2XI9A

Pilus-presented adhesin, spy0125 (cpa), p1 form
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
313
structure length
304
Chain Sequence
TSVLIRKYAIGDYSKLLEGATLQLTRVFSSNDIGERIELSDGTYTLTELNSPAGYSIAEPITFKVEAGKVYTIIDGKQIENPNKEIVEPYSVEAYNDFEEFSVLTTQNYAKFYYAKNKNGSSQVVYCFNADLKSPPDSEDGGKTMTPDFTTGEVKYTHIAGRDLFKYTVKPRDTDPDTFLKHIKKVIEKGYREKGQAIEYSGLTETQLRAATQLAIYYFTDSAELDKDKLKDYHGFGDMNDSTLAVAKILVEYAQDSNPPQLTDLDFFIPNNNKYQSLIGTQWHPEDLVDIIRMEDKKEVIPVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Highly Unusual Thioester Bond in a Pilus Adhesin is Required for Efficient Host Cell Interaction
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Cell adhesion
molecule keywords ANCILLARY PROTEIN 1
total genus 90
structure length 304
sequence length 313
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08341 TED Thioester domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.480 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2xi9A03
2.30.30.670 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2xi9A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xi9A01
4K3HA 3DVNB 4NOBA 1JRHI 1HE7A 4JKWA 4DVBA 2DBLL 1A1OA 1QA9A 3W39B 1HHKA 3ZDYE 2CSPA 1V7MH 4YNYA 4I18B 3UJTH 2CIKA 2ZOKA 3TPKA 2ICWB 2GIYA 4HK3N 3ARGC 5E6ID 3RKDC 3MACH 2IEPA 4HZLB 4QT5A 1FFQA 1QRNB 4UDUB 2AGJL 1GGCL 1UXSA 5IHUH 3U7AA 1TZHA 3HCVB 3OWEA 4MNHA 1QHPA 2F19L 1IAOA 3NCFB 5DWUH 2JJUA 3BOVA 3RWGA 3QEQA 3AU1B 1LK2B 5ANMB 1UKQA 4LEOA 4EJ1C 3VXRE 3VRJB 3OG6B 1SYVB 1ZANL 1KBGL 3NZ8B 4NP4H 4NO2A 5DHVB 4BKLB 1FVDB 5JPNB 5GHWH 1UKTA 2HJKB 4XVUC 4NNXB 2XNAB 3IJSA 3N1FC 1EGJL 5C07D 5I8KL 3DUSB 5BV7C 4R96B 5D5MA 4IRSB 5GRXG 3HNSH 2EIZB 2VL4A 1N0LA 4O4YL 4MS8D 4KMTH 4QXUL 5HHVH 2DWEA 1AP2A 2EEBA 4UOJA 5F88B 1M05A 3HC3H 4YHYC 3V5HB 2EDKA 4CU8A 2ARWA 2IAMC 3UTSE 4L3EA 4QNPE 4XGZA 5GSVA 4JRYD 1CF8L 2ADJB 1HWGB 1RFDH 1FNGA 1MJJB 4TYUA 3IETB 1ODAA 3CIQA 1FVCB 3DSNA 4JFDE 4CADA 2NY3B 1IMHC 3OKDB 5D6DA 1Q0YH 4G43B 4XCFL 4ZTOH 1HSAA 3HLAA 2PYFB 2LTQC 4YDJB 4JANA 1B88A 2VXTH 4WW2C 4MAYC 5FOBB 3D2UD 1OARL 1AD0A 5F3HB 1UQSB 2GY5A 5HDOA 2Q3ZA 1NH6A 3STLB 5TQ2H 2WBJB 5HDQL 1MHCB 1AGFA 3DX6A 2OI9C 3CK0L 4GAYB 5I1KL 1D5IL 5GS1C 2QSQA 4X9GA 4EN3A 3UTSD 2PTTB 3ILPB 4ODWB 2EYTA 2X4RB 4W6YB 2NW3B 1XF4A 3FZUC 1OGTB 5DK2B 4C56A 5EC2A 5HDQH 4ISVA 4KRPB 4AEEA 1BREA 1U6AH 5DJXB 1R24A 5E1HB 2IFGA 2FIRT 5I1AA 4QRQB 1CVRA 2XZZA 3OR7A 4FQIH 3QWOB 3OGCB 3CVHL 3MRNB 3PQYB 5LBSH 2HRPH 3U9PL 5HDBE 1EFXB 3BAEH 4NO5B 5FM4A 1ZTXL 3MV8E 5E00A 2OZ4A 1INQA 4HIHA 1IKFL 3T0EC 4X7CC 3VFPB 1TJGL 3KPLB 5E56A 2DQHL 4KK8D 1JHTA 4QCIB 5FA4B 3O8XB 1NJ9B 2J8UF 5TGBA 4BQ9A 1PLGL 3LB6C 3GI9L 4MHHI 2R1WA 4D2NA 3BIKB 4TSBH 3GMNA 3C8KA 3IGAA 3BVNB 1HXYA 4QXUH 1RUKL 5T3ZE 2VMFA 4GW5B 3CMGA 4X98B 3D25A 4JZJB 1B3JA 2DM3A 3GMQB 4Y8DC 2QKIA 1R24B 3ILQD 3VFOB 1MRFL 2FBJL 3V4VL 3IFLH 4PYGA 4L3CB 2G5BB 3DTXB 3QNXB 4UBDD 5CEXA 2P8MB 4MA7H 2V17H 4M93B 3ZKMC 4L4VA 1GZQA 1G7HB 2YZ1A 1ULVA 3FOLA 1YEIL 5EU5B 3KPPA 5JOFB 4XB7A 4CJ0A 3IU4H 1KIUA 2Y7QA 4ZPVB 4CMHB 2YPLD 2Q6WB 3I85A 5GGVH 1DQDL 3VXQB 4FFZH 4HJGA 5DUBA 35C8L 3U79A 3LB6D 2VLRB 3IB4A 2ADIB 1XGPB 2BHUA 5T5NF 4EN3D 1IGCH 2AABH 1KPVA 4PJ8C 3W0WA 4NQXA 4PJAA 3RWEA 3T3PF 3MFFB 3U1SL 4YBQC 4G7YH 4OGYL 1G9NL 1HSBB 1NMBL 1IFHH 4KI1A 3NN8A 3VWJA 5MEOB 1QRNE 2EYSA 4JRYA 4CNIA 1I8IB 5JW5A 5T3ZL 2ZP0T 2BVQA 4V1DA 2VXQH 4WNQA 3F5WA 4YHMH 3EJZD 5E2TH 2WBJD 2YKLH 5BS0E 3OJDB 3WSQH 2OBGA 3HMWH 4G6JH 1X4ZA 1Z9LA 3GK8L 3T65A 4G9FE 5C0NC 4WGVB 1OPGH 4U1KB 1MVUA 5EOTB 5B21A 3ARRA 5FM8A 3IDIA 1OGAA 3O3AB 2J5LC 3FN0L 3CD4A 3M17A 4JRYB 3PP4L 1I8IA 5JW5B 5E1AB 3SJVB 3QHZL 1N5YH 1M71A 3BRGC 3K1KC 3QO0A 5IVXE 5CJ8A 4V1DB 1FFRA 5FYJD 5DMYA 2EEAA 5FDWA 4KPHH 4I48A 5C0EA 2Z4QA 5IVNA 5KVEL 3N50A 5ESVA 3VXMD 4NHCL 3NA9H 4YDIL 1BJ1H 2BHYA 1YY8A 2Z0BA 3T65B 4XNQA 1NCBH 4U0RC 4JPIB 2PUQT 2ED9A 4TULH 1DDHA 2X44D 1DQJA 3MLZH 4QHMA 2FZ3A 4D9LH 4YHNB 5EOCL 3LD8B 25C8H 5F3BA 3W5NA 4OLWH 4JN1L 3QEGL 3STBA 2O5YL 3O4OB 1F13A 2WUBH 3GMLA 3VA2C 3BD4A 1OSPL 5TDOB 2ZG3A 3GMMA 4MA1B 5JORA 4QOKE 5KSVA 1SYVA 5I16A 5ICYB 3F58L 2XY2A 4PGDA 5SWZB 3NOIA 4ZTPH 4DK6A 4J6RL 3T1FB 1HH6B 3HI6H 4J1UA 2IQ9L 3B4NA 4JFPB 4M4RA 4YIQB 3SY0A 1SEQH 2R69H 1YQVL 3RJQB 4OGXH 3NIFF 3VJ6B 3QRGH 3ARGD 3A0OA 1KULA 1SBSL 3UC0H 3FJTA 4XCCL 2EDYA 1I8LC 3QI9D 3SDDC 4MCZB 5I9QC 3P0YH 3HC4L 1SQ2N 3X3GL 3CC5A 5I1CL 1RUQH 3QFJD 1Q9KA 1R5WA 3PGDB 5TQ0H 4XPFH 5HYQA 3DROB 1WAAF 3PDGA 1DUZA 1QUNA 5JZ7D 1KB9J 2DM7A 1JF1B 4K55A 4KFZC 3CMOH 5GS0D 3NAAL 3BN9D 4PYHA 5F6IB 3QZWB 5D1QB 4L9LC 4YIQA 1P7QD 5FCSH 5DMKB 3MRRA 1RURH 2GCYB 4KK5D 5DQ9A 3CZJA 2PTTA 3ILPA 2XI9A 1OGTA 1AI1H 3OR6B 2YK1L 3G5VB 4WWKC 1D5BB 4Z7OF 5EIIB 1UGNA 3O6ML 4MCZA 4DOHB 4OCXH 1EJOH 5DFWH 3RHWF 2DLHA 4RGOL 2EXYD 4OF7A 3V52H 1I1FB 3RDTD 5MEND 4JZNB 1PZ5B 1H3WM 1I9JH 5EUOA 5LVEA 1TVBA 5TPWH 2SEBB 1FYTE 5IFAL 1OB1B 1CGSH 3D69B 3RWJA 2CPCA 4FTVB 4Y1AB 4QTIH 1K3ZA 2D7PA 5FGBC 1B9ZA 5JLZA 4M1GL 2H26A 3CDFA 4UAOB 1Z5LA 5HGBB 4CJ1A 4LF3B 4C4KT 5CJXA 1YQ2A 3JVGC 1J5OL 4UI2A 1CICD 3MBED 4KK5C 3MV7B 2PF6A 3TCXA 4MJ6B 4XMPL 5E9DA 1T2QH 5HI4D 4O2CB 1CU4H 