2XI9A

Pilus-presented adhesin, spy0125 (cpa), p1 form
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
313
structure length
304
Chain Sequence
TSVLIRKYAIGDYSKLLEGATLQLTRVFSSNDIGERIELSDGTYTLTELNSPAGYSIAEPITFKVEAGKVYTIIDGKQIENPNKEIVEPYSVEAYNDFEEFSVLTTQNYAKFYYAKNKNGSSQVVYCFNADLKSPPDSEDGGKTMTPDFTTGEVKYTHIAGRDLFKYTVKPRDTDPDTFLKHIKKVIEKGYREKGQAIEYSGLTETQLRAATQLAIYYFTDSAELDKDKLKDYHGFGDMNDSTLAVAKILVEYAQDSNPPQLTDLDFFIPNNNKYQSLIGTQWHPEDLVDIIRMEDKKEVIPVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Highly Unusual Thioester Bond in a Pilus Adhesin is Required for Efficient Host Cell Interaction
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Cell adhesion
molecule keywords ANCILLARY PROTEIN 1
total genus 90
structure length 304
sequence length 313
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08341 TED Thioester domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.480 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2xi9A03
2.30.30.670 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2xi9A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xi9A01
1YZZA 3HNSH 1DQDH 3MRFA 4Z7UB 3UZEA 1WBXA 4NM8H 3TLRA 3LRSA 3DSNA 4GG8A 3QI9A 1MFAL 4LPYA 4LCWD 2Q87A 4M7LL 4XXCA 2CK2A 5L0QB 4QRTB 1GIGL 4KI5D 4K7PX 4BSWB 1NJ9B 4PJFF 2Q6WA 1TPXB 1NFIA 1G9ML 4ZS6D 4LHUD 2D31B 4S1SH 2XV6B 2FGZA 3TM6A 4M7ZC 5MP6L 2X09A 4NN5C 4HDIA 3SPVB 1KJVA 1VGKB 3ULUE 3AROA 4TSAH 3MRRA 3OF6D 4HIEB 4LCYB 1JZ4A 4UILH 2PYFA 5EWIL 4JFPA 4DTGH 3NH7L 2BVPA 3M1BB 2DTML 1MFDH 1RIVL 4GAGL 1I1FB 3TA3B 4YWGH 1R5IB 3W9DA 2X4SA 2X42A 3DVGB 4ZD3L 3SKMB 4JJ5B 2ATPA 3MBXL 1OPGL 1B6DA 4NHCH 4HW6A 1XR8B 4G9FB 5FOJA 2C9AA 2Y1VA 5IVXF 4ZUUB 4HIXH 1CXHA 1T7YA 4NN5B 4ZSOB 2IPKB 4OSUH 1P7HL 1FH5L 4Q6IC 1IVLA 1KT2B 1AHWC 3UTQA 3VFOB 5HHXH 1CDUA 5DEFA 1EDQA 1WVZA 4F37F 1F6AA 1NMAH 1P9MC 1MCDA 2X44D 2WBKA 3SCMB 1K5NB 3FQXA 3U0PA 2MOVA 2FO1A 5DA4A 4M7KH 2JCCF 4N1EA 3RX8A 2D9QB 4CNIA 2FSEB 2OCFD 3KGRA 4UT7L 3V5KB 3EO9L 3K2UL 1JHLH 1SYSB 2ZG1A 4KAQL 5IWLC 4UU9A 4MA8H 2ZPKH 2FECL 3PWPD 4PGEA 3DVNB 4EDXB 4EBQH 2OS7A 3G6AB 4L8DA 2PYEA 2CJUH 4H8WL 2W0PA 5IFAH 4U6VL 4OZIE 1ZHLB 4UB0H 2BFVL 4WFFE 1OM3L 4OM1H 1RSFA 2H2PD 4WW2B 1HDMA 1E4JA 2H45A 4LASH 3OJ2C 2AXGA 5KAQF 1JGLH 4LP4A 5HJ3B 2ED9A 2B20A 3QIUD 3PJSA 2EYRB 5JQHC 4U3CA 4Z8FH 2FHBA 2VDML 3BHBA 4L9DA 3JV6B 3ZTJG 5KVFH 3O3UN 1FZJA 3PV6B 3T77B 3ZKXC 3HA0A 4Z77B 5DJZA 4YAQA 4APQA 1UWEH 2PO6A 3S98A 1Y18B 4PJAB 3WS6C 4WU7B 4C56D 5HI5C 4OIIL 1I7UB 4N0UB 3STZB 2J6EA 4TSBH 3FZUC 4NQEE 3V5DB 1RAMA 4J6RL 1VGEL 4PBVC 2PR4H 3RGVD 3DPBA 4TULL 2APVA 1NFDE 2ARWA 3KLAB 4GO6B 5I1EL 1CBVL 4DW2L 5KSVA 4HIEA 4LCYA 2H41A 3QCTL 1XR9B 2VLRE 1DVFA 3DJ9A 4MNQD 1RD6A 3IJYA 3D39D 4U0QB 1MH5B 1INEL 5HI5D 1ZHNA 3C8DA 4HS6B 1BJ1H 4Q74A 3UTPE 1OB1A 2VLJB 3GHEH 2AQ3A 1N59A 5CJXC 4R7DA 1HHKA 4LPCA 3EYOB 4WU7A 3D85A 4LHJB 3NCJH 3FB7A 4PJIB 3FOMB 3QIBB 1VSCA 1F3JA 1IBGH 2WLZA 5AYUH 5H8DA 1U36A 3TIDB 4MQ7A 3L3JB 3HZMB 1AR1D 4LL9A 1Z9LA 3WL9A 1GH7A 3LKSA 1QRNB 2R23A 4P2OB 3S5LA 4JEGB 3LMJH 4JHAL 1IRAY 4PLJC 1MJ7L 4X7DC 5J6GB 4OQ1A 4RGOH 4OTXL 5JW4N 1JNHB 2W9DL 2Z93B 