2XI9A

Pilus-presented adhesin, spy0125 (cpa), p1 form
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
313
structure length
304
Chain Sequence
b'TSVLIRKYAIGDYSKLLEGATLQLTRVFSSNDIGERIELSDGTYTLTELNSPAGYSIAEPITFKVEAGKVYTIIDGKQIENPNKEIVEPYSVEAYNDFEEFSVLTTQNYAKFYYAKNKNGSSQVVYCFNADLKSPPDSEDGGKTMTPDFTTGEVKYTHIAGRDLFKYTVKPRDTDPDTFLKHIKKVIEKGYREKGQAIEYSGLTETQLRAATQLAIYYFTDSAELDKDKLKDYHGFGDMNDSTLAVAKILVEYAQDSNPPQLTDLDFFIPNNNKYQSLIGTQWHPEDLVDIIRMEDKKEVIPVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANCILLARY PROTEIN 1
publication title A Highly Unusual Thioester Bond in a Pilus Adhesin is Required for Efficient Host Cell Interaction
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Cell adhesion
total genus 90
structure length 304
sequence length 313
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08341 TED Thioester domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.480 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2xi9A03
2.30.30.670 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2xi9A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xi9A01
1D9KB 4R9HA 4G8GA 4FQQB 4W4NA 4YHOH 4KK6C 3WHE0 4LEOA 3WFCL 1YEEL 1ORSA 3HZYB 4EN3C 4HFUH 1N64H 1CS6A 1CD0A 5BXFA 4YZFE 1JYNA 4KRPC 4MA7H 4JFPA 3NA9L 3ZTJG 3N1GC 5EC1A 4L3CB 2X5PA 4P9HL 3B4NA 1UYWL 3U7YL 4EXKA 2VXTL 1JPFB 3PG2A 4MJ6A 5C0GB 1INDL 3TNNA 5IM7A 4G7VH 1TLKA 1YYLL 1WZ1L 4J1UB 2R1XB 4AIXA 1MY5A 1IGTA 1AGEA 3P9WB 4HIXL 3WSQH 1J0KA 1CFQB 4XWGL 2OSLA 3H3PH 3QR2A 3QEQD 3DUUA 3O9WD 4PGJA 3HPJB 4L3ED 4NP4L 4TSCL 5KN5B 1KG0A 1J5OH 1AO7B 4WIQA 1N4XL 1TMCB 2NY5H 2CH8A 3FL7A 3L9RB 3MROA 1CVSC 3STZB 1GC1H 3VI4F 3SKUD 1NGYA 3TM6A 4LCYA 1DUYB 1UKTA 2QADD 3PIQA 4RQQB 1A6ZA 4UDUB 3FO9B 1FFOB 4Q0XL 5C7XL 2XPGA 4LU5H 5BRZD 1FL3B 4HC1A 2VDPL 4NN7C 2EICA 4QHLB 4NKIL 5GS1A 1WIPA 1P9MC 2FYYA 2J8OA 1UXWA 1HILA 3QWOA 4QXGH 2XWTB 5TQ2H 3MGAA 3PWUA 5L2JA 5T3XD 2CGRH 1BFVH 4LPVA 1D9KC 2VB5A 3P73B 5IHZA 2DJUA 3GBML 3BPNB 4Y2DA 5D6DC 4PJ9B 2DL9A 1UM4L 4GS7B 3MJ9A 3O2DA 2V17H 5I0ZA 2XTJD 2WP3O 3AXLB 4F2MB 1I1AA 3VFPB 3SJVD 1OPGL 3RNKB 1I9RH 4L3AA 4G80B 2R1YB 3LEYH 4YHKL 4JFHD 3OJDB 3IU4L 4XNQA 5KG9B 1DBBH 4RAVB 1T1XA 4YHZH 5F7WC 5TE7L 4FTVB 3PE9A 2EDTA 4H8WH 4D9LL 3MV7E 4WTZA 1QO3A 3FO1A 1IL1A 5H8DA 3AY4C 4XH2A 2ZPKL 4C54A 2QJDA 4N0UB 1ONQB 3QDJA 1TVHA 5GSVA 5MEQB 1AKJB 3IGAA 1UCBH 4G9DB 5C8JA 2DYPA 5EZOH 2OX5A 1PG7H 1Z9MA 5E8OB 5TE6H 4U6XA 4JN1L 5D6CA 2N7AA 2XFXB 4U1MB 5HI4D 4HUVA 3VXSA 4Z7QE 3GMLA 1Y6KR 4LBEA 5B3NA 4R8WH 4XPHH 4XPGL 1Z5LB 1XGRA 3NPSB 3VXRB 4X7FC 1I9EA 4RBPH 3ZHLA 4L8BB 2BCKB 2QR0B 5FHBH 3B9VA 5F71A 1BQLH 3L3HA 4M7LH 1NGXA 2DKSA 4PJ9C 5EA0H 5DUBB 4GS7C 3NFSH 5J6GB 3I2CH 1MIML 4KI5C 5C0AD 4HS8L 4BZ2L 4M6AA 5E8DL 1JP5A 4XVUD 5EWIL 3J8F7 4OLVH 1JF6A 1UZ8A 1QA9A 1QFUH 3RIFK 5DJ0B 3T1WA 2H2PD 4ONFL 1HH9B 2GJZB 1L4IA 4G43A 4X80H 1TZHA 5IHUH 1CN4A 4UINL 4W6XB 5DC4B 1TVBA 4RMWA 5IFHL 1RHHB 2ICWA 4F15B 3D1MC 2VISA 3NCJL 4J3SA 4FFWC 1Z2KA 2NY1B 4PR5A 4LOUC 5IJKC 3DI3B 4GAYB 4AH2B 5DURB 3W0WE 1MFNA 1UA6L 3C8HA 5KS9B 4BFIB 4PJFE 4ELMF 2W0LA 4PTUB 4M43H 3QQ9D 4Y1AD 5JXEA 1GOHA 4PJDB 1KV3A 1NAMB 3ARED 4MCZB 1R3IH 4MA8H 1XF3B 3LPWA 4I0PD 4HZLB 2VH5H 5F7DA 3WDHA 4H26B 2FHFA 1X5HA 3PQYB 1T4KA 3VI4E 3S98A 2FJGB 2HJFB 2XQYG 2AXGB 2FIKB 3PV6A 3RX5A 3L3IA 3GRWA 3CFKA 3CXDH 3E2HB 5T1MB 1KJMA 3S34H 1XGUB 5D8JL 3AAZA 4M48L 5ERWA 4LLAA 4N8VB 5BS0B 4L8SB 1KTLA 5D96B 3TN0C 4AEFA 5DVOA 1E4KA 2HLFD 3FT4B 4NM4L 3KAAA 5DVNA 3GBLA 2FRGP 4O02H 4NKDB 3RIFF 4OF3A 2NY4B 3MUGA 1IQWL 2AV7B 2NR6C 1B4JH 5DYOA 5LXGL 5I8EA 1DEEA 1XF4A 1KLUA 1T0NA 4NQCB 1MCPH 1A7QH 5F44A 3ES6B 4HCRL 2HLAA 5GGTH 1U8QB 3PWPB 5GRJH 3JWNC 4TYUA 3V4PL 4OLEA 4KXZI 1A7OL 3WO3B 3FAXA 1YEHL 1WSST 1IGIH 5I66B 1J8HE 1IC5H 3K8KA 4F15C 4QLRA 3CX5K 3QUZA 1JZ2A 1A1OA 5GIRB 6FABL 3IVKB 2DDQL 3BWAB 1LEGA 4PRPD 1CK0L 5E00A 1MFAL 3ARBB 4FQXB 2VSDA 1JZ6A 3BKJH 5ACLA 5B3JE 3MJ8B 5DD3L 5KSVB 3U1SL 5ANME 5FUZH 1YYML 4JQVA 5F89B 4F9LA 4KKBC 1QRNA 3BT2H 3BRGC 4NRXB 2Y6SC 4U1LA 25C8H 3OR6A 4IJ3B 1JBJA 3BZEA 4YAQA 4E0RA 3FAWA 3KYOA 3HA0A 2OS7A 1JPSH 2LU3A 4H1LA 4UAOB 1JGVH 3LMJH 5TGBA 3HC0B 4K23L 3E8UL 5LWYH 1BQSA 5D96C 4ODSH 3D18A 4LP5A 5DO2D 1R0AL 2F15A 4G6JH 2VDLH 2NY4C 2P5EE 4FS0A 4U3HA 1MHEA 1KXQE 1CICA 3P11L 4XVTL 3ZDZE 1TZGL 4FABL 1IM3A 5HVGB 1G0DA 5ITFA 3SQOH 2VXQL 2X1XR 4L4TA 5CP7B 1HCFX 2NXYB 2QSVA 4HC1H 3P0VL 2P5WD 5DK2B 3MRCA 1A6TB 4HWEL 1OARH 4OJFL 2CK2A 3JSSA 4AENA 5DJ2B 3Q6FB 4WUUB 1S7VA 4NOBA 3UPRA 1U42A 4D3CH 1YEFH 4PJ7B 3RKDD 4ERSL 3ARFD 3ARBC 2C7UB 4M6NL 4YNYA 1KCKA 1FZKB 2FX8L 3EGSA 4PV8A 3RHWK 3MJ9H 3O2DH 3R0MA 1C5BH 5E0QA 2PTUA 3DRQA 1Y6NR 3MACL 4PRIB 2D7OA 2OL3A 2M26A 4QTHB 3RUGF 5HHOD 4YQXL 1PY9A 3RWHA 2JJSC 5SWZA 4OSUH 1RJCA 5B4MC 3SDCB 4YFEA 2UYLA 5JLZA 5T3ZD 4PJXF 5D7IE 5FB8B 2X89A 5EBGA 1HINL 2H9GA 3RX7A 4UNTA 4LLVB 4PP2B 4D0DA 4HLZG 5I1KL 1FN4A 5C0NC 3NCFB 3TBWA 4NO5B 1YEDB 3OKEA 2Y07L 2DQDL 5E2TL 5J1TC 4C4KO 5FGBA 1EPFA 1YUHB 4WI2A 1F58H 3W9EA 1A3RL 4CJ1A 4DFHA 2FX7H 2OTPA 3GSUB 1YPZF 4X6EB 4C57C 4LIQL 4PTTB 3HG1D 4GMTH 1IEBB 4MNQA 4PD4K 1CIDA 2FEEL 4G8IB 3S6CA 5FUCC 