1IC5L 1I7TA 3VI3E 5HYJD 3FZUD 1FL3A 4QO1A 1U8IA 4TUOA 4UIMB 1MSPA 5DJDA 5I6XC 2LVCA 4N0YL 3ARDA 4IM8A 4LLUA 4HFUL 4U1MB 2D03L 3ESVF 4PV9B 4U1HA 1XGUA 4G8EB 1RULL 1QQDA 3NMEA 2DTMH 4XPTL 2GITB 5JOFA 1PKQA 3EGSB 3HUJA 3S3PA 3VXRD 3TT3L 2NW2B 1A7NH 1V3JA 2XQYK 2QBWA 4NKDB 5DK0A 1UACH 5KOMC 3OAZH 4ONGH 3TO4A 5IB3A 3QIUB 3HTLX 1XZ0B 2PXYD 2R4SH 3OB0K 4N1CA 4NC0B 4XC3L 4UT7L 1CD1B 1CICC 3B9DA 5D7SL 1KPVB 2CIKB 5IVZA 4PG9A 1MCHA 4TNWK 4HXBL 5J6GA 1CYGA 1DBKH 2A9ML 1LK2A 5ANMA 4XVSH 5JW4M 2HVJA 4JZOB 1W0WA 4G6KL 2Y06H 4ODBD 1G9ML 4LVHB 4C0ZA 1IGFL 3QUMB 1IKNC 1PQZB 4JFXA 2NXYD 5FHAH 3DUSA 2FD6L 3QUYD 3QEQB 4OBSA 3S4SB 2CD0A 1VESA 1F02I 4NWUH 5JR1L 1B90A 1H5BC 5E2UL 3B9AA 1QFWH 1JL8A 4G3YH 1A02N 2P5WE 3NPSB 4RWHA 5ESAA 1Z3GL 3MRQA 2QHRH 3UTZA 3V0VB 4EDXB 1C5CH 1CTNA 4ALAL 4JVUA 3X11B 4KKLC 3VD5A 3BP5A 4XC1L 2MPAH 4OTXL 1A9BA 3NCCB 3EOBA 2HFFA 3BZFA 4U1JA 3QPXL 2Z8VC 4P4KD 1ED3A 3HE7D 3BHBA 4YDLC 5J1TC 3QHFL 4PLJC 3PWLA 5GPRA 4NM8L 1UQSA 1AFVL 4PTUA 3B9KB 2C1PB 1FIEA 4NQSB 5HYSG 4X6BA 1UEYA 3L3KB 2VNCA 3ZL4H 3QIWA 4AIZA 4YZFF 1S9YA 1A22B 3OKDA 2EDNA 3AFLA 3D3VD 5E8EA 1ZVSB 5ESAB 1RJYA 2WINA 1CK0H 5C0AB 1SM3L 3IVKB 3X11A 2E6JA 4OIIH 5FF6A 1VENA 5FYKL 5BMFH 4P9MH 3VRLF 4HWBA 3N1GC 4P59H 5HHXL 5HGDA 1F4AA 3F7VA 1A2YB 1QSEB 4HXAH 2FZ3B 3GBMH 3N9GL 4XP1H 3K0WA 1E4WH 5IMLA 3VW3H 3MMEA 4PY7A 3QPXH 3DSFL 5KVMC 2X4UA 3VXPA 4ZUVA 4M43H 3EYQD 5ALCH 3GSQB 4MDIB 1JYWA 2YPVL 4PTUB 3QUKB 4X6BB 4EOWL 2NZIA 1RZJL 5ETUA 1HQ4A 1T5WA 3S36H 2ITCB 4BH8A 3LQAH 4UIKL 4JFOA 3C2SA 1JZ7A 2WM0A 1N64L 4P2QB 1QFWL 3S88L 3IGAB 1KB5H 3HC0A 1ADQL 2B2XH 3CFBA 1F2QA 4NO5A 4Q9CA 5C0DB 2JELH 2JE8A 4UILL 3CFJB 4RNRB 3GSOA 4YHZH 1UA6H 5EFIA 4ZXBC 3MMEB 4OAWB 4F7TA 2BFVL 3KDMB 5FGCE 3G5XA 5F72S 3W9EA 1KUMA 3GMNB 3SDAA 1NLDL 1MI5D 4LCIL 2QADC 1OTUC 2R56H 1HQRB 1MLBB 1GPOH 1DBKL 1RJLB 3H42H 3IKCA 1JI1A 3OKLA 1ES0A 5CUSH 1X4YA 1A6TB 1I7UA 4MA8L 2Q6WA 3FT2A 3M45A 1UJ3A 3V6ZB 3D39B 3S34H 1X5GA 4LKXB 4HJGB 1RZGA 3ARPA 3JWDC 1YEGL 4Z8FL 1KIPA 2QSTA 5IW6B 2HJLB 3ZSTA 1UWXH 3CFKB 4WW2B 4P2OB 1DQLH 3K4AA 5AYUL 1BQLL 3MNZB 5C8JA 5GXBB 4WWKD 4GMTL 1D5XB 2YMXL 4NQXB 4PJAB 4QOKD 3RWEB 5I17B 4M7KH 1OWWA 5EU7C 3ULVL 4GSDH 1EHLH 3BPLB 3OSKA 4P5TD 2R2EB 4WFEE 3RDTC 3Q2CA 3RVVC 3O6FD 1XGPA 4XNZB 4KJPC 1NDMB 5C0RH 4ZDHB 3N85L 5FXCH 4C59B 5FYLD 1CS6A 4OD2A 5LG1A 4LKXA 2BMKA 1JIBA 5D7IB 3V4UL 3QDMA 1W0YT 1RIVL 3ETBF 4WY7H 4FTVA 4Y1AA 3NPSC 5C6WH 4L8CA 2HFGH 3MA7A 5DF0A 1DQQB 3E8UH 7FABH 5L0QC 1H0DA 1QSFE 2IH3A 4KK9C 4F7PB 3MRCA 3OHXB 1CI5A 3I6GA 1KTRL 1KV3A 3LEXB 3MBEC 4HMDA 5EO0B 2Q8AL 2VERN 1FO0A 3RWCA 3W9DA 4JY6B 5KBNC 5GQBA 4F7CB 1LE5A 3MV7A 1YNTA 4ZSOA 4UT6L 2Q8BH 3S36X 1I9JL 5T5FL 1NFDB 3BIAX 2DLGA 5F21B 5CGMA 5TE6L 1WWWX 2VXSL 5I19L 4F58H 5IT2H 1RY7B 4FZEH 4GKSB 4RRPG 3QJFB 1R3JA 3OZ9L 1G9NC 4P5TC 3O9WD 2V2TA 4OCXL 4P46A 2ZUYA 4QRRB 3INUL 5GRVL 3ULVC 2AXGA 1UG9A 3WFZA 5DGQA 1JZ8A 2UWEE 1YC8A 1PKQB 3BIBX 3LPFA 1LWRA 1S9XB 4NNPL 4PJBA 4Y5YB 4NOFA 3VWKB 3RWCB 3W9DB 4XP5L 4RWYH 3BT2H 3EOAA 4U3CA 1N0XH 5IBTH 3HAEA 5KSBF 4G6AC 5C0EB 4FP8L 3UEZA 1NCDH 2AAVA 1EO5A 2V7NA 3ZE1F 1BVLB 1U3ZA 3GKZA 1A3RL 4PRAA 1U3YA 3FO2A 5IIEA 4R4FH 4YO0B 1BIIA 1F00I 3MPCA 4NBZB 1REIA 5D2NB 4OLYL 4YHKH 3Q6GL 4HWZA 4L5FH 5D7JA 1WZ1L 4PLKC 4H20L 3QWQB 3QUYC 2FX7L 2R1YA 4DEPC 4X7DC 4E0RB 2HRLA 4M1CD 2CRIA 1K6QL 2BVOA 3D85D 2LAAA 2OXGA 2GJZB 3VFRB 4A2LA 1UB6B 4LRNL 1PG7W 3GUTB 5KSAB 3KJ4B 1OGAE 1NLBL 4LCWA 4PJEA 1G7QB 3SGDH 1K3IA 5H35A 4YO0A 1TZIB 3P3YA 4WTXA 5GIRA 4QRPE 1NAKH 4KWUA 2HN7A 4LIQE 4S1SH 1ZHNB 2MHAA 4OZIE 3NZ8A 4P4KC 4L5FL 3LKQA 3BZFB 2DQIL 3CH1B 1ED3B 4LSPH 5EOQH 2A6KB 3F65A 3T0EE 3LHPL 3K2MC 4WTZG 4D9LL 5KSUB 1T20B 2GAZA 2X4NB 3Q0HA 5KANI 4DOHE 4L4TA 4BSVA 3BZ4A 5GGQH 1UH2A 4PP2A 4X83A 4Q9RH 1F4YL 3DUHA 4KJWC 1MRDL 1T1XA 5MENE 1I9RL 2OR9L 5JDSA 3LY6A 4XMKH 3LS5L 3KPRA 5FYLL 4S0SD 5IBTL 1AHWB 2NXYC 4XP5H 3SGEH 3DROA 2PO6C 5DHVH 3G5VA 5I18L 3ZT6A 3T4AA 2V9TA 3GIZL 1BEYH 2P49B 1I7ZB 1N6UA 4GQ9L 4YDVB 5JXED 3LQMA 3CVIL 3P4LA 3KS0J 3HLAB 5ITFB 3LQZA 1H9VA 5DDHB 4F3FB 4TUKL 3UP1A 2VLLA 4D0DA 4MXVE 2JKXA 1ETZB 4BSVB 5FGSA 5DLML 1OT1A 4FQHA 3ARFC 4EQ2A 1WUNT 2Z93A 5CGTA 1LEIA 4FQJH 4BFIA 4HUUA 4POUB 2EYTB 3UYRL 3HMWL 3IF1B 2WQ8A 2D7OA 3L5IA 1D3CA 2CK0H 3ZZ1A 1Z6JT 5FO7B 4JY5H 7FABL 2F54D 1CLYL 3D69A 5HPMB 1HYSC 3W82A 2PO6D 1U0QA 5T3ZH 4YHIB 1I9RH 2P5EE 3GMRB 3V4UH 1NAMB 4CGTA 4ZOEA 4K3DL 4NRZA 1U8JB 3FCTA 4U1MA 1NMBH 1QPXA 2K7PA 5EZJA 2VAAA 4ZAKC 2YRZA 1IC1A 4CN1A 4PJ5A 1EHLL 1VPOL 4YK4C 2YC1B 1EMTL 1FGVL 3MLUL 2VSCA 3FT2B 4HCRH 4KI5F 4XPHL 3ARFD 2VDKH 5CLTA 4LSVH 4LU5L 1BQLH 3HR6A 4JZJA 1TCRA 4PJ7B 4YHLL 5I30H 1BJ1J 3V0WH 3KYNA 3KPSA 3IU4L 3MV9B 4N1HB 4M5YL 1A0QL 3BGFB 2A77L 5H8DA 4LIQH 4UOW1 4JQVA 5AYQA 4X7EC 3LMJH 4TVPE 2FLRT 1BZ9A 1OQXA 2VXVL 5BV7L 4M7JH 3ULVE 3RVVD 3P9LA 4MA7L 3CUPA 4IJ3B 2OYPA 2MCPH 4ZUSB 2BVEA 5F70A 3GSRB 5DQJB 1Q1JL 3TM6A 5J1AB 4HT1H 1UM4L 4QRSA 4N8CH 5DJ6B 4PB0L 2H8PA 2QQLH 5DC4B 1YMMB 1XR8A 4R90H 4NZUH 4KXZI 3C5JA 4AQOA 4OCWH 4L4TD 3TLRA 1QYGH 5D96B 3ME0A 1WCBB 4FABL 4EXPX 3WE6A 4R26L 5CD3A 2ICWA 1VEPA 1SYSB 4LLMB 4UIKH 5IJKA 3TA3C 4RGNE 1KTLB 2Z35B 