3LZFH 5HJ3A 1IC5L 1KC5H 1J0JA 4GBXA 1G6VK 3UTZB 1OF2A 1IGFH 4XPAH 5D1ZD 1MRFH 4HUNB 2OR9H 1U6AH 1PGRB 3EOAB 4QRRE 2HT4C 3ZE2F 1MI5B 4XVTL 1IAOA 4K9EC 2RCSL 1B3JA 1C8PA 4L8DB 4JE4B 4UTBH 2WUBL 5A2LH 1HHGA 4HIHA 5C0RL 5KBNC 1NCTA 2J4WL 2EDBA 4X4YA 2WNGA 4HCRH 1AO7B 4D3CL 2MNUA 4WO4B 1FG2B 5CLWA 1SBSH 2CUMA 1OTUC 3KJ4B 3TT3L 5I1GL 5AAWA 5I16A 2ADJB 1M71A 1NCDL 4N8VB 5EZLB 3O4LE 2XZQH 4TVPE 3GGWB 5EU6A 1BECA 1C5BH 3VXRA 1KT2A 3GMQA 3LZFL 4Y0GA 4Y4FC 2GK0B 5E8DH 4NM4L 5DUPL 5J8OA 3TC9A 1AQDA 3DMMB 1ZLSH 4J4PC 3L5JA 3TH2T 4EN3A 3QEGH 1RFDL 4LKCB 4MXWH 1N0LA 3GSQA 4M4RA 4QY8A 1QHPA 4NKOA 1NLBH 2H8PB 1U92B 3ARFD 4OUOA 3LEVH 3ULVD 4MQXC 5L88L 1F2XK 4HUMB 4LVEA 2D3VA 1P4IL 2P5EE 5D1XD 2PYFB 4TQEL 1T5WB 5HDLA 4XPHH 5TJWK 4OCMC 1REIA 1IKNA 1Q9WA 1X5LA 2JJSA 2VLME 3SE9H 4NO2B 3SPVA 4RDQG 5F9JB 3VJ6A 1EHXA 4OFYD 4YK4C 3ZTJH 1XF4B 3F58L 2FJGB 5ETUB 3MLRH 1QHOA 1QRNE 2R2HA 3V4PL 3K2UH 3P77B 3C5ZD 3L3KB 1S7UA 2VXQL 2ZJSH 3OJVC 3A67H 4FTVB 1IM9B 1YC8A 3AM8A 1Q38A 1SY6H 4KJYA 3QDGE 4M93B 3JVGC 1FZMB 4EJ1C 1J10A 1CR9L 3LV3B 5T1LB 2P46B 4MHHI 3MO1A 3S88H 3CVHL 1U8KA 1W0WA 3BH9A 5GISL 3ULVH 1DN0A 3DVIA 5HVHC 1KYOJ 3EJYC 1E28A 4F7MA 5ID0A 1TFHA 2XACC 5JO5A 2A77H 3EFFA 1HSAB 4Y5VB 5IQ7H 4R90H 2HMID 3RZCA 3ZZ1A 3BKYH 1NCCH 3T09A 2CDGA 4U7KA 1NGWA 2H9GB 4EQ3A 2OMBA 5J56B 1KEMH 1NDGB 1KJMA 4QCIB 3IGAA 3MLWL 4XCEA 5C86A 1AXSB 5F3BB 2A2QT 4M4PA 5IHZB 4M5YH 1DLHB 1N8ZB 5D7LD 4KAQH 5CD3A 4RAUA 3HKFA 3IU3A 2IPTH 2C4XA 5CD5D 4XX1G 3O6KL 5HHME 1CD1B 2NXZD 3FN9A 3FTGA 2BRRL 4NRYB 1PX3A 4P5MA 1YNKL 3DETC 4IOFD 5I76A 2H32A 4XNUL 4PJBB 2CLVA 5SWQB 2QHRL 5KAQG 3KS0H 5HHPB 2APWA 3K74B 1AP2B 1FNGB 4LIQL 2VL4A 3F5WA 1DQML 1VPOL 1HN1A 4PV9A 1RZGA 2R29L 2EDNA 3S37L 1QSEE 1X5HA 3BE1H 1T2QH 4DGYH 1KYOK 3F12B 3QZWA 1MCEA 4M1DL 3WSQL 3MGOB 5IUSA 2H6PB 3L95A 4PP1D 5IJKC 4TNVF 1U3HB 1HCFX 2WQRA 1FFQA 1F3RB 3K8MA 1RURH 5E95B 1F02I 3VXSE 4L9LB 2AV1A 2J8UB 3D69B 2ZNWA 5A1AA 4AY0A 3QI9D 2A6JB 2JB6B 3OQ3B 5TQ0H 4Z18A 3O0RH 2IJ0C 1AGEB 3RX7A 3GMPB 1PZ5A 2FL5A 3U46A 1JP5A 4FFYH 2EH8H 3FKUS 2ICWA 4PJGA 1CICC 2GHWB 1EK3A 1KBGL 5DUML 3BO8A 4PJCB 1BOYA 1UM5H 4JY4A 3O6FA 1N2RB 2ADFH 4DKEH 4HH9B 4J1UB 3L9RB 2DBLH 4QWWC 3TO4C 3K4AA 1BVKA 1RZKC 5TQ0L 2DJSA 4N0YH 1BVLA 4G8GD 1EHLH 4HWNA 1B4RA 3NCFB 1T20A 3HCVA 4IJ3C 3SDYL 2VZUA 4HJGA 2Y72A 2YD9A 1KXVC 1H3WM 1INDH 4D8PB 4DZBB 1W0VB 1YECH 4H0GA 4LSUH 4PJHE 5JUEH 3GI9H 3VXQA 2NW3A 2HRPH 5IMOB 5HBBA 2H3NB 3C5JB 3UDWC 5D1ZA 4JN2A 3NCCB 5JPMB 1RJCA 5I1LB 3LN5B 2IALA 4ZXBC 3MV8A 5H37H 1YECL 4AT6B 4MVBC 4RCAA 1KEGH 1UXSB 4XCCL 2VZOA 2DJUA 1MVUB 1OPGH 2J6EL 2R0ZH 3DRTA 2DQUL 3UP1A 1XGQA 5B3JF 3EOYG 1UM5L 4DEPC 4UILL 4EN3C 5AUMB 5HGHA 3IETB 3K46A 3TWCH 4O2FA 2G5BB 2VITA 3GM0A 1RUAL 3K3QA 3HPLA 1T4KA 1RY7B 1SEBA 4Z7UE 5IB1A 3X17A 2E7CA 3QQ9D 4WI6A 2Y36H 1MFCH 5E2UH 5KSAA 1MLBB 4OD1L 4L8SA 4RBPK 4GMTL 2YD6A 4G7VH 4Y7MA 2AI0H 2XQYG 1FORH 3MBEB 1C08B 3FFDA 3P3YA 4X7CC 3HMXA 1AI1H 4S2SA 3I6LD 3OKOA 2FZ3B 1I4FB 2IBBA 1IEAA 1QFHA 4OLZH 3UTTA 5ESVA 3HZKB 3IDNB 3RPIB 2DQDH 3GI8L 3P4OA 5K9OA 5DO2D 5JDJA 4MNHB 1T2JA 3HC0A 3OKYA 4EIGB 5JHLL 3ROOA 5EZIL 3B9DA 5JW3L 4CW1B 