2NXYC 3QNZB 3G5XB 3SKOB 5LBSH 5EG6C 1UH3A 4KK8D 3DROB 1MRDL 3STBA 4ZS7L 4KAQL 2CK0H 5E8NA 3RHWF 5DMIH 4YJZL 5A16B 5FK9A 3QUKA 1JV5B 5DD6A 4Q6IA 2EIZB 3BMWA 3KDMB 4NN6B 1KB5A 3VFNA 2FSEB 5GISL 4DGVH 5JZ7D 2B7DT 1E4WL 2CDEB 2FX9H 4PYGA 2FWOA 1AGBA 4WU7A 4PUBH 5HYJD 2X1PA 3EO1A 5E8PA 2RCSL 1RUML 3HTLX 2EECA 1CFSA 1G7QB 3QZWG 4OZFH 4JCMA 4OLUL 1U3HB 2A73A 5C6TH 5DD0L 2AKRA 3V6OC 3BZ4A 1BF8A 2D9CA 3O4LA 3QI9B 4P9MH 3SDCC 4N8VG 2XI9A 4QNPE 5BVPL 3ETBF 1QLRB 4JFEB 4JRYE 1B0RB 1EMTL 3LOWA 4O51A 1FFPB 3RZCB 3LKRA 1UZ6F 4YX2L 3RY6C 1JNJA 3T1FA 1O5DT 1FNGB 1K3IA 3HPLA 4X4XB 1JTPA 1CFNB 4Z7UB 2DD8L 4OFVA 2YPLE 2R2CA 4F33A 2E7BA 3C9NB 4WY7H 4KROD 2EYRA 5CEXA 2NY2C 1L9NA 1XIWB 3N1PC 1RVFH 2MSPA 1OAYH 3KPLA 3EJZC 2MFNA 3LHPL 5DI8B 5FYKH 4EKXA 2FLBT 1K4DB 5IR1A 1BP3B 2BNRD 2AI0H 4HWBH 5J0BA 3DNKA 3QRGH 3CFDB 3EFDL 5JORA 3V5KA 4XHQA 4XVJL 5TF1L 3LRHA 4M1GH 3IDMB 4XMPL 5DHYB 4U7MA 4PJEA 4UUJA 4X6CF 1C16B 5IQ9A 4LKXA 3SO3B 2VDMH 5J11B 1F4XH 2G60L 4CMMB 2I9TA 3MV9E 2CMRL 4JHBA 1RIUH 4LLQB 1FV1B 4QRRB 3JTTA 4XXDA 1K6QH 5KSBF 5KOMC 1JYVA 1FAIH 1HKLL 3GIZL 1U3HC 2W0FA 2YK1H 3MRBA 4K7PX 4UI2A 5DMYA 4PFEA 5E70A 3KHOA 1D9KD 3RGVA 2YEZA 5MEOA 2CLRA 3WKML 1S3KH 2XZAL 4CL7A 5E4IA 4HUMB 5B38B 4BH7A 4Y4HB 4BH8B 1Q0YH 2VZVA 2ZUWA 4IOIB 1DQJB 1N6VA 2XT1B 1VFBB 1YY8A 4PJHA 4QT5A 2DI9A 3RAJL 4FFVC 5L8LB 3FRPG 3QYCA 2FEDC 2H1PL 3PHOB 3WFHA 6CGTA 4HKJA 2FJHB 4FQCH 4XPFL 1XIWC 3OV6A 2Z93B 3V2AR 3O6LH 1QSZA 2GAZB 2NTFA 5DMJB 2AABL 2JJTA 1JGEA 1R3LA 3TH3T 1NCDH 1S7UA 2XA8L 3G5YB 4AQOA 5BJTB 1AO7D 4KGLA 1BQHG 4F7MB 4Y5VB 1SJHB 5A3IC 1WWWX 2I26N 4TTGA 3TCLA 4H1LH 4CVUA 2XICA 1MHHA 5CZVH 1TDQA 1JGLL 4WHYH 3WNLA 5JW4N 1RZGA 4UTBL 3SO3C 1FRGL 3WIFB 5FKAB 4M5YH 4LIQE 4OFKA 3O3AA 5MP6H 1BGXH 3MZGB 4I77L 1S9KC 4RWYL 5ALBH 2Q3ZA 5IV2B 1CFTA 1QFWL 4N68A 4U1NB 3FCTA 3FHQA 5AZEL 3O6FC 4Z95L 4JR9H 1OSPH 4NNPH 3GJEA 2GFBB 5F88B 2VLJE 1U8HA 2HFEB 3BD3A 1LO3H 4N0RA 2ICEA 4PJ9D 3LEXA 2GW5A 4Y4HC 1ZLUK 3DTXA 1JGDB 4WWID 2ADJB 2NNAA 3HC4H 4N0FA 1KPVA 3FB5B 2A77L 3TJHC 1MAMH 2FNBA 4JFQB 1G7HB 2FZ3B 4Y16D 4I4WB 4ODWB 5E99H 4QHUB 2JCCE 3LCYA 4LCWD 1QSEE 1YC8A 2IWGA 4UQ3B 1L0QA 1XR8B 4GKSA 3TA3A 5TPWH 3WBDA 4QGTA 1KIRA 1P84K 3OJVC 1IC7H 1UC6A 3CVHL 2DQJH 4FTVD 2HTKC 3T0BA 2OL3H 4EIZC 3EOAA 3C5SB 4G6FB 4WWKA 3FONB 3JWOH 5F97E 4AG4L 4P23B 4DZ8B 1S78D 3V0WL 4OM1L 1AKJD 3EO0A 4LQFL 3UTTB 1T7XA 1G7LA 3VU2A 1XH3A 4JFXB 2D7NA 3SY0B 4FQHB 1FBIH 1KTKE 2E7HA 3KPMA 4KH2A 3TF7C 4FQ2L 3ILPA 4HBCL 1S8DA 4CU8A 4N90E 2B1AH 5T1DH 1NAKH 5I19L 2NMSA 1GIGL 3ZE2E 1NFDF 3DARA 3VXRD 1EAPB 4UDTB 1ADQA 1ZVHA 4XBGA 1A7BA 4KK9C 4TSBH 2A9NH 4S0SD 3TT1L 1WQVT 4IRJC 5GGVY 3L95B 5CINH 4C58B 5FA4B 1OD9A 1KCVH 2X7LA 1KYOK 2D31B 4LSUL 1RZFH 3GIVB 4IOFC 3UTZB 2JTDA 4NQXA 3T0AA 2J8UE 1J0JA 3MRFB 1SQ2N 1WTGT 5F6HJ 2H8PB 4V1DE 2BOCA 3T4AB 1AQDA 2J6EL 5JPNB 1PLGL 1VEOA 3B43A 1NH6A 3QNYA 4JFDE 1UACH 5FYLD 4XAKD 2X4QA 2P8MB 4PJGF 1A64A 4P5TB 4IMKA 4KPHL 2P8PA 2R2BA 4Y4KC 1CGYA 5EOQH 2Z35B 1QLFA 1NCNA 2L7UA 4H88L 3V4UH 2NY1D 1QBLL 2NYYD 2HWZH 4DQOH 5DURD 4CUCA 2YSSA 3VFGL 4S1QH 2A74B 5EORL 2Z4QA 5D71H 4X98A 1E6OH 4MDJB 5TFSH 3BI9X 1RUPH 5IBTL 2DS4A 2EIBA 3KPRA 3MRQB 4F7EA 5KSUA 1KBGH 2HKHH 2P7TB 3PQYD 2MJWA 4G5ZL 4NOFA 5A0DA 3PWJB 3U82B 3EOYG 3IJHB 3DJ9A 3P4NA 5K9KB 4ZNEE 5DJYA 2MPAH 1ZE3C 3N1QC 2PO6A 5E9DE 2R39A 5B38G 1RZIA 5BS0D 3FOMB 1XF1A 5BQ7A 4U6VH 3U0PB 4ZNCD 1D7FA 1IGYA 2F5AL 3P30L 5GGVL 4I5BB 4K8RL 4RIRB 3O41B 1I1FA 3DX7A 5I8KL 4MAYB 2CKBA 4X5XA 5IB5B 3U46B 5KJRL 4M5ZL 4I3RL 3G6JE 1MEXL 2I5YH 3CMOL 4NQCD 2CD0A 5DQJB 4M4RA 5CILL 4ZFFB 4TSAL 2HN7B 2ID5A 5H35B 2JB5H 4OCLC 4KDTA 3PWPD 1TJIH 4P5TC 1BBDL 2DQCH 1JFQH 4GRLA 4HFWB 4PRBB 3UROR 3VXUA 4BSWA 4Q9RH 3C2SA 4X6DB 4HS3A 5CBAA 3NACL 3NA4A 4OUUA 3RU8H 1T3FA 1RFDH 1JNLL 3QXUA 3MV8A 5EOCH 4WTXA 4OZ4B 3D0VA 3C2AH 3ARBD 4FQXD 1I8LA 5SWSB 5ETUA 5IW1B 5EDXA 4NUJA 2GSGA 3OKMA 3IETB 1HYRC 3QJFB 1B6UA 5CGYC 5JPMA 5ALCH 4NQDB 2Q7YB 1RZKH 3VD9A 1JN6A 2QKIB 3N1FC 3QFJE 4HSQA 1AIFA 3NFNB 5B4MD 5EIVA 2XZCH 3KLAB 3CXHJ 4S10A 4WFHE 4P3CH 4BYHA 3DXAB 3VD4A 2ZKHL 4XC1L 1NFDE 5C0ND 5KVDL 4LFHG 5IKCA 2X4TB 2PNDA 3MBXH 3L7FB 4P2QB 4MAUL 4YFLI 1XGQA 2IFFH 5I8CA 3DV4B 3TIEB 1RULL 2HKFL 2CDFA 4K71C 1FL6B 4TVPD 2GK0A 4QHNB 2R0KH 4MAYC 3O8XA 5E5RB 3T3PE 1IGFH 2W07A 2VR5A 2GITA 1M7XA 4HUXA 2PXYA 1F2QA 2V2WB 1SVZA 1OTSC 4UNUA 5HHQA 1PKOA 3OKDA 3CD4A 1DN0A 2NXYD 1T20A 1LK3L 4D9QE 5LG1A 2ICWJ 3SBWC 5K59F 1BOYA 1LEKA 3HB3D 5JW5A 3S5LB 5C0DA 2K7QA 1HXMA 1U8NA 1I1RA 2NPLX 3MRRB 1NCWH 2EDXA 5ISZE 2R23B 2LV4A 4M61B 3PNWB 2WWMC 4NHCL 2Y06H 2GJ6B 3D9AH 4Y4FA 3WN5A 2Q8AH 3OKKB 3MA9H 4EUPG 1H5BA 1XAUA 2V5RA 2ZNWA 3HI1A 4PRID 4XPAL 1I3GH 1RJZA 2WINA 1K8DB 3BE1H 4Q7DA 1YNKH 3MGTB 2BJMH 3QDGB 3SDCD 5JOFB 4J8RA 3GMRB 5MERA 5F7EL 2H41A 2VABA 2VAAA 2P46B 1C5DB 4PJIF 3KVQA 4KHTH 5FO8A 3O2VH 1M05B 3MRHA 3SKNA 2Q76B 3MLSL 3Q6GH 3KJ6H 1FGVL 1X5YA 2R0ZL 1L0XA 4NQEB 3JUYA 3OKNB 5L2KB 1AGFB 3MV7A 3VFRA 1XCQB 1YNLH 1FO0L 2YPKB 2ERJC 3D87B 3O0RL 2P24A 4OM0H 5C0BE 3HN3A 5T33L 4ZYKB 8CGTA 1P2CB 3OQ3B 1V7NH 5DRNA 3U83A 4JM2B 5D1XB 3L3GB 1ADQH 1EHLL 2YWYA 1EV2E 4MXVE 4OFYD 5C0RL 4LARH 2BERA 