2XHJA

Circular permutation provides an evolutionary link between two families of calcium-dependent carbohydrate binding modules. semet form of vcbm60.
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
119
structure length
119
Chain Sequence
b'SNSITVRARGVNGQESVSLQVGGTTVQTWTLTTAMQDYTASTSLTGEIRVAFTNDATGRDVQVDYIVVNGQTRQAENQSVNTGVWANNQCGGSGNSEWLHCNGYISFGNVSLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CALCIUM-DEPENDENT CARBOHYDRATE BINDING MODULE
publication title Circular Permutation Provides an Evolutionary Link between Two Families of Calcium-Dependent Carbohydrate Binding Modules
pubmed doi rcsb
source organism Cellvibrio japonicus
molecule tags Sugar binding protein
total genus 24
structure length 119
sequence length 119
ec nomenclature
pdb deposition date 2010-06-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.60.40 Mainly Beta Sandwich Lipoxygenase-1 Lipoxygenase-1 2xhjA00
2XFEA 2XHHA 2XHJA 2XFDA
chains in the Genus database with same CATH superfamily
1N8SA 2WXTA 1CA1A 2KXTA 4QEYA 1KHOA 1FGOA 2LGEA 1FGQA 3V99A 1ROVA 3V92A 3BNEA 2PPLA 3BNCA 4NREA 1HPLA 3V98A 2PVSA 3FG1A 1LOXA 2XFEA 1OLPA 3BNBA 1GYGA 1N8QA 3FG3A 2WY6A 2P0MA 1LNHA 2KXVA 2LG7A 2FNQA 1Y4KA 2IUKA 2QNGA 2WXUA 2LRGA 3BNDA 3IBZA 1F8NA 1FGRA 1BU8A 1YGEA 1W52X 2SBLA 2IUJA 3VF1A 1RRLA 1QM6A 1LPBB 1IK3A 4QWTA 3U6GA 2XFDA 2XHHA 3FG4A 1ETHA 1RRHA 1HU9A 1GPLA 1LPAB 3PZWA 1JNQA 3CWZB 3O8YA 1QMDA 1RP1A 2XHJA 2QZ7A 5EEOA 1FGTA 4WFOA 2OXEA 1NO3A 1FGMA 4WHAA
chains in the Genus database with same CATH topology
2XHJA 2LGEA 2XFEA 2LG7A 3U6GA 2LRGA 2XHHA 4QEYA 2XFDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XFE A;  2XHH A;  2XHJ A;  2XFD A; 
#chains in the Genus database with same CATH topology
 1N8S A;  2WXT A;  1CA1 A;  2KXT A;  4QEY A;  1KHO A;  1FGO A;  2LGE A;  1FGQ A;  3V99 A;  1ROV A;  3V92 A;  3BNE A;  2PPL A;  3BNC A;  4NRE A;  1HPL A;  3V98 A;  2PVS A;  3FG1 A;  1LOX A;  2XFE A;  1OLP A;  3BNB A;  1GYG A;  1N8Q A;  3FG3 A;  2WY6 A;  2P0M A;  1LNH A;  2KXV A;  2LG7 A;  2FNQ A;  1Y4K A;  2IUK A;  2QNG A;  2WXU A;  2LRG A;  3BND A;  3IBZ A;  1F8N A;  1FGR A;  1BU8 A;  1YGE A;  1W52 X;  2SBL A;  2IUJ A;  3VF1 A;  1RRL A;  1QM6 A;  1LPB B;  1IK3 A;  4QWT A;  3U6G A;  2XFD A;  2XHH A;  3FG4 A;  1ETH A;  1RRH A;  1HU9 A;  1GPL A;  1LPA B;  3PZW A;  1JNQ A;  3CWZ B;  3O8Y A;  1QMD A;  1RP1 A;  2XHJ A;  2QZ7 A;  5EEO A;  1FGT A;  4WFO A;  2OXE A;  1NO3 A;  1FGM A;  4WHA A; 
#chains in the Genus database with same CATH homology
 2XHJ A;  2LGE A;  2XFE A;  2LG7 A;  3U6G A;  2LRG A;  2XHH A;  4QEY A;  2XFD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...