3P4MA 2JIXD 3VFWA 3MLPA 3NCBB 2BHZA 4IRZL 5T33H 1AGBB 1QEWB 3U9UA 43CAB 4OD1H 2BNQA 5JR1L 3NIGE 1V5JA 2NY3B 4DFIA 2VSDA 1MEXH 5SV3A 4YEFA 2P8PA 1U8NB 3C6LC 1RUAH 1IC4L 4KDWA 4L8CB 2QQKL 4KUCD 3GRWL 2HP4A 4MMXC 5I75B 1CDBA 5A0LA 1KEML 1ES0B 1S5IL 4LOUC 4AEEA 4X9HA 5TE6H 5GGUB 5C0DB 3ZDYE 4NYLA 2C3XA 1DBBL 2Q1EA 2P47B 1R0AH 4HJJL 4OQTL 1VFAA 3N06B 3VXRD 4FFWC 4WV1C 4QWWD 3D25A 3TO4D 1Z2KA 2B1AH 2KQMA 4X4XB 2XICA 2B7DT 3AB0B 4XNXH 3G08A 5F7UA 3OGCB 5IMMB 4PJEF 4YHKL 3NABL 3RA7L 4M3JA 1P2CB 3RU8L 2ARJA 3EYFB 1G7MA 4UI2A 5GHWH 1UM6H 4KROB 4MNHA 4LLUB 3R8BB 5ESVB 1IM3B 1Z9MA 1NDMB 2DQIH 1HHJA 3RVTC 3RL2A 8FABA 1U9KA 3U0TB 3VXNB 1H3UA 3U0WH 3VXPA 2DICA 2GT9A 3LPFA 4KVCH 4X7FC 5DURD 2J12B 3ARUA 4C57C 2WP3O 4YQXH 4F15B 1EUUA 4KKNA 2XN9E 4JVUA 4PJDE 4MD5B 3M8OH 4HUKB 4RZCB 1KN2L 1HXMA 3Q5OA 1MFEL 3GMMA 3U7YH 4QTHA 2H1PL 1EEYB 5KS9B 5DFWH 2X70A 4G5ZH 4LMQI 5FF6B 2R0KH 2DQFB 2DDQH 1BFVH 3ABZA 4K3EH 1AFVL 1VKXA 3MV9B 5IW1A 3THML 4G80B 5D72H 4QRUA 4G8IB 1UJ3C 4IDLA 1BFTA 5I15L 2RFXA 4X4ME 2J1KA 1MVUA 2ZZUT 1MLCB 5KS9F 3BD3A 2VNCA 1WZ1H 2X2YA 3QAZB 4AEFA 4JFZL 4PLKD 3U83A 3E1F1 4GS7C 2VZVA 5DHXB 4FNLL 5DJAB 4AMKL 3UO1L 1OD9A 5FDWA 3TP4A 4G80A 4MJ2A 5DRZB 3T0DA 3L7FA 3VFSB 3IDIB 5CZXD 1S9VA 1IT9H 3I6KB 2F53E 3BN9D 5FXCH 1DUZB 5GGRY 3BRGC 4O51B 1YEKL 1NCDH 1J8HB 1CG9A 4KUZL 5FF6A 2XNAA 3BISA 2CLZA 4JZNB 4S1QL 3T0WA 4HS8H 2WUCL 4DOHB 5EBLA 5LWYH 4RZCA 4ZUTB 3LHPL 3DX6B 1SBSL 4Y19A 5HI3C 2G60H 4OD2A 4EUPA 2EKSB 1OSPH 3G04A 3F7RA 2APFA 3OZ9L 3VXPB 5B8CC 4NKMA 1PKQE 3N9GH 3MLWH 1HQRA 3T0BA 1A7RL 2X4NA 1HQ4A 3KG5A 1CLCA 2WUCH 3PABA 1FNSH 1YJDH 1HHIB 1T1ZA 2Z8WC 2GEEA 2NW2A 4ZPTB 5SWSE 3C09B 4BKLA 2HG5A 4Y16C 4HGMA 1IGYB 3MRGA 1EEQA 3QCVH 1ZV5A 4XMLH 1OW0A 2NXYD 5SV4A 3AU1B 5FM5M 2UVEA 1V3JA 4FFWD 3LSOA 3TNNB 2VH5L 1P4BH 2NX5E 4KH2A 3QFDA 3FT2B 5IB3A 1MJ7H 3MGOA 1CFVL 4RWHA 5DJ0A 2J2ZA 3TEUA 1WWAX 4U1JA 5KN5A 3QZWB 4XC3H 3Q1SH 3SE3C 5DJ2A 2Q7YA 3QCVL 3ZKND 3DO3A 2R2EA 3HS0A 4JFEB 1RZ8B 1AP2A 3FT3B 3W11D 1QA9B 5HGBB 4PTTB 5C0FB 1WCBB 1ZVSB 4NC0B 5EUKA 2Z35B 4Z7WB 3OGOE 5E6ZA 2P48B 4HUVA 1QSFB 2QR0A 2RB8A 2OBGA 2EDWA 4GRMB 2M26A 4BZYA 1U3JA 2EDFA 3KXFA 4H88L 5LKNA 3DYMA 1A22B 3FTGB 3GB7B 4OLVL 5I1CH 4G43B 1URLA 3G6JE 4TOYH 3DIFA 3RHWK 2CIKA 2DB8A 4JFFB 3GFUA 2A0LD 2DWDB 3C9NA 4YHLH 5DQJB 1HEZB 3RWJB 1NAKH 4MA1B 4XCEB 1WFUA 2DLFL 3DX8A 3GSXA 5D93B 2ICES 3U36B 5EC2A 4LSPH 2P5EA 1PQZB 2Z91B 1WIOA 1S9KC 5BJTA 1I4FA 4OZIF 4EXPX 4OF3A 3HI6H 1JGUH 1P4IH 2JCCB 1E6OH 4RMUA 2NXYB 5ALBH 4KK6C 2UZYB 2AXHA 1QR1A 1CE1H 4Q2ZA 4OZFG 4QO1A 4CU7A 4LHUA 4RGOL 5D2LE 3ARGB 3CSYB 5LGJB 5FB8B 1NCAL 1CICA 4PJXF 4WY7H 1FN4A 4OZIB 1VACB 1E27B 1P7KA 3NH7H 4NFDA 2P24A 2XN9B 3PWVB 2A6DB 2MJWA 4X99B 1PKOA 1JGDA 5AUMA 5K9KA 4KKLC 5BVJA 3T65A 5IJKA 2FBJL 1NL0L 1FN4B 4OZIA 1A3LL 2AW2A 5FYLE 1FZOB 3H9HA 1U8HA 1NMBH 4JANB 2HJFA 3WNLA 1K3ZA 4GKZA 3RTQC 4NP4H 4NOFA 4AT6A 1ZLVK 3TYGL 2D7NA 2WUBH 1QR1B 5F9JA 5DVOA 1MHCB 1EH9A 1EO8H 3LCYA 4U05A 4DGVL 1F11B 2H3NA 2AJSL 2SEBA 5B21A 1C1EH 4NJ9H 3VXOA 5HI4C 4QXGH 1CGYA 4HIXL 2DKSA 4KKBD 2Q86B 4I3SH 3U36A 2EE9A 5SWZE 1P6FA 3LPGA 3OR6B 3DX8B 2VLRB 5KSUA 1OAQL 