5DURD 4F7CA 1LE5B 4EUPB 3WMSA 2NY2C 2DD8H 4RISH 4ZSOB 4HS6A 2EYSB 2FATH 3EFDL 4ZUSA 4Z7QF 3INUH 4OV5B 4JKMA 2BVPA 2OMBA 5J1AA 2O61A 3S9DB 5BRZA 5D1XD 1XGTB 1PYWA 2E7CA 2VXSH 1GRWA 3R06A 4GRLA 5B22A 3TWCL 3QIWB 5DC0A 1JRHH 4GW4B 3TBWB 3DX9B 3KPTA 3PE9A 1BFOB 2IPUK 5E5MA 4MQ7A 2I27N 5F6IC 3WE6B 2Q8AH 1SM3H 4Y5VB 4ONOA 5TF1L 5IJVB 3U30B 2MJWA 3MRPA 4KMQA 4BZ1H 2JJSC 5AUMA 4WV1C 5D7JD 4XRCA 3ARTA 1U3JA 3S97C 5IMLB 5EU6A 3G5ZB 5JPMA 2Y9RT 4OFVA 4KAQL 2CDGB 1QR4A 1MQ8A 4G7VH 1RUPL 4Y0GA 4RMWA 5KZCB 3UDWA 4G8GA 2NY2D 5T3ZD 1UB5A 4PRDB 1QBMH 5C6TH 1WV7T 1YN6B 4ZPTB 2E7MA 4HWZB 1UCTA 3QULB 3TNNB 3TIEA 5E8NA 3DX9A 4GSDL 1NMCB 5ID1A 1LP9A 5CEZD 1CGVA 3O9WC 1G6RL 4JANB 2NTFA 2R1YB 2IGFH 4HK0A 4LQFH 1YEDA 3RZCA 3ULVD 4KJYA 1I3GH 3UCRA 4MSWA 5CEZL 1JWMA 4MB4A 1BZ7B 3FQNA 1X5XA 3MLRH 2R0KL 2IH1A 2O93L 3QQ4B 3EYOA 3ES6A 2VABB 4Z95L 3T0ED 1YNLH 4PJEF 4F7TB 3G5XB 3W9EB 5L2JB 1NL0L 5FYJL 3ARDC 1TZIA 4IRJA 4JFEA 5EOCJ 1CZ8L 1G7IB 3ARYA 3SKNB 3REVB 2ZNXA 3GJFH 4TUJA 1I75A 3IAQA 3GIVA 4PB9L 4XCEA 2AXHA 1FE8H 3K8MA 4X6DF 3S37L 1FQ9C 1M1SA 5F9WC 2R56L 5SWZE 2C4FT 3SDXB 4DVRL 5IOPA 4JPVH 3RNQA 3S5LA 1RZGB 3HKFA 2KUTA 4XC3H 3BD3A 4U1SA 1WGOA 2VAJA 2LFGA 4K7FA 4OV6F 4U1GC 5H2BB 4ONGL 4N5ED 5K9KA 1MAJA 2Y07L 1CFQB 1CFVL 2E3VA 3BUTA 4M6NH 5J06A 4YUEH 2VABA 5GGUB 3LH2H 3NGBB 4M1CC 2B2XL 3UTTA 2DBLH 5L2JA 2DQEL 5D70L 4IRJB 4JFEB 4OZFG 2VDNL 1FLTX 3REVA 3BSZH 1R3LA 3FT4B 1YEHL 3HG1D 3RA7L 2DWDB 3PV6A 1R5WB 1QSFB 3CU1A 4LSTL 5HXMA 4NSKA 5C0CA 5CLWA 1J7VR 2FO4A 5DRWA 3ROLB 4QLRA 3OAUL 3BP6B 1IAIH 1G7LA 1I4FA 5DJCA 2V9QA 4G6ML 2EKSA 1DQQA 1ACYL 5DMKA 3LZFL 3KJ6L 4NN6B 4YXKH 3KYOA 4RMRA 2V2WB 4BELD 1RUAH 5ISZE 1CGYA 3QUZC 1NDMA 1XGYL 5MERA 3DX8B 4KHTH 1BD2B 4DJMA 1QZ1A 4ZUUA 5DR5L 4UTAL 3WO3B 4Y2OA 4JREC 2N4IA 3FB7A 3QDME 3QFDA 5TF1H 2ZCHL 2VQTA 5DEFB 4A6YH 4XWOD 2P45B 5IMMB 5J6HB 3P11L 5B38A 4WEBH 4ZAKD 4LK4A 1HI6B 4CL7A 3TESA 5EZJB 3K4ZA 2EE6A 4OCNC 5M94B 4N68A 4LLVA 3IDGB 2NX5A 2NXZB 1R0AL 5D7LB 3RPIB 1A5FH 4PJBF 3DJ9A 2FATL 3ZE0E 3HE7C 2CKBA 4JFYA 4LAJH 4ONHB 4TPRL 3EOAB 2F58L 4PRHD 3V5DA 1MFAH 1N59A 3SGKC 2V7NB 1QP1A 1QA9B 3HI1B 2XZAH 2ZUTA 3U9UB 4P23A 5DMGC 1IC7H 3IDMB 3MOQA 4ZUWB 2OJEB 2OMNA 3ARDB 1I1RA 2AXFA 2COQA 3LEVL 3MNVA 4I18C 3UBXG 1G7MB 2EH8H 5GSRB 5F1OB 4L3ED 1OGAB 4MD4B 4IDJL 2NX5B 1JPTH 4KTDH 3MTRA 1UXWA 3P0YL 4J8RB 3SOBL 1X7QA 2J8HA 4X9HA 4XVSL 3V6FA 4E5XB 3SPVA 3JTTB 2H8PB 4U1LB 4WEMB 1KEGH 2ADGB 1YEFH 3GHBL 3CGTA 3BN9C 3D18A 4UV4H 5AZ2H 1FSKB 5KAQG 5LWYH 4LL9A 2CKBL 5JOPE 3MODL 5IVZB 4NNXA 4Z0XB 4LPWA 3LN4B 3L1OL 2Q7YB 1F8TH 4ETQB 3HI6L 3T2NH 4GBXB 3QIWD 4JO2L 4TSAH 4I3SL 4WV1A 3GB7A 3MLWL 3V2AR 5DMJB 5I30L 5EIVA 5E8PB 1G7MA 1ROWA 1PD6A 5F9OH 2ATPB 5E0QA 2GJZA 4XPHH 1JNLL 3LKOB 5J1SC 3V0AC 4G9FB 2O5YH 3QEGH 3PWNB 2BY0A 4QYOA 5T3XL 4F15B 5DJZA 3O2DL 1OTUD 1GGBH 5AG9A 4YXLL 4YC2B 2PYFA 4G9FD 4LPTA 3MRQB 3U7YL 3PGFL 4C54A 4NHUA 4G8GD 4XTRD 5E6ZA 1AXSA 2NXYB 3QXDA 2OK0H 2GT9B 1ZLWK 1IL1B 4NQCD 5EUKA 5JZ7C 4X0KA 3HA0A 1UH4A 3VI4E 1T1XB 2VDRL 3C08L 4XVUD 3TNMA 3L3JB 4HG4K 5DHYA 3QIWC 4X80H 4ELMB 4LPXA 5DDHA 3IYLW 2FEEL 4OZ4A 5BW7C 4X6EA 3TPUB 4JG0L 3MLVL 3LRHA 3T4AB 5DQDL 3T0DA 1N8ZB 2PXYB 3DYOA 2D7MA 4RGOH 5DD6B 5EO1A 2Z8RA 4FG6C 5J57B 3KLAB 4CMMA 3FQTA 2HFTA 1U8MA 3D3VE 3RUGE 1AXTL 1EJOL 1FPTH 1QFPA 3RAJL 3O6FC 1EEZA 5KW9L 2VLJE 4X7SL 3TO4D 1YEEH 4LSSL 4EDWL 3O6LH 3TBVA 1YEDB 3TIDB 5IJKC 5H94B 2DLTA 1U91A 1AJ7H 3QDJB 1FL5B 1AGBB 1KEMH 4QXWA 1NC4D 4XTRC 5DSCA 5EU3A 3ARDD 5IB1A 3W5MA 4Q9QL 2I9LA 3QUMH 1HHGA 4NQVA 4RGMC 5EZOL 1A1NA 5GGQL 1KC5H 4RDQF 3VGDA 1BD2E 5DUML 4JCLA 4HGMA 5L8KB 3AY4A 1BWWA 4ZFGL 3B2VH 4PRBB 3BO8A 5C0BE 4LLQB 4HKZB 3BJ91 2BC4A 2GSGA 4L4VB 5D2LB 3PL6A 1KCVH 3CH8A 3NCJH 1NKRA 3RWJB 3FOLB 2DN7A 3GO1H 3T0WA 3WIHL 5EU3B 3QFJE 5CFHA 3B2UD 2AQ3A 4Y2DB 1K8IA 4XX1G 3X14A 5DVNA 1FJ1A 2ESVB 5GRWA 1JWUB 3L5XH 4P57A 1ERNA 1AKJA 3EFFA 4GW1A 2QLVB 1W72A 4Y19D 1A6TA 1DBAH 3OPZH 5I6XB 3HRZB 5T1DH 1U8QA 5IQ9B 1GZPB 4RZCB 4WCYL 4HKZA 4RGNB 3AREC 3B9EA 3IFLL 1I4FB 1KCUL 4PJDF 1E6OH 3MJ7B 1MELA 3VD9A 5EOCH 3NCBB 2DIBA 1RSFA 4BFBD 1VDGA 3WHXB 2FR4B 1A3RH 3S35X 2XRAH 4MD0A 4XZUB 2CGRH 4JFQB 1NCBL 4CDHA 5FO9B 4EKXA 4LSUH 3NIGE 2WBKA 4KRNA 4Y4FA 5DMIL 1SBBA 2AJZB 4E41D 5JHDA 1JZ5A 3KPSE 5EU4B 4E9LA 5IQ7L 4PTTA 3B2UC 2WIIB 4IOFC 2DBJA 4MJIB 3LRSB 3QNZB 1AO7B 1GSMA 2IBGA 3MRFB 5F1IA 4N90D 4MZ2A 4OF0A 1DFBH 4JPWL 4HWEH 4LSQH 4PG9B 2DTSA 4ONFL 3O45B 4XBEH 2JIXD 1MVUB 4PRHE 3CVHH 4ODUA 4UINH 5EOTA 1RAMA 4JZOA 1HXMA 4E42A 1Q9WB 2Q3AA 5L2KE 2BJMH 3NFPB 4U4BA 3SJVE 5D7IE 4LLVB 1CIUA 5J4MA 3U36B 4PS4H 1KJ3L 4OF5A 1CXFA 3DMMA 4OCMC 4N8VA 5KSAD 1NBVH 1OPGL 1S9WB 3HUJF 1U8PB 3RQ3A 1PGRB 5L2KA 2B7DT 5IEHB 3D85B 5JHDB 3RFZC 5JNYA 4LSDA 1ZT1B 5IVOA 4O2EB 4HBCL 1T7VA 2FEEI 2YKLL 5C09E 1FORH 1FV1A 2AV1A 2XG5A 3IFNL 5FA3B 3UPRB 1YA5A 1XCQB 1NFDE 3RBSA 2VXTL 4YE4H 5LAXA 5C0FB 4IOFD 4P2QE 1U9KA 2N56A 3GSUA 3S4SG 1YJDC 3TIEB 3L3OA 1IT9L 2CDEA 4OLZL 3QXAB 4EI5A 5C0RL 2VKWA 5EU6B 3Q3GA 3U1SH 3VMPA 2EDOA 3H3PH 3SQBA 5SV3A 1ZSDA 3VXMB 2IPTH 3BN3B 4RMUA 5HHVL 4XPGH 2X4SB 2BSED 3F12A 4GXUM 2X1XR 2GUOA 2AV7A 1QFOA 3FO2B 5FA3A 1NCWH 