2XI9A

Pilus-presented adhesin, spy0125 (cpa), p1 form
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
313
structure length
304
Chain Sequence
TSVLIRKYAIGDYSKLLEGATLQLTRVFSSNDIGERIELSDGTYTLTELNSPAGYSIAEPITFKVEAGKVYTIIDGKQIENPNKEIVEPYSVEAYNDFEEFSVLTTQNYAKFYYAKNKNGSSQVVYCFNADLKSPPDSEDGGKTMTPDFTTGEVKYTHIAGRDLFKYTVKPRDTDPDTFLKHIKKVIEKGYREKGQAIEYSGLTETQLRAATQLAIYYFTDSAELDKDKLKDYHGFGDMNDSTLAVAKILVEYAQDSNPPQLTDLDFFIPNNNKYQSLIGTQWHPEDLVDIIRMEDKKEVIPVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANCILLARY PROTEIN 1
publication title A Highly Unusual Thioester Bond in a Pilus Adhesin is Required for Efficient Host Cell Interaction
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Cell adhesion
total genus 90
structure length 304
sequence length 313
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08341 TED Thioester domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.480 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2xi9A03
2.30.30.670 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2xi9A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xi9A01
1RZIB 1I8KB 1MWAL 5DJXA 3IAPA 5DTFB 4ZNEA 5I18H 5EO0B 4CVWA 5CSGA 4JQIH 5CCKL 1JTTA 3ZKXC 4Z8FH 3NA4A 4ZFFA 3KVQA 4OGAC 5E2UH 3T2QA 3AC0A 3FRUB 4NYLB 4ODWB 1IL1A 3UEZA 3MCKB 3FQUA 2O5ZH 1KYOJ 3AY4A 5FUCC 1IQWL 2YUWA 3KYOB 1D5MB 3HNSH 2DBLH 1AD9B 5EZIL 2DJ4A 1WITA 3KXFE 3JV5A 5CILH 5CJXC 4ZPTB 5BMFH 4X5WB 4TTDD 4GXUM 4I48A 1IEAA 1UKSA 3ARDA 5DI8B 3G6AA 4JO2L 5CJOL 2BSTA 1TCRA 4FXLA 3I2CL 1RJLA 1KNOA 2GY5A 1MFEH 5TDNB 3O41A 2MCPL 3WD5H 3MRQA 2Z8WC 4NQTA 4OV6F 5IMKB 4Y5XB 4F7CB 1ZLSH 1T0NB 1GJIA 1YDPB 3FB8A 2DLGA 4DAGL 4WFEE 3OKKA 3TJHC 1H3UA 5HDBF 2PYFB 1G7IA 3UAJC 2NTSP 3X14B 3IKKA 1K9TA 1D6VH 4HCRL 3V5HA 4M5ZH 1JHLH 5F9AC 5I71B 4KJWD 4I2XB 3H3PH 3SGDI 4K9EL 4J7RA 4X9IA 3FL7A 1ZS8A 4WO4A 5JW5B 4Z7VF 4KKNA 3PWUB 3U79A 2DWEB 4BELD 2EXWC 1AGBB 3GK8H 4M6AA 4RAUB 1QBBA 4XCYA 3WFBL 5I1HL 3VH8G 4B53A 5CD3A 3MJ6A 4N0UE 2VR4A 2QJDA 3KPRA 2XV6B 3ARSA 4G6JH 3UZQA 2CRIA 1UB5B 3HZMB 5I1EH 1S9XA 1H8OA 5JW3L 4WUUB 3VFRA 4IOSD 1E27A 2CLVB 1Z5LA 4EN3D 4WUUD 1E4XH 3HC0A 5ANMA 2O61B 5CHNB 4JFPA 4WY7L 3MV7E 4KROC 1KPVA 3AS3A 4QRUA 3GHEL 3MXWL 3MLUH 4NBZB 1IGYA 2X4OA 3BISA 1B4JH 1NUGA 1I1AA 4XB7A 3H42H 4NQCB 4P4RB 3MJ9L 2CLRA 1JNJA 1J18A 4ODXB 2ZCKL 3QRFM 1EEYB 5IB1A 3MYJB 2ICEA 1MAMH 1RY7B 2NTFB 2ATPB 5EA0H 3BD4A 4V2CB 1FFNA 5I76B 1UKTA 2Z9TA 3E6HA 4DQOL 3FQRA 4LIQL 1OM3H 2R39A 1HHJB 3MV11 1DVFD 3UPCA 4I3SH 1P69B 4JM4L 4R96B 1NLDL 2C3VA 4Z7VE 4PP1D 4UIMB 1UYWL 4NO2B 5MI0B 3R06A 1I1CA 2VLLB 5LG1A 5E6IA 4NRYB 1G7MA 1YNLH 4D9QD 4Y5YB 4MJ5A 4ZYKA 3I9GL 3HR5A 1H9VA 4HFWB 3QUMA 1ZT1B 5E00B 4LSRL 1BX2A 3IAQA 4TOYL 2BVUA 3IFLL 1JV5B 5I19L 3BGFC 1URLA 1N59B 1WZKA 3EOYG 4R97C 3X13A 1FDLH 5EZJA 1XH3A 5FGCB 4Z77A 4OQTL 4Y7MA 4CMHC 5DMIL 3RUGE 3BP5B 4CVXA 4ZFOA 2YRZA 3FB5B 3VFOB 4DK3A 3I50L 1NFIA 4FXGB 3NPZB 4JY5L 2EH8L 4E5XB 4WI8A 4EIZC 1YEHH 2WBWB 3R1GL 3ZO0A 3CUPB 4NNXA 4GUPB 4DTGL 3S37X 3QFJE 4KAQH 5GZND 4Y19A 2XNAA 1M05B 2P8PA 1V3LA 4E41B 1KYOK 1ZOXA 1HILB 4WFHD 1A3QA 3TV3H 5CGTA 2HT4C 2E8ZA 1JGVH 3WLWD 2DM2A 2V9QA 5B8CA 4OF0A 5MERB 1PG7H 3D87B 3EYFA 1TXKA 2HMID 1ZMYA 1L9MA 4Z7WF 1ZAGA 5TFSH 2I60H 3QPXL 3SE9L 1HHKB 3Q6FB 5GGVH 3QULB 7FABL 4JRWA 4HPOL 4PGBA 1T1ZB 1ZEAL 3GSOB 1G9NC 2V2TA 4Q7DA 1EO8L 5C0JB 4YH6A 4OD3L 4XNXL 4MAYC 5D1QA 4DVRL 5BZDA 5KZCB 1YNTA 2OJZL 1CE1H 4ZAKB 3F5WA 1QYGL 2DQHL 5KZCD 1S9VB 4ZAKD 4YHZL 5D8JH 3MRFA 4KJYB 2RCSH 3BZEA 1A6AB 4U1MA 4G7YL 4XPAL 5MHSE 1QFUL 2R23A 4F58L 3DO7B 5DD0L 5F8RC 2FDBP 2WBJC 3I6KB 4AG4L 2YD6A 4DKDC 2YWYA 3VXUE 3S36L 4OZ4A 5BO1L 3HMWH 5I0DA 4OIBA 1K2DB 2B8OT 1K4CB 3MJ7B 5GRUH 1LK3H 4P99A 3AU1B 1LP9F 3N1MC 2IANB 3ARGB 4MNGE 1JJUA 4U4BA 1N7MH 1MJ7H 1KIQB 4X7SL 3MRIB 4U1LB 4ELKB 3KYAA 4MDIB 3V5KA 2YK1L 4QRPE 2BVOA 1T7WA 5CWSA 5IHUH 3TJEH 4PRDA 5C0GB 5E1AB 3W39B 1BGXH 1M7DB 3QBTB 4L3EA 4PLNC 1I1YB 4M93C 1A7RH 1LO2L 4NO5A 3IJHB 3PL6B 4PJCF 5I1CH 4GBXB 4P2QB 5GJTH 2CDGA 4P2QD 4P5TD 5EULV 5AAMA 4IEFB 1Z3GH 3LDBC 5JA8B 5ID0A 1CGSL 1R3IH 4NSKB 2DM3A 4PJ7F 1ZTXL 1EXUA 4WHYH 4YQXH 1N26A 2J6EH 1S9YB 1XF1A 3O4LD 4DCQB 2NXYC 1QRKA 3FFCE 5FGRA 4KKLC 2VDMH 4JFHD 4KY1H 5HHQA 1Q9OA 2ICCA 4Z5RA 2IADA 4CNIB 5L8LB 4G43A 3NA9H 3QEQD 2FECL 1YNKL 3U4BH 3QNYA 2E9JA 1FVEB 3BH8A 5HD8C 1JNNL 1DDHB 3U4EB 1DEEB 2VL5B 1FNFA 4LLDA 1KN2H 1QRNE 2ADFH 3KPSE 2YD3A 1U8MB 4NN7C 2V17L 1XGQA 2F58H 3RHWF 4D94A 1U8IA 3PHQB 5FM8A 3SCMB 5KSAA 3QQ4A 4YHMH 4WENB 3LVEA 2V9TA 3WIFB 5C8JB 1OTSD 3BAEL 3RWCA 1HYSC 3RAJL 5IFHH 2ARJQ 5B3JE 4EOWH 4GMTL 4OB5H 4PJCE 3WS3B 3LKPA 2AJVL 2UUDK 5GJSL 1J11A 2P5EA 3HI6L 2A9ML 2XZQL 5AD0B 2IPUG 1G7QA 3HMXA 5GPRA 4D2NA 2DB8A 1RK0B 3ARFC 3GI8L 5EBWA 4NRXA 2WINB 4YPGB 5SV4A 4DW2H 1OSPL 3MRKA 4PYHA 5IHZB 4PR5A 3EYVA 3J7HA 3JV4A 3PWNA 4QOKA 1FORH 2OJEA 4AL8H 1ZLVK 5DQDL 3TBVB 1MHCA 3PIQB 3MRGB 5HPMB 1WAAF 4JB9L 4LLYB 3M8OL 5DZOA 5CP7A 1HHIB 1H5BC 4W4NA 3SKNB 1OTUC 4A2LA 3T0EB 3S35X 3HS0B 1YY9D 4WI7A 3LH2H 3RX8A 3FFDA 3CFKB 5JXED 5J13C 4Z7UB 1F11B 2FL5B 2O5XH 1CD8A 3GM8A 2VXQL 4ODTL 5MENB 3ZDXF 2X1PA 5D1ZC 3A6CH 4PB9H 