3GNML 4ZFOL 5EFIB 2W07A 3TCLB 3NZ8A 1YY9D 2BVOA 3CZFB 4OQTH 4YDVA 2CH8A 2OQJB 1TCRA 4LNRA 3C6SB 4OGXH 1UM6L 3NAAL 5JIPA 2F5BH 1XMWA 2AI0L 5D2LA 3DECA 1WBZB 2AJUH 1K6QL 4BK5A 2YUVA 4YHKH 2EE6A 4X6FB 5E00B 3ULVE 1OD7A 5DD5L 3TJHD 4GQ9H 4GKSB 3QUXD 1T6WA 4X8XA 2FB4L 2EDXA 4ZNCD 4FFVC 1P7QB 4BA8A 4XZUB 1JPTH 1IM9D 2A6JA 4K71C 5DXWA 4LOUD 3MFFA 3QFJB 3BPCA 1WITA 4G8GB 2UUDK 4W68A 1H3XA 1QVOB 3I6LE 5I17B 1D5XA 1UCBH 1DQQB 3GMLA 1IQDB 3IDYC 4DCQA 2HVKB 1CTNA 4P2QE 5FA3B 4TSBL 8CGTA 1YMHA 2Q3AA 4DVBA 2DD8H 5C0IB 4Y5XC 5JR1H 1S7QB 3BPNB 3BXNB 2I07A 2YC1A 3EAKA 5T1DH 4UT6L 5B3JE 5HHPA 4D0DB 4ZUWB 3EGSA 1DDHA 2ORBL 3HC3L 1B0RA 3L5XH 4PJDF 3UBXA 1QLRB 4K9EL 4UNTA 3O9WA 2VIRA 3LQAC 2IH1B 4YPJA 2ZSWB 3TIDA 2VAAB 1XGPB 1VEOA 3VRJA 5FM5O 5JW4R 1T3FB 1F3JB 3VW3H 2RR3A 4J3UA 4MB3A 2B1HL 3K4ZA 4LRNH 4UV7H 3GHBL 4NIKB 2BSSA 3VXRE 5TE6L 5F7KC 3FOLA 3SGJC 2FYYA 4XXDA 2EH7L 3IDUA 3T3MF 2GIYA 2D9CA 5GGQH 4JQXC 2JF1A 5C09A 3RL1A 1LWRA 2APTA 4POZD 1Y0LA 4LDLB 4NUJB 2HTLD 4BZ1H 2VE6A 3MGTA 3QUKA 4MAUL 4OF5A 4NN7C 5HHMD 4RNRB 1I7UA 3OJMB 2V2WB 3D3VD 4IRZH 1W72H 5T33L 4ELMA 5FAAA 4HKBA 3ZHLA 3PWLA 1CF8L 3QPXL 4P49A 4PRHA 3WFEH 4JO2H 4WI8A 4H26B 1ND0A 1CDCA 3SDDD 2DQDL 3U9PH 3FT4A 1PY4A 3MV9A 1T2QL 2XN9D 1RZJL 4ZOAA 5JHLH 1A8JH 4DUXA 1IGJB 4WNQA 4HK0A 3PQYA 4F2MB 4XMKH 4XVUC 4QXWA 1S7UB 1SJHA 5F44A 5LAXB 1F4AA 5BW7C 2V9QA 2VDNH 2IWGA 4JO2L 1MJJA 5D6CA 1QRKA 1UVQA 4R26L 1Q94A 4LPVA 1CWVA 3CFJA 5A40E 1DANU 2L4OA 1RK0A 4MNGA 1VHPA 3JWOL 3MYJB 5EH1A 1ORSB 3O3EA 2VWEE 4F33A 4G9DB 2DI7A 1P53A 3MRCB 5ISZB 4MD0A 1KG0A 4MCZA 3O2VH 1A64A 1I9RL 3PIQA 1Z6JT 5JZ7D 1SHMA 3VXSD 1P4LB 3NA9H 3BZEA 1S7VB 1A6VH 1X5JA 2XKNB 5ILTH 5ANMB 4M7LT 2DTSA 3TCXA 3C6LA 4YXLL 5KVMC 4FQCL 2X4PB 3FRPG 3HZVA 3BKYL 3WN5C 3NIDE 3FB8A 3UYOD 4NKOB 1OAYL 4JO4H 1ZXQA 4GRWH 4M9OA 1FIGL 3KPSE 4PJAF 1UH3A 3TYFA 5I8CA 5I71C 2CKBL 2V2XA 3BQUA 4X4ZA 1C7SA 3IJHB 3RAJH 1BD2B 1MREL 5CJQL 3WFBL 2IPKA 3T1FA 4NYLB 5FKPA 1CDYA 1L7IH 3IJHA 5DQDL 1T1XB 4ZNEE 4W4NA 1Q9LB 1I8MA 5EU6B 1JRHI 1XR8A 2B5IB 1A7OL 2AV7B 2X1QA 5T5NG 3OAYK 3HZVB 3SKMA 4OZ4B 1DLFH 4EI6B 1XZ0A 2J8HA 1CS6A 3ULUC 4LDEB 4FQXB 2DF3A 4PD4K 1CLOH 1I1RA 2G2RA 4L8SC 3HPJB 4P48A 4JHBA 5KSAC 4FZ8H 1HKLH 1VEMA 1P4LA 4U0RC 4YEEA 3DROB 5INDA 1A3RL 1UB6B 3WS6A 1MAJA 1NL0H 2HFGL 3D9AH 1MI5A 3ULVF 5DURB 5BOPA 1J86A 4CRPA 1T21A 4G9DA 4QTIL 4HQQH 1OF2B 5TF1L 4X98B 1OVZA 3JWOC 3W0WD 5SX5H 2Z93A 5A2IH 2EE2A 1JNHA 3VXUD 1UVQB 1HYSD 3GSRA 3OKOB 1WZMA 4UDUA 4HAGA 3GSUA 5I8KL 5DEGB 5J6GA 3RUGB 5D7IE 5L8LB 3PHSA 4U7SA 4IRSD 4P2RB 2OK0L 2AXJA 2LVEA 4FTVD 1IGJA 3LEVL 4L8SB 3TGXA 1VB9A 2R4RL 4FOMA 2FJHA 4EI5B 3E2HB 5DUBA 1CFNB 1NLBL 1HHHB 1YUHB 2NNAA 1JGVH 3UDWA 4LVNC 5C7XH 1X4XA 2C1PB 2KL6A 2Z31A 2QHRH 2NY0D 3UROR 4LIQH 2HJLB 3KLDA 5C0BB 2VE6B 4IDJL 2YKLH 2VLKA 3GK8H 1I8IB 4PJGE 1HWHB 4JGUA 3IKKA 2AJXL 1UXSA 4OFVA 4HCRL 4H20L 1JPTL 3OZ9H 3TBSB 2UYLA 2BRRH 2COQA 5I1LA 4HLJA 4F9LA 2BSSB 4P5KA 2VABA 5INCA 3IF1B 1H8NA 1FBIL 4XTRD 4NC1C 4PJ7B 4X5WA 5CCKL 3FRPA 4ZAKC 3MRHA 4QXTB 3R06B 4OI8A 4YDLC 1HSBB 3EDJA 5IQ7L 3UBXB 5MI0C 5IQ9B 1J5OH 5AZ2H 1W8OA 1BVKB 2WIMA 4ZFOA 4PR5A 3TFKC 