1U8NB 4FFYL 3TBYB 1CDUA 1B0RB 3UTQB 5EUOF 1UZ6E 1NEUA 5HYFA 2DQFB 3VD3A 1JGUL 1WWBX 4E41A 5K9QG 1UZ6F 4XXCC 2EO1A 2XT1B 2ATPA 3MYJB 1S5HB 5D7JB 3S34L 4W81A 4M7LT 3SE9H 3WDHA 1EV2E 2CDEB 5DMGD 3V6BR 1AC6A 1AH1A 5IGXH 3T09A 1VFBA 4JDZA 5FUOL 3GSNA 4LPCA 3GMPB 2QTEA 3AS1A 3KYMA 5IKCB 4ZNEE 4CKVX 4PJAE 3VRJA 3VFRA 1OGAD 3SCMB 2DF3A 5JPNA 1D9KA 5DJAA 1PEZA 2E27L 5DJ2B 2BVYA 4HH9A 3ZSSA 5IM7A 5LGHL 1KIRB 4PJXB 4HZAA 1R3LB 3ARZA 3RU8H 4K7FB 5AD0B 5HDBF 1S5HA 3ZE0F 3GBNL 4MJ4A 4JGJA 4WEUD 5EU6D 4P2RB 3ZLQC 5EFIB 3LQAL 3O6FB 4HPYL 3TYGH 2X4NA 4L4TB 4Q0XH 5DJCB 3GMPA 1LNUA 1TQBC 5LBSL 5F44A 1I9EA 3U30C 2RFXB 4CVUA 5ALCL 2AW2A 3VH8G 5D1ZC 3SCMA 2J8UB 1TJIL 5KVGH 1E4WL 1P7HL 1LILA 4Z78B 3HMXA 5DJ2A 4WWKA 5H94A 4L9LB 4OKVA 4FQQA 3UJJH 4BFEA 5CAYB 4OCYH 2AJSL 2PR4H 4PP1D 3UXFA 4U1NA 5DEFA 3WXVH 4JR9L 3EO1A 4G42A 1UC6A 3UBXA 2A74A 2NY5H 2X4PA 5EULV 2QR0B 4YR6B 2GTZA 3FRUB 4FFYH 2H9GB 1EHXA 2KH2B 2FECI 3WNKA 4BQBA 4W6XB 2G9HA 3QHFH 5I1AB 3BW9A 5C0AE 4XCYB 1U8IB 5DVKA 5FM5M 1UH3A 3MCLL 4KXZH 2Y5TB 3KYAA 3VRIA 4NQEE 4K71B 2DQCL 4YHPA 1T03L 2XPGB 1MQKL 4XPBL 1T0MB 1HKLH 4ZQKB 3ZDZF 5HYJB 2BOBA 4GO6B 5ABDE 5KSBB 1DEEB 1NC2B 3G5YB 1J10A 3OKEA 4O4YH 3HUJB 3G9VA 3LKPA 5HVWA 5ID0B 2VUOA 5E2UH 2VR5A 3EYFB 5CHNB 4NC1C 5DRZA 1TVHA 4HF5L 2OS7A 1HIMH 3PP3H 1OAXH 4HIJB 4NT6B 1FORL 4G6AD 1OY3B 4HLZG 4ORZC 2YSSB 1TCMA 4YXHH 3QJFA 1T3FA 2AJUH 2AXFB 1EPFA 1IAKA 4KVNH 3U0WL 5CGYD 4P3CH 1MVFA 2E5EA 1HHHB 4PS4L 1EH9A 1U8OB 3D3VB 3O2WL 1S7VA 4TQEL 3BKCL 3VXUD 1EX0A 3GSWB 1VFMA 1O5DT 4K8RC 2H2PC 3OKOB 2ADFL 4ONFH 4PRIA 4QKXB 3GKWH 1MY5A 4XNXL 3OF6D 5HD8C 2ZUVA 2HG5A 4MJIA 3MRBB 2X4QB 3DVFA 4R97B 3VXNB 1L0YA 5JXEC 4I13B 5E2JA 4CU7A 1P7KB 5E6YA 2R4RL 2HJFA 3SKJH 1MHEB 1UEMA 4MAUH 5BZDA 2ZUQB 3AU1A 4MMZC 4QYOB 4K9EC 1FG2A 1YMMA 2PYEA 4EBQH 4RMTA 2G2RB 4AH2A 3FB6B 5I1EL 1JUFB 1CLOH 4DN4H 2PXYC 3CLEL 1OWRM 4JHAH 3U36A 1ZHBA 1KNOB 5JHLL 5JQ6L 2QL1A 2OZ4L 1J0ZA 1S9WA 3VFGL 4R96A 5D5MB 1Q0XH 2BSRA 1IARB 3OG4B 1A3LH 4M62L 1CXLA 3GNML 3GBLA 5H37H 1WC7A 2GJ6B 2XN9B 2EDLA 3GUTA 2ATKB 4R7NA 1CE6B 1UCBL 2RQ8A 3MLXH 3U83A 3UPRA 1NBYA 4NC1E 4AEFA 3WS6C 2M26A 2GYSA 4JJ5B 3TJEH 3RWHA 4AH2B 4GMSL 4BFGA 5TPWL 2OTUB 5F97E 5DC9B 3VFTB 3Q3GB 5A16B 3WFBH 3JV6B 2NY7H 1P9MC 4KKLD 5IJVA 1MCNA 4BSWB 5JUEH 4DZ8B 3MLSL 5AUMB 2NX5E 1I1YB 3GHEH 2A6IA 2JB6A 4ESKA 4NKQB 2JIXB 3L95B 3MFGB 5CBAB 5F7UA 4JFOB 4HIEA 2BP3A 3Q1SL 1IBGL 2E7BA 3QUZD 5EZOH 2VQ1B 2ZSWA 1RMFL 3TBVB 4LMQE 2OSLA 4ODVL 3I9GL 1FIGH 4Q9QH 4QY8B 4LFHD 3VXRA 3BDXA 2YWYA 3ZHKA 2D2OA 3OR7B 1KEML 3QWOA 2V7HA 3MOAL 1OP3K 4XPFL 2BRRH 1NGPL 1K4DB 2BZDA 3KYKL 1RUQL 3NACH 2K1MA 3IFPA 4LAQH 3X3GH 3E3QE 4M8QA 9CGTA 4D0DB 1F90L 1BZ7A 2Z92B 4UNUA 3MNWA 4QHLA 3QQ4A 1J8KA 2DI9A 3ZTNL 4X5WA 2B39A 2I9TA 2R1WB 1J8HE 1H15B 4YK4B 4P48A 1ZT7B 2FEDC 1CTOA 3BO8B 2EH7H 2G60H 3HZKB 1I3VA 1NDGB 1T1WB 3ARBB 5FGBA 1EUTA 4HQQH 5IW1A 4TUJB 1NGQH 3GMQA 4OQTH 4W6WB 4XCEB 4JQIH 2IJ0C 2B1HH 4NJ9H 4NM4L 1AR2A 3EYUL 4P4RB 1CBVH 1A6AB 3ARFB 4NQCE 2F8XC 1GAFH 3F58H 1QO3B 4HHAB 1ONQB 1T80A 2F5AL 2VQUA 1AO7E 5D4QA 4YXLH 4EZMA 5I2IB 1GGBL 1D6VH 1I8KA 3QWRD 1MREL 4WI7A 3RI5F 1NC2D 3MROB 3HI5L 4JHAL 4LRIA 1T2XA 1FRGL 1QFWI 5LKNA 2UZXB 3QZWA 4P5TB 2VLKD 4JFHE 1NPUA 3L5JA 1J05A 5F9DC 4NZRL 1U3HC 4U3HA 3MV9A 4YDIH 4UUJA 3TH4T 3MV8B 1X5FA 3X13A 1J0KA 3UBXB 1FFPB 2D9QB 2C3GA 3HAEH 4ZNEA 2B1HL 1IJ9A 2IAMA 4JY6A 4F9LA 2VLJD 3GKWL 4HUNB 4QXGH 1KT2A 1Y18B 4NUJB 3B5HA 3C9NB 3U4BH 4UV4L 2XZCH 2X40A 3OX8A 1WTLA 4HKJB 2YPKA 4KUZL 2VZOA 4R4BA 3DI2B 1F3DJ 2Y23A 1YEFL 3O2WH 2BVQB 1KEGL 1R3JB 3FN0H 4WVRA 1TQBB 3DX8A 2FL5A 1BD2D 2XWTA 3C8HA 3MJ9L 3U2SB 3MCKA 1A6VL 4GH7B 4OB5H 5JNYB 1HXMB 5D1ZD 1KXVC 2GW5A 3OKYA 5I71C 3OKEB 1INDL 4P5MB 3U82B 4WRLA 3OXRB 1IM9B 4PJBB 3IU3A 1KCLA 1MJUH 2BX5A 2AVGA 3LEVH 4RMQA 4NQCB 3A6BL 4U1GB 1VGKB 3L3DB 4EUPA 3O3AA 1FIGL 3EJYD 3D0LA 3TVMD 5T3XE 5HVFB 3QRFM 5D7JC 4KK9D 5D7LA 3RPIA 3SDCD 3BP7A 4NO0A 2CQVA 1M71B 1VGEL 2XTJD 1FNEB 1QG3A 1MCCA 3RIFK 1C5BH 5C3TA 4XH2A 1ACZA 5KS9A 1FAIH 4Z77B 3GMOA 1N4XL 3CVHA 1UWXK 3WV0A 2LABA 2GITA 1JPFA 5C0GA 2HMID 1IC4H 3MCLH 1T66C 3SBWC 5HVGB 1EEQA 1KYOK 5LQBH 1QACA 3O8XC 3HNTH 2BNQD 4H1LB 1SJEB 1SY6L 3VXMA 5I76A 1DQDH 3H0TB 1BVZA 4NJAH 2EDQA 4HIXH 2IALB 5IBLD 1E6JL 1UWGL 4XBGA 2KPNA 3H9HA 3L3GA 2DQFA 1JZ3A 4D0BA 4NO3B 2ID5A 2ADGA 2GTWB 1C5DB 2JF1A 3QDAA 3M1BA 1TQCB 1PKOA 3VXUA 3RZCD 3T0EB 1UWEL 2ICCA 4M62H 4PGDB 4BH7A 1BFVH 4OT1L 4JDTL 2L0DA 2AXJA 1G1CA 8FABB 4ZD3L 4Z7WE 3M8OH 5LXGH 3RI5K 5K9OB 1XGRB 1KIRA 1X5YA 3ALXA 3R4DA 4PJXA 5E8PA 3CFCL 1AE6H 4DKEL 5EBWB 2X2YA 1WC7B 1NFIA 2JJTA 1OP5K 2W59A 1WWCA 4FOMA 4P2RA 4M6MH 4OZGA 4QRUA 3TYGL 3I6LE 3HMXL 5DJAB 1HINH 1R5IB 5EWIL 3ECBB 5D8JL 3UDWC 3BKML 4LEOB 3H9ZA 1L6XA 1UJ3C 2DIAA 2RFXA 3GIVB 2CIIA 1CFVH 5A0LA 4BKLA 2H32B 4PG2C 4U1JB 4XP6H 4KVCL 3GEWB 3SGKA 4YDKH 5D7LD 5FAAA 4DGIL 2BERA 2GKIA 4CVZB 4XP4H 5F96H 3BEVA 1L7IH 5GZND 4S1DD 4DZ8A 2JCCA 4JPVL 4DVRH 3B9KA 3GSNH 3HPJA 3F7PC 4HC1A 4L9DA 4H5SB 3PGCB 5FK9A 4WHTA 2NYYC 1R3HB 4EVNB 1CGXA 3MV11 2WMPA 2DKSA 5E08H 3TPUA 4K3JL 2UVFA 2AEQL 2P24A 5HVHB 3PWPB 2EO9A 1KJMA 4Z5RA 3EJZC 4PLOB 4UT9H 1B2WL 