1N3NA 5MEND 2YA0A 3T2NH 1RV6X 1CXEA 1KULA 5E5RB 1A4KB 5JIPA 3O2VL 4KDTA 4HC1A 3TA3B 1BAFL 3SDAC 2GAZA 2YA2A 1NUNB 2NY4C 3STLB 4JDZA 5HVGB 4ODUB 2PKDA 4FTVA 3S3JA 2AJYL 2C3XA 2ITDB 5B3NA 3JTTB 2FB4L 4Y2DC 4X4YA 1VHPA 5FYKL 4M3JA 5EC1B 5I9QB 5TQ0H 3L3OB 3V8CA 2R0ZL 2VLME 3IVKB 1RUPL 4C56E 3WJLA 1T5WA 1IEHA 1EFQA 1UKQA 2F8VA 1S7RB 3BKMH 3GMLA 4MWFA 2J4WL 1H3GA 1XGRB 2MOVA 4IDJH 5C6TL 2RB8A 1LWRA 3KXFB 2ENSA 3O3AB 1Y0LA 5FGBA 5ICZB 4JKMA 1WAAE 3DXAA 1I8IA 4PTUA 3GUTB 5IMLB 3D0VA 5C1MB 5L0QC 4HGWB 2AXFA 5C08E 1DL7H 4ZS7H 1HXYB 3HI5L 15C8L 1CFTA 1K4DA 5SWQA 1ACYH 4TRPH 5D6CB 3ZDXE 4JZJA 2FLRT 1MOEA 3EYOA 4M7KL 5EUKB 1AD0A 2EE9A 5IBUB 4WFED 3X11A 4F9LA 3AXLA 4JO4H 5GIRA 5DEFA 4LSUL 4NUJB 3W2DL 1M7IB 4IIQA 1EUTA 1WIUA 4FQLH 4MMZC 4YBLC 1BFOB 4PJBB 3BP6B 3ZHKA 1MRDL 1LO0L 1A5FL 2X89A 3VE0A 2BC4A 3TBSA 3OJDA 1NGYA 1KOAA 4MJIA 2DQJL 2DIBA 1EAJA 1RZFL 3QEUB 3MFGB 3T4YB 3OXSA 1IAII 2P43B 5DUMH 5IGXL 1DSFH 1HKFA 4FZ8L 1DQLL 4N0UB 1JF6A 1FGNL 5EOQL 4DKAA 2RQ8A 3IS0X 1N4XH 2I27N 4X8JA 3KYKH 3WUWA 1MCPL 3CLEL 4TNWK 1RUKL 5HDOA 1UB6B 5E2WH 5J12C 1PY4A 2D7NA 5F7NC 4NWTH 4WVRA 4LLWB 4Q9CA 5KBNC 3M07A 1QG3A 3MV7B 5KSVB 2CUHA 2ENYA 3MV7D 2G5BB 1AR1C 4PD4J 4U1IB 2EEBA 5H2BA 3OG6B 4R0LC 3BW9B 4LVHC 3IKCB 4OJFL 1MJ8H 4RGOL 2BY3A 2WWMC 3WFEH 3AUVA 5EZLB 1CE6B 1N6QL 4NKIH 1LO3L 3CFEB 1ZHNB 5C92A 4WEBH 4TSAL 3VFVB 1P7KA 1RZKC 3NPSC 3GZKA 3Q2CA 1ZXQA 4RDQF 5CEZL 4Y16D 2A74A 3N9GH 4PLJD 5DF0A 1SYVA 4EI5A 1V05A 2YPLD 3THMH 2CKBA 5T5FH 3FO1A 2EIEA 1E4KA 4JFOB 1N64L 4BQ8A 2B20A 5FOBA 2BERA 2F53D 3IXAA 3SKUD 2Y36L 5KVEL 2AQ3A 4TVPL 1G9NL 3L6FB 2QTEA 3LKQB 1Z0MA 4PS4H 4OZGB 1R3KA 2EC8A 3LQAH 3UC0H 2ADIA 1RULH 4M8QB 1HH9A 4OCLC 2EKJA 2OI9B 4Z9KB 4BUHA 2NYYD 3LS4L 2FIKA 1J8HE 1S5IL 3AS0A 4HWZA 5JZ7D 1N2RB 1U8JB 4KJQC 3DX6B 4G42A 1M1SA 3MGOA 3REWB 1NLBL 3PABA 3BDXA 5DD3H 2YHGA 4DUXA 3QFJB 2FJHB 2APFA 5EIIB 3FTGB 3P9MA 4P2RA 5D96B 2YEZA 4EXPX 2RBLA 3GJEB 4TN9A 1G1CA 4WWID 5HVHC 4FQHB 4HIXL 4PJAA 5ISZE 1A4JB 2I9LA 2EKSA 4MSWA 4QRSB 3MOBH 5I8CB 5GQBA 5K93A 4LRIC 1FL6A 4RISL 1CIDA 1TZHB 3MRHA 3BQUD 1KUMA 3EFDH 4LDLB 5IEHB 3VXNA 2Q7NA 5HHNB 1JGLH 2H2PD 4ENEC 4YHLH 1AQDA 4X98B 4NKMB 5JXAL 5DD5H 5CD5C 1F58L 5ID1B 3E6FA 4Z0BL 4YK4C 3DJ9A 3QI9B 3VCLA 4JJ5B 1WFUA 3WIHL 1U8QA 2E27L 3QI9D 3VFUA 5TGBA 3ARDC 3V9FA 5MHSD 2Z35A 1ZHBB 2EXYD 1G7HB 4LPWA 1EH9A 1G7JB 1W72L 3C60C 1WIPA 4WDIA 3TBYB 5DEGA 1CG9B 4JN1H 1IZKA 1RU9H 1T4KB 4FQCL 4UQ2B 3ESUF 4CW1B 2DQIH 3VXUB 3L1OL 1I8MB 2CGRL 3GSNB 3QXUA 3VXUD 4JPIA 4RQQA 3V7AE 2W0FA 1J1PL 1YN7B 3D25B 3RQ3A 3CK0L 3EUUA 3P4NB 1WVZA 1YMMB 3EOTH 5GGQL 4G8EB 2ZZUT 1TZGL 1DQJB 3C6LB 4MNGB 4LKXA 2WQ8A 4EQ2A 2FGWL 4U6XA 3C6LD 2GTWA 2OK0L 1NMCC 4YXLL 4Z78B 4QRPD 5D7IF 3HN3A 4PD4K 1O5DT 2R0LH 5EU7E 2CO7B 4OZIA 3IU4H 2GTZA 3QPQD 4JFDD 1XF5B 3LCYA 4PIRF 4YEEA 3ALXA 3M17A 1GZQB 5CGYC 2YSSA 4WJ5B 2G75A 4PJIA 3E1F1 3V5DB 4NN6B 2F54E 3QQ9C 1C7TA 3QDAA 4HWBL 1FVCA 2XZCH 3ZTJH 1CL7I 5EORH 3S8WA 1WBZB 1ITBB 2R2BB 3EOAB 4P23A 5IW1B 5LBSL 3HUJA 5CEXB 1R3LA 1YEJH 2N1KA 3PWLB 5HSFA 2NY6C 5ACZB 5DJZA 5HI3C 3F12B 1TTGA 2DOCA 3C6SB 1AY1H 1I1AC 2A9NH 2HRPH 4JAMB 5JORB 3TH4T 5GISL 5FUCE 4CVUA 3OAYK 3FFCB 4FMKA 4L8BB 1QHOA 4HT1H 3O6KH 3FFCD 3Q5OA 3P4LA 4PTTA 4BYHA 3STZB 2P24A 5DC9B 1WTLA 1Y18B 1MIEH 3P30H 4U1NA 1G6VK 3R0MA 1R0AH 4K23H 2CQVA 3RWGA 2NR6C 3RIAF 5F7MC 4JY6A 5C0AD 4GW5B 4G6KL 1JUFB 2UYLA 1QRNB 2DQDL 4JREB 3KPSB 2FX7H 3ZE0F 1CLOH 2QLVB 3LEYL 3KPSD 2AERT 3SO3C 3O4OC 5LGJB 4PRHA 5D7IE 4OIAA 5CINH 4FFWC 2BVQB 4JANB 4YC2B 1MWAB 1D9KB 2DWDA 3TT1L 1D9KD 3BPOC 4M7JL 4PJFE 5FA3A 1JBJA 1QNZL 3FO0L 1HDMB 3MO1A 4RGNB 2BFVH 2AJXH 2PYEA 5FYKE 4WHYG 1M7XA 4XT1C 3QEHB 2GSGA 3M45A 4YR6B 5FV2A 2MNUA 1HSAB 4FQQA 1YEEL 4JRXE 3TNNB 1A6TB 5J11B 3TH2T 1LDPH 3WSQL 5IK3B 3MLRH 4L4TA 3VWKD 1ZGLP 4ZQKA 4HD9A 5DVLA 1XZ0A 4FQXA 1AQKH 1MCCA 4DGYL 3QO0B 4F33B 4HIHB 2AJUL 1FPTL 2YR3A 5B8CC 5LGHL 4XPHL 2AV1A 3CNKA 3IFPB 3JTSB 1I85A 2XFXB 4WTWA 4PB0H 3MZTA 3RDTB 4APQB 1I9JH 5ITBL 4LVOC 5HHVL 4I18A 4WI5A 1HK6A 1ZT7B 4XWGL 3CC5B 5IB2A 5T33L 3GSUB 2XPGB 5D1QC 1KLGB 4NM8H 4UDUA 4K94C 4QHKJ 3UXFA 3EYSH 3QCUL 1I4FA 1AJ7L 2W0PA 2VXSL 3FB6A 2NW2B 3VG0L 2EICA 3X3GH 1UWGL 3OAZK 3L3KA 4X6CB 1KIRA 1ZSDB 4R4FL 3W9DA 5FV1L 1MPAL 3QWQB 3VGAC 3HE6A 4BZ1H 3MUGA 4KTEH 2DQUH 4YLQT 1TMCB 1FNSL 1IC4H 5JW4N 1JWUA 4C56B 1AGEA 3FOMB 4YUEL 4HDIB 5IG7A 3OKNA 1GZPB 3AREC 4MD0A 3H3BC 2C7UB 4KKAC 4UAOB 1JNHA 4YE4L 2G2RA 2AKRA 3QIUD 4MJ6A 4MS8C 4XMKH 2VSDA 3IXTB 5I17B 5JA9A 4PP2A 1MFBL 1GC1H 1CD0A 1UJTA 1IARB 3G6DH 1UCTA 5DJDB 4L9LA 3DIFB 5CKAA 5C08D 1FN4B 1NC2D 2H45A 3DSFH 4L4VA 3OGCB 4Y4FB 3ISWA 4YBQC 1A1NA 4S1RL 4MA8H 3MOAH 5AZEL 3BVNB 2IH3A 3OPZH 3PXHA 1D5ZA 2M8XA 4TNWF 2VQ1A 3DMMB 2AK4B 4AM0B 4YHYB 1CLZL 5D7LE 4BK5A 3NN8A 1F4WH 4QGYA 4PRPB 2ADGA 1X4ZA 2C3GA 2E3VA 4JEGB 2VDNH 1UXSB 4WV1C 1REIA 4FQJL 1QZ1A 3C5SA 4R26L 1DTUA 1OAKL 1X6NA 4XMLL 3VD3A 1LNUB 1RZKL 5K9OB 1X5AA 1XF3A 3TYFB 3GSNH 3CDCA 3LRHA 3CFCH 4BUGA 4TUKH 2HLFD 5BOPA 5HGAB 4K71C 5EBGA 5B38A 5BVJB 4TVPE 3TT3H 5SX5K 4KTDH 4UBDC 1BBJB 4GMSL 3FT3A 1F3JB 1JGUH 1H15B 4HUWA 5T3XL 4PJ9B 1KG0A 4AENA 2DQFB 3N06B 4NJAH 