2FEEI 2XTJB 4BM7A 1HDMB 1N7MH 5C9KA 4QYOA 4ZAKD 1UJ3B 3ARTA 4F37K 3KPQA 5IW6B 4E42B 3NZHH 1ZHBA 3P0GB 3IXAA 2YZ8A 4KKAC 1EGJL 4OBSA 4OGZA 3RWIA 3GMLB 2W60A 4QRRB 1NFDF 1BQSA 1Q9OA 3D69A 4Q6YA 3KDMB 1XF2A 5ICYA 3TFKD 1QVOA 4I3GA 3C5ZB 2EXYC 1U3HA 4HQQL 3GIZL 3ZT7A 4P2RE 3DBXA 2ESVE 5F1OB 3U1SH 3F58H 4G42B 1RUML 1KB9J 3V6FB 4DGIL 2XTJC 4JM4H 2OJEA 5FGSA 4JDZA 3K1KC 5HHVH 3TA3D 3ZO0A 5C6PB 5KSBB 2V6HA 1CCZA 1KCUL 1ZA6A 3FN0L 3O4LB 2IH3A 1TCRB 3VDBA 1KIRB 3CH8A 1EEUA 4PJIE 4UQ2A 3CXDH 3NZHL 1KJ2A 5EOTB 5EC1A 1HXYB 3GSVA 3WJLC 3L6FA 3RKDC 4X9IA 3G9VA 4IIQC 3HRZA 4GAFB 1U8LB 3N0PB 1LO0L 5F21B 3O4OC 3WEXB 1CD8A 3RU8H 5CIPH 5IFJA 1BLNA 2Q86A 1P84J 4IRJC 1NCWH 4U31A 4KUCF 4B53A 2O5YL 4Z78A 4MXQD 1QQDA 2E7HA 3C8KB 4WGVB 1IGTA 3HAEA 4KJWC 4KQ3H 1DLHA 4JLRA 4Z7NE 3EIFA 2FR4B 3I50H 4J3TA 4XAKE 4HDIB 4X4MA 1MCNA 4PJ9B 4E41E 2JELH 4WJ5B 2YUXA 1NANI 1FZOA 3QO1A 1SJXA 2N1KA 4PRIE 1J88A 2QQLL 3EFFB 4BSWA 1KENH 2VDQH 1OSPL 4D0BA 4QRTA 3SDDA 4KVCL 3CCHA 3KHOA 2OR8A 1X5FA 4HKJA 2VOTA 3DETD 1FE8H 1I8KB 3RDTD 1P7KB 1U8KB 1W0WB 2YPVL 1NMAL 5J13B 1WBXB 4PJFA 4E5XA 5EZIH 4E5XB 3P73B 5L6YL 2M8XA 2R4RH 1N3NA 4WUUB 3C60B 3ARGA 2VJXA 5GRVL 1CZ8L 4ZYKA 2RHEA 1KFAH 1RZ7L 4FTVA 4NO0A 1FZKA 2BY1A 4OSUL 3WFBH 3CDYA 1VCAA 2J8UF 4F8TA 3RDTC 5KS9E 3X3FL 4APQD 3CC5B 3FO1A 1UKSA 3O2WH 5DJ6B 3S5LG 2JJTC 3QDMD 5DHYB 1XGUB 3N1GC 4UQ3B 4F57L 5C8JB 1MFNA 1TIUA 4YGVA 3FQTA 4H25A 4P99A 3VGBA 1YJDC 1JV5B 1JJUA 1FC1A 3VFGL 3HG1A 1CDHA 1ZSDA 4MA8L 5DLML 1BWMA 3WDIA 4U1NA 5HYQB 5JZ7C 2R8SH 4M61A 4G8FA 3PGFH 1T5WA 1U8QA 3MREA 3PF2A 5CWSA 4O2EA 3PXHA 1DCLA 3G6JB 5EZOH 2ZWLT 3PL6B 3CH1A 4I18A 5ID1B 1FFOB 4KHXH 1KCVL 1VFOA 2EIBA 2P5WB 1EERB 2XTLA 4FZ8L 5GS3A 2LQRA 3VG9B 1JF1A 4EI5D 1FFNB 5BRZD 1CVRA 4RISL 2QBWA 2P5WA 3DSFL 1F00I 4PG9A 5BMFH 1WCBA 4XNMB 1QSVA 3FT3A 2EIZB 4PJ5D 4N9OB 3H9ZA 4MDIA 5C71A 3AM8C 3QISA 7FABH 2OTWA 5FO8B 4ELKB 4U1NB 2ZOKB 5HYQA 1M71B 3NFNB 2XIDA 3RTQB 4LIQE 2V5SA 4OFPA 3WIHL 1EFXD 4S11A 4U1MA 1SJEA 5JOPD 1QFWI 4WO4A 5JUEL 5B3NA 3D39B 4HLZH 2JJSC 4UQ3A 1XGUA 3S3JA 4AIZA 4JDVB 4WVRA 2IQ9H 4BZ1L 5IHLB 5DJ6A 2VDLL 3DI2B 1EBAA 4HC1H 2WBJB 3RGVB 4D9LL 1B2WL 3RQ3A 4R2GB 4NKDA 1FZKB 4LARH 4M6AA 1YN6A 4XPGH 2IC2A 5FYJH 5IW3A 1ZHKA 3BDBA 3EO0B 1FQ9C 2ZKHL 2GITA 1T04A 4O58L 2C3VB 4RGMB 2V17L 5DUMH 3VA2C 1CL7L 2VQ1B 3P73A 5IVXE 1CLOL 4ZOBA 5IQ9A 5IB2B 4OCSH 4UT7H 1TENA 1I8KA 1DUZA 1JHLL 3R06A 3EJYD 3GEWB 4MQ7B 2AJVH 3SDDB 1FAIH 1GOGA 1U58A 1CF8H 3QPXH 4GRLC 1BGXL 3ME0A 4X7SL 4LCWA 4IBLT 3LKNB 1GGIL 1VEPA 2E6PA 4R7DB 1R5WB 4JREB 5HYSG 1RPQA 3TO4B 1ITBB 3IDYB 2ADIA 1U8MB 4PJ8A 4QXUL 1P1ZA 1PSKL 4HXBL 4I0CC 3K80A 3X11B 3CSPA 4OCSL 1ZTXH 3ARDC 1FIGH 4FA8A 4H8WC 3RGHA 5DC4B 4U6XB 1KCVH 5FIEA 5FYJL 2YMXH 2AKRB 1OSZA 4L1DA 4JJHA 5C0GB 2HN7B 1C16A 4O58H 1RHHA 2XYCA 2BOCA 4KTEL 2F19H 2GJJA 4MJ5B 4KHXL 3STZA 5TFSL 1U95A 5FYJD 1MELA 1YEHL 1FCGA 4QTHB 4PJAA 5DJYB 4UQ2B 2YD4A 5GS0C 4OI9A 4QHLA 3OXRB 4WHYH 5CJOH 1DN2A 2OTUA 3HB3C 2X1WL 3LEXB 4BZ2L 1A7NL 5DJZB 4Z77A 5JORB 3FFCA 3QJFA 3JV5A 3FO2A 5KSBA 3WIHH 5IR1A 3U0TA 3QB7C 4MZ3A 1I1AB 4JFXA 4QXUH 3WO4B 4EOWL 3GSRB 4FQ1H 3OKLB 2A74B 4YFEA 