5HHPB 2VDKH 1PKQE 4HJGA 2WM0A 1DEDA 1OP3K 4I3SH 4UTAL 1ITCA 2P49B 4WHTA 4KRMB 4ODBD 5ACMA 4M3KB 1T7YA 2H32B 1L7IH 4N9GB 3LQMA 3OWEA 3C8DA 2XWJA 3WLWC 4K3DH 1F4YL 3H0TA 3REWA 2BNUA 5F3BA 4XP1H 5HJ3A 1U3HD 2PYEB 4R96B 4OF5A 3W9DB 1PJ9A 4RX4A 1S9YB 1BZ9A 3CLEH 3QI9D 2HAZA 3KPSE 2OZ4A 1W72B 3EYUL 1ZGLA 1YEKL 1H15A 4JFED 2EYSA 1HEZA 2HH0L 1SM3H 2R69H 3RQ3A 3PWNA 2X4NA 1TTUA 3P77B 2Z91B 3RZCD 5GGRB 1PZ5B 2JKXA 3VW3L 3P0YH 4BQ6A 1GGIL 4LSPL 2EDEA 3GSXA 3E6FB 3IFPA 4XCFH 3VWKB 1SYVB 2BVTA 5F9OH 2RQ8A 4D0CA 4HXAH 2IH1A 4A6YL 4U0RC 4OZHB 3W0WA 1EHNA 4IIQA 4IBLT 4PJFA 4RMTA 1T5XB 3SPVA 3FRUA 4DKEL 1FC2D 2BY1A 3LS4H 4NZRL 3QIUA 5D1XC 5A3ID 2OR9H 1BWWA 1MELA 2VDNH 1JPGB 5HDQL 1P6FA 1R5WA 4FP8H 1IC4L 2DQEL 4TQEH 3RL1A 2FL5B 4HUUA 1X5IA 5L8JB 3OPZH 3KHQA 3CZFB 1AR2A 5J4MA 4TRPH 3TV3L 5SX4H 1T22B 4GAFB 43C9B 3U6RB 2VDRH 4J4PA 1U8PB 5DRWA 4J2XA 5IFJA 2JK5A 4LHUA 4FZ8H 3QCUH 3DYPA 4YDIL 4QRRD 2ORBH 1X5ZA 2IF7A 4BKLB 1T04B 3C5JB 1VCAA 1Q9OB 1A6VL 3T2NH 1SEQH 4L29A 1UM5L 4UIKH 1I7RA 1MCIA 3JWDH 1MHCB 3DO7A 1M7IA 4L8DB 1QSFE 2BSSA 2W65B 2FB4L 4WI6A 4ZUSA 5E5UB 2G9HA 5HYQB 3D85B 4OLXL 3TJHD 5DD1L 4DTGH 5DHVB 4PJIE 3O6KL 1J8HA 5T1KB 5ADPL 3B5HA 4D8PA 5A2IH 2WW8A 3VWKC 3LKNB 3M17A 2OQJA 3HNSL 5EBMA 1N0XH 3HMXL 4DWHA 4HX1B 2EKJA 12E8L 5EU7C 2YWZA 2HTKD 1NANH 5EUOB 1WBXB 4E41B 5H94B 3QG7H 4N1CA 5ANMA 4O5LH 4L4VE 4OGAC 3GSOA 1Z6JT 1E28B 1BVKA 2V9RA 3R06B 1ERNA 1S9VB 1QQDB 4WW1A 4NKOA 1VACA 3ZDYF 2H26A 4LVOB 3GMNA 2HG5B 4U1IA 2D03H 4MSWA 2Q20A 3I02A 5EO1A 5BO1H 3MLYH 2R4SL 4YDVB 3CH8A 1E4XL 2EH7H 4NQSA 4JFFB 1TNNA 1NBZB 1SBBA 5IGXL 3QG6A 5T5NG 2EC8A 4KK9D 3OGOE 4Z18A 2P5EA 4C0ZA 3X13B 1C7TA 1I8KB 4XX1G 3T77B 3LKQB 4ZXBB 3BWUC 4OD2A 4Z7WB 2GEEA 5T5FL 4IOFD 1IFHH 4JY6B 3QUYA 4KTDH 4YIQA 3LRSB 3OAZH 3GKZA 1PW3A 3HI6H 4LFHD 5D2LB 4M7LT 1RUQH 1NLDH 1HHJA 4MD0A 1OAQL 1DE4A 4MS8C 3ET9F 4XBEL 5CLWA 1U8LB 4TUOA 2O61A 1JGUL 5GRYA 3GSRA 4C83A 3CSPA 2GKIA 3MLVL 4C56B 4XP6H 1EBPA 1HKFA 2AQ2A 2XN9D 3QULA 5TE4H 4JDTL 2CO6B 3OSKA 4JG1H 4EIGB 5E2WL 4B7LA 4JO2H 4GJTB 2J88H 2RFXA 1CI5A 4G6FD 3PL6C 4G3YH 5E7BA 4LLMB 2ZCKH 4P23D 5TQ0L 1YEJH 5I16B 2G75B 1JWSA 4XCEA 3UTTD 4X5LA 3CSGA 1KJ2L 4S11A 4XVSL 3QDMB 4HV8A 4WGVB 5AZ2L 5D7IA 2IALA 3K2UL 1R3JA 5J89A 5EIIB 4EBQH 5JA9A 3O45B 1U36A 1KEMH 4LCIH 1ZHLA 5D1ZB 2Z31B 2LTQC 3MRNB 3MYZA 1RK0A 5INCA 5KVGH 4U33A 3OXSA 2DTML 3BO8B 3FN0L 2PYFB 5IBUG 1I8MA 1CGSL 1FL5A 3AGVA 3C8KB 1MWAB 3S37L 3WXVL 4QTIH 2EDBA 2F19L 2UVFA 3MLWL 1RUAL 4F57H 1FNSL 4NIKB 5HVHC 5HI3C 3BN9C 2F54B 3G5VA 2AEWA 4U1SA 4Y19B 3DV6B 4XCNA 2KQNA 4KTEL 3VXQA 3OZ9L 1QR4A 5J12B 4P4KA 5HGDB 5JIPA 1CLYH 1MIEL 3CIQA 2CJUL 1R6VA 4P5TD 4TN9A 5AG8A 3FQNB 1A2YB 4X6FB 3WFBH 4XNXH 1KN4H 5CHNB 1FYTB 5J13C 1I85A 5D7SL 4FFYL 3S9DB 4CN4A 2D4DA 2ZOKA 4UZGA 2OZ4H 2V9QA 3PDOB 1T1ZB 2O5XL 2APWA 5DF0A 4L8CB 1G6RA 3LQAL 1DQTA 1RIVH 3OX8B 2M2DA 3MXVH 3RA7H 2BFVL 1NEZG 1ZMYA 2Q1EA 3VXTA 1A5FL 1HHKB 3WS3B 2MNUA 4JRYA 3SDXF 3GMOB 3QEGL 1CLOL 4MX7A 1BECA 4DUWA 1KLGA 2X4PB 2BY2A 5F1NA 3VXMD 3WFCH 4WJ5B 1YEEH 5BOPA 3MYJB 1F6AA 5H2BA 2X44D 2YPLA 3NA9H 3MRDB 3SE4A 3O3UN 4J12A 1N3NA 4TPRL 4U4BA 4S1RL 4P9HH 1JPST 4MA3B 1UYWH 3U7YH 5F6IC 2VXTH 3RDTB 3BMVA 1WICA 1YZZA 1INDH 2WK2A 1FORL 3LN5A 1FZJB 1XGPB 3HCVB 3BN3B 1YYLH 1WZ1H 1JL8A 3FHAA 1J18A 4LLWA 1A7RL 3QQ3B 4GSDL 4HIXH 1IQDA 4M62L 4XWGH 3QAZC 4PRHB 2IC2A 2PUQT 3VDCA 4H8WC 4NP4H 5KBNC 4TSCH 2EE2A 1FFQA 1N4XH 4J7RA 5E6IC 4HS6A 1ZKAA 5J12C 1OTSD 4Y1AE 4MNGE 4NSKB 1ZXQA 5HGBB 2V7HB 3WD5L 5EZJB 4NNXA 2HVKB 3R1GL 4OAWA 4WV1A 1WAAF 4ZUVA 5TDPB 4XPTL 3LDBC 3MV9A 3UTSE 2ZUQB 4XI5C 4Q0XH 5C7XH 4RWHA 2VDPH 2M1KA 5FKPA 1A1MB 4I18A 3H9HB 3B3IB 3DURA 4NKIH 2HT2C 4ONGL 5SWSD 2WWMD 3FJTA 4OZGB 2QEJA 5EN2B 3F5WB 3IDJB 3TIDB 5I1AA 4DN4L 5LGKA 1VGKB 1I7UB 4NQDD 1B0GB 3HC3L 1R5VA 1OF2A 2ZSVA 2H45A 3GBMH 1ZA3A 1UM4H 1DDHB 1HSAA 1JWUA 3SDAC 1UWGL 2V2TA 3DXAD 5B21A 1OPGH 4PJCB 3HZKB 4R90L 1D5MB 5EUKA 1FZOB 3ALXA 4GQ9L 3RDTC 3ZDXE 3ULUL 4YHKH 4P2QD 3IU4H 5GXBB 2DOCA 4YR6A 1U2HA 1M6OB 5TE7H 5GS2D 1DVFB 4D9LH 4IRSA 4GRWE 3WNPA 5ENWA 3FFCE 1LK2B 2ZPKH 3DX9B 4JB9L 1KFAL 2AERT 4G7YL 2A9ML 5CEZL 4HAFA 1IEAA 4G8GB 4GBXB 4JN1H 4I3GA 4DFIA 1KCSL 5CP3A 5BXFB 1FJ1B 1R3KB 4JFPB 1ZT1A 1YQVL 2ZUQC 4OIBA 1SEBA 5EC1B 3ZYJA 3QWRD 4XPGH 4CMHB 1OT2A 1MOEA 2GJ6D 5IM7B 4XP9L 2VLJA 4PS4L 1IGTB 1AGEB 2OXGA 4P5MA 4JPWL 2NW3A 4I8DA 3ZTJH 3QDGD 1KG0B 5MEND 4PRNA 1V7ML 1QRKA 1MIMH 3MO1A 4V2BA 4HS8H 1H8SA 2JCCA 3ARYA 5E8DH 4BZ2H 1QSEA 5EWIH 2ENYA 1CG9B 4LCYB 3WIHL 1XCTA 4KV5F 5C0CE 4P48A 3JV5A 3PIQB 5K9QG 5DJDA 4NQED 4ONFH 5F9WB 4XRCA 2DL2A 4ZAKA 1HHGB 5L2KD 1X5KA 2VXSL 4UINH 2XPGB 5DA4A 3MODL 3EJYC 4WW2F 4HK3J 1Q9LA 1KCLA 3KLHC 1DVFC 5IFHH 2FYYB 5IB4A 1HILB 3U0WL 2XKNA 3NCJH 2NZIA 3PWUB 5L2JB 4XTRC 3D39E 4X5WA 5FDWA 1UA6H 3MX0A 1HHHA 4Z0BL 4GBXC 4JM2D 1KXTB 5D1XD 5IHZB 1U8OA 1UXSA 2PW2A 4X7DC 1INEL 1BQUA 4EOWL 1HI6B 3I3EA 5LGJA 2A6IB 1I1AB 5F7HA 1YECL 1T6VN 3NOIA 4CMHC 1ES0A 4NJAL 3DGGA 1LE9B 5D9SA 4QXTB 3QXDB 1EVTC 2PTVA 5D8JH 1SYSB 3RZWA 5BW7A 5CBEA 4M48H 2J8UA 5GZND 2PYED 3MRPB 4CNIB 2AJVL 4NM4H 5I8OL 1QO3B 4MB3A 4V1DA 4HUWA 1IQWH 3QDJB 1TVHB 4BUGA 