5KTEL 2X1OA 4RAUA 1H3GA 1S3KH 3VMNA 4I0PA 2Y5TA 5LCVL 2X89A 5E4EB 5J13B 5MENA 4XPBH 3TZVD 5L8JB 1CF8H 4GG6E 1GL4B 4GG8A 2NZ9C 1C16A 3HC3L 3TBSA 2DMCA 5HYIA 1FYTB 5KN5B 2I9LB 5ID0A 1FLRL 1RQ5A 5ENWA 2CK2A 4DZBB 3MRHB 3EYFA 3FO1B 1QEWB 4FQ2H 4HFWB 1ZMYA 2Q20A 4LLDB 1CGWA 3BDYH 1RZIB 5AG8A 4ZMAT 4M5ZL 4O5LL 2VWEE 2YD1A 4X4MA 1CGUA 3GJFK 43CAA 4P4RA 1QBBA 2O5XL 1S7QB 3ZT5A 5DI8B 3JWDL 4HHAA 4WU5B 2YPLA 2IPUG 4EI6A 5ESQB 5EUOE 1P6AB 5JW4Q 5CHNA 5DRZB 3ULUD 4FTVD 4Y1AD 4XI5D 2RBLA 2HLFC 1HOCB 3MV9D 5BJTA 1A4JA 4FXKB 1QTYT 4GG8B 5DWUL 1NBVL 1YMHA 3DRTA 4TRPL 1T7ZA 1GGCH 5IHUL 5B3JE 4MVBC 1KJ3H 4DGYH 1T3FB 2FJFB 4JKPH 4DZBA 4F7EA 5T1KB 4CW1A 1F4XL 4F57L 3UMTA 5I75B 1ZHLA 1D5MB 2G75B 3CFDA 4C56D 1W8OA 1X5AA 3FFDB 4AJ0A 2D4FA 1G7JB 1U58B 4K8RH 4WW2A 2X4OB 1WCBA 4K23L 5I8CB 3BZEA 4HPYH 2NTSP 4OFIA 4L3CA 4ZUWA 2P42B 3QNYA 3T2QA 1KIQA 2APWA 1QBLL 5ITBL 2F54A 4OUUA 1S7SA 2YA2A 4MD4A 4XP9H 4CUCA 1HOCA 4JFZH 4P2YA 5LGHH 5MHSD 1H3UA 2OL3H 4I9WD 1LE9B 3TP4A 4LGSB 4LFHG 4E5XA 4NN7B 3D6GA 4M48H 3KLHC 3LVEA 3OXSA 5C07E 3ARVA 3QDJD 4ERSL 5IB2A 2AQ1A 4Q2ZA 1MY7A 4GW4A 3KXFB 1T4KB 2P5WD 4GXVL 3GI8H 1DZBA 1G7JA 1KJVB 2VDQH 4PJ9C 1YPZB 1MUJB 3I02B 4F7MB 4YPGA 5IGXL 1DBAL 3L3HA 2ITDA 3T0VA 5SV4A 3ZE2E 1J1XH 3EDDA 5SX4I 5IHLB 5JA9A 5IFJB 3G5ZA 5A16A 1AD9A 4GKZA 3D87B 3NH7H 4G9FA 3MREB 1UENA 3TBTB 3D85A 1WJ3A 3OJ2C 1T4KA 4WUUA 5E8DL 1E28B 2AV1B 2J4WH 4GRLC 4MNQB 2JK5A 3ELAT 4JFDB 4ZFGH 2ERJB 1FN4B 1S7UA 3HE6B 2FBOJ 3O3EB 4PRPA 3VWKA 5DURB 5BXFA 3I3DA 2EDFA 1P1ZA 3MGOB 3MR9A 1F6AB 1SJEA 3OGOE 3K1DA 4NQDA 3DHMA 4U6XB 4U7MA 1G84A 1JGDB 2A9NH 1WZLA 2VZTA 4PJFA 1PFCA 1S78C 3SJVA 1Q9LB 1JPGB 2XZQH 2AK4D 3QO0B 3GSQA 1R6VA 1ZK9A 1BF2A 2DLIA 5ICXA 3RZCC 3EBAA 3IXAA 5F8RC 4N0CD 3RL1B 5DD6A 2XA3A 4R3SA 4QY8A 3FTGB 4W4NA 3BRFA 3PABB 2M8XA 3BWUC 1OP9A 3MBXL 3KXFE 3FHQA 1ZT7A 4JZJC 3RAJH 3SDXA 2IAND 3RHWK 5B8CC 1P84J 1U93A 5IW1B 4L8BB 4TUKH 3VXSA 1U8KB 2Z92A 1ZGLA 2HMIC 1AGBA 1CXEA 3CVIH 4Z7VF 3ZYZA 3CX5J 1GGIL 4M00A 5HHPA 2KDGA 2I9TB 1V8HA 5HHNB 3KDMA 4GQ9H 1MCJA 4GRWH 1QKZL 1VFBB 4JDZB 4W4OA 2IPKA 1QLFA 5DJ8A 4LHJB 1QD0A 3IXAB 5IQ7H 2MHAB 3FTGA 4PJHF 1P5UA 4G43A 3P2TA 5FYLH 1ITCA 2AJXL 3ROLA 4J1UB 4N0CC 1AD0B 1TZGL 5D6CA 2QV2A 5E94B 5D2LA 5E4IA 4R7DA 3O2DH 1T2JA 3ARED 4LHUB 5SWSE 4N8PA 3O3UN 4PRHB 5L7XL 1E6OL 5T3XH 5IB4A 2FWOB 2FGZA 3PWJB 5EBGA 3MNZA 1FL6B 2ZZUT 4AQ1B 2F5AH 3X13B 1KPUB 1M7IB 4QRRD 2PO6B 5HDLA 1TETL 4JO4L 2DAVA 4N5EC 4HEPG 1KXTB 3I84A 3VG0H 5A3ID 1A6WH 1JI2A 3WDJA 3LOWA 1MJ7L 1GH7A 1HHIA 4I3SH 4XWGL 4D8PA 4B7IA 1F8TL 1M7DA 3QT2A 2P8PB 4ZO7A 2LVEA 5FECA 5HYEA 4Z0BL 2ZCKL 3QJHB 4OKDA 4J2XA 4FQQB 3W0WE 2NZ9D 5DFTA 4OM1L 3TA3A 2E7LC 4I3RL 2ORBH 1N6QH 2X9YA 1CXIA 3SO5A 3RUGF 1E4KA 1NJ9A 4HUUB 5TGBB 5C2BL 4BQ6A 4S1DC 3FFCD 4HUWB 4Q97A 3VXOA 3SOBH 3UPAA 4IDJH 1SVCP 2HH0H 1FVEA 4K07A 2FJGA 2IANA 3MQIA 1YNTB 4B7LA 1RZIA 5C0BA 5K9JH 2Y72A 2YD8A 1A7RH 5DJ0B 5C0IB 1A64A 4RWYL 1IM9A 4U6HB 3O45A 4PD4K 4XH2B 2OTPA 3UTTD 3QJHA 2WBWB 3F8UB 1D7FA 3GRWA 5GSRA 1DVFC 4BK4A 3H9SA 2AXGB 3KPNA 1NANI 3U4EA 5C0GB 2B1AL 1BIHA 2LU3A 3VXTA 4QRTA 5K59E 3QISA 3LKNB 3N1PC 2IMMA 3H7BA 3JV4B 3AC0A 3TN0D 1MCOL 4ODTH 4BJLA 4F7EB 1TNNA 3D39D 1V7NL 3NTCL 1TVHB 1LVEA 2E9JA 4M93C 5CILH 4NC2B 1X9QA 4KI5E 5C0BB 3RVTC 3LRGA 2CO6B 4IIQA 4WEBL 2VLME 5D2LE 2A38A 1A6UH 1P53A 2QQKH 5I66A 3O2VH 1Y0LB 4MXWL 1MNUL 5EPMA 4PV9A 4N1EA 4U1HB 1C5DA 1WFUA 5SWZD 5BZWB 2DIJA 4LGRB 3MOBL 4N0FA 5EBMA 4M61B 4Y16B 1DQMH 2DQDH 3DVGB 5EH1A 3LKOA 4AG4H 5B39B 1XGYH 2P48B 5KG9B 3QDGA 1NCCL 5F1SA 5GGRB 4PUBL 4LCCC 3GSWA 1HEZB 4ZXBD 2R8SH 4XI5C 3V6OE 5JW3L 5DZNA 4R9HA 1B0GA 2FIKA 2H45A 2WUCH 1I8MA 3OMZA 4N90E 3TN0C 3RVXC 1KN2H 4Y4KA 1Y6MR 3E6HB 2XNAA 4BQCA 1MHEA 2LAGB 7CGTA 8FABA 4U1KA 4JY4B 2DQGH 5GIRB 4MDJA 1FNAA 5L9DH 1U3HA 4U2ZA 1YEHH 3RA7H 3RVTD 1LO2H 3SKJL 1IVLA 4X5LA 5CEYA 1DQLL 5AYUH 4GJTB 2NY2B 3QUMA 2D0FA 2APVA 1I1AA 4KY1L 4JFXB 4ODSL 4YFLI 5GGRA 1XGTA 4AK1A 4OCSH 1YEJH 1CDCA 1N5AB 4ZFOA 3KPMA 4MA8H 2FLBT 1HHJA 5F71A 5ACMA 2ZUWA 3PG2A 3MRGA 1BFOA 1RI8A 1GC1H 1HSAB 2AJYH 4XVJL 3MV01 1KJ2A 1MHHB 1GPOL 4P46C 3KLHD 3IDNB 5JDJA 4Z9KB 1K5NA 3G08A 4TSCH 5DYOB 2KZ1B 3B6SB 4OLXH 2PTUA 5FUZH 1U3HB 1MIEL 1I7ZA 4H0HB 3D48R 3HPJB 2AI0L 2H2SC 2D31A 2EH8L 4C58B 1KLUB 2WBJA 3LV3A 2AK1L 2R0ZL 1FCCA 1NEZA 5ITFA 4PJFB 5EORH 1PSKL 4ODWA 4MB5A 5IHZA 5DZOA 4BSWA 3G6JB 1MJ8H 3LN5A 1KB5L 2P7TB 1RZFL 1UB5B 4PRDA 5C07A 1MIMH 2A6IB 4PJDE 1EAJA 4KHXH 3HZVA 4NIKB 5DEZA 5FGRA 2IGFL 4FNLH 5CBAA 4RA0C 2P44B 3PABA 4NZTL 1A3QA 3FOMB 1CFSA 2DQCH 3PHOA 3UPCA 3QDGD 2F54E 3BGAA 2RCSL 4QHUB 1HILB 2AK4A 1GHFL 2I24N 1A2YA 4D3CL 5ISZA 2IH1B 3K8KA 32C2A 5I73B 4HWBH 3P9MB 3O8XA 2XV6B 4XNMB 3BPOB 3TO4C 5HD8D 2F53E 5FUZL 2MFNA 5EBLA 3WIFA 4A6YL 3VG9C 1S7RA 1OAKL 4MDIA 2VR4A 4TSCL 3Q5TA 3QG7H 1AIFA 4TOYH 1OM3H 2CMRL 5CJXC 1A4JB 1EK3A 4FXKA 5CJ5A 1HQ4B 1T5WB 2Q86A 3L9RA 3TVMC 1ZWIA 5IWLA 3QG6B 5IB5A 4QRPA 3W11C 1OL0A 1OCWL 4TNWF 3LD8C 4GRMA 1AFVH 3ZHLA 2E6PA 2XTJC 4Q74A 1ZHLB 4IMKA 1ZLWH 3WXWL 3SE4C 1XMWA 1CLCA 2H1PL 1EHAA 2BOBB 5DA0B 1II4E 3V7AG 3GJFA 4XMLH 1F3JB 1KPUA 3CLFL 5IBUG 1PG7H 1T66D 3C09B 3MCG1 1RZKL 