2AQ2A 2XTJD 4C54A 4LPXA 1ZVYA 5CBEA 3VFNB 2XWBB 4CN1A 2ILLA 1IMHC 3B43A 2B39A 1LP9B 4I3SL 2P7TA 3WFEL 1P2CA 3UAJC 3UYPA 3JZ7A 4LLVA 3QCUL 4ENED 3KPOA 1I3VA 2CDEB 1CT8B 5EO1B 1FLTX 1KPUA 3HI6L 4EIZC 1WT5C 4DKFH 1D6VL 4RIRB 2FSEA 5KOVC 1ZKAA 2YD8A 1DUYB 4HD9A 3E3QE 3IFOB 4X6BB 1LP9F 5EZJA 4PR5B 5D7JC 3TIEA 1ES0A 3FQXB 1JTTA 4U1IB 3D48R 2QADC 1BAFL 2NZ9C 4JM2C 2GSIB 1KENL 4YDIH 5DEFB 1RQ5A 4S1RH 3GUTA 5FKPB 4ELME 4UV7L 4FQIH 3V6BR 4PUBH 4QLRA 4GQ9L 3MX0A 4WV1A 2VABB 1NEZB 5E7FA 3AVEA 1LQSR 2XPGA 3KYKH 4AM0A 5FGRA 1NBZB 2L0DA 3ZDZE 1FRGH 3VD9A 4OZHE 1L9NA 4CVZB 4NCC1 2EKJA 3CFCH 3D18B 4ESKA 2DMKA 4ZDHB 1OP9A 2VDKL 1QTYT 4A2MA 3KPMA 4WCYH 5C0BD 3QO0B 2ORBH 2F54E 4ZFZA 5I66B 1C08A 1VERA 5EO0A 4MCZB 1KG0B 4GXVH 4NM4H 4U1SB 4IRSB 4P2RD 3HHRB 2NY4B 5JHDA 1UC6A 4Z9KB 2Z31B 3H9YA 1G7HA 1A7PL 1CK0H 4YHIA 3WIIH 1EMTL 1F90H 2BC4A 4QRPD 3QWRD 4XGZB 1CFNA 3SKJL 5FO9B 4PRDA 3KPSA 3QUYD 2G5BA 2VITB 3O8XA 2FJHB 4HFUL 3TF7C 2R0LH 4XCNB 2BSRB 4ISVB 3BWAB 4HK0B 4F2MA 4BFIB 4MS8C 2UY7A 4DQOH 1AHWA 4ZUVB 2BSRA 4KK9D 5D8JL 2O61A 1XGQB 2APBA 3O6KH 5DD1L 3RJQB 3QQNA 1CN4A 3PGCA 1CFTB 1G1CA 4LBEA 3ZYJA 4OGXL 2BERA 2NY1D 5BVPH 2JK5B 2OMNA 4J4PD 5HHOA 2ERJC 5I66A 3IKCA 2FJFA 3C5JA 1NCAH 1ZT7A 5IHUL 3QIUC 1M4KA 3D18A 3P0YH 5CP3H 1QPPA 2W9EL 5FYKL 5L8KB 2QSCL 15C8H 2AABL 1DR9A 5E94A 4LPUA 1NBZA 3UTTD 4KRPD 1XCTB 2B4CC 4G6AD 3JTSB 4HJGB 2XQBH 2VQUA 4JVWA 4UDTA 3KR3H 4LFHD 5CAYB 1BQLH 4LCIH 4XXCC 5GISH 2CXGA 3MLUL 3ELAT 4M1GH 1XGTA 5DRXB 5HHOD 5JXAH 4DGIH 4UAOC 4GW5B 3PDOB 3QAZC 1J8HE 1IAIL 4P9HL 3U7WL 1WQVT 2N56A 1QOKA 5LWYL 2V2XB 1C12B 3ARBC 4S1DC 4FQHA 5D7JD 3TPUB 4PJCE 1K2DA 1FL3A 4P59H 1TJIH 3FB8B 4Q97A 4FXGA 2JB6A 4LP5A 4OLVH 5I1CL 3KPPB 3BZ4A 3LVEA 2AV1B 4W70A 1HH9A 2DM7A 2XQBL 5F8QC 4QT5A 2D0GA 3MCKB 1U6AL 4OTXH 5A43C 1Z9OA 3N1PC 1YMHB 2VR9A 3PWPB 1S7VA 5FKAA 4OF6A 1ZGLA 1NCWL 1JL8A 4LLVB 2OLDA 2F9BT 3W0WE 3MJ9H 2PTVA 4BQ9A 5JQ6H 1RZGB 1FYTB 3BPCB 1FNSL 3IXTB 3FMGH 2FWOA 4L3EE 3D0VA 3MTRA 2I9LB 4HGWB 4ZNEA 2OK0H 5C6WH 3BN9C 5AEAA 1T22B 4ONHB 4Q9RH 3C2AL 4P2YA 1SY6L 5IR1B 4TTDC 5ESQB 3D1MC 3VXMB 5D72L 1OQOA 1RZKL 2PF6A 4LSTL 4UB0L 4TUKH 1IGCH 4UV4H 3TVMB 5F7EL 5JORA 1OP5H 3QQ3B 2A1WH 5I18L 5K59E 5JPNA 2VXSH 3SKJH 2R69L 4DW2H 2X7LA 3QHFH 5IMLA 4HFUH 1Q0XH 4P2QA 5CD3B 4OUUB 4ELMB 4PTUB 4OV5B 3GSNL 1YC7A 2VLRA 3GK8L 3OR6A 5KSUB 2NY0B 4WWKA 3U0WL 4L3CB 1FL6A 2A1WL 3MGTB 1NEZG 1MCWM 3ZDZF 1OSZB 4XNZC 2WIIB 3P11L 4Q9RL 4U6XA 2EDTA 1OTUD 3QH3A 2IBGA 5ICZB 2LFGA 3HR5A 3OPZH 3SKNA 5JOPE 4D9QE 3RL1B 1P1ZB 1JHTB 5ID0B 4UUJA 4WW1A 1MJUL 1KC5L 1U8OA 1R3LA 4Z5RB 4NSKB 5D1QC 1NAMH 5C0AD 4U1KA 1PG7W 4KRMB 3D0LB 2VDMH 3GSNA 5I1AB 2QSCH 4OLZL 4LCWB 4AL8L 3EBAA 2FEDD 1MFDL 1RIVH 2WV3A 2XKSA 4KJYB 3ZKMC 4XMLL 4K23L 4I8DA 2R1XB 5D93C 4F7PB 4FQCH 4CBPA 1PZUB 1B4JL 1YJDL 2X9XA 4KQ4H 4RFOH 5T3ZD 1QLRA 5D1XC 2NXZB 1G6RB 1NGXA 1OCWL 4IIQB 4F3FB 2X4UA 3EYSH 3H9SB 2C3HA 3W0WA 4RRPG 3CSYA 5LGJA 2I07B 4YHNA 1MHEA 2MKWA 1J18A 3VFMA 2NY1B 1YN6B 3IDXL 2W38A 4P4KB 2CRMA 5B39G 1IAKA 3ARBD 4S1DD 1H15B 3QXAA 4HMCA 1I8LA 2F19L 3BYTA 3ARGC 5C09E 1L7TH 1UWXK 1Q9KB 1CQKA 1E4XI 4WDIA 4R26H 1LEIA 1A7OH 2CO6B 