4YUEL 3VE0A 3ZT5A 2R9HC 3IGAB 5GGSY 5LXGH 1P4IL 5C8JB 2DYPB 4JFDA 2J8HA 1QR1B 1KJ3L 5FV2A 4U6XB 5ITBL 5D6CB 3EDKA 5MEPA 4M9PA 1ACYL 1UJTA 2CLZA 3OKOB 3TBSA 2ZSWB 3VXSB 5F9WC 4HCRH 4LBEB 4WO4B 3MRLA 3V4PH 1A7OH 1YEHH 1PYWA 2Z8VC 2F9BT 2HRPL 2Q3AA 4B0MM 1WISA 3ECBB 2G5BB 5D1QC 2LABA 5F3HA 3QO1B 4HF5L 3QXAA 6FABH 2DDQH 1VEMA 2Z8WC 4HKXA 4Y8DC 1CK0H 1MFAH 3EAKA 4M03A 1NGXB 5DD3H 1S7QA 2BHZA 4LSVL 3U1SH 1TFHA 1YYMH 1OGAB 4P46A 5KANG 1WV7T 4FNLL 4OZFB 4ZNEA 2UV3A 1ZT4A 5E9DA 4MHHG 2YRLA 5DRXB 4ZO8A 2VLLA 4YHIB 1QA9B 4A2MA 2VSCA 1WWBX 2R15A 4YXLL 3VD5A 2VL4A 3HE6A 1TZHB 4K23H 3E8UH 1WIOA 3WHXA 5CEZE 4LKCB 1TZIA 5DEGB 1TVBB 3VFWA 4OI8A 1R0AH 1MWAL 2UWEE 1KENL 5L8KB 4V2CB 1ZEAL 1HDMA 2VISB 3G6JA 4G9FE 3TVMC 1OW0A 3B6SA 3P11H 4XVTH 4X8JA 1A4KA 1TZGH 1WUNT 4JEGB 4JRXE 2QLVB 4FABH 3UPAA 2N4IA 4XB8A 3PGCA 3C08L 3D85D 4MS8D 2BNRE 2VXQH 3OJ2C 3ZZ1A 5F7DB 4WO4C 5T1KD 1T4KB 3P0VH 1QLEL 4F37K 5LAXB 5HVWA 2RR3A 4WFFE 4HWEH 4OJFH 3L3IB 3VGDA 1PQZB 1T21A 4IEFB 2WBJB 5E8EA 5HPOA 4K7FA 3AAZB 4JREC 5ERWB 4E41D 3SHSA 3ZKQD 3A6OA 4ERSH 2ZG1A 4M6NH 3ZHKA 2L7JA 3GUTA 2MKLC 2FX8H 3FN3A 4KK5D 1AGDB 1BFTA 1CF8L 2CXGA 3QFJA 4P2OA 3MACH 3SCMB 3CVHA 3FQUA 3MUGB 1VFOA 3UMTA 3LB6C 2AQ1A 4U0QB 5I8EB 4YQXH 4K3JL 1XF4B 1XGTB 3HZVB 4LPWA 4U1KA 2R56L 1MQKL 1NFDA 4JFFD 4ZTOL 3QFDA 3MNVB 4ZUTA 1HINH 2ICES 4LLUA 5IMLA 3GKWL 1CGVA 2B5IB 5I1KH 1WLHA 3K0WA 4J23A 2Y07H 2DQDH 4KC3B 2YD4A 2R2EA 5E2TH 1B4RA 3S7GA 4ZXBD 2DN7A 5BZDB 1A3RH 4JKLA 2VWEC 1LEGB 5KS9F 2Y1VA 5D7JA 32C2B 5HI3D 3BN9D 4LIQH 2VKWA 4JM4L 4PJDF 4LSRL 4QYOA 4Z9KB 4NHUA 5DSCB 3IF1A 1QRNB 3C6LA 2AXJA 4QHKJ 4U1LB 3H9SD 3OR6B 3MJ7B 1TCRA 1MRDH 4S2SB 5KAQG 4MQSB 3KYOB 1MLCA 4ZS7H 3FRPA 1FFNB 4KAQH 5I74C 5ISZA 4H1LB 5D7LB 4WI7A 3WS6C 2GCYA 2WBJC 3L3OB 1I7ZA 3QUML 5HI5D 5TGBB 5GISH 1E4WH 2MCG1 4PREA 1F3DJ 1Q9WA 5IVXE 1Q9KB 4Z7OE 3RWDB 2B2XL 3GNML 2RCSH 1RUMH 3QCVL 1T2JA 3SCMC 1MHEB 2JJVA 5FM8A 3QDMD 1CICB 1WF5A 4OLUH 5ID0B 5DD0H 4Z8FL 4Q9QL 1YNTA 2BY0A 5I1IL 4GT7A 4NZUL 2AK4B 2OXHA 2AEPL 3CLFL 1CQKA 5BVPH 2ZG2A 5D1ZD 1JRHI 2Z31D 1EMTH 4KI5E 4WTZG 2OTWA 3QH3A 2B5IC 1KJVA 4YX2H 1PGRB 3D3VE 4FQLL 2PN5A 4R2GD 3CNKA 4AENB 2XA3A 4NNYB 2DD8H 1S7VB 3UPRB 3UBXI 5C0BA 2J1KA 1K4CA 4YNYB 2F54D 3EGSB 4Y19D 2IPKB 1E27A 4P2CG 3B9KB 5IJVA 3LHPH 3T04D 4MB5A 1BZ7A 4F7PB 2OL3B 3V5DB 3W81A 3GFUA 1R24B 5I1LA 3RWHB 1N26A 1PKQA 3G6AA 3EFDH 1TQBB 1CGTA 2UYLB 1OOAA 4XVJH 5JLZB 5TF1H 3TBVA 2OJEA 2IPTL 1FYTD 1JHKL 2H9GB 4XMPH 4W81A 3BT2L 5FO7A 1DBKL 1FN4B 2DM4A 3LV3A 3BGFB 3BGMA 4XI5D 2G60H 3OKEB 5AG9A 2MWCA 4M7ZB 2WNGA 1CFVL 3TO4C 2CMRH 2HT2D 5A2KH 4OLYL 3KPSA 1CICC 1HKLH 3GIZH 4OIAA 3FZUD 5HY9A 2EZ0D 3DBXA 4TUKL 3DMMA 5TF0A 3WFZA 3FT3A 4AMKL 4KI1A 3WKMH 2XZAH 4OUOA 4GKNA 3VRJA 1URLA 1BHGA 2PR4L 2V7NB 3NIFE 2BDNL 3C6SA 3ARTA 4WNQA 3F7VB 3BW9B 1HYSC 1A1NA 5E8NB 4XAKE 5DD6B 3RAJH 3NN8A 4DK6A 2YA1A 2H1PH 4Z76A 3ZYIA 1QBML 4G42A 4PJ7F 4ZQKA 4XPFH 2FWOB 1AGBB 2ED8A 4WU7B 3TPUA 1QP1A 3GSVA 1M71B 3B9KC 2AABH 2J7LA 4YHPA 1XF5A 5TH2B 1CFSB 1L0YA 1W8OA 2XA8H 1LWRA 2A73B 3CDCA 2QTEA 3JWOC 2AKRB 3BZ4B 1TQBC 3QT2A 1SJEB 2AK1L 3SGEH 1UQSA 1NFIA 1IRAY 1Q94A 4FQPA 3HAEA 3PQYE 4O51B 1JGLH 3AC0A 4RFNB 3LKRB 3NFPA 4UTBH 3BGFC 2W9EL 1FRGH 2X4UB 2X4OA 1G7PA 3T1FB 5JIIA 2DLGA 4KKLC 2X4SB 4M7ZC 2C1PA 1FAKT 4I77H 5CEYA 4RWYH 4F33B 2W9DL 4R3SA 3CXHK 4JJ5A 4LAJH 1CDHA 2EYRB 5BS0E 3CSYB 4OFDA 1QFWH 2YRPA 3NCEB 1QHOA 5AZEH 4Z95H 5A43C 3THML 1QSFA 5I18L 4PGBB 1AD0A 2YKLL 3BHBA 2A6KA 5IR1B 1U8JA 1S7SA 1FZMA 1UG9A 3GMPA 5JORB 3ROOB 3V5KB 3MZTA 4NQCE 2A77H 5CKAA 1ZSDA 4N9OB 3ARPA 4R26L 3IJYB 3PWPE 4K9EL 4OIIL 1U2CA 4HMCA 1FG9C 4UUJB 4LKXB 3X11A 3ULVL 4XB7A 4L4VA 3DGCR 1N59A 3EJYD 2I9TB 3CVHH 2OM5A 3KXFB 5DTFA 2AXHA 1DVFD 1LP9E 3H42L 1D6EA 3JTTB 1BIHA 5D70L 4NDMB 3EYSL 4AG4H 2W0FB 1W0VA 4PLKC 4GXVL 3V0WH 5IVNA 4OM1H 5DUML 2YEZB 2F5BL 2OCFD 4LQFH 5MEOB 1CWVA 4W6YB 4GBXD 4G8GD 3PABB 3LKSA 4BH7B 2W0PA 1T83C 2VR9A 5IIEA 3ZL4L 3SN6N 4LL9A 3CDYA 4FQ2H 5C86A 1ZOXA 2BMKA 4RFNC 4HBCH 4KKAC 1UCTA 5ACZA 1YY8B 4PJHB 5I19H 1GIGH 3IDUA 4PJBB 4GW4A 3TT1H 4FG6D 2W1NA 4HKJB 3NVQA 5I15L 4UOJA 3HMWL 1T2QL 2ARJA 1NL0L 1WT5A 1P7HL 1ED3A 2NTFB 4ZSOB 1F11A 1Q1JL 1R3LB 4LSUH 3ZHDA 1S7UB 4TVPE 3NIGE 1ZT7B 1BMGA 1NBQA 1YN6A 2C3WA 1X5FA 4M00A 1KTDB 3HE7C 3LQZA 4K07A 3TCLB 5IUSA 4FXGB 1AXSB 2AS5M 1MHHB 1JJUA 2J6EH 5FUCE 4Z7VE 1PLGH 3RNQA 1RZGB 4OGXL 4HK0A 4KPHH 3W39A 5JHDB 3GRWL 2NY6B 1ZK9A 2C4FU 4WUUE 4PJ5B 3BP7A 3D69B 5C0FA 4WTWA 3KJ4B 4YDKL 3G9VA 1CFTB 4H88H 1ZS8B 3L5WA 1NDGB 3FCTB 1QBLH 1UGNA 1NC2A 3F7RA 1RZJC 3WEXA 3VFGH 4YEEA 3GJEB 5EORH 2G5RA 4NQUA 1P4BL 4KZEL 1KCUL 1ZA6A 5IBTH 3DTXB 4I9WD 4I2XE 1OAKL 2NNAB 4YGAB 1QPXA 1KPVB 1I1AD 3OKYA 3L5XL 4XP5L 4G5ZH 5IK3B 2ITDB 3SDYL 2FJFB 2CR6A 3NCYS 5EFIB 1S7WA 1IKNA 4B5EA 1DBJL 4GKSB 3TA3B 1V3MA 1CLZL 1D5ZB 4BQ8A 1E0OB 3EOAB 3I6LD 4U2ZA 5DJAA 5H37G 3P30H 2F5AH 3CH1A 5GGVH 4WWKB 3HKFA 3U2SA 4K8RH 1DANU 3QDJD 5HYFA 5CGTA 5I8KH 1ORQA 2Z0BA 3EO0B 5AAMA 1X9QA 5KJRH 1G7LB 2DYPD 3ARGB 4M5ZH 4I3RH 1XH3B 1T0MB 1MEXH 1V3JA 1Y18B 2IANB 3CMOH 2BOBB 1RJYA 3ROLB 5CILH 2R0LL 4TSAH 3VXSD 5I0DA 3ILPB 1S8DB 3K8LA 4PY7A 1BBDH 1NKOA 