4LMQE 3OHXA 4WGWB 5KW9H 3MJ8B 3SDXE 1ZANH 4WNQB 1UA6H 1J1XL 3L9RA 3QIWB 5HY9B 2MKLC 4HKXB 5L7XH 4O2FB 3DECA 4GKSB 2OTUB 3D3VE 3T4AA 4K2UH 3P0YH 1VA9A 3GMPB 4ACPA 4O2CB 1EMTH 3IDIB 3VGDA 4ZFGL 4QF1A 2P7TB 5FYKU 4ZSOA 2XWBA 5KSAC 3Q5YA 4NFCA 1CZ8H 1EGJL 1K3IA 1P1ZA 1CGUA 1R3HB 1FNEB 1S78C 4Q9RH 2QQNL 3QUYA 2OBGA 5TDPA 4MA1C 1QR1A 1BZ7A 4J1UA 3VFGL 3WNMA 4PJEE 5CUSH 4X4XB 5SWZE 3FT4A 3RIFK 3EZJB 3I02B 1HKLL 5AWNH 4N8CH 1K5NB 1VESA 4MQXD 1WUNT 5EU3A 1PKQE 2ZOKA 5IM7A 4JO3H 2VR9A 3VFTB 4F57H 1NCDL 3C5ZC 2BOBB 2NY3D 3U1SH 4IBLT 1FBIL 1A7PH 4FMFA 3QG7H 3IU3A 1OGTA 2MWCA 4KHXH 5LAXA 2GK0A 1BJ1J 1X5GA 4NFDA 2GSIA 5FYJH 2HVKA 4AEHH 2D2OA 5BJTA 2V7NA 4LCWB 4GW4A 3GMRB 3B5GA 3RTQB 1M71A 3SKOA 1W0VA 1HH6A 1JZ7A 3RTQD 2R1YB 3RRQA 2GKIA 1J8HB 3H3KA 1MWAH 3FQXB 2J8HA 1J8HD 3V0AC 4NUGL 5CCKH 1VDGA 3NCCB 2JJVA 3VG9B 3PHOB 4FXKA 1DUZB 3G5VA 2Q6WA 4JHWL 1TETL 1S7UB 2ITCB 1WZLA 3SDCC 3B9KC 1KTDA 3VFWB 4M4RA 1P6FA 4UOJA 2L7JA 4E0RA 3SE3A 1IGIL 4UINL 3A67L 4KDTC 1UZ6F 4XH2B 1PX3A 5I74B 3U46B 5J0BA 1CICA 3CCHB 1IQWH 4PJHA 1S9WB 5D9SA 1ZGLM 5EZIH 4XX1E 4IS6A 5ISZB 5AYQA 5INCB 4D0DB 3CZFA 2VAAB 3B3IA 5ISZD 2IFGA 2E7LC 5I16A 4ZPVA 4OZHE 2XI9A 4O4YL 1CFNA 1FFPA 2VNCA 4Y4HB 3ULVF 2PW2B 3I3EA 1U3HD 5JOPE 2FO4B 4JO2H 4R3SA 5CJOH 1J0JA 1P4BL 3I2CH 4X6DB 1NKRA 4YFEA 3MV8A 3ORJA 4V1DE 3WJLC 2MCPH 3NIDF 3D0LB 3TNMA 4BFIA 4UDTB 3VWJC 3C9NB 4BH7B 2B1AL 1VADA 2FYYA 3FO2B 4OUOA 2E6PA 4DAGH 3LB6C 4U1SA 5FGBC 3K80A 5JNYA 1JGEB 3SKMB 4F7MB 1GGYA 4LBEA 1NCAL 1IGML 2Y5TA 4HCRH 3TO2B 3B2UC 3QDGE 1U93B 2D7TL 3WMSA 5I0ZA 1LDSA 1GCFA 1H3TA 4HK3N 4K9EH 3LKRA 4JFXB 4OGYL 2BOCB 3D39A 1T1YB 4NZDA 4XVUD 4MQSB 1AO7A 5EN2A 4PRBB 3U6RB 3ARYA 1T66C 3WFBH 4OF5A 4XNUL 2BMKA 5I1HH 4G9DA 1MCQA 4F9LC 2PTTA 3BUYA 5DQ9A 3GSXB 3S37L 3HNVL 1UZ6E 4HZLB 1LE5B 5F3HA 1ZHKB 3BZ4B 5I66B 2H6PB 4K7PX 3DVNA 1A0QL 4Z0XA 1UXWA 1YEDB 5JW3H 4WI3A 3SGJA 5DD6A 3EZ8A 4LMQI 3ZSSA 1MJJA 3HG1D 4WWKD 4WY7H 1P5VA 2P5WA 4PV8B 3GHEH 3MXWH 1WZ1L 1EUUA 5E2TL 4K3HA 3MR9B 5DLML 3MV01 3S96A 2A73B 2Z92B 1L7TL 2VR5A 3MJ9H 4BH8A 3KLSA 1OHQA 1HQRA 2ZCKH 5DJ0B 2F54B 3GJFA 1ZT4A 3I6GB 1S8DB 4LAJH 2F54D 4MNHB 2QKIA 4XP6L 1OL0A 2FBJL 4MXQD 3BHBA 4NIKB 1P9MA 3O2DA 3WS6A 1DE4A 1J0ZA 3S4SA 4DQOH 3PNWB 4LIQH 4OGAD 4JHAL 1CDHA 5DFWH 2DYPB 3H7BB 1T7XA 4LFHG 1KLUB 4P0DA 5HYSB 1NLDH 4JKKA 4OZGF 4OKVB 3CX5J 4C83B 2GFBA 2YRPA 4NC1C 1UYWH 2A83A 4I8DA 1BOGB 1SJVA 5ILTL 1KFAL 1SJHA 1UCBL 3MRDB 1CGYA 3I9GH 5BXFB 3NFSL 4FS0A 1IGCL 4NHUA 1T3FA 1ADQA 1RJZA 4C4KT 2PO6C 1MJUL 3S3SA 3Q1SL 4PGCB 4GOSA 4LSRH 4PY7A 1J12A 5CIPA 4TOYH 3IFLH 5I19H 4RBPK 4PJ5D 1WV7T 1MHEA 5CBEB 2YPVL 4ZO8A 4N8VA 5DJCA 4OQTH 3DUUA 1E4KC 5DMIH 4PJGF 1WICA 1TVHB 4HIIB 5EOTB 2XWTB 1XCTA 3CMOL 4Z7NF 2DM4A 3I50H 1GRWA 3TJHD 4LLQB 2CDFA 4JY5H 2EH8H 3UAJD 4TPRL 2J8UF 3BZFA 2ATKB 4GAGL 3R1GH 3UTOA 4JFQA 4GRLC 3ZTJG 4DTGH 4PJFB 3VW3L 4XXDA 5F70A 2D9CA 5TE6L 3O3UN 4PRAB 1NJ9A 1QSEA 2EXWD 3T2PA 1PLGL 3RI5F 1UH2A 3T3PE 4JRXB 5HGHB 4MVBC 3EOBB 3HAEH 3RP1A 3G6JB 1JYXA 3NCMA 3JWDL 5IEKA 1U3ZA 4UT9L 3QPXH 1AGCB 3SE9H 4IOFC 3GBNL 7FABH 5EWIH 4PJDE 2FEDC 3NIGF 3TVMA 4HPOH 1FZOB 1EEUA 1V3JA 1AKJB 4NZRL 1ZEAH 1CN4A 3C5JB 3KYMA 1EO8H 4XNXH 4LGRB 4DVRH 4XAKE 4KROD 1OGAE 2OJZH 2NLJA 3G5XB 4YXKL 1SVZA 1QYGH 2DQHH 5DD1L 2V5RA 1ERNA 4YHZH 5D93C 2EE2A 4PFEA 3WE6B 4G7YH 4XPAH 3LN4A 1IC5L 1WFOA 2EYTB 1QFUH 5JQHC 1Q0XL 1SEQL 3GFUA 3NFPA 4F58H 1LO4L 1U41A 5DD0H 2YN3A 4UOW0 4N5EC 4EXKA 4LHUD 4Z7NE 4AG4H 4L3CB 1U8NB 3Q48A 4U6VL 2R0WL 1CD1B 2J8UE 1RZ7L 5IOPB 3U7AA 3S36H 4OFPA 5BO1H 2WAHA 4LOUC 1ZKAA 2HJLA 4NRZA 4OLEA 3T8XB 2OMBA 3UPRB 5HHOA 1MIML 4JFEE 4XXCA 5JHDD 3S9DB 1DZBA 4X7SH 2V5MA 4JN2A 4JHZA 2EDEA 2YK1H 1MI5E 4G80B 2F8XC 4H0IA 2XWJA 3NZ8A 4HUUB 3KJ4C 3U7WL 3KLDA 1BOYA 3BGFB 4ETQA 1OWWA 4R97B 3U2SB 4JCLA 1LO2H 2BVPA 4Y4KA 5TH2A 3CH1A 4P3DA 5DFTA 1C8PA 1X5JA 3L3IB 4PGJA 5J57B 3OR7B 2W92A 5F71A 3S35L 5IMMA 1JRHL 2X1WL 1MVUB 4XZUA 3VXTB 4P2OD 2G60L 2MTPA 3QCVL 1ZTXH 2E7CA 4DOHE 2MQCA 3RZWA 1R3JB 4B5EA 1QA9B 3G08B 4FOMA 5IHLB 2X7LB 5D7LB 3CX5K 3DYOA 4NDMA 5D7LD 2HT4D 4KKCC 4ZNEE 2EYSB 3O3DB 1W2KT 2FBOJ 2OL3L 3VRIA 2G9HA 2WIIA 1GH7A 1XGPB 4HXBL 4IHOA 4P23C 2J88L 1YNKH 2XKNA 3UYOD 5BOZG 4ZUWA 4L8DA 5E08L 1JNNH 3DVGB 1U8PA 3BRGC 1VB9A 1U91B 1CT8B 3MCG1 4TNVK 3MRMB 2AXGB 2V17H 3W0WB 1BVKB 3P3YA 4MAYD 3UYPA 4E42A 4S0SD 3BWAA 4UV4L 5D1XA 3VH8A 5FDYA 3SDXB 1DLFL 4GG6A 5DURD 1CQKA 4KUCF 1A7BA 1HWHB 3BAEH 4FQ1L 5IR1A 2OP4L 3RAJH 5I8EB 4TQEL 1UH3A 4GMTH 3UROR 3D3VB 4LLAA 1ES0B 3WNLA 2AJVH 5GJSH 1HHGB 2ICWA 4MCYB 3NGBC 3OKDB 2WBJB 3HZYA 5GGUA 2HLAB 3HI6H 2A9MH 2XZQH 2WBJD 4YXHL 3KPPB 3CGTA 1C08B 1KELL 2DBJA 3GI8H 2R1WA 4ELME 1X5YA 3HR6A 3MGAA 2MSPA 1OSPH 2WBKA 5I2IA 1NCUA 2D7OA 3H2WA 2BNQA 3UCRA 4OBSA 4S2SA 3WFHB 4PYGA 3SGKA 3U82B 4PJEB 4NQVA 1N8ZA 5DQDH 5SWZB 3T0BA 4X0KB 3LZFL 5SWZD 4JB9H 3M8OH 1LD9A 2BSED 1PKQB 4UNVA 4WU5B 3QDMA 4RWYL 4M93B 1UEMA 3AM8A 3L5IA 1P4LA 5KSBA 3KPRE 5H35A 4PJXA 1RHHB 2EDJA 2VXQH 4ODTH 3ARRA 2CD0A 2IQAB 3UBXI 5EDXA 1KJ2A 5FKAB 3LDBB 1SYSB 4WW2A 1ZVHA 2JB6B 4FQXC 3KS0J 3FB7A 4KZDL 4QRTA 1W72B 3O2VH 3FONA 1ZVSB 5K33A 4ISVA 1BAFH 3ZTNL 4WCYL 4GW1B 