5FO9A 1RK1A 5A3IC 5T1KA 2FGWH 3O8XD 1B6DA 3ZDXE 4L3AA 1FNSL 4KGJA 1ADQA 3REWB 1RIHL 1BMGA 4K8RD 1MCSA 4G3YL 1IAMA 1OF2A 3O3DA 5DQJA 3PWPE 2X4OA 3TFKC 3KPQA 5DRWB 2NY4B 3RU8L 3MBEB 3DIFB 4UDTA 4MXQD 3EYVB 2HTKC 3HNVL 3O6KH 1XR8B 1SJHA 4G8FB 4NN5B 3WS3B 2E6QA 4E42B 1FZKA 4LASL 4F8TA 5HGAB 2F54B 1G6RA 1P4LA 2ZWLT 4PB0H 4ACPA 2E9WA 3JBG7 1IQWL 4HT1L 1MUJA 3I02A 1YMME 5HI5C 1QSED 2B5IC 2ZSVB 3VFNB 2A9MH 5AAMA 4J4PA 4LKCB 2BDNH 3OKOA 2DJSA 3AS2A 1YJDH 5C0AD 5F93C 1ZT4A 3C9NA 1RJZA 3AGVA 4KJWD 3ARQA 2YEZB 2YPKB 1OTSD 4KQ4H 1NMAL 4ELKB 2A1WL 4NRYB 3OKMB 4OCRL 5IMMA 5J6HA 4I8DA 1JCKA 3MBEA 4WIQA 5IFHL 2KKQA 3TT3H 1HN1A 5FV2A 2EDWA 2FB4H 5DRNB 2IADA 4NYLB 4UB0L 4X4YB 3C60C 3TV3L 4LARH 3QUZA 3VDAA 5EZLA 3BH9B 1G6RH 3MLUH 3MUGA 1S7UB 4YFDB 5IMOA 3OHXA 1I1AC 5C1MB 5GZNC 4FQXB 3MZGB 4TNVK 4GUPA 3BKJH 3EHBC 4D9RD 1FO0H 1S7TA 3SDYH 1FGNH 3O4OC 2N1KA 2NYYD 2YRLA 5DRXB 1LO5A 1YY8B 4G7VL 1FN4A 1W72H 1NBZA 4HJJH 5EPMB 1HH9A 2X7LB 3QUYB 5HHOE 2NY5C 3H8NA 4N0FB 3W39A 3IJHB 5DRNA 4U05A 3VE0B 4HBCH 4C56E 5EZLB 2NY1D 4NKMB 4DAGH 5B8CA 1CE1H 2ZCKH 4LBEB 5C9KA 1CGSL 4OSUH 3JTTA 1DUYB 4MNQD 4KJYB 3RL2A 3VXSB 3FO9B 2H3NA 5I76B 2H6PB 1FH5H 4Z7VE 4XWGH 2XWBA 1A1OB 2DM2A 5IMKA 4MNHB 1YYMH 3E6HA 4L1DA 2R0LL 3F7YB 2DQJL 2IPKB 5D2NA 1TETH 3NABH 3B3IB 4FZ8L 2W9EL 4JDVA 3NZHH 3EO0A 4KZDL 4UDUA 4H25B 1X44A 3FONA 2C4FU 1MFEH 1S7WB 3TO2A 4QRRE 3VXRB 4K2UH 3IJHA 1JGVL 3RTQD 2E8ZA 5K59F 5DJYB 4HS8H 4K2UL 1OW0A 3U0PA 4R26H 3KPSD 3S5LG 3ZYJA 3DO7B 3SN6N 3RVUC 1DCLA 4KZDH 4R7DB 2C9AA 2W92A 1CQYA 3KPMB 2FHBA 2W65B 3EO9H 3CC5B 3DNKA 2P5WB 4KTEH 3ULUC 1OHQA 1AP2B 3MNWB 4JEGB 2XWBB 2J8UA 1FFNB 2QQLL 3VXME 3T77A 2BSSB 3V8CA 5E8OB 2XTLA 1R5IA 1W0VB 3I50H 4U6TA 5DYOA 2EDEA 5F7EL 1PEWA 1OP5H 1C08B 3UO1H 3VD4A 4S1SL 3EO0B 4FZ8H 2X4TB 1LO3H 3G04A 4D9QE 3CH1A 1A14L 1VADB 5L2KD 1S9VA 1T83C 2X10A 5GGTL 1OAZH 2VXUL 2A77H 1YYML 4WTZA 1JNJA 4XGZB 3LDBC 1WFOA 1NUFA 3B8SA 4LRNH 2PXYA 4HJJL 2GTZB 4OQ1A 2DI7A 1NGYB 5A2KH 2ICWI 3DX6B 3TA3D 1K6QH 1DBMH 2F8VA 2A6DA 1MCEA 1QFUH 4YBLB 3SDDB 1K8DA 2D9CA 4HMCA 1PZ5A 3VXOB 3LS4H 1IGJA 1MWAA 3BKJL 5ERWB 1OB1A 1VPOH 1IQDA 4HAFA 1DTUA 2L4OA 1XAUA 1WBZB 3B5TA 4KH2A 4DN3H 5ISZB 3ROOB 5C0BD 4KDWA 1L4IA 1NCNA 3S96B 4OZIF 5DUMH 3D9AL 1KC5L 1BAFH 4GKOA 3VGEA 1FGNL 1XIWB 1J1PL 4KTYA 3BGMB 1IGIH 4Z7UE 1ETZA 3KWWA 4URTB 5ELIA 1T83A 4R97C 1J8HA 5GGSB 4F80A 4AZ8A 4NHCH 1C1EL 2Z93B 4JY5L 3QA3A 3JUZA 4GBXC 2A1WH 4KI5C 4HSQA 1HKFA 2R23B 3FKUS 3OKKA 4KQ4L 1JTPA 4JFEE 2VISB 4HKJA 3EJYC 3MRNA 3PQYA 3LKNA 4B5EA 2FYYA 5CSBA 3TV3H 3SDCC 5SWQB 4U6YA 3QO1B 3ZKND 3HAEG 5I75C 1N5YL 3QI9B 4HAGA 3EYSH 1NC4A 3O0RH 1T04B 3QH3A 4X6DA 4IIQB 2V6HA 3X3FH 3RIAK 3EGSA 1S7VB 1NMAH 5CSZB 4ORGA 4G6FD 4UQ2A 3H7BB 3MLYL 4JN2B 3IU3B 3DX7B 4LASH 4YEEA 3TYFA 2MSPA 2F53A 4JG0H 1VACA 4QHNA 5E99L 4Z7WB 3P0GB 5C7XH 4NKDA 3VRLE 1DBBL 4M9OA 5SWSA 2QKIB 4GXVH 3VFMB 1NGXB 1X6LA 4L8SB 5IF0A 3I50L 4H26A 2R23A 3DBXA 1T0NA 4LPVA 4MXQC 5GGRY 3WS6A 1RIHH 5GS0H 2OI9B 2YD6A 2B4CC 2FJFA 2NQCA 2OK0L 1JZ4A 5HJ3B 4G8GE 3CFDB 1T5XA 4M6OH 1BVKA 1TJHH 2A2QT 2VDLL 2BY2A 1HK6A 4IMKC 1N2RB 1F58L 4F2MB 1WBYB 5CGYC 4JY4A 3LEXA 4G7YL 3MFFA 3MRKA 1OAQH 1S9KC 3QHTC 3RY6A 1EFXD 2AJZA 2V5MA 3HPLB 4AENA 3ULVH 1PAMA 1A7QL 1NAKL 1ZT4B 4M7KL 4GS7C 1CLZL 2UZIL 4FFVC 5T33L 4O00A 3SKMA 4GMTH 1WEJL 1PX3A 2BCKB 5DD1L 3H9HB 3WCYA 2MTPA 4XAWL 2H1PH 1NSNH 3ET9F 1ZHKB 4JO2H 5LGKA 4FQ1L 3U4AA 5GGVY 5L88H 1T5XB 5GRUL 4I2XB 4Y88A 4GRWF 2A83B 1BVKB 2D4DA 5ADPH 4DAGL 2HTKD 3MUGB 4YPGB 3WBDA 1Q94A 4LLMA 4FQXA 3Q48A 5JIHA 2CMRH 3IDIB 4WI3A 1B0WA 1BQHB 2Q76A 4YX2H 1K4CA 3QEHB 4M5ZH 1NLDH 4H88H 1FP5A 5HI5D 5E1AA 1XF3A 2BCKA 3DURB 5IK3B 3LN5B 3GSXA 3U7WH 2C1OA 3HB3D 4FFVD 4MQTB 1MAMH 3T3ME 3UJIH 1VEMA 5T1LA 3SBWA 3L3OB 1EJ6A 3FQTB 3UJIL 1P4BH 3L6FA 4KZEL 5INDA 3WO4B 1MAML 2H32A 2NY1C 5FGCB 2DQHH 5E2WH 4MQ7B 1D6EB 4H0IA 2DQUL 2R29L 4RAHA 3MLPA 1I7RA 1H8OA 4IHOA 4ZUVB 3MRDA 43C9A 2P7TA 3DECA 5C07B 2OM5A 3ISWA 4KRLB 1DQJB 4ODHL 1N7MH 4DUVA 1ZLVK 4BH8B 3R0MA 1CL7I 5CINL 4EN3B 1PSKH 3FB5B 1Q9LA 4FZEL 4LNVA 1U8NA 1XF4B 5DK2A 4EIZC 3WIFB 1JFQH 4M9PA 3FB8A 3HC0B 1WAAA 1EXUB 3N9GH 3GBML 4JB9L 4XP1L 3NA4A 3MXVH 3HE6D 1YEKH 3VH8B 1YEJL 5LJYH 4HGWA 3MYJA 3QULA 4AIXA 2J12B 3TVMB 4WFGE 5BMFL 3KVQA 4OIIL 5GS2D 3IDUA 5CWSA 1CK0L 3T0XA 4OAWA 3DETC 2ARJQ 4MZ3A 4XAWH 4WHYH 3WIHA 1H3XA 4UTAH 5EA0L 2KBGA 5DD1H 1XF2B 4IHOB 1S7RB 5E6IB 3HUJE 1LEKA 3SY0B 1H3TA 3BH8B 1CLZH 2HFGL 2NPLX 5D71L 2LV4A 1RIVH 2CLVA 3KPLA 5ICYA 4EXKA 5I2IA 2XQBL 5CSGA 4V2BA 2AS5M 3MLTA 2M1KA 3GJFB 4PD4J 1RZ7H 2YUZA 4Y2DA 4N9GB 2NNAA 4XCNB 1RFDL 2F15A 4O2FB 3TJHD 2W91A 5EDXA 4MMXC 4J3OC 1FNSH 3N0PB 2R8SL 5EO9A 2XQBH 1KGCD 3R1GH 5KVFH 5I74B 5E9DD 2VKXA 2VLJB 4OBRA 1U95B 4P2OA 2EIEA 2NY0B 2QHRL 5CWSB 2P1YA 4HWUA 1KTDA 3IDJB 1GZPA 1Z3GH 2W9LA 4PJFF 5F1KC 3EZ8A 3MV8D 4ZFZA 1J18A 4WU5A 2VDNH 4HUVB 1LNUB 4LRIC 5GS1B 1BHGA 4WHYG 2HT4C 2CLVB 4LDOB 5CMAA 4BFIB 3C6SB 2A6DB 2GCYA 3KPPB 4LLWA 1G0DA 3IXTA 4UZGA 4OCLC 4ZDHA 1XIWD 4LHUD 3F7QA 5CINH 1OM3L 1FFOB 5D1QA 4ODHH 4PBVC 3S37H 2CRYA 3NFSL 1U58A 1NAMA 5C09B 4J3WA 3UROR 2GQHA 3MRMB 2R4SL 4OLEA 5FECB 2ZG2A 3MXVL 2XG4A 