3QEQE 5H94B 1MSPA 1PQZA 4PBWD 3WFDH 1MREH 4G8GA 4YBQC 3P0YL 3DGGA 3BP7B 5KZCD 3HN3A 1OP5K 1AI1L 4PJ8D 3U9PL 1TZHA 4QY8B 1U8IB 2H32H 3DRQB 1T1YB 5MHSE 3LRHA 2LE9A 3DIFB 3CUPB 5FYJE 1WICA 3NPZB 3C60D 2DMCA 5D2LB 3PL6D 4GG6B 5AAMA 1TVHB 1KCSL 3CSGA 4LNRB 3O3DA 3D2UD 3QPQD 1MAML 2G9HA 3DRQA 4PGCA 2JJVA 5D9SA 5EZLA 2OZ4L 3NZ8B 1E4XL 4KJPD 3IS1X 4JPIA 2J88H 4WENB 5IROA 4X7EC 4WTWA 4RFNB 4UOW0 3RDTB 3WS3B 2XXCB 1I7RB 1CD0A 2Q7YB 1MFEH 5MEOA 5J1SC 1N6UA 3BPOB 5C0EB 4GT7A 5LXGH 2GJ6E 4IDJH 1ZSDB 2A6KB 4NQCB 2BZDA 4MJIB 1JV5A 2WMPA 3N1MC 4DKDC 2J6EH 2R0ZL 3DLQR 3O6ML 5ICXA 4LLMB 4F80A 2HJKB 1FVEA 4DKFL 5C8JA 2PXYA 4NM8L 5CP7A 3BD5A 4FQPA 4YUEH 3DX9B 3SDXE 2X6MA 4WI5A 5TH2A 2UWEB 5GRJL 1ZS8A 1D5ZB 4PREA 5DTFA 1BBDH 4O2CA 1XGYH 1VFBA 3Q6FA 5E1AA 1OAXH 3P9LA 7FABL 4DN3L 2I24N 3F7QA 2P24B 2XN9A 3PWVA 4YPGB 4YUEL 4XP4L 1VA9A 3X14B 4CMMA 2CQVA 2X4QB 3D2UA 2C1OA 2J5LC 3B8SA 4JFYA 5BZDA 3D85B 1EHLL 2XNAB 3RFZC 1QO3A 4XNUH 3QUYC 4NJAH 1MOEA 1PJ9A 4LHUB 2LTQC 4XPGL 1OB1B 2HFGH 4GAGH 2ZKHH 3GHBH 1A6VL 3L7FB 5ILTL 4HWUA 3X13B 3UC0H 1HI6A 3MLTA 3SCMD 3VFVB 5FUCE 3LDBB 1XR9A 1LK3H 4NUGH 5LBSL 2DQEL 1DFBH 1HH6B 4PRAA 1QLEH 3VW3L 3VFGH 5BV7L 1ERNA 1MPAL 3ET9F 2DIJA 4I5BA 1OAXL 4U1LB 1YMMD 3MRDB 1CXFA 4Y4KD 2RFXB 4HSQA 4P2QB 1XGYL 1K4DB 4NFBA 1GIGH 3DXAE 2PO6B 2ADGB 3PP3K 4G43A 4QRPE 1X6NA 3IRZA 2FX7H 3TN0B 1IE5A 4BH8A 4XP4H 1CU4L 3MLSH 4OI7A 5HYJE 4NNXB 1RUKL 2NMSA 3LDBC 1ONQB 3WO3B 1RZ7H 2V7HA 3BHBB 1BX2A 1EEYA 1T03L 2PW2A 1I1AD 4P0DA 3QG6B 1EO8L 3C2SA 2BNQE 3OB0H 5FM4A 4JM2D 4DJMA 2DQJL 1MFCL 3SDYH 5TF0A 1NMBL 4GMTH 3W81A 3OKMA 2F58H 4HAFA 3S37X 3TJEL 1MPAH 5IBUG 1A7NH 4QHKI 1YEHH 3P9WB 2PYEB 3CAFA 4V1DE 1DFBL 3FB5A 1J1XH 3SGKA 2R9HD 4N0YL 3WLWC 2GSGA 3BW9A 1R5VA 4UU9B 3JBG7 1OCWH 3FQUA 2AK1H 3DUSB 1AD9A 2UV3A 3RJDA 4CNIB 1R5VB 3B9EA 5DK0A 5K33A 2YA0A 4PJXB 4F58H 1JNNL 3VWJA 3G08B 5IMMA 2VXTL 2I27N 3UTTE 5IBUB 3AAZB 3TA3C 3D25B 4WHTB 1C12A 3SDAB 4PLKC 3WJLA 4NQDD 1XF5B 2BOBB 4HMDA 1JGUL 5EBLB 5I2IB 3QG6A 3OPZL 2W0FA 2YPVH 3OX8B 3ZSSA 1BOGB 3NCMA 4PP1C 1J0ZA 1U8NA 1S7WB 4NWUH 4FG6D 3TN0A 3MV7A 1SY6A 3VFSA 5E94B 3FN0H 5BMFL 4IRJD 3U4EA 4DFHA 4PJ7A 5EIQA 2R1WB 2YEZA 1WEJH 3GJEA 3GIVB 4PJBF 3T0VA 4RFEB 1JPST 1YMMA 4TOYL 4U1LA 2GTZB 3ROOB 4UOW1 3VXUB 4P23D 3SDCA 2EH8L 4LSQL 3PGDB 2Z8VC 4N0FB 5C0NC 1FNAA 3TYGH 3O0RL 2Z4QB 4LLQA 4U3HA 4CGTA 2HVJA 4G8IA 4R4ND 1OGAA 2IPTL 4KQ3L 3VFVA 4UTBL 3SDXB 2V9RA 2F5BL 4NZUH 5I8EB 2V2TB 2I25N 4U3XA 1OARL 5D1QD 3S97C 3O8XB 4AEHH 1AIFA 5FYKD 5BQ7B 1IGFL 3ZHDA 4EQ2A 4HUXB 4HUXA 2X4QA 1H3VA 3O3BB 4ZAKA 3D3VB 3DTXA 5DVLA 5BS0B 1NFDB 4PJCF 4ZXBD 1VFBB 3ULVL 5HDBE 1U8JA 2FLRT 3MRKB 4U1SA 3RUGA 4JN1L 1TJIL 2FIKB 3LKPA 6FABH 2CKBB 3CPLB 1WISA 2XA3A 4QF1B 3MGAA 1IM3A 1U8PB 5CSZB 4X8JA 1ROWA 5DD3L 1EJ6A 1F42A 1ED3A 5MERB 3RVVC 4C83B 4JFHD 1JYWA 4X6EB 4D9QD 2GW5A 1UB6A 4NHUA 3MACH 4H5SA 2FBJH 4H20H 4CDHA 1CL7I 3EKCA 4TQEH 4LVNB 2NY4C 2G2RB 4JR9H 1K3IA 2ICCA 4NRZB 1LNUA 2DQTL 3INUH 5SX4H 4NZTL 3ULUL 1JK8B 2XG5A 1TJGL 4JN1H 1BBJB 1D9KA 3HRPA 4KDTA 2W9EH 5FYKH 4OLWH 1JPGB 4XPHL 3FRUA 3LMJL 3H8NA 1MY7A 1I7TB 2D7PA 5F89A 3O2WL 3GKZA 5SWZA 1VENA 