2HFFB 1KXTB 1EZVX 4NKQB 1I85C 1J86A 1KJ3L 4NQEA 5J4MA 1KSRA 1NMBL 3SE4A 2AJYH 2LU4A 2NXYB 3DVIA 1OVZA 4QHMA 2FB4H 1C5CL 5EU6A 4KKLD 5FYKH 4QT5A 2JK5A 2DM7A 3QHFL 1A47A 4CGTA 1KEGL 4OFKA 3PV6B 2R0ZH 1FYTA 3RVTC 1RUPH 4OI8A 1I3RB 3O11A 3MRLB 2DI8A 5CJBA 2GI7A 3CDFA 2J4WH 3GKZA 3FT2A 4MDJB 5F89A 5C6TH 3ZT7A 3NIFE 4U05A 5EC2A 3B9AA 4MD4A 1N6UA 4OZHB 5ENWA 3RVVC 5HDLA 2ZNXA 2UUDH 3WHE1 3BGMA 3HE6C 3GI9L 2XG5A 3N0PB 5F7KC 5JOPD 3DRQA 4Z7OF 1I7TA 2XZAL 3HI5H 2R8SL 3MREA 3WKNA 1MQKL 15C8H 1HYSD 4PREB 1XGTB 4V1DD 3MJGX 2OQJA 1F6LL 2UWEA 4M7KH 2W1NA 3H9SE 3TO4B 1S7TB 4KRPC 3ARFB 3CPLA 2V7HA 4LSUH 3W2DH 2Z31B 1I75A 4ZOEA 1CR9L 4WTZG 2M2DA 3QDGB 1CI5A 5A43C 2CLZA 3QDGD 4G6FD 4WI9A 5DR5L 3F7YA 3UJTL 2YUZA 3EFFA 1MRDH 1LO0H 5DHXB 4I13B 4KK9C 2HAZA 3QP3A 4Y19E 2DQJH 1RZFH 3DV6A 1T22B 5FK9B 5J6GA 4P46D 4FZ8H 1H5BB 1IKNA 5EOQH 1M6OB 1A6VL 1A8JH 2VDKL 4JRYD 5FF6A 5IKCB 3DTXB 3O81A 1MCPH 4X99B 3CLEH 2VZ1A 1RUKH 3TF7C 4UNTA 5J13B 2DQEL 5JIIA 1UC6A 5GGSA 3MV9D 1HXMB 1WCBB 2A6IB 5D1ZB 5T3ZE 1GXEA 5D1ZD 2CKBL 3KDMB 4JO1L 5HGBB 5I8OL 4XNZC 3H9HA 4N8PA 4PJ8C 4OLWL 2XY1A 1T04B 3MLTB 4NQXB 3SDAB 4OJFH 3OKMA 3MLSL 4RGOH 3EBAA 3SDAD 4NC2B 4GAJL 3QFDA 2NY4D 4JDTL 1NCWL 5IJVA 3WNOA 1N6QH 1LO3H 5IJKC 1I9EA 2CMRH 5DVNA 2FR4A 5D6DC 4Y2DB 1EV2E 4TSAH 5FDWB 2WWKO 3REVB 5E4IA 3QISA 2HRLA 5I1IL 4HJ0C 1HSBB 5CEZH 3IFOB 1INQA 4P4KA 4BJLA 1E28B 2V5TA 1U95B 4DN4L 4CVZB 1N64H 4HK3J 4OD2A 3QUYC 1TVBB 4ZXBC 1IM3A 3P11L 1N0LA 2Y36H 3UTZB 5KVEH 1B88A 1JPGA 1TJHL 1UZ8B 3MC0A 4TVPH 5JIKA 5L0QB 4JM2C 2VLRA 1G9NH 5F1IA 1TPXC 1BEYL 3LQMA 5C07A 5LKNA 4JZOA 4JGUA 1AR2A 3NZHL 4N9GA 3MNZA 5FYLL 3LS4H 1BFTA 1S5IH 2JTDA 1JHTB 2QHRL 3IRPX 1MH5B 1JL8A 4N90D 4POZC 2I9TB 5ALBL 3QWRD 3Q3GA 5C09E 1EHAA 2C3WA 3U9UA 4YBLB 4KJWC 3VI4F 1QP1A 3VXRB 1PD6A 5DC4B 3FMGL 1T89A 2EE3A 5JOFA 4K7PY 5CLTA 2WV3A 4G9FA 4HIXH 1GOHA 4JQVA 5H94B 4Z7WA 4HS8L 2NMSA 1X7QA 5EOCJ 2Q87A 4RISH 3CSPA 4QHKI 3KYNB 4C58B 5HYJE 3E0GA 4D9RD 3PQYD 5J56B 5T1KD 5T1LB 1FRGL 5E56A 4PJDB 4KTYA 5J12B 5A0GA 4HJGA 3SE3C 3HRPA 1A7NL 4N0YL 5ACMA 1J10A 4L8CA 5JXAH 4JY4A 1F58H 1OGAB 1B3JA 1AR1D 4HUXA 2H1PL 4M8VA 4Z0BH 1R24A 2NW3A 4R90L 3WIHH 2E27H 4R0LB 4XBPA 3MGTA 1YN6B 5KANI 1Q9KA 1HCFX 4TSBL 3OJVC 5F7DA 1W72H 3MZGB 5ICYB 1EO7A 2JJWA 2WWMD 5DJ2A 1VFOA 2O5YL 1JWSA 4LSPL 4FQCH 2EDLA 5MEOA 5F93C 4MLIA 3NPSB 2P5EE 2GJZA 3L1OH 2CGRH 5C0BA 1KCUL 3VI4E 1DVFC 4I0CC 1J1PH 4TULL 3CK0H 5IROA 1VCAA 3HAEG 3LS5L 5GGQH 1TZGH 5I15L 4JFED 4U7KA 2FGWH 3UTPE 1H8NA 2OK0H 1FVDB 4U1GC 1CFSB 1MI5B 4QOKE 3BMVA 4YXLH 5INDA 3DSNA 2L7UA 4U6YA 3T04D 3VXSB 1F6AB 3VXPB 5J1AB 3JVGA 3KJ6L 4LDEB 3DI2B 5GRYA 4ZUVA 1XIWA 4M02A 2XN9D 3EO1B 5DHVA 2RFXB 12E8L 2A6JB 4H8WL 3BEVB 3DX7B 4HWBH 3SDDD 3HPLB 4TNVF 3SGJC 4KJQD 4NCDA 1WJ3A 3EO9H 2JIXA 5JIHA 5LBSH 2CIIB 1CF8L 2WANA 5HGDA 1F6FB 1UJ3A 1A3RL 1AIFA 1NC4A 2AEPL 2WW8A 2Z91A 5GZNC 4NNPL 4I4WB 5GISH 2R56L 1KCVL 5JO5A 4MX7B 4IMLA 3MLXL 4LSVL 5DWUL 1D3CA 4FTVE 4NO0B 2NNAB 1P9MC 2FHFA 5AUMA 1BMGA 4QNPF 4R2GD 5MEQB 5HJ3B 1KCSL 5SWSA 1IL1B 1U6AL 4G6KH 4KV5F 2A0LC 3ZE1F 4ENED 1X3DA 2XXCB 3FQUB 1HN1A 2IJ0C 3LEYH 4PGDB 4NHCL 4TUJB 5CD5D 4YK4B 3RVXC 4RGMB 2NPLX 3BWUC 3ARDB 2CIKB 2Y7QB 3ARDD 1YPZF 3TT1H 2WIMA 4KVCL 2FEEI 4NNYA 3C60B 3QXDB 4LLUA 6CGTA 3S6CA 1QNZH 5DRNB 3FO0H 3O41B 5DMYA 1NCCH 4YHNB 4OLZL 4M61A 1MFDL 3KGRA 4X9BA 3RPIA 1D6EB 4J8RB 4PV9B 3FO9B 1YMHB 4ELMB 1FNGA 4XHJC 1A3LL 3RWEB 3HC3L 1YEEH 1NGXB 5L2JB 3CU7A 3RU8L 1C12B 3P0VL 1A9EB 3WSQH 2OSLB 1RFDL 1VPOL 3V5HB 1KJMA 5C0CA 1PW3A 1WFTA 3QZWG 1NMCB 3ZDZF 3PP4L 5D2NA 2JJSA 5DHYA 4DGYH 1IAIM 4MJIE 2AJUH 1WBYB 4P5KA 4EVNA 1FPTH 5LGHH 4CRPA 5FM5M 4XPHH 3CXHJ 5L2KA 3KPRB 2DLTA 3KPRD 5LGKA 5CGYD 3EYUH 1FGVL 5ITBH 4OZFB 5HHVH 3WDHA 2CO6B 4NKDA 4XWGH 3DV4A 5FECB 5D5MA 3RL1B 5F7EH 5T33H 1RZ8A 5F7LB 3OAYH 8FABB 4KUCD 5KS9A 1KPVB 4X6FA 2D03L 5KTEL 1QLRB 3UX9B 2NY6B 2X5PA 1WWBX 3B8SA 1IGYB 1RZJC 5E2JA 4YO0A 2NY6D 1CU4L 1D5XB 3QCUH 1KTLA 5HI3D 4H5SA 3BPCB 5ALCL 1AJ7H 2VXSH 5I1DA 3HTLX 1I1AD 3VG0H 3NFNA 2CLRB 1UWGH 1EFXB 3GMNA 5IB1B 4NC1E 4R4FH 1BIIB 5GRWA 1ZHLA 1CDGA 1MPAH 2ZG2A 4EI6B 2VQTA 4Y2OA 5IWLA 1FNSH 5JDSA 2O26U 1KB5L 3GIVB 5DRXA 3AAZB 2Q7YA 4YUEH 3TCXA 4PJAF 5HYSG 4I3RL 2NR6D 2PXYA 1IGTB 1U8LB 3O3BB 1XMWA 3OB8A 1YQ2A 1KGCE 3ZDZE 2FX8L 4YE4H 4MNQA 4KQ4L 4RFEA 3UTSE 3O4OB 2OM5A 5T1DL 1MFBH 5AZ2L 5DJ8A 3PWVA 4JZNA 1ZA6B 4MJ5B 4ZYKB 5E6ID 4S11A 4FFWD 5DK2A 1ZV5A 1KCRL 3R8BB 3VA2C 1QR4A 3QUMB 3AVEA 3GO1L 2X4QA 3BP4B 4S1RH 3ZYOA 1BX2B 3BPOB 5AZEH 1ZA3A 2FECI 1A2YB 3MA7B 4QRRA 5K9JL 3MRRB 4J23A 1XH3B 3H9SB 4Y4KC 5EZJB 4Z77B 1CLZH 3TPUA 1TIUA 4YHPB 3OKYA 25C8L 4HS3A 4FQJH 3G5YA 1OAKH 4R26H 4XMLH 3BMWA 5A2LH 5BS0A 1FFOA 4HKBB 5BV7C 1RZKH 3QAZC 3EYQC 1F5WA 3HRZA 1MY7A 2P8PB 1NPUA 4P2RE 4Y19D 2FJFA 5ESAB 3A6BL 3QJHB 4GMSH 1I7RB 4QHUA 4GRWE 4HKJB 5T3XH 5DVOA 3LKNB 5EBLB 5GS1A 1I3VA 5F96L 2WNGA 4HAFA 3RKDC 5EO9A 3EYFB 1QQDB 5JXEC 1J1XH 3QO1B 3ECBB 2HKHL 3WEXB 4OZIF 4LVOB 5IVXB 5T3ZD 4R4BA 1DQQB 3QR2A 4XP4L 5F1OB 3O9WA 2A6KA 1R5VA 5D1QB 4ZFGH 3OAZH 4PJIF 5BZDB 2ERJC 1IQDA 5D1QD 1XR8B 4XCNA 1A1OA 3VXME 1F4AA 3F5WB 3S5LB 5D1XC 1EGJH 3TWCL 1Z9MA 