1HOCB 2NY6C 4X7TB 4YHYC 3S37X 4FQ1L 4HPYL 2QL1A 4OTXL 5D5ME 3IT8D 3NACH 3M8OL 4MVBC 4FN0A 3KJ4C 3MREB 3MLXL 3ULVD 2X6MA 2DIBA 1JNLH 5GRVL 1N2RB 1A3LL 3WLBA 3GB7B 2X7LB 4X83A 3KS0J 1FLTX 3RWIA 2GJJA 5DFWH 3HMXA 4LAQL 4KKCC 1OGAD 4M9OA 3IFOA 2HA1A 5BVJA 5DGRA 2D2OA 2BOCB 4JFEE 5IVZA 1JZ7A 1AQDB 3MUZ1 2UZYB 3S96A 3WNKA 4GOSA 5IT2L 2HT3D 3L7EA 2X4QB 3TA3C 5F1OB 2ZKHH 4QHKI 4XC1H 4MJ4A 2P8PB 4M7JL 4Z7UE 5KVDH 3RFZC 1LILA 1PAMA 1QLFB 4MAUH 5CSZA 5I17B 5JW3L 2OTUA 2J2ZA 1RULH 2HKFH 4MCYA 2YSSB 3FO2A 3GSNA 3KPQA 1WFTA 3ARGC 4JDZA 4Y1AA 4MNGA 2DMCA 2EO1A 2Z4QB 2DWDB 4JDVA 4PD4J 5JXED 4X98B 3AREA 5I1GL 3IU3B 2GUOA 1WC7A 3VWJA 4F7EB 5KSUB 4OGZA 1KEGL 5FYKD 2BHYA 4LMQE 5C09E 1LK3H 1VFAA 4DJMA 1I7TB 2HJKA 4PJAF 3UTSA 5I1DB 3RL2A 5B39G 3OGCB 1A6UL 5K33A 1RD6A 3P4NB 4LP4A 5DJYB 3H3BC 2WBJD 2D0FA 3GEWB 5TDOA 1U95B 2AJYL 1UVQA 5BQ7B 3BDYL 2CRZA 4QRRE 1RK1A 3QRFM 4NHCH 1C1EL 1TTFA 5ESVB 1CCZA 2XQBL 3QUXC 1AC0A 1UWXH 4XPAH 3WO4C 3DX7B 1HXYA 2CKBB 4N0CC 4JY5L 1C5CL 5DDHA 1V3LA 4MNHB 4NCDA 5F7EH 4DGYL 4B41A 2CRIA 3NCYP 1KJ2A 3RPKA 3DX6A 1ZGLP 4BSWB 3VXUB 2CRMA 3MLSH 1F5WA 1AI1L 1FGVH 4HS3B 1KB5L 5CBAB 4OUUB 3DETD 1T3FB 1LO0L 4LSSL 2R0ZH 3KYNA 4JGJA 4PJ8C 1YY9C 3MSPA 1U41A 3QUZD 3FFCA 1AXTL 4PGEB 3BPCA 1H0DB 1FO0H 3S4SB 1FNEA 4M7KL 4Y5XC 1BFOA 2DKUA 3BDXA 2E9WA 3OKMB 5T33H 4IOSD 5E2UL 5CWSA 1QRND 4L1DA 4X7EC 1NMBL 1K2DB 1CE6A 3V6ZA 1EHLH 3D0LA 1NQBA 2ZUUA 5C0RH 1ZLSL 3B9DA 3BGAA 5D7LD 4M1CC 3G9AB 4UTAH 5IWLC 2VJXA 2AAVA 1GZPA 2X1WL 5EB9A 5IKCB 8FABB 5HDLA 5J8OA 3L5IA 1OQOA 2CXKA 1F4YH 1XGQB 2MPAL 2EDDA 1Y0LA 3BAEL 2GK0B 2DJ4A 1CICD 3DUSB 3GJFA 4FA8A 1Y6MR 2B39A 1EDQA 2EYTB 3IKKA 3CCHB 2AK4D 1NGZA 2GITB 4HUXB 1RURL 3EYUH 1YEKH 4J3WA 4PGCA 3JWDC 3HR5A 3OKDB 3U7AA 5FECB 5C0CA 2WAHA 5KW9L 1T20B 4MDIB 4LSDA 3VW3H 1LEKB 1MAKA 3O9WB 4JAMA 4X6DF 5JW5B 4L3EB 2O5YL 5DQ9B 1EZVY 5C0DB 1GGIH 4LSPH 1TJHL 1HXMB 1KIPA 1I1YA 1MCWW 2XRAL 4QRPB 2GYSA 3K4DA 4A6YH 3OAUL 4JN2A 3D39A 2OMNA 3RBSA 4Y4FB 4LPTA 3WN5B 3KPOA 4DKEH 4J3UA 1PY4A 3HI1B 2E9JA 2GHWB 1QPPA 3WDJA 2WINB 3KYKL 4NZRH 3UTTE 4KJPC 4ZOAA 3FKUS 3V52L 5C0EB 4ZOBA 5HDQH 5HYSB 4Z0XB 1IC4H 4YPGB 2DQEH 5FV1L 1EO8L 2VABB 3FB7A 4XMLL 2X89D 3BUTA 3MXWL 5FO8B 1G0XA 3VXNB 1MJ7L 1WIUA 1IEHA 3SKNB 3TV3H 1XZ0A 1S9WA 4EUPH 3GDBA 2B1HL 3RTQA 4KKLD 2E6QA 3QEHA 4YDIH 3VFRB 2MHAA 2I07A 3CFBB 4X9BA 3CFCL 1A6VH 4E5XA 3INUL 1UM5H 2FGWL 1IZKA 4GG6B 1MCSA 1F13A 2VLRE 3JBG7 3CSBA 1MLBB 5DRNB 1JZ3A 2I60L 3G5ZA 1CL7L 2FB4H 1JF5A 4QOKE 3O9WC 4L9LB 4OLXH 3TGXA 4JPIB 5DD1H 3ARDB 2E9IA 3LSOA 4HJGB 3KPNB 4ZFGH 3O6KH 3ZO0A 5ADPH 3GSQA 4KMLB 3CC5B 3IYLW 4WHTB 5C07E 1P7KA 3HNSH 3FFDA 3W2DL 2WLZA 4Y7MA 1N8ZA 3MCLL 1YC7A 3HMXH 4R6UA 5GGRY 4O2CA 4ZDHB 4W68A 4B50A 12E8H 5DJ6A 2QADC 5IB2A 3H0TB 1PEZA 3REWB 1QZ1A 4GQPH 3MRKA 1X5GA 4DVRL 3RPIA 5HJ3B 1Z0MA 2XZQL 4GKZB 1BWMA 2EYSB 3IDIA 2QQNL 1HEZB 4EN3A 2P8LA 2XXMB 3PWNB 2X4NB 3LEVL 3F58L 4GUPA 2R4SH 3RBGA 1E4XH 1JRHL 4ZODA 3HZMB 1U91A 5GHWL 3FOLA 2UWEA 3GSXB 5IGXH 1MREL 2XTJC 1VADA 4LLDA 4D0CB 5J3HD 2IH1B 2EDOA 4G9FA 2LVEA 1SBSL 3W0WB 3IDGA 3PUCA 1EEQA 3SGJC 4JRXA 5DJXB 3SPVB 3FRUB 2QHRL 1OSZB 5T5FH 2BNRA 1VDGA 5CUSL 3QIUB 1CDBA 3TLRA 1BAFL 1I4FA 3KG5A 3RJDA 4JM2F 1OAQH 4L9LC 2Y9RT 1R5WB 4XBEH 3BOVA 4MMZC 1RIHL 3ARDC 2BX5A 2P42B 1JGUH 1DLHA 4HUUB 3QQNA 4LNRA 3FQTA 3MLVH 2YD1A 2WUCL 3D6GA 2VC2L 5D93C 4ODXA 5MHSD 4JDTH 1IT9L 1NFKA 3BH8A 3RX8A 5DRWB 4LSQL 5JW4R 4NYLA 5IFJB 4X9IA 5EPMA 4LHUB 5E2WH 4BA8A 2WIIA 3KXFD 1BVLA 1P9MA 1YQ2A 2WQRA 5F9JA 3S88L 4H0IA 3CFIC 4ORGB 2DLHA 1FFRA 4RSVA 3SE8L 4FFZL 5SWSE 5TQ0H 1D9KA 4L29B 3SE9L 3L3KB 4FQQA 1KJ2H 5D6DA 4XVSH 1R3HB 3DO7B 1ZLWH 2BSSB 5AZ2H 1DBML 1PG7X 1DZBA 2XY2A 3DIFB 3K2UH 4ZUSB 2G9HB 3B83A 1X6NA 2VL5A 4HKBB 4GRWH 1JPFA 4KFZC 1J8HB 5C0GA 5JOPE 4DN3L 4F9PC 2AJXL 2DTMH 1LDPL 4LCUB 3ALPA 4J1UA 5EBMB 4Q74A 3EO9L 4OZHF 2VKXA 4P2QE 1CGSH 5CCKL 1FDLL 2H2PC 3ZKXB 3WXVH 3S37H 3HPJA 5KN5A 1ZHNA 4MWFA 2F19H 5DK3A 3AY4A 1RUAH 3MLWH 1FNSH 1F97A 3GSOB 1V8HA 1UEMA 1BVKB 4JANA 3STZA 4EXPX 1AE6L 2ZCLL 2AXFA 2H26B 4LRNL 4KTEH 3GMNB 3OZ9H 4P0DA 4RQQA 1MIEH 4MSWB 3S36L 2CJUH 3QQ9C 4UDUA 3BP4B 1FFOA 1GAFL 5JHDD 1TETL 4ZUWB 4K94H 4I0PC 4PJ5D 4OLZL 5C9KA 5D7SH 4FFYH 4NWTL 3QA3A 5IVXA 5C6PB 4ETYA 1LD9B 3GJFH 4TRPL 2P5EB 5FYJL 3EDFA 3K3QA 3JZ7A 4QEGA 1YDPB 2O5XH 4DEPB 3LQAH 4PJ9A 4MJIE 3OKLB 3T3MF 1B3JA 3IXTB 3Q5YA 5GRWA 2BFVH 3QUYB 1EA9C 2CKBL 4KKCD 1A5FH 3D2UB 4CKVX 4YIQB 4HUNB 3QEGH 3DVNA 1CLOH 4F2MA 1HHJB 3QDGE 2HLFC 1DE4B 3T08A 4HUKB 4AIZA 1TJGL 4G80A 3GSRB 5HHVL 5SWQA 3D3VA 3N0PB 3TBTB 3S3PA 2AV1B 3GO1L 4XXCC 2ZUSA 2KPNA 3QULB 3OJDA 1YJDL 5KG9A 3TA3D 4TPRH 4RAVA 5IMMB 1WFUA 4S1RH 1JZ4A 1CXFA 1C08B 3LIZL 4NQEE 1RPQA 5LGHL 5L2KE 1FORH 4QWWD 5EUOF 4WWKD 5E7FA 3HR6A 3MA7A 1ONQA 5MEQA 5IJKA 2F8XC 1A7RH 3MOQA 4GSDH 4NO2B 1AKJA 2YZ8A 4G9DA 4M62H 3BKYL 5E8OA 3I84A 4UQ2B 3QXVA 4NRYA 2FIRT 4XAWL 5HPMB 5D7IB 1J11A 2Q6WA 1PSKL 1F3JA 1X44A 3WD5H 3AM8C 4L4JA 5IROC 3R1GH 1Z5LA 3FQWB 1IC1A 2V5YA 1JPTL 1RK0B 3T4YB 4L8BA 4ODHL 4XPTH 4D94A 4G6AC 2BCKA 1B9ZA 5GGSA 5AWNL 5BOZG 1OHQA 4M93B 3MFFB 4XBPA 4XZUA 5EBLA 2EH7L 3TN0A 1AC6A 4LDEB 5SV3A 1P1ZB 