4PJ9D 4ODUB 4FMFA 1EUUA 4M1DL 3BWAB 1BJMA 2C3WA 1G0XA 1Q9WA 2XIDA 3FRUA 3VGAC 1TVDA 2YZ8A 3DLQR 3UJTL 4OUUB 4RQQB 3T2PA 4N0UB 2AKRA 3B43A 4ELMF 1N4XH 1HNFA 1IGIL 1MOEA 1RPQA 4HUWA 2NCMA 3OKMA 3CPLA 2B1AH 2PYEE 1P4IL 4GAGL 4OI7A 3P4NB 4FQCL 4Z7WF 5L2KB 1SJXA 4GRWB 5KS9B 2FJGB 2IANB 4EOWH 1RULH 4JJHA 1T04A 1MIML 2CLZA 4HFUH 4N0RA 3STZB 4JO3L 4LVNB 4I18A 1LO5B 4BQ8A 3MYZA 4U2YA 5IVXB 1TDQA 3LKPB 5T3XD 3LS4L 3MJ8A 4U6HA 1A8JH 4UV7L 1VACB 4QHNB 1BP3B 2FO1A 4Z76B 1ZA3B 2AI0H 4WUUE 2NY0D 5HHXH 4P59L 1LQSR 5D2NC 5GRUH 1JHKH 2H2SD 2IFFH 3E0GA 4OD3H 4WWID 3O11A 1CDIA 3BEWA 1ORQA 5ICZA 1MJ7H 2ZOLA 3L3GB 4MA1C 1MFCH 4PJ7E 1S78D 1NUNB 3TCLA 1A14H 5T33H 2PTVA 1KJ2H 1CL7L 3TZVA 3SGDI 3E6FB 5CP3A 1MFDH 5D9SB 3TBYA 3F7YA 5JMOC 5B8CB 3ZE1E 3OF6A 3TWCH 2W0KA 3DWTA 4DW2L 3K80A 2VDLH 3O9WA 4FXGB 4AEHL 5MHSE 4OTXH 3BISA 4EUPH 4U6XA 5E7FA 4LP4A 5IV2B 2VZUA 5J11C 1UXWB 2VZSA 1XZ0A 1MCLA 4I0CC 5KG9A 3VI4F 1ORQB 5ICZB 3U6RB 2HJFB 2ZPKL 3AM8C 2NY1B 4M7LL 5MP6H 4K71C 3ALWA 3R06B 4GRLB 4ZS6D 2YD9A 3B3IA 5HPOA 5IBLC 2CIIB 4DVBB 3NCYS 3DV4A 1LDSA 4OCWL 2I25N 2R2HB 1WIOA 5C7XL 5E99H 1KNOA 2HWZL 3QCVL 2WWMD 2YOCA 2AJXH 1PQZA 3PV7A 1EO7A 2VC2H 3BP5B 4MXVF 5CCKH 3STLA 3B8YA 3FAXA 4DK3A 1BQHA 1WK0A 4S0TD 4NM4H 5CEYB 1AGEA 4NJ9L 4WHTB 4WW2F 1I3RA 4BYHA 4JRWA 4IOSD 4XCCH 3SE8L 1VADA 1A6UL 2QQKL 2UWEF 4HDIB 4S1QH 5CZKA 3FHAA 4CN4A 5EC2B 4JHWH 5FO8A 4U3XA 4Z6AT 1KELL 4O9HL 1UFUA 4OGXL 5DJ8B 1YUHA 1HNGA 4S10A 1QBAA 3BZDA 1EAPA 1HHJB 2JJVA 5T1LB 5EU7E 1LD9A 4DQOL 3L6FB 3X3FL 3MRGB 2IQ9H 4TVSa 3WNPA 2R2HA 1DUZB 3EYSL 3O0RL 2C7UB 1MCBA 1MHPH 5KJRH 1OTTD 4S2SB 3TFKD 4ZYKA 1AXSB 3G6AA 1A9EA 4WUUD 4Y4HC 1IL1A 5EUKB 5MEPA 2C1PA 2LE9A 4NN5C 3AXLA 2JIXA 2WSKA 3L95A 4YC2C 4AIZB 5C09D 3ES6B 4PY7B 3KNBB 4F33A 5EN2A 1AQDB 3K3QA 4JQXC 1F11A 1A7RL 5TDNB 3DO3A 4R2GC 1RMFH 2EKJA 5FFLA 1RZ8B 3BGMA 1MWAB 1Z9SA 5FO7A 4KRMB 1ZGLP 4FTVE 4Y1AE 5KSAC 1QEWA 4S1RH 3D9AH 1QFUL 1EEYA 1GOFA 3C09C 4LLDA 5T1MB 1CD9B 1BF8A 5L8LB 1DBML 1QVOA 1J8HD 3WL9A 3KLAA 4CMMB 1AGDA 4LPYA 3V95A 3HS0B 4P9HH 1BM3L 1IRAY 4JGMA 4MLSA 12E8L 4U33A 1QR1A 4PJXE 3QXVA 4DQOH 2SEBA 1UM5H 2NY4D 2P8LB 3X12B 3G6AB 2BNUA 2FRGP 2EC9T 2XTJB 1OLZA 3RGVA 2YD2A 2BSTA 4NKOA 2Z31B 3TC9A 3UYRH 1RZJC 4RIRA 3V79C 3FAWA 4PJXF 3V7AE 2VE6B 1MH5B 2CRZA 1UADC 1IKNA 3BPNB 3F6IA 3KNBA 3NCMA 4PREA 5CBEA 3UO1L 4F33B 1F45A 1Z5LB 5HGBA 1JYNA 5FDYA 4U6YB 4H8WC 4WJ5B 1IM9D 4M48L 4PBWD 5KS9E 3OKLB 3O6MH 1JF5A 2X42A 3EHBD 5IF0B 5K9QI 2HYMA 2YSSA 3FFCB 5JIKA 3QNYB 3GI8L 1P6FA 1IGYA 3HZYA 1L0XA 4M7LH 4OFPA 1SEBA 3L7FA 5CMAB 4EQ3A 5F8QC 2VXQL 3DV6A 3DETD 5FA4A 1XIWC 3MSPA 3RWFA 2P4AB 3RIFF 1PG7L 1L9MA 1MRDH 1ZVYA 4P5KA 5FHBL 3CLFH 4BK5A 5ACZB 3WFEL 2CR3A 2R0LH 3WEXB 3L7EB 2HLFD 4PRIB 1RVFH 1JN6A 4WJ5A 4DGYL 5TF0A 1SY6A 3LHPH 2X89D 3LDBB 4FQXC 4OLUL 4QNPF 4LSPL 5EOQL 5HI3D 1I9IH 2Y5EA 2HJLA 4P0DA 1MFEL 2VSDA 5C09A 1EFQA 5J13C 3UTSA 3RVXD 2BMKB 5D7IA 1CE1L 2YS4A 3VFUA 2VZ1A 4KKAD 1ZE3C 1G0YR 2UVEA 2RHEA 4F57H 1GZQB 4FN0A 1GGUA 4ETYA 3WHXA 1ZHBB 2FR4A 4TTGA 2IH3B 5B39A 4MJ5B 4P3CL 3MRCB 4IRZH 2IWGA 1JHKL 1W72L 4NFBA 2C3XA 2GK0A 5E03A 1G9MC 3QDMB 4D0CB 5GZOD 4PTTB 4UV7H 4L8CB 4D3CH 4OZFH 1TENA 3TBWA 4WUUB 1F4WL 2MQ0A 4MNQA 3D2UB 1IEAA 1XFPA 1H0DB 2O5XH 5GISL 3IDMA 4JN1H 3WUWB 2FBJH 3V4VH 4O5LH 4ZOBA 4NWTL 3VFVA 3CX5K 5HYSB 3MLZL 4QRPD 4RMSA 2UV3A 2IADB 2FB4L 3EOBB 3K81A 5AEAA 3SKOB 1FLRH 1URLA 2ARJA 4J8RA 3O11B 5JPMB 1NCDL 2DM4A 1YDPA 1C12B 3HN3A 4PP1C 4LNRA 4NUGH 5TE4L 4G5ZL 5GJTL 4M1DH 2BNQB 1U8LA 4R3SB 1S7TB 4K3JH 5EZIL 3TNNA 4DGVH 2HLAB 4YNYB 2PN5A 5HHME 5E8EB 2XFXB 3AREA 4XXCA 1XCQA 3O4LA 1EXUA 1FHGA 4UT9L 4PJDA 5LAXB 1IZKA 1IQWH 1HZHL 2W1NA 1S7XB 2FX9H 4HGWB 1JWMB 3A6OA 3BPCA 5CIPH 4GRLD 2IG2H 5I0DA 4K7PY 3CSPA 1KPRA 5F7DA 3RWIA 2EYRA 2EC9U 4KVCH 2R1XA 3FB5A 2BDNL 4JFDD 5IHZB 3RWGB 3QB7C 3GK8H 1TXKA 1EDQA 3CK0H 1DUYA 5E6IA 5JXAH 1ZSDB 4NZDA 4JKLA 3VGFA 3EW3B 4I5BA 4ERSH 1CT8A 2HP4A 5KSAA 3HZVB 1Q9KB 5E2TL 4YHML 3GFUA 5E95B 1QPPA 2FGWL 2C5DC 1S5IH 3JZ7A 3C8DA 3UTQA 1HCVA 3R1GL 4DFHA 5IOPB 4Q0XL 1Q0YL 1J1OH 3ARXA 1AE6L 4DKEH 4X0KB 4HKBB 2HN7B 2QJDA 5JA8B 4Z7VA 5BW7A 3N85H 1YYLH 3BPCB 5K9KB 5BO1L 5HBBA 4RMVA 2B0SL 3RPKA 1FL6A 3TF7C 1NCCH 5FO8B 4K8RL 2E27H 2DQDL 3U48A 1MJJA 5EO9B 3WNLA 4CADB 3Q6FB 1AHWA 4JKPL 1U95A 2RR3A 1H8NA 4YDJA 1E27B 4MXWH 3SGEI 4ZS7H 5KSUA 1G7LB 1RZKC 3QIBB 3QZWG 2FJHA 3S98A 3QXUA 2XY1A 1FAKT 3SGJC 5D1ZA 1P9MA 2PYED 4Q6YA 4QGTA 1OOAA 4LLWB 2OR8A 4OGAC 3MC0A 1UWGH 1GC1C 2Z91B 1VFAA 1KG0A 4ZFFB 4O02L 2O5ZL 3IKKA 4FNLL 4K9EL 5I9QB 4PFEA 2XTJE 1QLEL 1WIUA 4O2CA 4YHZL 4PJ8B 3FRPA 4XPGL 1OF2B 2DQUH 3OGCA 3EAKA 5FCUH 2NY4C 2VITB 3CPLB 5JQHC 3WKML 3T3PE 2GSGB 3MRJA 2DLEA 2A0LD 3H3KA 4XB8A 5EORL 1IGMH 4LCUA 3ARBD 5K9JL 3WUZA 2VDML 1IKFH 1X5HA 2P5EA 4JHBA 4NZTH 1C5BL 1YPZF 1ZTXH 5TJWK 2VLMD 1INDH 1OTTC 4QRTB 5DQ9B 5JIPA 3ZDYF 3S6CA 4OLXL 1KN4L 3ULUE 2D0GA 3BVNA 4O58L 1K9TA 4DEPB 3SE3A 4GAJL 2NR6C 1KCKA 1OW0C 1DN2A 1UYWH 1S8DB 2C3VB 3IS0X 2AJYL 4XVJH 3BMVA 5DUPL 1VGKA 3L3DA 1N6QL 3DHJA 5KANG 5ALBL 4KK6C 2OL3B 3THMH 4PJ8A 3VA6A 5I66B 4JG1H 2XWJA 3W2DL 2BRQA 1U36A 4QRRA 3BGFC 3QI9A 3V4PH 3OKNB 1NC4B 