3VXOB 4LF3A 5E99L 3BGAA 1EEZA 2QQNH 4NN5C 3HUJF 3V4VL 4AYFA 3GSRB 2R23B 5DUBA 3VFGH 1TJGL 3CMGA 3VGAB 1SY6L 3ROOA 3UTTA 5DJYB 4AIZB 2JLLA 3CFBA 4QTHA 3B9VA 1HKLH 3OKOB 4N68A 3DGGB 3RNKA 4UQ3A 4IRSA 1RZIA 1I8KA 5D2LE 2QHLA 1NCDH 3AREB 2IH1B 5DTFA 4XBEH 3WO4C 3DOSA 3HA0A 4KKAD 1FBIH 2NX5E 3GJFK 4I3GA 2BHZA 3FKUS 35C8L 3SGKC 4MS8D 4X7TA 3S88L 3FRUA 4GQ9L 4ODWA 3DURB 5CWSB 3TC9A 3C09B 2VQUA 4K7PL 1HI6B 2V2XB 2EE6A 5F9WC 2A1WL 4YBQD 4OZIE 1AD9A 4L3ED 1YYLL 2QL1A 4ZPTA 1J5OL 4DZBB 1RUML 4X5WA 4NUGH 3BDBA 4MJ2A 1WWAX 4PJIE 1KPRB 5C09B 3LQZB 3TYGL 5DI8A 3IDJA 4JHWH 1TETH 5C09D 3U0WL 4WV1B 2PUQT 4QY8B 4WW2C 5DMKA 5TDNA 1AE6L 1PFCA 2CR6A 2A38A 1IGIH 4UINH 2AXJA 3A67H 4ODHL 3HUJE 5GGRY 1K85A 1T7YA 5IMKA 1FZMA 3PDOB 4Y5XA 4F7CA 4HG4J 3VFNB 2CH8A 2EYRB 1J1OL 4XNMB 5AEAA 4DGVL 2PYFA 1JVKA 3P2TA 1ED3B 2J6EA 3X14A 5HYJB 4O4YH 5IV2A 4I2XA 5KOMC 1RSFA 1P4BH 3P73A 5D72L 2EDOA 4G43B 5CSBA 3DX8B 4NWUL 3MRCB 2ZG3A 3GDBA 4JG0L 4YFLI 2DWEA 5E9DE 1P6AB 5GS2D 4R7DB 5IBTL 4X5XB 2B1AH 2ICWJ 2DQGL 1AGBA 1TQCC 3V0VB 2VSCA 2AV7B 1PG7W 1XGQB 5KSAB 2NY5C 4OZFH 2WP3O 1P7HL 1NCAH 1UB5A 2D31B 1IGMH 3HZMA 5KSAD 1BP3B 1MRFL 1R6VA 5F9OL 1XF4B 3BRDA 1S78D 2CLVA 2X05A 4MA1B 2O61A 5CHNA 2OL3B 3LY6A 3AFLA 1AGDB 3LKPB 1IRAY 4OGYH 3LRSA 2FH8A 2CSPA 2P5EB 4F15C 3QIBB 3TM6A 1N6VA 2PYEE 2P5ED 4XNUH 2W60B 1G7QB 2X70A 3Q0HA 4NQCA 2VE6B 4NOFA 4HMDA 4Y16C 1UWXK 4P4RA 3S37H 3HNVH 3MYZA 3MUY1 4YZFE 5EFIA 1GOFA 4ODXA 4BFGA 4NRXB 1EEYA 3MYJA 3C5ZB 1T1WB 4HV8A 5M95B 1A0QH 1VGEL 2HA1A 2GT9A 3C5ZD 1DN2A 5HHXL 4Y5VB 2NTFA 4MQ7A 3PWNB 3ALPA 3WN5B 3OV6A 5I76A 3K4DA 4QOKD 4NQSB 1UEYA 2VLKA 3H7LA 1ORQA 2ZUUA 4KK6C 1WZ1H 4BK4A 5E2TH 2WWKT 4N1HB 4UT7L 3QUXB 4U3XA 4HIEB 1IKNC 5DLMH 4QWWC 4R96A 1S7QA 1L7TH 4UIMA 1NMAL 4NO2A 2VL4A 2VLLA 4NRYA 1GVIA 4XP6H 4Y5YA 3CDGB 2FBJH 2N7AA 4V2BA 4H0GA 4HFWA 1N5AB 3SO5A 4JG1L 5E00A 3SDCB 3B9KB 2NY1B 4JHAH 5GGTL 3V8OA 1JV5A 2WLZA 3GKWL 1N59A 5L6YL 5FKPA 2ZUQC 1JN6B 5EG6C 1SBBA 3T65A 3BP5A 5DRWB 3FB5A 5ILTH 2W9EL 3VFOA 3PP3K 1KFAH 5F7HA 4U6HB 4FTVB 1UCBH 4FXGA 4FTVD 3QHTC 4ODVL 4XB8A 4E5XA 3NFSH 3FN3A 4OSUL 4X4YB 1IGCH 2EIDA 3CUPA 1N5YL 4GUPA 4GLRH 1MJUH 3RZCC 3Q1SH 4S1SL 5D7JA 1NANI 4M5YL 1M05A 4E41A 3QUZA 2H2PC 3NCBB 1HILA 2YPVH 1NH6A 4P4KC 2ARJB 3VWJB 2ICES 3FOLA 1OB1B 4BSVB 4XI5D 1MHHB 2Q1EA 1OAXL 4M6ML 5J9PB 1Y0LB 1GAFL 4RMUA 3CMOH 1I8IB 3LB6D 3E2HC 1WT5A 3DXAD 4TPRH 3FCTA 1UM5L 2AXFB 1HHKA 4GAGH 3DX9B 4BFEA 4YWGL 3Q6FA 3QULA 2X9YA 3HI1A 3VW3H 3B2UD 4L4VE 4NOBA 3VGFA 1CFTB 1T1ZA 3GSOA 4ONHA 1RZJL 4KRLB 5C0JA 3I6LD 5TE6H 1HOCA 2UZIL 1J87A 2IG2L 1ZWIB 1AD0B 4HH8A 2DL2A 4KJYA 3X11B 1A6AA 5GIRB 4OF6A 3JWDH 1A6ZB 3MBEB 1T6VN 2BVEA 4UT9H 3D18A 4K8RC 1AP2B 4QEGA 3QQNA 2I26N 3GBNH 3DO7A 3FHAA 4NQDE 1F3DH 3I6KA 4YGAB 4F7PB 4NZRH 3ARZA 3VE0B 4CADB 1NGYB 2X89D 3V52L 4MJID 1JIBA 3U0TB 4YXKH 2DTML 5DD1H 1OLZA 1GGIL 3OG4B 3WXVL 1K2DA 1BF8A 1K4CA 3MJ7A 2GEEA 1KACB 5DMJB 2GJ6B 3AU1A 2Y07L 1IC5H 2IANA 3V6OA 1QFWI 3ARGA 1Q0XH 1KIQA 1SEQH 5TDOB 3MRIA 4U1LA 1LO4H 3CSGA 4ELKA 4MDIA 1NDGB 3L5JA 3SEPA 3UO1L 3ELAT 2EZ0D 1JZ8A 4U6VH 2R0WH 4GSDL 5C0GA 3W39A 3UTQB 1RZ7H 1NL0L 3VMNA 1M7DA 1G84A 1VFUA 3MFFA 3KPMB 2GQHA 1OT1A 1CGXA 1C16A 5D71L 3IJHA 3QRGL 3PL6A 1Q72L 2BY0A 4GBXA 2FH6A 4ORGB 1MIMH 4KMTL 5BV7L 4MD5B 1WC7B 1WSST 4U1JB 4NSKA 2MQ0A 2V9RA 2PO6B 2X41A 4ZTPL 3ULUF 2PO6D 3U7WH 2CXKA 2BP3A 2PETA 1P7QB 3GM0A 3VGBA 1IVLA 1S9YA 3EHBC 2CKBB 4LPYA 4DCQA 1PEZA 5IROC 4EI5D 5EB9A 3UTSB 2MKWA 1KGCD 5F7UA 5FOBB 2HTLD 2X6MA 4KKBC 4CNIA 3SGEH 2EDTA 4NC0B 3HZVA 4PBVC 3S35H 2XKSA 1JRHH 3GSQB 2UY6A 1FVEA 2G60H 2DJUA 1DDHA 4GRLB 3U4EA 1DEEA 2VL5A 3JVGC 1FAKT 2DQTL 5SX4I 4OAWB 5CBAB 4PGEB 1FIEA 3PHQA 3SCMA 1XIWC 2FIKB 3WL9B 3B5HA 4FZEL 3WCYA 2KQMA 4LCYB 2OL3H 4MVBD 2AS5M 4HXBH 2J88H 1Q9LB 5E08H 2EEAA 3WS3A 1UJ3C 3K7UA 4HH9B 2ZOLB 3BEWB 4IOFD 3G9AB 4P2RB 5JMOC 5AD0A 4P2RD 2Y9RT 4JPKL 1RK0A 1KXQE 1YECL 4PJHE 2WINA 2EKSB 4YPGA 4MSWB 4YDIL 1DLFH 5EBMB 5IHZA 3VDCA 1LGVA 2OP4H 3BXNA 3TZVA 4TQEH 5HYEA 2YD7A 2V5SA 1G9ML 3O2WL 1FIGL 2WUBH 5L8KB 3TBVA 3PIQA 3MRGA 5HPMA 1QFPA 4Q9QL 1T83C 3RA7L 4N5ED 4JQXA 1U58B 1HHIA 4YXHH 3SKNA 3T0EA 1KELH 1BLNA 1LEKB 3HS0A 4MCZB 4X9FA 3VXMB 4LLMB 3TN0B 4G5ZL 4MHHG 4Z7UA 1F11A 2FL5A 1MCNA 2Z35B 3VRLF 5MENA 5E7FA 2YUXA 5HHPB 1VENA 4LAQL 5J3HC 3IDXL 2Z0BA 3TFKC 2ESVE 2UV3A 4OUUB 2ZPKL 3LZFH 2KUTA 4XTRC 4M7ZC 3D39E 3TA3A 3MTRA 1AO7E 4XAWL 5D2LB 4RWYH 1J0YA 4DKFL 2KZWA 5KAQG 3STLA 2YBRB 4ODUA 5A2IH 2C1OB 2H9GB 1UFUA 2NX5B 3PGDB 5I30L 1XAUA 3JTTA 4J6RL 2NX5D 1Z9SA 3CLFL 5EC1A 2JCCE 1KB9J 2CPCA 5CFHA 3L3OA 5I1JL 5F88B 1KIUA 5D2NC 3IVKA 1BM3L 2JJSC 4JKWA 4KZDH 5E8PB 1L0XA 1S7RA 3W11C 2P5WE 1G7PB 1LK2B 1XGRA 3ZTNH 4WCYH 4H1LB 4L8SB 3KXFA 2NY5L 3O3AA 4R7NB 3OL2A 3MRJB 5ICZA 2EO1A 4XNYL 1YZZA 1KJ3H 1NMBH 1RVFL 4U6TA 4JHBA 3GUTA 5IMLA 4HGWA 1QVOB 1C5CH 1LO5B 1HXYA 3X12B 3QHFH 4MZ3A 4RZCA 1KEGH 1YY8B 3CFIC 4X7DC 5E8DL 5B39B 4P23D 5D6CA 3EDKA 4AK1A 5FUOL 3BOVA 3HCVB 4GG8B 2APWA 5EUKA 2VXUL 1WFNA 5ADPL 2BK8A 2DLIA 3E3QC 4NUJA 1M7IA 4D0BA 2Q86B 4PTTB 1HCVA 1UH4A 3GI9H 1BFOA 2XZAH 4HQQL 4PJBA 5IWLC 1J0HA 3BP6A 2R8SH 4U1NB 3P4MA 1MQKH 3QDJE 2IPKB 