4O9HL 4Z7WF 3UPCA 2PYEE 4DN4H 2BVPA 1JZ8A 3IDNA 5DO2C 3G5VB 5D2LF 4HEME 4HW6A 3HC3H 4U1SB 4XCNB 1UWEL 4U6TA 3OTTA 1S7XA 2FO4B 1FNFA 3VXQB 5DJ0A 2DTSA 4BSVB 4P4KB 3X3FL 1UWGH 2GJZA 1XR9B 2B20A 4R90H 4YXKL 1CE1L 4GQ9H 5HGAA 1RHHA 3ULUH 4IM8A 2ZOKB 3NH7L 4OZHE 3V8CA 1WGOA 4BFIA 5EU7E 2GT9A 4PTUA 4AEEA 1MJJA 3VFUB 2C3VA 1UH2A 4OCSL 1ZGLM 4MCZA 2J88L 1XF3A 3BISA 1DQML 3ARFC 4JRYB 1AXIB 4JB9H 1KFAH 2VLKB 4HWNA 4H26A 4G7YH 3PQYA 4MX7B 2A9MH 4WFGE 5C0IB 5CEZH 5HYJB 4A2LA 2FJGA 1KLGB 2HJFA 3TCXA 2AXGA 5C2BL 3LKOA 1T1YA 1G1CA 5I6XC 3QHZL 4G6KL 4RBPK 1KCSH 5HHME 5GRXG 1F6AB 1RHFA 5H2BB 2YPLB 3HUJE 2PO6D 4LVHB 1YQVH 4POZC 1DSFL 4M93C 5BS0A 1HQ4A 3ZE0F 1X3DA 1I9JL 3SE3C 4EQ3A 3UJIL 2ZG3A 3QBTB 5FXCH 4NKDA 4XP9H 4CN1A 3OAYH 1GZQA 4NKQB 4PS4H 1OLLA 3RWEB 2DQUL 2FO1A 3VFVA 2A38A 5JO5A 1KUMA 3BKML 1TQCB 1EXUA 4WI9A 3SKJL 4NQCA 4HH8A 3BQUB 5FO9B 4HS6B 1V7MH 5FYJE 1FC1A 5DC0A 1J1XL 3VXUD 4NNXB 3PF2A 4OAWB 3OHXA 3WIHH 5I66A 3Q0HA 3KNBA 4ZUVB 2R2HB 1X4XA 4KK8C 3MV9B 2F53E 3Q5OA 5EBWB 1LP9A 5LCVL 4AQ1B 2VXSH 2O26U 4P57B 3TNMB 1OB1B 3MODH 3IVKA 1B6DA 4POUB 5KSVA 4P3DB 3EYOA 3U0WH 2YD5A 5JZ7C 1Z9LA 3VFSA 5K9OA 5I1AB 5F89A 4WU5B 4Z7NF 5J9PA 2RHEA 1ND0A 2BSTB 1FVDB 1OF2B 4Z0BH 2IADA 5A0GA 4ZFOL 2A2QT 4D2NA 1INEH 4EOWH 3FQXA 3HC0A 3I50L 3VRIA 5BV7L 1YECH 2DICA 2H6PA 4NJAH 3IXAB 5DJCB 3F6LA 1MUJB 1OTTD 4R7DA 5CKGA 4CVWA 5CIPA 4H5SB 5F70A 2AJVH 4IRSB 5EO9B 5I8OH 1PX3A 2HTLD 2PXYD 1TVDA 4KROC 3BQUC 3V4VL 5GGQL 5D2LE 1LEIA 4YUEH 3O3BA 4Z7VA 1P4IH 5CZKA 4KY1L 2QSCL 5DK2A 1KJ3H 2E7LC 5ITBH 2BRRL 4HQQL 1HE7A 1ACYH 4C56E 5DJ2A 3Q6FA 3SGKC 2IAMB 4WUUA 3DVIA 1SVCP 1ZT1B 4QRPD 1DCLA 4N0YL 4Z6AT 2WBKA 2KBGA 2C7UA 3RVUD 2HRPH 1MPAL 2DLFL 3MUJA 4Y4FD 4LVNB 3NIDF 4OZGF 5IOPB 3CPLA 4HF5H 3CK0L 1HNFA 2D0GA 4QTHA 4RMSA 4P5MB 1J7VR 2FDBP 1KULA 1CT8B 3H6JA 4WW2C 4I2XA 1AR1D 3MRIA 3QDME 4LSVH 5IEKB 2EE3A 1F6LL 5JIHA 5FB8A 4P2RE 3R8QA 4HGKC 3P4MA 5GQBA 1Z9OA 4LLVA 4FNLH 4PP2A 3MO1B 2JCCB 2GTWA 3MC0A 4PJCF 2QQQA 1T89C 3RY6A 1E6JL 1YEDA 4NO5A 1XCTB 1MCOL 5ICZA 1NSNL 4OCNC 5DJDB 1WFOA 4YXLH 4PBWD 5KVEL 4XCYA 4U7KA 4JHAL 3U4EB 4KGJA 2RAMA 4Y16B 4Z78B 1MWAH 4F7TB 1KENH 2BVOB 1ZEAH 4LPCA 2FH6A 4G8IA 3ZTNL 4LCWB 4Y19E 3G5XA 3SKOA 2K9UA 1HHHB 3DVGB 4YGVB 4Y5YB 3TZVB 3EDJA 4HJ0D 3T0EB 3C08H 2CLVB 1I9IL 3ARDD 5A16A 3PP3H 2IAMC 3CFJB 1KC5L 5LGJB 4NCC1 5D5MA 1QLEH 3V79C 4LEXL 3WUWA 5EU6E 1MCJA 1ES0B 1CD1B 4HEPG 1FYTE 3DGGB 3AFLA 5FM5M 3SO5A 3MQIA 1NJ9A 4W70A 4JFOA 1G7QA 4OI9A 1ZLVK 3BKCL 1MF2L 3F8UB 4UT7L 1U3HA 4TTDD 1OWWA 3MNZB 5J6HB 4RX4D 1A6WL 4QY8A 1CF8H 1QLRA 4JFEA 1B0RA 3UDWC 2OLDA 3VE0B 1DQLL 1ZHBA 3EFFB 3V7AE 4K3JH 4Y89A 3DWTA 4JFDB 3VGBA 1CGUA 2FR4A 4L5FL 2R56H 2UUDH 3BPNC 1MQKH 1FNGA 5MEPB 2CLZB 4X4XA 4FMKA 3TBSB 4ZTOH 4Z7UA 1JHTB 3KLSA 3GKWH 1RV6X 5LKNA 1OAXL 4MD4B 4XT1C 1WK0A 3G6DL 1KCRL 1XIWA 4Y16C 1BEYL 5FF6B 4HHAA 3W0WD 4JPVL 4N1HB 5DMKB 2GY7B 5F3HB 3QXAB 5KAQF 4HKXB 3QIUD 4R4FL 3MBEB 4Y5YC 4PRHE 3CFDA 3TZVC 3A6BL 5FM5O 5JUEL 5ELIA 4JM4H 4ONHA 5C09A 5SX4I 3T0EC 3V5HB 1UKQA 4LSRH 1VGEL 3P9LB 4MXQD 1OP5H 1X5XA 3IDMA 5IG7A 2GTZA 1I3RA 4BQCA 1S78C 1RJLB 5GS0L 4CDGC 3LPFA 4OCMC 2PTTB 3MPCA 1C16A 5I76B 2B8OT 3P40A 3VCLA 4CMMA 3UCRA 1LQSR 4LHUD 2XG5A 3QB7C 1AGCB 3QUMH 4QRRA 1FV1A 4HZAA 3HE6B 3WHXB 3M07A 3VFWB 2DQTL 3O6FA 3DSFL 4BELD 3NPSC 3QZWB 4OZGE 3WFEL 1HDMB 1WEJL 2B2XH 3GNMH 3QCVH 2XG4A 3G6JB 4AIOA 5HGHB 3T0WA 4Y4HA 2P1YA 2CDGA 4BH8A 3TYGL 1EJ6A 3VXPA 4Z8FH 4X8JB 1JNNL 1A4KB 4Q9QH 5I1IH 3O11A 4NZUH 3R4DA 3CLFH 2AEPH 4M8QA 1C8PA 5E5MB 2Z92B 1CDCA 2W0KA 3GI8L 1J8HD 1NANI 3QXWA 4WI4A 2EXWC 1M1SA 5L0QB 5E56A 2Z93A 4FQLH 1BLNB 7FABL 2GAZA 3BP5A 1CXIA 1T21B 3ULVF 2E27L 4IRZL 2CIIA 2Q86A 1FNAA 5BJTA 3AMLA 2NY7L 4F7MA 1QVOA 3MBEC 4PB9L 4MJ2A 3GUTB 2HVJA 1G6RL 3ARVA 3PGDA 1REIA 3PHQA 3KYAA 1KOAA 4P2OB 3CVHB 3FQUB 3H8NA 3PDDA 2NY1C 2NYYC 1G9NL 1KT2A 3U36A 1EO7A 5DEZA 3QJHA 3KPPB 1MVUB 3HS0B 4ZUTB 2IPTH 2SEBA 4LLUB 4XNMB 1JHKH 1K85A 1DBKH 3HE6C 4WENB 5IV2A 1SY6A 3NBNA 5CIPH 4G6AD 4IRJA 5GZOD 2P5ED 1J1PL 4Q9BA 2R2EB 3E2HC 5F88A 1CFVH 4OLYH 3U30B 1OW0C 3WL9B 3QUYD 4L8SC 3D2UD 2ZJSL 1H3XA 5D7JB 1F90L 5MI0B 4TUKH 4AMKH 3DOSA 4JFQA 2FZ3A 3V6FA 3C6LB 4QHUA 2PR4H 1BBJB 4KUZL 2BDNH 5L0QC 1XR8A 1I1CA 2Y36L 4Z77B 3HNVL 4DCQA 4Y4KA 2GCYB 3T0DA 4CADB 3VG9B 5INDA 1QBMH 4DVBB 1U6AL 1FQ9C 4DZ8A 4X0KB 4MA1B 4MQ7A 5DWUL 3UTTA 3QIBB 3RWFA 1BQHB 4P2OC 4FQHA 3V6BR 3GSWA 2B4CL 3CGTA 4CRPA 4FQXC 3OR7B 4CGTA 2AK1H 4WI8A 5EZIL 1NUFA 4GMSL 4I9WE 2YRZA 4RGOL 1EAPA 1MRFL 4UDTA 5IMOA 3ZKMC 2OTWB 3QH3B 1W0WB 4ELME 1D5BA 3G04A 3ZKND 4GG8B 4IJ3C 2W9EH 4POZD 3OF6D 2FECL 3TFKD 1DLFL 5FA4A 1A3QA 3U9PL 5I9QB 4UAOC 2D31A 3GIVA 3UTZA 2W9DH 4U1HA 2E8YA 5J56B 5I30L 2VLRA 3MRFA 1U9KA 4OD3L 1TPXB 5MI0C 3THMH 5JMOC 5I18H 5JW4M 1E27B 1XT5A 5IJVB 3T4AA 2YKLH 4QOKA 4LPYA 1MFBL 1HIML 4UNVA 4GW5A 5DUPL 3G6AB 4P4KD 1KPUB 2P8MA 3VGEA 4P5TA 3JV0A 5C07A 4YHLL 1U8IB 3LAFA 4R0LB 4AT6B 4R26H 3T65A 1DUZB 3DSNA 3NCBB 3B8SA 3LV3B 4K9EH 4OIIH 1DQDL 3EOBA 4MA1C 3HB3C 3ULVH 2Y4SA 2JELL 1LO5A 2NLJA 5GJTL 1EEZB 35C8L 3QIBC 2A74A 3H42H 2EDKA 5D70H 4EZMA 1ZWIA 3EYSH 4GXVH 4JRYD 1T66D 1IARB 2VLKD 1GL4B 3DMMB 