3TZVB 1SEBB 3FQRA 1T0MA 3KPSB 1MF2H 2LQRA 2NLJA 2W9DH 4PR5A 5TE7H 4WUKH 1T7WA 1ND0B 4XP4L 5F96L 1X4XA 2DQGL 4KUCD 5L9DL 2R15A 3F62A 2XZCL 1A7QH 4L29A 1DVFD 5HGHB 3DVNA 4TNVF 3I6KA 1NBQA 3PWPD 1U2CA 3FFDA 5IV2A 2Q1EA 2XQYG 5D8JH 2R2CA 2NR6D 3CFEB 5IEKA 1JGEB 3LSOA 2GSIA 4KKAC 4XC1H 5E4EC 4MDJB 4AY0A 1CD8A 1PX4A 3WIIH 1DSFH 2FEDD 1XGUB 4G8EA 2CXKA 2XRAL 4OFKA 1DQML 3HE6C 3OKNA 1JVKA 5DHVA 3MRLB 5GS0L 3HNSL 2BOCA 3BQUC 2ENYA 2WUCL 2ZNWA 4XX1E 4MJ5A 1BOGA 1GJIA 4NWUL 3RTQC 4EIGB 3K2UL 3PWNA 1D9KD 2BVOB 3QUXC 5HGHA 1GGIH 4UTBL 4PUBH 4JVPA 5DD0H 2GK0B 4D0CA 3RUGB 3EDKA 3IFOA 2E8YA 4WI5A 1FG9C 1Y6NR 3QIUA 3SKMB 4J23A 4KDTA 5F89A 3S3SA 2I60L 5EU6E 5CD3B 1YPZA 4F7MA 4CVXA 4KQ3H 3PXJA 1SYSA 1J0HA 4JQIL 3B6SA 4B41A 4H1LG 4FQXD 3BKYL 5CZXD 3TJHC 3KGRA 4HXBH 1MCIA 3FONB 4NDMB 4UT7H 1AGEB 4LMQI 4W4OC 3I2CL 3LQAC 4OV5A 3K46A 4K94C 5I1DA 5CILL 2BVPB 2Z8SA 5I1JH 1U3HD 4X6EB 4JRXB 1PYWB 2Y36L 1EBPA 5FDWB 3RGHA 1CGTA 1U8LB 1FAIL 4XT1C 4GAYA 8CGTA 5C0CE 3KPRB 1DE4A 2ATKA 1FVCA 4ZOCA 2CDGA 4HWNA 5F7MC 2JK5B 1D9KC 4JFDA 2C26A 2HTLC 4DN3L 5DVLA 1JNNL 1ZOXA 3MXWH 1VKXB 4KROC 1IEBA 1YN6A 2ZG1A 4ZPTA 3CDCA 5C0DA 2IBZX 3WD5L 1EEYB 4IRJC 3NIGF 3RWHB 5JUEL 3CFJA 3KXFD 2ORBL 1AGDB 5I1JL 1MHCA 1WWAX 4P46D 1LP9B 1D6EA 3I2CH 3G6JF 3JV6A 4Z0BH 5I1DB 2X4RA 3BXNB 4HK0B 2HH0L 4AIOA 1INQB 4X7SH 1NANH 5D5ME 5BOZG 2JB6B 2JLLA 1A7BA 4UNVA 3HE7A 4RIRB 3MZTA 2DYPD 2OX5A 5C08E 5E8NB 3DGGA 1C16B 5GGTH 1FZJB 1ZWIB 2EDRA 1JJUA 3MV7E 1INEH 1I85C 4QRQA 4WHCA 4QTIL 5CS7A 1HH6A 1I3UA 3X12A 1UVQA 3BMWA 3GNMH 2F53D 4GMSH 5IUSA 1B4RA 2V5SA 1QSEA 2Z31A 4JQVC 5LGJB 3VFOA 3V52L 4YFEA 2VOTA 3C08H 3P4MA 2AQ2A 1FBIH 4QF1A 1S7QA 1TZGH 1K4DA 4OD1L 1CLOL 3TT1L 4DN4L 1LK3L 3LEYL 4NGHL 4C57C 4KGLA 4I9WE 1LEKB 3C6LD 3C5ZA 1JWUA 3AS0A 2FHFA 1CFQA 4PJ5B 2WV3A 4X4ZA 4GW1B 3O3DB 3DPBA 4HS8L 5GGUA 3HRZA 1V05A 5EC1A 4JGUA 3L3IB 3RNQB 1QKZH 3WEXA 1RHFA 2W9EH 4WDIA 1DJSA 1GCFA 1BGXL 2DWDA 4ZFOL 4WO4D 1RHHA 3NIDF 1QSFA 4J7RA 2R39A 1JYVA 4WUKL 4X6DB 1T89A 4MAUL 3W11D 1JPST 3BZEB 1NQBA 4F7PA 5A40E 3EIFA 3UTTB 4JFQA 2ZSVA 3GRWH 4P5KB 4DKFL 5ACZA 1D5BA 3Q5OA 4TSAL 1KIQB 5CJBA 1L7TL 3UZQA 4B50A 5EU4A 3H9SD 1QSVA 3MODH 4YGVA 1S7SB 4OSUL 2WIIA 1RJLA 4OFDA 3HG1B 3HB3C 5SWSB 1Q8MA 2EH7L 2V2WA 5HYJE 3RTQA 4P2RD 5ALBH 1HIML 5DUPH 1KCRL 5JW4N 3ULVF 4LCUB 3P40A 4WDIB 1KB5A 1SMOA 5M7QA 3OJDA 2FSEB 4KTDL 3UZEA 5HYJA 4HLZH 1ZEAL 2PCPB 4LCWD 1EA9C 1S9XA 4YXHL 4PBXA 2BRRL 3WUWA 3SCMD 1VFUA 3MRMA 3SDYL 1CDBA 2VDMH 5HGGS 5HYSA 4ODXB 1IGML 4HK3J 1FVEB 4HF5H 4JE4B 1BLNA 5I1IH 4MQXC 3P73B 4WI2A 3S3JA 4DKDC 4NN7C 3NIDE 5L6YL 4IS6A 3EJJX 4NPYA 3DXAD 1BZQK 3V8OA 1UKSA 4HBQA 5B38B 3M07A 2FL5B 4L4VD 4FHBD 5KTEH 5FYKU 3V5DB 1ZHKA 4R0LB 5IG7B 1OTSC 2ZCLH 3MGAA 1E28A 4BZYA 1WIPA 3O3BA 4PR5B 3AREB 4NKMA 2E7HA 2VLKA 3QUXA 3CX2A 2VZ3A 3UTOA 2DL9A 4K3GA 1Q94B 3HR5B 3NH7L 3P11H 1BBJA 1ZA3A 2GFBA 1E4XI 1JMZA 1MCPH 3IT8D 3C60D 4P49A 3PP4H 2VZVA 5ESVB 3TZVC 3HI1A 3JXAA 2X9XA 4FQPA 3VGBA 1I1AD 4JR9H 1J1XL 2VUYA 1VEOA 4R8WH 3DURA 5KZCD 1JE6A 3GMMB 4GG6F 4R2GD 1DVFA 5D2LF 5F7NC 4ZXBB 4L1HA 4JFZL 4YHOL 1HHKB 4FQLH 1Z9MA 4YHNA 5ITBH 4G6JL 3VI3F 5HHQA 2A6KA 1KPRB 3BKMH 4PY8J 4AM0B 4APQA 5BO1H 1T20A 2GAZB 4LVNC 1UZ8B 1I7RB 2PETA 3U0TB 1PKQE 4LQ1A 3S4SA 1CG9A 3RUGA 4JCMA 4MSWB 4HULB 1RZKH 2W65A 3H0TA 5GJSL 1J87A 1VSCA 4WI9A 4LSTH 3FMGL 5JTWA 4XMLL 3KLSA 3AY4C 1F4XH 5HHNA 5C08B 2R4RH 3SDXE 4EI5D 1NBYB 4OGYH 4OI9A 2DQEH 3SDCA 3WFHB 2GTWA 4MVBD 3PDDA 4YHOH 4NDMA 3LAFA 5FUOH 2HKFH 2Y07H 2PW1A 1T6WA 5SX5H 1A47A 3QXTA 1AO7D 4NBXB 4MJID 3H6JA 4PGJA 15C8H 3V7MA 3JWDH 4XNUH 5F9JB 4U7SA 4WW1B 1XGRA 5E94A 1E6JH 3WFCL 1J0JA 4JLRA 4HIXL 1OAKH 4QHKI 3TNMB 1T89C 3UAJD 1I3RB 5I1GH 5HVHC 4RFEB 3PGDA 2GI7A 1ZVSA 3V5HA 2LTQB 1H3PL 1IAIM 2HT4D 3RVUD 3JSSA 1MRCH 5H35B 1IGJB 3QUXD 3DGCR 3IVKA 1KG0B 2HVKA 4JPKH 1GHFH 5ERWA 4I2XE 2F74A 1OAXL 3ULSA 5F7LB 4OKVB 1QLRB 2EDHA 1DLFL 1JNHA 1JHLL 5D1ZB 5DO2C 5CD5D 3ARWA 2VLJA 2NY0C 4Y19B 4YFLF 1LEGA 4Q9BA 4FQ2L 3BXNA 1IT9H 4HV8A 3IDJA 4LPUA 3BP6A 4BSJA 1A9EB 4L8DA 1S3KL 3ZKSD 4WW1A 3W0WD 3S8WA 1HKLL 4Y4FC 4XXDB 2QSVA 1B2WH 4JLRB 3GI9H 3TBSB 4Z7QE 4XHQA 2G9HB 1CR9L 3QA3B 3FQXA 1NAMH 3A6BH 4RFEA 1WF5A 4RRPA 4LVOC 1CFSB 2AEQH 2J8OA 1MRCL 4MB3A 3ZDXF 4LSRH 1FSKC 3MRJB 5J11B 4RFOH 1ZEAH 4YGAB 3AM8A 2EDXA 3WNMA 5I1GL 5SX5K 4Z5RB 4IRZL 5GZOC 4FQIL 4RNRA 5E70A 3JWOC 4RA3A 2IQAA 5AWNL 3LQZB 1LO4L 2VWEC 1QR1B 5FKAA 4GOSA 3IDYB 2ZKHL 4UQ2B 4F3FA 5B4MC 4BUGA 4LF3A 3E3QC 5EBLB 3ZKXC 2AJSH 2PR4L 4NQVB 4Q6IA 1S8DA 4OCSL 3QFJA 3VFPA 3EDJA 4HIJA 3MUY1 1LEIB 1T7YA 2Z9TA 1DFBL 5JMRA 1T0NB 5E9DE 1ZVHA 4YWGL 2BNRD 5DJDB 4OLUH 1T21B 3BFOA 5EWIH 3HMXH 5I15H 1CFBA 3HFMH 1I85A 4P5TA 4M6ML 3V9FA 3ZYOA 1KIPB 3V5KB 3BPOC 3TO4B 1FRGH 3CDYA 4FXLA 3U9UA 3FFCA 1WBYA 1D5XA 5D6DC 4ZD3H 2HVJB 4L29B 1D6VL 4XBPA 4ZOAA 4OT1H 3HPLA 1BFVL 2OQJB 2FH6A 3WHE0 1IE5A 3JUYA 4LSUL 5DMIH 1KACB 5DZLA 2J3SA 2GEEA 4AG4L 1NGZB 1CD1A 3NFNA 3CFEA 5IEKB 3UYOD 1T21A 3C6LC 3QCUL 1DEDA 3L5XL 3VXQA 3DYMA 4Y4FB 4NQDD 3M8OL 1JN6B 3WJLC 1TCRB 5SX4H 3KYNB 4WU7B 3UZVB 2A83A 1C8PA 4ZS6C 1X5ZA 4UMGA 1SY6H 4Y4KB 3SDAD 5F89B 3IRZA 4BUHA 2G60L 4JRXE 3V0