4HMEA 4OF7A 5E9DB 1NFDB 3QT2A 3ZL4L 2PNDA 2UZYB 3QEUA 2VIRB 3T4YA 3I84A 3NOIA 3OB0K 2ILLA 4N0UA 2IBZX 4PRHD 2ZUWA 1CR9H 1UB6A 5KSUB 1MAKA 1OW0A 5DR5H 3UJTH 4LLWA 1JZ4A 2VXVL 3MV7A 1TQBC 5KSVA 3JUYA 2PYEB 5IVXF 4D3CL 2PYED 4QCIB 3SKJL 3BW9A 1QSEE 3IKCA 1CGTA 4ALAL 1A6VH 3RJDA 4WUKL 2VDKH 3RY5A 1TZIB 3L3GB 1U92B 5EZLA 2DQEH 1CE6A 1GGBL 2NY3C 3CFEA 2XRAL 1V7ML 3GGWB 4ODBD 4GRMB 3VFVA 4ZQKB 4L4TD 4YDKL 2OZ4L 4JO1H 4FQXB 1OP5K 1JFQL 5I8OH 4AMKL 4FQXD 4OLWH 1U2HA 4NFBA 2FCBA 1F02I 3BKJL 3D85B 1U8OB 4F7EB 3MLSH 3GEWB 4JFOA 1NGWB 4ZMAT 2Y72A 2XICA 2ZUXA 4GAJH 4OZFG 3QQ3A 1IGJB 4OFYA 4RIRB 4JDTH 3WLBB 4NBXB 3T08A 2VXTL 3D2UB 3O4LE 1FE8L 5DO2C 1QSVA 3L6FA 1BHGA 3LKQA 1EERB 5I1IH 3O9WC 3L5HA 4OZGA 4M8QA 1HEZB 4OCYL 3QEQE 4UDUB 1O7SA 4MLSA 4LP5A 1NSNL 4DN4H 1N2RA 1U8JA 2VZ3A 2VMFA 2VTFA 3DX6A 4K8RL 4P49A 1NBQA 3P11H 1XF2B 5HHOE 3REWA 2QADB 3D5OF 1TJHH 3W9DB 1Q0YL 1GPOH 2DRUA 3HE6B 3RVVD 3QFJA 3TBTB 3HE6D 5DDHB 2VH5L 1BEYH 5EIIA 2XT1B 5DS8B 3GJEA 5LVEA 5I1AA 5LXGL 4X9HA 5E8OB 4IRSC 3NZHH 4OLVL 3MLZL 1ULVA 2ZKHL 3U7YH 4FQHA 1EBPA 5LQBL 3L95B 1OAZL 5FYLH 2NY7L 3UJJL 5JQ6L 4J3UA 4MD0B 1A4JA 2X4RB 2QHRH 4QRSA 5I8CA 5KJRL 4NKOB 4F2MA 4F9PA 5FAAA 5ALBH 1LEGA 4KRPD 5FHAL 5IEHA 4WI4A 4CAGA 3V2AR 4L4VB 1VACB 2ADJB 2VJXA 3FMGH 4L4VD 4X98A 1HNFA 1I1FB 2YD1A 5IFJA 4KK9D 1KB5B 1A6WL 1NBYB 3IETA 5ID1A 2VQ1B 5IVZB 3QI9A 4JJ5A 3GSWB 4HS8H 1YA5A 2BVTA 3OZ9L 4PBWD 4CN4A 4P57B 4LP4A 2IALA 3DO3A 3FQWA 1G7JA 3C5SB 3LIZL 5F1SA 4KGLA 2WP3T 1FRGH 4NQDB 4I9WD 3TBYA 1CG9A 4GXVL 5HDQH 4NQDD 1A7NH 4X7EC 1IAIL 1KCLA 1T4KA 4UQ2A 2W9DL 4NJ9L 4N0YH 4Y5XC 3K2UL 1VGKB 4CW1A 2BHUA 4WWKC 3VXUA 1I8MA 3GSNA 4KXZI 4XNZB 3RBGA 4PJXF 4PJ8B 2H1PH 3LEVL 1F13A 1YN7A 3D25A 1X5HA 2GHWB 1YMMA 4LDOB 2VUOA 1RURL 2NCMA 4IRJB 4O51A 4G8EA 4UTBL 2WZPD 3C6LA 1DQJA 4RAHA 4WW2F 4GG6E 4TSBH 1IM9B 2XTJD 1HHHB 3GMMA 2H2SC 1AHWC 1IM9D 1OAUL 5EUOE 2O5YH 3FHQA 4MXQC 1MQ8A 4LSPH 4H1LH 1VSCA 3SN6N 3ZE2F 4N9OB 3MXVL 2KQNA 3S5LG 4FNLL 1XF5A 1KCUH 4HJ0D 1ZK9A 2CUIA 1GZQA 4TULH 2JB5L 2BJML 2EIBA 4WJ5A 2ID5A 3LS5H 4MMXC 5I15H 3IDMA 2QSTA 2LU7A 4ZXBB 1T0PB 4DEPC 4PRNB 3QUYD 4ZXBD 2R2BA 3EOAA 3ES6B 5CEXA 4XPFL 5IW1A 3PWLA 3B4NA 3I85A 4JM2B 4WFGE 4QGTA 1Z9OA 3FT4B 4JM2D 3F12A 1TPXB 3C6SA 4XRCB 5K9QI 1X9QA 1CLCA 3KJ6H 1FCGA 4JAMA 5BRZE 5JORA 5EU3B 3QDME 2YN5A 3FFCA 4L8BA 5I73B 1S5HB 12E8H 5KSBE 4H8WH 2CRZA 3D69B 1IBGL 1Y18A 4M1GL 4POZD 4LEOB 2UWEF 5HHMD 1CF8H 2R29L 1JUFA 1A3RH 1QRNA 5IHBA 2AEPH 1KTKE 4MXWL 2EDQA 4NNPH 3IF1B 3RJQB 4HAGA 2R56H 5MI0C 1MF2L 1KCVH 2X9XA 3SJVA 3HZKB 3Q6GL 4JANA 3MLXH 4LSVH 4Y5YC 5DWUH 1X4XA 1MWAA 2F15A 2R2HB 3QHZL 1IAOB 5EU6E 3T2OA 2FSEB 4WTZA 5FOJA 4YHOL 1VKXB 1KCSH 1V8HA 2VDRL 4JKPL 3FQTB 1HDMA 1U6AH 1FYTE 4YDVA 4EN3B 3LD8C 3QEHA 1JWMB 4PJHB 4YR6A 4NHCH 4F7TB 5ICXB 1HSAA 1DUYB 2H26B 4M6NL 2ZUYA 4JFYB 1QHPA 1A6TA 2IMNA 2AJSL 1JPSL 5IK3A 2DJSA 2EDYA 3W5MA 3KPLB 1WBXB 5D7JC 4KVCH 2WK2A 3QUZC 3UZEA 3HC4L 4OLZH 3QJFA 5ERWB 1T2XA 3MV8D 4BFIB 3QO0A 4HWNA 1MFDH 4F33A 5IESL 4HIHA 5JLZA 4PUBL 1MCKA 5HDBE 2FYYB 2YC1B 1LE9B 4XPBL 1A3LH 1QLFB 3OKEA 4XGZB 2Z8SA 3HC3H 3IFPA 2XIDA 1DVFB 3ZHDA 1SBSL 3JTSA 1WT5C 2XFXA 3RU8H 1IILE 3P0VH 1RFDH 2YPLE 3RDTA 4APQA 1VPOH 3IRZA 2QQKL 3QSKB 1YJDC 1ZT7A 1EX0A 2ESVB 4HCRA 5L88L 4I0PC 4U1GB 2ESVD 3PP4H 2XPGA 1RIUL 2F53E 1KLGA 2B4CL 5C0NC 3D39D 4GAYB 1AO7D 3W81A 1BD2A 4A6YL 5A3IC 2XQYG 1FNLA 2NW2A 2EIZA 5E6ZA 2DQCL 4X6CA 1ZSDA 5IB5B 1F90L 2W65B 3DPBA 1FGVH 1YEKL 3T1FB 3ARVA 3CH8A 3O8XA 2JCCB 3RY6C 4LSTL 4HK0B 1CVSC 5KG9A 3U9PL 4OT1L 4MGXA 4C56A 3FOMA 4HDIA 4P2OC 5KTEH 4J3XA 2P5WD 1GZPA 1CU4H 2C7UA 5ALCH 1PZ5A 3F7VA 2EEDA 2ICWI 3IXTA 5I17A 3V6OC 1CL7L 3ARGC 3S34L 3GJFB 1ZT4B 5DJDA 3MJ9A 3BHBB 4L29B 1FN4A 1B0GB 4K3GA 3K8LA 2OR8A 3OGCA 4Y4FA 3LHPL 4EJ1C 3GRWL 1KB5H 4RWHA 2X1OA 3JWOL 2EDKA 5FUZL 3BVNA 3T3MF 4I3RH 3DMMA 2AK4A 4I5BB 1PDKA 4AM0A 2N56A 2A0LD 3U36A 4R4ND 4U0QB 2FX8H 2J3SA 4KQ4H 4UV7L 4PRPA 3NCYP 5T1DH 1UXSA 2AQ2A 1T7VA 3WIIL 4X6EB 4WFFE 5AZ2H 3RVXD 3K46A 3P4OB 2C3HA 1LNUA 1KCRH 3QDJB 3TYFA 1RJZB 5J8OA 1MCEA 3QDJD 3GO1H 4PY7B 1QACA 2EDWA 4Y8DC 5BVJA 3LEXB 1GHFL 5JPNB 1LMKA 5K9JH 1BBJA 1F3JA 5HYFA 1RK1A 1H15A 4PJ9A 2DQFA 2I07B 3K3QA 1DBBL 25C8H 4LCIL 4OQTA 5A2JH 3MJ8A 4NZTL 4XHJD 4GKOA 4HJJL 2XACC 4WNQA 3M1BA 4Q6IB 3QIWA 4M00A 3ZKQD 4HKXA 2HJKB 4GKSA 2OTUA 1WISA 3GMPA 1NUFA 2KDGA 2LAGB 3A6BH 5DA0B 2P7TA 3KPNA 5TQ2L 3SCMC 4G9FE 1IAKB 5FO8B 1QSED 1R3HA 1FNEA 4Z7WE 5F96H 4GS7C 3T3ME 2RCSL 3QEGL 3QG6B 4JFDE 2HT3C 4WHTB 3HAEA 3UYRL 4O2EB 4FHBD 1AGFB 2HKHH 4X4XA 1A9BA 2X4SA 4P5TB 1YEFL 3I02A 3MLYH 3TVMD 4XP4H 2UVEA 4DVBB 4ONFL 2J7LA 1KBGL 1RUQL 3TP4A 5F72S 1SHMA 2AK1H 1DANU 3VFTA 2Y4SA 1Q8MA 3ZKND 2BOBA 3TWCH 2DMCA 5E99H 3BT2L 1WQVT 1JF1B 3LPGA 4W4OA 3V4VH 3O4LB 4Y0GA 3TZVC 5IMOB 1RZGB 1K8DB 1TJGH 2GITB 1SY6H 4Q2ZA 4LCWA 1INDL 4UNUA 2VKWA 1BVLB 3QCTL 3QEQB 2R1YA 5CMAB 1FG2B 1J8HA 5C0BE 5C0AE 3FQXA 2P49B 1LP9E 4RFNC 3RPKA 3ZZ1A 3PHOA 35C8H 1S7UA 5HHOD 3SBWA 4TTGA 1A14L 1JZ6A 3S88H 2IBZY 4GQ9H 3E8UL 4NM4L 2B5IC 4FQPA 2X2YA 4K7PH 3TA3C 3U46A 3VU2A 1JPTL 2A1WH 1Q9WA 1OAQL 1S9WA 1RAMA 1G6RL 4ZS6D 3GIZL 2PR4L 3SY0B 1CXLA 