2IG2L 4GXUN 1WZLA 2F5BH 5DUMH 3X14B 1BJ1J 1OGAE 1EIBA 3PWJA 3K8MA 2KQMA 3MJGX 1IAIM 1IBGL 2C3GA 2WQ8A 1F8TL 3ZL4H 4EDXB 3C6SB 2YPLD 4WNQB 3STLB 3FOMA 5I9QC 1EVUA 3TYFB 1CYGA 1LO2L 2DF3A 4U6HB 1MJUL 3EYVA 5F1KC 1ZHKB 5I15H 4ZQKB 4RIRA 1QBBA 3HMWH 3O41A 1T2QH 3TPUB 1NL0H 3GGWA 4MAYA 5DRZA 1BOGA 4P3WA 1Q1JH 2CPCA 4YHPB 1XF5B 4EI6A 3V9FA 2HFFB 4LDLB 2VWEE 1AQKL 3BQUD 3MOAL 5DJZB 2HN7A 5H35A 3GI9L 4M6OL 4HFWA 4PRBA 1NFIB 4HGWB 2P48B 4XMKL 3SBWA 1Q94B 4YHNA 2BNQB 4R0LC 4IDLA 5FYKE 5ADOL 5I71B 1ZVYA 3QO0B 4YE4L 2A1WL 4JO4L 2YN3A 1T7ZA 3MRGA 4HXBL 2JLLA 3MV9D 4WHDA 4OGXH 4H0GA 2X4OB 3GRWH 1G7PB 1P6AB 4NO3B 4JQIL 4UBDC 3EZJB 5SWSA 5CEYB 1AP2A 1A02N 4NN6C 4R3SB 4JJ5B 4BK5A 4YDKH 4QRSA 1QFWM 2GQHA 1QSFB 4TNVK 4WFED 5D7KE 1AD0B 1MCDA 3NFNA 3BHBB 2AEIT 3NZ8A 1WBYB 1P69B 1S7SB 1P4BH 4KZEH 1KCUH 3KLAA 4PG2C 1AHWA 1FZMB 4QGYA 1OAKH 2RB8A 3U9UB 5B39A 1N5AA 3QI9C 3L5XH 4XP5H 2NZ9D 5I1CL 4OT1L 1IAIL 1ZSDB 3SDYH 4S1SL 5ESQA 5J1AB 3RUGE 3L7FA 4P2QA 4X4YA 1DBJH 3TIEA 3RZCC 1FL6A 3X11B 1Q8MA 2NY3B 4LQ1A 5CJOL 1S5HB 4PJXE 1CLZH 4LDOB 5A1AA 2D0HA 4IRSD 4JG0L 4D9RE 1D6EB 3SKMB 2ZUYA 1A6AA 1Z0NA 4AEHL 4RRPA 5B8CB 3ARZA 1FO0B 5IVOA 3MRJA 4IMLB 5I71C 2W60B 2R0LH 5IIEB 1YPZE 1RU9L 2D7TL 4DKFL 2IAMD 2BMKB 3MRRA 4OGYL 2AJZA 4TNVF 4PY8J 5D7LE 4FQ1H 4HPYH 4OTXH 3H2WA 3BZDA 3M8OH 3O3EB 3PNWA 3MLXH 4QRUA 3PGFL 5KSAB 4KZDL 5GRUL 3D48R 4KVCL 4Q9CA 4JPKL 1IM9A 4MJIA 4U1JB 5DT1L 5J11C 1A3LH 1JIBA 1ED3B 3MGTA 1F11B 2BVQA 3QDGA 4LAQH 1PVHA 4XPBL 3B2VL 3S36X 4OCWL 1C5DA 4AM0A 1YN6B 1M05A 2AK4E 3LQZB 3QHFL 2Q76A 1RZ7L 1ACZA 2EC9T 2H2SC 1P53A 2YA0A 5FHAL 1CU4L 4NQEA 4JKWA 5C70A 1UB6A 5IT2H 4NC1C 3OKNA 1QFOA 1RZJL 5L2KA 1AGFA 5E4EB 4HBQA 4HK0B 1S5IL 2CUMA 5F21B 4M7JH 2YPKA 1IAOB 3BP7B 1FSKB 5C0FB 5HDBF 1QYGL 3EKCA 2M8XA 3GBNL 1EFXB 4MLSA 4GW1B 5JW3H 2XN9B 1UZ6E 3T2OA 4WHCA 3DRTB 1HCVA 4XNUH 3WEXB 1P2CA 2A83A 1UFUA 2WLYA 5B8CC 1DN2A 5D1XA 3TZVD 3U7WL 3L3GA 4A6YB 3T0ED 2COQA 5I1GH 1T0PB 5HHPA 1KLFA 4BFEA 1YMHA 1KEGH 3UBXA 4Y5VC 3MJ6A 5CJXC 4G8FA 3BH9A 3C87A 4PJHF 2X4RB 3ZE1F 2H32A 4PJBF 3QQ4B 4WEUD 4N9GA 1A6UH 3UTQB 5KSAC 1CZ8L 3O2WL 1FPTL 2WUBL 1OVZA 1ZTXL 2AJYH 4ZMAT 1S7TB 2PYEA 4NFDA 3BDYH 4PJAB 4R96A 4MYWB 4M8VA 1K3ZA 5DD5L 4EUPB 1VKXA 1C1EH 1O7VA 3MR9A 4K7PY 3N06B 3F6IA 2C4XA 3U2SB 2XQBH 4X6CE 2J5LB 2V5MA 1RQ5A 1ORQB 4O58L 2JJWA 3P77A 4JFDD 4JY5H 1C5CH 2AEQL 5GGRA 3ZKSD 3HRPA 4WDIA 3PV7A 5KSBE 1NC4A 1JUFA 5KTEL 4DGYH 4UIMB 1TIUA 1L9MA 5H37H 3WJJC 4QHMB 5FYJU 3VWKA 1SYVA 4HMEA 1XFPA 2EXWD 3UJJH 1AI1H 3FO0L 4XC3L 1WWAX 2BXYA 1FSKC 4OZHA 1KB5H 2BXZA 1LO0H 4LSSH 2JJUA 1T5XA 4QCIB 3VH8G 3HAEG 1NCAL 1AXTH 1MQ8A 3UAJC 4M7KH 3UZVB 2EIDA 2VE6A 3MBED 3CJJA 2FBJL 2WANA 1JPGA 2QQLL 1DP0A 5CSBA 3MCKA 5E2UH 3PJSA 4K55A 4P23C 5BVJB 1NMCB 2DLEA 2I24N 1NMBH 5HHNA 3U6RA 3HUJA 43C9A 1U8PA 3MLRL 1ZLSH 3L7EB 1K5NB 3HE6D 1T04A 1MI5E 1MCCA 1Q9OA 3ULSA 3KYMA 2FCBA 1K9TA 3VXMB 3GMQB 4HJJL 3EOTL 4ZG1A 5CSZB 3IRPX 3BAEH 3VI3F 4G6ML 3FO2B 3ELAT 4LPXA 3D5OF 3REVB 3KPQB 2KZWA 4CN6A 4AL8L 1OGTB 4K7PL 1WBZB 1SJXA 2AP2A 2GUOB 1RURH 1ZANL 4JJHA 4NM8L 2W59A 3VWJB 1T6WA 2GK2A 1Q72L 5T1KA 4DOHB 5KW9H 4JLRB 3LKNA 5CD5D 3Q48A 2HJKB 2F53A 2D7MA 3RL2B 4HX1A 2O5YH 3LRGA 3JV4B 1VSCA 3VGFA 4O00A 1TJHH 1KPRB 4J3OC 2XRAH 3I6KA 2F74B 2WMPA 4NZTL 5TDOB 3PL6A 5H94A 5CMAB 3OAUH 3K74B 3KXFE 5HDBE 2VLME 2OR7A 1MRCL 1S9VA 4P2OD 2OJZL 4HKZA 1NMCC 3KYKH 3SDDB 3L1OL 2YBRA 2Z9TA 4UU9B 3V52H 2JIXB 4WFHD 4YDVA 1EO8H 2OBGA 4XMLH 3MXWH 5FOBB 2HJLA 2VXUL 4LGRB 3VGHA 1KJ2B 4TULL 3ZKMD 3F65A 1MJ7H 4PBVC 1GGTA 1NBVL 4PJBE 3X13A 5F7UA 1VEPA 1KGCE 2B1HH 3LKQA 3WHE1 1MFEH 2Y72A 2AJ3B 4GRWB 2FEEI 3FFCB 3BUYB 5I73B 4JY6A 3BPCB 2APXA 3CFCH 4ZSOE 1FNEB 3E0GA 1GXEA 1ZAGA 3LRSA 3CDGA 3RWGA 1BFOB 2DWEA 5D2LA 5D7JD 3INUH 2FGWH 2N1KA 5DXWA 4D9QD 1KIQA 2CIKB 3VRLF 5DA0B 5CWSB 1YN7B 1W2KT 2IQAB 3C6LD 1OM3L 2YPVL 2I60H 4C56A 1CE6B 1CL7H 1JI2A 4L1HA 3WMSA 2QQKL 3V6ZB 2EDQA 4ZPTB 2E8ZA 5ISZD 4RMQA 4LRIC 4APQA 1QFHA 1TNMA 3RWCA 3T8XA 5JHDE 1CD8A 1GOGA 2L0DA 1GZPB 3QXTA 2JB6B 3W2DH 4LLMA 2H3NA 4PJ5E 3MCLH 5I16A 4H0HB 2G75A 2OYPA 2Z8RA 1D5XA 1IGJA 2DM7A 3QIBD 3WDIA 4PJGE 2XV6B 3QDMA 5DVMA 4DVRH 3UTPD 3SDDC 2CUHA 2OK0L 4P2RA 4U6YA 3GJFB 2XZQH 1QACA 4FXKB 1HH6A 2ADFL 1NGZB 3NABL 4EI5B 4PGCB 2QQNH 4QRQB 3HR5B 4OZIB 5C0CB 1HK6A 4ODUA 1U3YA 5GGUB 3LEVH 3F58H 1G7IB 2Y5TA 4JAMB 2PYFA 3I6GB 1JRHH 1A4JB 4PPTA 5MENB 5GHWH 1G9MC 1I1YB 3C8KA 4F7CA 1MREH 1CLCA 5I73C 3DUHA 1XF2A 5C0BD 4K3EL 3WJLC 1X4YA 4JN2B 1SBSH 3D39B 3OAZK 2XWBB 4Y19A 1ZVSB 4WCYL 5GRZA 2QHRH 1DQQB 1F42A 5GSRB 2DQGL 5E6IA 5CUSH 5D72L 1YMMB 1BAFH 5HGDA 3O3DA 1FP5A 1UJ3B 4K8RD 4QXUL 4YZFF 5I1EL 2IANE 1A9EA 1IVLA 2VOTA 1A2YA 1RIHH 2CKNA 3F62A 5EU6A 2C1OB 3QPXL 3NGBB 1FYTA 4NWUL 2WUCH 2VC2H 3KLDA 1S9WB 1IT9H 1DJSA 2XNAA 1J0HA 3PDOA 1T1ZA 4LSQH 5EC2B 4UBDD 3S88H 4Y8AA 4MJ5A 2MHAB 3OX8A 3QPQC 2I07B 1SJVA 3L3DA 3SE8H 3WS3A 3BFOA 4FFZH 4JFZL 4E5XB 3AUVA 3GMOA 3QEUA 3SE9H 3DMMD 5FIEA 4EI5C 3VFMA 1QKZL 1H3VA 4W4OC 1DBMH 3MYJA 3SDAA 2NW2A 1J0YA 3MRDA 1A14L 2R29L 3RDTA 3MNWB 4ZFOA 2J4WL 5C9JA 1EHAA 4DN3H 1INQB 2D7PA 1FZJA 1JCKA 1XGPA 5IBUB 1BD2E 1WZKA 1GGCL 2AJXH 1LDPH 1N8ZB 4PLJD 3PDGA 4BQ9A 3EO9H 4O2CB 5CJQL 5CCKH 1FDLH 4PY8I 4HIHB 4PRHA 2DQIL 4LASL 5T3XL 3SGEI 5IB2B 3RPIB 3RWJB 2BC4A 4NSKA 1UJ3C 4ZUUB 3B5GA 2G2RA 4LCCB 1AE6H 2ZCLH 4RAUA 2HVKA 2BNQD 4LRNH 5EOTA 4EN3B 2EXYC 2P8LB 5TDPA 5EZLB 4GUPB 2VMFA 4KRPB 4JM2C 3S36H 5E1AA 1GAFH 1TETH 43CAB 2BSRB 1A1MA 4RGNB 1S7RA 1U91B 4OLZH 2VZ3A 2UWEB 4NWTH 4OZGA 5JHLL 2Y7QA 3N9GL 1BF2A 1VADB 3A6CL 4LLDB 3UJTL 3IDJA 4YDJA 5K59E 4G9FB 5FYJH 4YEFA 1I7UA 1FLRL 1JMXA 1QSFD 3IDGB 1NEZB 3G08A 3BYYA 4JRXB 4GG6F 1EEUA 2VIRB 3X3GH 2CKBH 3UZEA 1I4FB 1NGPL 4J3TA 4Z7QF 5KOVC 5F7KC 4CBPA 5GZNC 3UO1L 4F58L 4NKMB 1D5MA 5C08E 1TJGH 1DLHB 4ODVL 5HHVH 1IAMA 2H2SD 3HRZB 1H3PL 2ZCHL 2ADGB 3MRMB 3VXUE 3GO1H 4ZO9A 2MKWA 1YJDH 2OP4L 5GGTA 2NY3D 4LVEA 4NYLB 3TJEL 3LIZH 5HDOA 3BVNA 4L4VD 5LGHH 2WIIB 1DVFA 4JZNA 4ZFGL 4FXLA 3ULUC 3FB8B 3BRFA 1QEWA 3DX9A 5JA8B 2HP4A 4LCCC 5ICYB 4GBXA 3BKYH 4XAWH 3T2PA 2NX5E 4BK4A 1PSKH 5E08L 1FJ1A 1R3KA 4FMFA 3KR3L 1YEIL 2VL5B 2ZNXA 4EEEA 4RGNC 1JPTH 5F1SA 1LNUA 2P45B 4ODHH 1T03L 2ESVB 5KSAD 1LE5A 4JKKA 5AWNH 4JZOA 4XP4L 2BHUA 3M1BA 4PJFF 3S8WA 4O9HH 1ZHNB 4MWFB 3ORJA 1B0WA 1SMAA 1BJMA 3BPOB 3GSNL 3L3JA 5FGCE 2ARWA 1JNHA 2X9XA 4JANB 1UWEH 4MMXC 1RZ8B 2AXFB 4ZS6C 2MCPL 3CUPB 1CG9A 3S35L 5E6ZA 2ATKB 5DFVD 3X3FH 3QEQE 5ABDE 1GCFA 1HHGA 3LY6A 4L3EE 3BJLA 2ZOLA 5JDSA 1CE1H 1P4LA 2E7CA 4YXKH 1P7QB 4QRPE 1FG2A 5JXAL 3QA3B 4ZFZB 5IVXB 1EFXD 5D1QA 3H9SB 1QBAA 3NH7H 2AJUL 1ETZA 1NC2D 1R5IA 5E2VL 3UAJD 1LVEA 2BRQA 1HHIA 3ALWA 5CD3A 1Q0XL 3BZFB 4OCSH 2VR4A 4P4RB 1S9XA 5BRZE 2EE9A 1DQMH 4KVNL 1HI6A 5F72S 4WGWB 3DVNB 3O6ML 2A6IA 3UYPA 4KK5C 4YWGL 4AIZB 4ELMA 5AUMA 5C2BH 4JFYA 5T3XE 5SWQB 1LE9A 1MH5A 3QHZH 3D3VB 4QXTA 4G6KH 2YD6A 3QXDA 4LVOC 2B0SH 2EDWA 5SX5H 1SYSA 5IBLC 1DSFH 1FIGL 1MVFA 1I9JH 3MRPA 4CNIA 2WIMA 2XTJE 3UJIH 1UB5A 5B3JF 1JYXA 2HT4D 3SJVE 4O2FB 3EJJX 3BPOC 3GMMB 4BUHA 4PRDA 3TVMA 3MA7B 2DQUH 3P4OB 5E94B 5T1LB 1OCWL 3TO2B 4R2GB 5F8QC 1TTGA 3VFTB 4GG6E 3BKMH 4JFHE 1QR1A 4ZXBC 3L5JA 3SKJH 4NRYB 2IQ9L 1I8IB 3OKOA 2ZSWA 2Q6WB 1SMOA 3CFEA 4WO4A 1F3JB 1J1XH 3W5NA 1CGXA 4JHWL 4KWUA 5FYKU 4XNZB 3ECBA 5A2FA 2G5BA 1WCQA 3QO1A 5IB1A 2NY5C 5LCVH 1BM3L 5GGSB 2V5TA 4JZJB 5JIKA 4XBPB 3AROA 3R0NA 1M7DB 4XZUB 5EBLB 4K94L 3TN0B 3ZDZF 2UY7A 1A8JH 1MFCL 1GC1C 4S1DC 2X10A 3C60B 5HI5C 1OGAA 5C3TA 3MLUL 2BVPB 2W91A 3IDNB 3PWLB 2IMMA 1MAJA 3F7YA 2XXCB 1NGWA 4OZFA 3QCTL 1S7XB 5BZWA 5DRXA 4YHIA 5EU5B 1U0QA 4RDQG 3VGGA 2YR3A 3I50H 3FB6B 4JQXA 3N50A 5BV7H 3ESVF 4DKAA 4LKCA 5DEGA 3LPGA 5D1ZC 3ZDYE 3WFDL 5HGAB 2Z31C 3UTOA 3RVXD 3ESUF 1KACB 1J0IA 5C0AE 3HLAB 2BVYA 5M94B 2PW1A 5L88L 2X40A 4R2GC 2R4RL 1F4WL 5J57B 3V0VA 4ETQB 2GT9B 3D25A 1MJJB 3IRZA 2VO5A 4MD5A 2DLTA 5JNYB 3JVGC 3VXOB 2C3VB 1BX2B 5FOJA 1YA5A 3V4VH 5LVEA 3VWJD 3Q5TA 5KVMC 5GGQH 1F02I 3QIWB 5D7IF 4QRTB 4GH7B 1F3DH 5IMKB 3N1MC 4LHQB 5T3ZL 4KY1H 5LAXA 3ARXA 2QSCH 4HWBA 3LKOB 1T1YB 3UTSD 2ED7A 2BRRH 4HQQH 3V8OA 1PQZA 1JHLH 4XNZC 2J3SA 3WS6A 2WBJA 4N0YH 4JZJC 1HQ4B 3MMEA 5ICXB 5I1HL 2R8SL 2DKMA 1MPAH 2BP3A 2DLFH 1CQYA 1CGWA 1AGDA 3ILQC 3C60C 1EHXA 3SCMA 1FYHB 1GZQB 3CK0H 3P3YA 3QUMB 3VFVB 1G7JB 3SDDD 5HYIA 2DI7A 5JO5B 1XGTA 3RJQB 3HZVA 1EXUB 2JIXD 3IB4A 1U3JA 3MLZL 3EUUA 4OKVB 5E95B 3MNVA 4NT6B 5DJ8A 3FZUC 3LN4B 2EZ0C 3RUGA 4DZBB 3DYMA 3IFNL 1E6JH 3OHXB 4KJQD 1MCOH 2EH8L 3KNBB 3LVEA 1NSNH 1QOKA 4PJXA 3H7BA 5FDYA 5SV4A 5BZDA 4HWZB 3WKNA 1LP9B 2HFGL 5KVEH 5E1HB 3FFCD 4JHAH 4JGMA 1LDSA 1EEYA 2DIJA 3OXRB 2VITA 2GIYA 32C2A 2EDFA 4PG9B 4KMQA 3EYOB 5HD8D 5DSCA 3VFSB 4QNPF 3ZTNH 1JF1B 5K9OB 5KVFL 3QIWC 5J9PB 1ND0B 3I9GL 2P4AB 3JTSA 1U8MB 1YPZA 2IADB 3MJ7A 5IESL 4S2SA 2V2XB 1FFNA 1WJ3A 1I9IH 3FQXB 5D7LA 4PRPE 4D0BA 1LMKA 1KC5H 3L3OA 3VRIB 3OG4B 2F8OA 4LEXH 3O4OB 2H6PB 2LU4A 4LEOB 1Q9KA 1ORSB 1UM6L 3RWDA 3TO4A 5DEFA 2XQYK 3B2UD 3BKCH 4R7DB 1MF2H 3QPQD 3ARRA 4UT7H 3BX7C 5ID0A 4XNYL 5CIPB 4Z5RA 2AK4A 4MJ6B 1A6WH 3TNNB 2VZTA 3DVFA 4EI5D 1LEIB 1DQLH 3O3BB 4Z7VB 5C0CD 2OSLB 3DUUB 4L5FH 1RI8A 2Y25A 4NNYA 3A67H 5D2NE 4AEIL 3SDXE 2P43B 1OAXH 2YC1A 2W9LA 3MROB 3G6DH 4NPYA 1KCRH 2DQFA 1BEYH 1NGYB 1U58A 3D39D 4JPVH 2IPKA 3B9KA 5ID1A 2P5WE 3CPLB 1ZLVH 3BEWA 4F7PA 1A6ZB 3V5DA 4WEBL 2YUWA 1R24A 2VUYA 4R4FH 1YMMD 5ESAA 3PHSA 1V3KA 4LLYA 3A6BH 4I2XB 3MRIB 5JUEH 4NO0A 5GS1B 4NQVA 2DMBA 2EDLA 5CS7A 1VGEH 2WZPD 3UX9B 1UXWB 3QWOB 4N8CL 3BP6A 4ISVA 3P4MB 2EXYD 5GS0H 5HSFA 2GTWB 1F6FB 1CDUA 3RVWD 3O4OC 4ZPVA 4Y2DB 4FOMA 2IEPA 5ICZB 2YUXA 3U0TA 3RTQD 5HHOE 1UADC 4XCYB 3TP4A 4PP1D 4YXHL 4Q2ZA 2NY2B 5T3ZE 3E1F1 2DQTH 4X6CA 5HGGS 3DSFH 4MXWL 1WAAE 1N7ML 3WFEH 1WEJH 2C5DC 2ZP0T 4JY4A 3MLTA 4JO3L 5L7XL 4FG6C 5KSBA 1JI1A 4E9LA 4XNQB 3TYGH 1T1XB 2V7NA 1JNNH 1IGCL 3F7VA 3BW9A 3FO1B 1IL1B 2RJMA 1MJ8L 4XH2B 5D5MB 3GI8H 5GSVB 3HG1E 1CXLA 5J7CC 3WUWB 2EE6A 7FABH 2YD7A 3T0XA 1M71A 1NJ9B 2LE9A 4HUVB 1OTUC 4JFOB 2E27H 4IRZH 5TH2A 3GMLB 5AEAA 2NY7H 3ULUD 5IW3A 4PB9H 4M4PA 4QF1A 1EO5A 1G6RH 1SJEA 1XGRB 2MQ0A 5GS1C 1X4ZA 4QY8B 1E4XI 2VTFA 3VA2C 2DAVA 4KK6D 4CU7A 2X9YA 2VLKE 4P5KA 1ZHBB 1T83A 5HYJE 4EN3D 2YD8A 1BIIA 1G9NH 4WEMB 1CBVL 2JCCF 2JF1A 4KRPD 3L3HB 2ATPA 1U92A 2X4UA 4HIEA 4AZ8A 2FR4B 4Y2DC 5CEZD 1MI5A 2X4SA 4RGND