2X4UB 1YYLH 5INCA 3RWJB 4D0DA 4AIOA 2VAAA 1J5OH 1RUMH 5CZVH 2LQRA 3QNXB 4Y4KD 3WFDL 4Y4HA 1ZE3C 1P4IL 2PW2A 3TYGH 1CDJA 2FO4A 3B43A 4P2YA 2ARWA 3U0WH 3RIAK 4PJ7E 2K7PA 3VFSB 4X6DA 4CDGC 5KVDL 2AEIT 1AE6H 2BNRE 4XZUB 3VJ6B 3QAZB 2X4TA 5BV7B 3OXRB 3D0LA 4ODHH 2LAAA 1ONQB 4FP8L 3C9NA 3GBLA 4UDTA 4BH7A 4XP5L 5C0DB 3EYQD 4HULB 1J1OH 3SKMA 4F7MA 2CK2A 2E7HA 4DGVH 4P46C 2X10A 3ILQC 4LPXA 1JI2A 1OY3B 2G9HB 2YD2A 3V6FA 4N0FA 2HYMA 5D72H 3WNPA 1C5DB 3RKDD 4NWUH 4JFXA 4JG0H 2BOCA 1T1YA 1U8PB 4EDXB 4IOIB 3GMOA 5IBTH 2DQGH 3QZWA 4UT6L 3BKCH 4XPGL 3IJSA 5DC0A 2AEQL 4G8GA 3W9EB 3ULVC 5DQJB 2AJ3A 3KPTA 3GSXA 2J2ZA 4HZLA 4E42B 4WI2A 5I8KL 1ZHKA 4RX4A 5I66A 1BQHB 1CD9B 2H6PA 4GG6B 1MRFH 5D1XD 5F9OH 1YEDA 5D5MF 4NN5B 4D9LL 5KS9F 5EUOB 2DKUA 2HWZL 3BN9C 4W6WB 4NPYB 2K1MA 1FL5A 4PV8A 2WMPA 3DUHA 3GB7B 3T0XA 3HZYB 4PG2C 3MLWL 4MB5A 4S1DC 4M1CD 3MR9A 5CSZB 5CP3H 1A6PA 2A73A 4HLZH 2Z92A 4UIKL 1WK0A 5DJ0A 4B41A 2F54A 1S7SB 1S8DA 4MNHA 1VGEH 1BQSA 4S10A 1OW0C 5HHXH 2BNQD 5T5NG 5AG8A 1LILA 5F3BB 1C1EL 1YUHB 1FO0L 1N8ZB 3PNWA 2I24N 1UACL 3BN3B 2DYPA 4WFGD 4YJZL 3H7BA 1MREL 3JV6B 1OWRM 5D2NE 2APTA 2K3TA 2QQQA 4UT7H 5BRZB 4JDVB 1KLUA 4DFIA 1B0RA 5BRZD 5HYSA 5IB4B 4OM1L 3QDMD 1NMAH 2A2QT 3ARUA 4H0HB 2DD8L 5KSBB 2F74B 3MRDA 2VISA 5BXFA 1EHLL 4K3EL 3CIQA 1FL3B 4YGVB 5E0QA 5TQ0L 2Z4QA 2KL6A 4JG1H 4PGCA 5JPMB 4LPUA 5GGTH 3HLAB 4BSJA 4H1LG 5D5ME 3GKWH 4XCCL 5CBEA 4XC1L 5L6YH 5KS9E 5E70A 1DN0B 3EW3B 1NAML 2APBA 4MB4A 5F6IB 1FCCA 3RY4A 1OT2A 1UM4L 1TVHA 2FX9H 4HIIA 3RWHA 2XWTA 2W9EH 4AH2B 4NQED 3BPLB 1YJDL 4LLQA 5DRZA 4ODVH 3FN0L 3E3QE 4OSUH 1CWVA 2LTQC 5B39G 1N5YH 4QT5B 4CMMB 5EU6D 2X1QA 4S1SH 4M5YH 3ZHLA 1F97A 1FYTD 4FG6D 1I1RA 3L7EB 4PRAA 1WEJL 5GGRB 1TQCB 4AQOA 4JRXA 1OAXH 4M6MH 1L4IA 3EOBA 1D5BB 2MQ3A 1AXTL 4MNQE 3LMJL 3G6JA 5BZWA 1YPZA 2N4IA 5M7QA 1UM5H 1AGCA 4YWGH 3KPQA 1JNLL 3BSZL 1FZOA 1DQTA 5D96C 1AKJA 3O6ML 3FZUC 4WU7B 3QXTA 2P1YA 3C5JA 1RZJH 2C4FT 4QHNB 3ESVF 1OCWL 2UZIH 2IG2H 3G5XA 3OKLB 1JPFB 1H0DB 4Y16B 3WE6A 4UB0L 3SGDH 4F9PC 1KT2A 4RMQA 1C5BL 5JW4Q 1ND0B 2YPLB 4MB3A 2EYTA 4HF5L 5ECJE 4EBQL 1CQYA 4FABL 4Z7VB 4CDHA 4NO3B 1JZ5A 4JVUA 5BS0E 5DYOA 3EFFB 3OWEA 1U8NA 3KNBA 4L3CA 2F53B 1CD1A 3OR6B 2Q76B 1MCSA 5IOPA 4CL7A 1WZMA 4UTAH 2RJMA 5IQ9B 3DV6B 3V52H 5J6GB 4KK6D 2DTMH 1GGIH 5TF0A 3T8XA 3WXVH 3WHE0 2HFEA 3UPRA 4QWWD 4OLUL 2Y07H 1A7OL 1I8LA 1ZLUH 3RUGB 5JTWA 3NABL 5A16A 1FYHB 4G80A 3SDDC 3UO1H 2BSRB 4GSDH 4RMVA 3ZYZA 4HUUA 1NL0H 2J5LC 3ULSB 2AI0L 3PGCB 4LL9A 4EUPB 3U2SA 4DUWA 2ZUQB 4XWOC 5D71H 1JGDB 3QRGH 1Q72H 4P3CL 1HWGB 3QWOA 3L3IA 5F7WC 3CFJB 4KMTH 5BV7H 4XCFL 3CSYB 2R2EB 5B4MD 4HWUA 1MVUA 3WBDA 5ETUA 2GUOB 3BQUB 3RZCB 4R2GC 4H25A 3QYCA 4X7CC 4ZTPH 3RKPA 3RZCD 1ROWA 4HHAB 1R3JA 3O6FA 4LPTA 3QH3B 1QA9A 2X7LA 4P4KB 1MFNA 4H88L 4P4KD 5E5MB 2EYSA 3AY4C 3O3DA 5EZOL 2OR9L 4X80L 2QV2A 2VZOA 4WFFD 2WSKA 1Q94B 1XGPA 5FFLA 2P4AB 4F37K 5DD3L 4LCUB 2YOCA 4MXVF 5GXBB 2P8LB 2VLRD 1MUJB 1U91A 4OLXL 2DQTH 3MRMA 5C07D 1J9CT 3RGHA 4EDWL 2AXGA 4N9GB 3W0WA 1BVKA 3WNKA 1U8HB 3V4PL 2OTPA 1OD7A 4FZEH 2ZNWA 3SDXA 3U30C 1D5IL 1E4XI 1G7LB 2L4OA 3Q3GB 1UADC 5I8EA 2HN7A 1MELA 3D3VA 1ORSB 4LKCB 1U3YA 1ES0A 5EPMB 4K8RD 4MCYA 3R4DA 5FM5O 3DHMA 3SE8L 3OKDA 5C2BL 2WBJA 3O0RL 2HLAA 1C08A 4JPKH 1MLBB 1YECH 4QRPB 4WO4C 3HG1E 1T1XB 4G9FD 3RX7A 4X83A 4Z7WB 4YDIH 2HH0L 1EAPB 4JFDB 4JLRB 2KBGA 3TBWB 4O5LL 1FFRA 4U7MA 1RIHL 4PJEA 5FB8A 1G9MH 3O2WH 5CZXC 1CFQB 1FIGH 3CVHL 5SWZA 4RGNC 3QXAB 1V3KA 4X0KA 4QTIH 4Q9QH 3BYTA 3RA7H 2B39A 3LSOB 2WM0A 1PKQA 3IDYC 4M6OL 4WU5A 4MXVE 2HVJB 3PWPA 5H37H 3DROB 1R24B 4Z18A 3IFNL 5J1SC 4G5ZH 2BRQA 5IQ7L 1IZJA 3MGTB 2FJGA 2DI7A 4DZ8A 5DJAB 3WIHA 1MRCL 3CFDB 4LAQH 5FKAA 3IDXH 1QEWB 1SYSA 2IBBA 2JB6A 3L5WB 1JHKL 4XVSL 1JWSB 2ZPKH 2XA8L 4N5UA 1W72A 2H3NB 1ZVSA 4XPTL 2AAVA 4Q74A 4XAWH 4GW1A 1SEBB 4NP4L 3R8QA 4PGZA 2HFFA 3AS2A 4Y88A 2J12B 5C0AB 4DKFH 4LLVB 1LP9B 1X5IA 5C0BD 43C9B 4PJ5E 3RDTC 3EHBD 4APQC 4BSWA 1S7VB 5I30H 3BP7B 4J6RH 1S7XB 3CLFH 4Z76A 3ZKMC 1T0MB 2EDHA 1RMFL 3PV6A 3GMQB 4KKBD 5I1JH 5E6IC 1BM3H 1X5FA 3MRLA 4K9EC 5CAYB 2VLKE 2HT2D 4U6YB 3ULVL 1SMOA 3UMTA 4MDJA 5CEYB 2NY5H 4PJCB 2A9NL 2W0KA 4XNYH 4LGSB 3MQIA 3MCLL 5FGSA 1XIWD 5H8DA 3O8XC 5KN5B 4HX1B 3WNNA 4FFVC 4PJ7B 1MIEL 5HGGS 1XGYL 2BNRB 4PREA 5E8DH 5JW4M 2R0KH 1GGCL 3O45B 1XGTA 4HWBA 1Q1JL 1MVFA 2BNRD 5HGDB 4DKEL 2VYRE 5FUOH 3VWKB 1AIFB 3VFPA 2FX7L 3ALWA 2HJFB 2VXUH 4YDJB 4MA3B 3TO4A 1S7TA 5ADPH 1A22B 3ARFA 4B50A 2Z31A 4FFZL 1ETZB 4IMLB 2AEWA 1U8KB 2XYCA 5K59F 3CDYA 4HQQH 2FO1A 4Y4FC 1MHPL 4QRQB 1XCQA 3QNZA 1CTOA 3ZE0E 2MHAB 1NBZB 4HGKC 4RSVA 3W82A 3ZL4H 1ACZA 4E41E 5FK9A 3DETC 2EDXA 4YHYC 3RI5K 5HBBA 1CXFA 4TYUA 5E7BA 1R5IB 1O0VA 1M6OA 2GJJA 5IKCA 5C0EB 3DTXA 4X99A 3MPCA 1ITCA 5GRVK 2WQRA 3BI9X 2AQ1A 4QHLB 2Y6SC 1HXMA 1WCBA 2A6IA 2VXVH 3AB0B 4EUPH 1JZ2A 5IP4A 5JHDE 4U31A 3KDMA 5J3HD 3F7RA 2DI9A 3TFKD 4D3CH 3R0NA 4RAVA 3RPIB 3KLHC 1P2CB 1T04A 4HKZB 2OMNA 3MLTA 4XTRD 4LASL 3SDAA 1CFVL 4ALAH 1FNGB 3MUHL 2K7QA 3EDFA 4OCRL 4WUKH 5IW6A 1IGFL 3C2AL 3QIWC 1GGBH 2XRAH 3QIUB 1V7MH 4Y2DA 5FDWA 4X6BB 3U48A 5C0CD 4YDKH 5HVFB 4XP1L 2OZ4H 4P59L 1HSBA 1JFQH 5K59E 5D2NB 5C08B 4AMKH 1NC2B 3IFOA 1WWCA 2XY2A 4P5KB 3BKJH 1E28A 3W11D 3PDDA 1U95A 2CXGA 4CVZA 1MLCB 5TF1L 2YS4A 1CVRA 1A6UL 1QFWM 2ZJSL 1FNAA 2VXTH 1L6XA 1UZ8A 3RWDB 4O02L 3V6OE 1FE8H 2B7DT 3VI3F 3VFMB 3HPJA 2J8OA 4OBRA 1IFHL 2CUMA 3KPOB 1RZ8B 3L3HB 4OCYH 2X09A 4HW6A 1UT9A 1KTLB 1JHTA 3L3DB 1NSNH 1XR9B 4HLZG 4JFFE 1MH5A 3O6LL 4JPVL 4K8RH 4URTB 4W4OC 2I9TA 4A6YB 4Q9BA 3LAFA 1Q0YH 3D48R 3OB0H 4DK6A 2VH5H 4R9HA 4YHKL 3BX7C 3VXRA 5HYQA 2Q7YB 5LXGH 5DFVC 4OLVH 4NT6B 3MLZH 2ZKHH 2E6JA 2OR7A 5LQBH 1BQLL 1OAZH 2NY7H 3UJJH 5H94A 5JQ6H 2VRAA 3VG9C 4S1QH 5KJRH 4OD1H 4MNQD 3KYNA 1CXKA 3DRTB 3SBWC 5FHAH 4ZDHA 4QXTB 5DJ8B 5T1LA 3V6ZB 2MPAH 4CU7A 4PJDA 2BRRL 3V6BR 4X7FC 1P5UA 2VB5A 5F6HJ 5I74C 2OTWB 2X4QB 1T6WA 4YNYB 3T1WA 3QUKB 1OGAA 4KTDL 1A6WH 4Z7UF 4QRRD 1JGUL 4N1EA 4JE4B 3OZ9H 2QQLL 4Y4HC 1YN6A 3RVWC 4HS3B 5E1HB 3LIZH 1OP5H 5F1NA 5ICYA 5ADOL 4KDVA 2NY3B 4GXVH 5BS0D 2YKLL 1IAIH 4KC3B 4P48A 1R5WB 2W9DH 4NJ9H 4CUCA 5IFAL 2NXZC 3K2UH 3QDHA 4K7FA 1RUAL 1Y6NR 3LEVH 1JTOA 1RURH 1ZLWH 4PRIA 4UTBH 1MCRA 1INEL 4NZJA 1MEXL 3WFCL 1FVDA 4AT6B 1OAUH 1MI5A 1NQBA 3VXSA 2VC2L 1F6AA 4XP9L 5DO2D 3MXVH 3VXPA 5J1AA 2Q8AL 4FRWA 3O9WB 4FNLH 5CJ8A 1B2WL 3O9WD 3T0EE 2X44D 2Y06L 2JB5H 2BJMH 4F37F 2EDFA 4K07A 3EO1A 4LF3B 2A6JA 1BQUA 4S0TD 3BEVA 4Z7UE 5F9JB 3DX7A 1EGJA 2J1KA 1Z2KA 5C0IB 2NZ9C 5T1MB 1OQXA 1I7UA 4XPFH 2CIIA 5IB3B 2VDLL 1PYWB 1U3HB 32C2B 3UTTD 3S98A 4GT7A 3NH7L 4KGJA 4PLKC 2R69L 4IRSD 3MRNB 2F5AL 2YZ8A 3C8KB 1FZJB 4PJBF 1WCQA 4MX7A 4XI5C 4U1KB 4NO0A 5E5UB 2NNAA 2E5EA 4LRIA 3EDJA 1XGUB 4PG9B 2HTKC 4ZUSA 1IBGH 4M1GH 4X7TB 1FSKC 3PDGA 5MEQA 5HJ3A 4U1HB 2VLJE 2Y5EA 1BWWA 2R29H 1OF2B 4U33A 4LPVA 4MXWH 3BO8B 1F42A 4UUJB 3GNML 4PGDA 4TUJA 3V0WL 1E6JL 5FO9B 1GIGL 4P5MA 1MF2H 2V5YA 2B2XL 4JZJC 3Q6GH 1JP5A 1QTYT 1VEOA 3O3EB 1GSMA 4CU8A 4IRZL 3QHZH 2CIKA 2Y7QA 3IDJB 1UVQB 5FA4B 4KK5C 2G5RA 4YHOH 5FM4A 4JRYE 3C60A 3QXDA 5DMKB 1W0WB 2VDRH 4JKPH 4IIQC 4LNRB 5DRNA 1KEML 1KJVB 4YHNA 3FRPG 1MFAL 1D6EA 1QSFE 4J8RA 1FZMB 3MV9E 4PV9A 1OLLA 3FO9A 1YMHA 3HG1B 4WWKB 4ELMA 1N0XL 3RWEA 2VAJA 1NGXA 5BW7A 5L2JA 3IGAB 4M6NH 3ULVE 2BSSB 1QO3B 2AJSH 1G6RB 1C12A 1JYVA 1A9EA 3HHRB 2OSLA 5IV2B 1JPSH 4YEFA 2ZSWA 2E7BA 3G5ZB 3P0GB 4UU9B 3NIDE 3P73B 4PJBE 1AHWB 2XZZA 2H2SD 1FV1B 3HC4H 3QUML 3WDIA 5IESH 3G04A 2EZ0C 3ZKXB 2AJZB 1WBYA 4PUBH 1BQHG 4XPBH 2SEBB 1DQDL 5F7YC 2BNUB 3MRBB 4DJMA 4F8QA 1SBSH 3L3JB 3IB4A 3TIEA 2VITB 4ZFOL 2PW1B 3ILPB 4OZFA 2QQKH 4JM4H 4HIJB 4BKLA 5L88H 4OCWL 5FECA 3RL1A 4DEPB 1RIUH 3MX0A 1OTTC 8FABA 3RUGF 1GYAA 3BIKA 3LRSB 3B8YA 1T2JA 1QLRA 4GXUN 4LQ1A 2B4CH 1VFAB 4R6UA 1TNMA 1D5XA 2IMMA 1NAKL 2V2WB 2Y25A 2X70B 4KQ3L 4LARL 3BPCA 4XMPL 4A6YH 3K81A 5E8NB 4PJ5B 4NQCD 5EFIB 2DQCH 1EFXA 4MJ4A 1F90H 4EI5C 1BIIA 3EGSB 5ESVA 1YEKH 4HV8B 4EI6A 3GSVB 2GT9B 5D7IB 4LSTH 4MQ7B 2HTLC 3U9PH 3BH9B 4OT1H 3GIVA 4N90E 3AAZA 3SPVB 4Y1AE 1CCZA 5T3ZL 2VLKB 5GSRB 1ORQB 3VRJB 2VLKD 5I1LB 2WLYA 4U2ZA 3BDYL 1IGTA 1U8LA 3O3BA 3STBA 5DZLA 1EVTC 1I3GL 4ZFZB 5H37G 1S7QB 4IJ3C 4K94L 4XVTL 1CL7H 3IJYA 3S34H 1I8LC 5IBUG 1AXSA 2BCKB 4YAQB 1ZA6A 1F45A 2C5DC 3K0WA 5DSCB 3LHPH 3GRWH 3BP4A 4D9RE 2H8PB 3PQYE 3JWOH 5J6HB 5FUZH 1II4E 3PJSA 3K8KA 1A2YA 1UWEL 3MA7A 4KHTL 4OZGE 5F44A 1FO0B 5IIEB 5JHLL 3MRRA 5FKPB 3H9SA 4G6ML 4RNRA 3H0TB 3LD8B 3HNTL 3INUL 3T65B 4UV7H 4YHPA 4KROB 4OD3H 3WIIH 3AMLA 3EJZD 2C1PB 3LOWA 4HKBA 2IAMA 5C3LD 3RWIA 4Z95L 3NACL 4WW1B 5D7JB 3IDGB 1Y6MR 3O6FC 1GHFH 3QUZB 5D7JD 5I1GL 5ESAA 4LVNC 2FWOB 3QJHA 3QUZD 1I7RA 4E41D 4PJGE 3T77A 5HI5C 4LHUB 2P46B 1F4XL 3FOLB 4HKJA 4KPHL 1RJCA 1JYNA 5EH1A 3LKNA 5EBLA 1DBBH 1CDBA 1NAMB 4LCIH 3OGOE 4NZTH 4HJJH 2FEEL 1QQDA 3QO1A 5A1AA 3FCTB 3ECBA 4XHQA 3L7FB 3WEXA 2D7MA 5EWIL 5IVXA 4W68A 5EU5B 3HI1B 5BQ7A 3MMEB 1KLFA 1DQQA 1MAJA 5JHDB 2X4PB 4KFZC 2F19L 4ONHB 4I0PB 4FFYL 4QYOB 4I0PD 4YIQB 3NMEA 4UI2A 4RMWA 3DBXB 1HOCB 5TQ2H 3F7QA 1XR8A 3S5LA 5JR1L 5C0ND 2W91A 3VXOA 3VD7A 3QEGH 5A3ID 2QSCL 3OF6A 3V4UL 4TVSa 3NIGE 3GSRA 1YEGL 3D18B 2DDQL 3UYRH 2UVFA 4LEXL 2XN9E 5DJYA 4CMHB 5DT1L 4AIZA 3U0PB 2E9BA 1YEFH 2JJUA 1KPUB 5GRXG 3OKOA 3IDNA 2MCG1 1NEZB 3DGGA 4ONFH 1FJ1B 1KBGH 1RUQH 4P2OB 5D70L 1CGSH 3P77A 3AREA 2IH1A 3CVIL 2CR3A 2AGJL 3BT2H 1IT9L 1YMME 4AEIL 2XKUA 2IAND 3ARGD 2GCYB 3DURA 1Z6JT 4CBPA 3VA6A 5GS3A 1INDH 4EUPG 2NY2C 3QCTH 4Q6YA 1HI6A 2M1KA 2V2XA 1S7WB 2N7BA 4XNQB 5C7XL 2NY0C 3MFFB 4JFFB 4DZBA 3HMXL 1C16B 5B3JF 4JFFD 1KPRA 5C09A 3ROLA 3PL6D 3LQZA 4JVPA 4GBXD 2X40A 4MAYB 4WV1A 1A14H 4QY8A 2ZG1A 4W81A 1HZHL 3BUTA 5DURB 3E8UH 4NM4H 5DJ6B 1E4JA 3PDOA 1JPTH 3VFNA 3DYPA 1OAQH 3ZT5A 3MOQA 1G6RH 4ZUUB 3GIZH 2EYRA 2PR4H 2YPKB 4XNMA 1KIPB 4D8PB 1ED3A 2JELL 4TUOB 3WFDH 5HYJA 1PEWA 1P4IH 1S3KL 4XVJL 3HZVB 5TPWL 1JPST 3DX8A 5KVDH 3MRCA 1BFVL 1T21B 3K2MC 4R7DA 4FP8H 4X5XA 4XP5H 1FLRL 3V0VA 4OM0L 5FYJE 3ARBA 4HUVB 2AV7A 4H20L 3G9VA 3ZDYF 2F5BL 1NEUA 3FQNB 4HC1L 2DAVA 4XCEB 3CD4A 2D31A 3SCMD 3SJVE 1T20A 1BF2A 4GS7B 4BZYA 1XF4A 5IVOA 1K3ZA 1EA9C 5F21B 3RGVA 1NDMB 3MROB 2OL3A 2HT3D 1AGDA 4M9OA 3MNVB 3QA3B 1W8NA 4HMCA 2X4NA 3RL2B 4RGNE 4UT6H 3QIBA 4XPGH 4AIXA 4JGJA 3CXDL 5E4EC 2W60A 5FO7B 2AEQH 4M62L 3TO4C 2IF7A 4X6CF 1JK8B 4NCC1 2VE6A