2HMIC 3V7AE 2O5YH 4J1UA 5T3ZE 1DUYA 2A38A 2CPCA 1UYWL 2A9ML 2P8PB 2F74B 1CFSB 1GHFH 3QDGB 3QUYA 1AR1C 5EU4B 1G84A 3SDAA 4PB0H 4GW4A 1K8DB 1AGDA 43CAA 1BD2D 1UM4L 4L4JA 4X9GA 4JR9L 1GXEA 4PLOB 5D7SH 2X4PA 1A1NA 4P2CG 4K3EL 2PTTB 4GFTB 1RHFA 2Y23A 2HLAA 5C09D 2XWBA 5C0BE 5K59F 3VXTB 2XZAL 1LEIB 4MA3B 2QQLH 3QEQD 3PWPE 5GRYA 1CBVH 3TT3H 5F7HA 1OP3H 5GGRA 1RUMH 4RMWA 3FO2B 4OFDA 4TULH 4H88H 5C9JB 4HHAA 4PGDA 3NN8B 1WUNT 1G9MC 1JZ8A 3MYJA 2KUTA 2NY2C 2I9TB 3B9KC 2YWZA 5IB1B 5D6CB 5GIRA 1G7IB 3KYAA 3O9WD 4A6YA 1A1OA 5GJTL 5I76B 4O2FB 1DTUA 1GHFL 1XIWB 3BQUC 1MRFL 4NNXA 4OAWA 5KSBF 3MRQB 4KUZH 4L4VE 1NEUA 4JQXA 5IROC 4Z8FL 5F96H 5DDHB 3ES6A 3NCJL 3ETBF 3AXLB 4JHZA 4JRXB 4XBPB 3T0ED 3X11A 3DRTB 3MRIB 1FO0A 1CE6B 5E9DA 5GSVA 2XWTB 2ADIB 4PJ5B 1KJMB 4QCIA 2WANA 1HH6A 4PRAB 4E0RA 1JNLL 3U7YL 3CFIC 5IK3A 4NZTH 3T0EA 4U49A 1HKLL 1QACA 2C3WA 2EIEA 4ORZC 2Q8AL 2P5WD 4R4FH 2WINB 3WUWB 2NX5B 5I74C 3KPNA 4OCWH 3QUXA 5KANI 2QQKH 1ZOXA 4PY7A 5FFLA 2NXYC 3THMH 3O2VL 5HHOE 3BDYH 2W65A 5CJ5A 3Q5YA 4M7KL 4D3CH 4IHOA 3OV6A 2VLKE 1AO7E 4IRJB 2Z8RA 4X5XB 4MYWB 1NBVH 4G5ZL 5IMLB 2VQ1A 1DBKL 5MEPA 5BV7B 4WTZG 5GPRA 1T04B 4BQBA 4Y1AB 1LO5B 5C7XL 4PJGB 3NABH 4NKDB 4I18C 4HS3A 4L4TE 5DTFB 1T22A 2W0LA 4ONHA 5IB5B 2CKBH 3EGSB 3FZUD 3UPRB 4PRPB 1JNNH 3F7YA 5CMAB 3LN4A 1CI5A 3MA7A 4PRBA 1U3YA 2CJUL 4H8WH 4I0PC 3QDAA 3FQWA 1F2QA 1FRGL 5JA8B 5FA3A 4MJIA 3P40A 1IBGL 5J11C 3OKEA 2ZOKA 4LASL 5D6DA 5C0EA 5K9QI 5ADOL 5E5MA 3MCKA 2VL5A 2M1KA 2GAZA 3FQRB 5A16B 5HI3D 3KPRB 3RDTA 3MFFB 5DC9B 5FGCB 4ODVH 1DEEB 3MV11 1XGRA 4HKXB 2OXGA 4PG9B 2CLVB 4LGSB 4YE4L 3RWCB 5DRWA 1U93A 4TVPD 5J1TC 3ZDXE 1WEJL 3K8LA 2JLLA 1GCFA 1F90L 2PW1B 2PCPA 4NQVA 5MENB 4GW5A 1MFAH 1U8QB 1ORQA 4NQEB 1TZHB 5M95B 3REWB 4JFZH 2ZSVB 1L7IL 5D7KD 1YNLL 4XP5H 1M1SA 3D6GA 1NBYB 2XA8H 1XCTA 2ZUYA 1FG2A 1AGFA 1WTLA 2CDGB 5HGDB 3CLFH 3ZKMD 4WFHE 5H94A 2QLVB 3LRGA 4YHOH 2VR4A 5GHWL 2MWCA 4RA3A 3E6FB 5JO5B 5KZCB 2EO1A 4LLYA 1Q9KA 3ILPB 4P46A 1ZAGA 4BH7B 1LK3L 4GH7B 1H15A 3NFPA 3QXAB 3VFMB 3UC0L 3BPLB 1MHPL 4Y5XB 1TVBA 4MNQB 1KTDA 5F88A 2ADFL 3GMOB 1YEGH 3SBWA 3FONA 4PJ9D 2NTFB 3WDHA 5D6DC 3LV3A 5T1LA 5J1AB 1SVZA 1IEBB 4Y2DB 3VCLB 2W91A 4C4KT 1NGPL 3WLBB 1I9RH 4XWGL 2V5TA 5I9QC 1IM9A 3C5SA 3W39B 4NZJA 3L3KA 5E03A 3QNZB 3QDGD 4FABL 4Y16A 3ARFC 3IDJA 3CDCA 4W6YB 1J0IA 3FB7B 4GLRH 3CLEH 1YNLH 5ETUA 3D0LA 3OXSA 4C55A 1G7JA 2ICEB 2M2DA 3H7BA 2R1YA 4X7SH 2VLJA 3F65A 4QHKJ 4HH8A 4XI5D 3TPKA 2A83B 1MH5A 4U6HB 4ZO7A 1MRCL 5BZWB 4EOWH 2WZPD 1DVFB 1Q9WB 4YXHL 3VWKD 4MA7L 1NCUA 3M45A 4KRNA 4RISH 3BN3B 1BFSA 1X6LA 2DQGL 1A6AB 4BELD 2E7BA 1X5IA 1GZPA 4MAUH 5FUCC 4R6UA 2W0KA 1FNHA 1XIWD 1PG7L 5MHSD 2XPGB 1S5HA 3AGVA 1U8LA 35C8L 5JW5A 3GSVB 1HXYA 3NIFE 1NGPH 4NUGL 4C59B 1Y18A 3DMMA 4L5FH 1RURL 1QD0A 1FYTE 3FB6B 2GK0A 3O6FD 3GUTB 3OHXA 1NCNA 4DKEL 1Q0YH 4F7TB 3SDAD 2EDQA 1HZHL 2GJ6B 4M5ZH 5D5ME 2G75A 3JTTB 1T1WA 4Z7WA 1P7QD 3V6OC 3ARDB 4XMKL 1QR4A 4G42A 2B1HH 4CADA 4X6BA 1R3JB 4YXHH 4HG4K 3EHBC 3TESA 3IXTA 1RZ8A 4KRLB 1AO7A 3H2WA 3A6CH 3MRPB 3HTLX 3R1GL 2A6IA 4YFLI 1KPUB 4K55A 1F4WL 3MUY1 4U1JB 5KN5B 1BJ1J 1BGXH 4XP5L 4R0LB 1GGCH 3L5XL 1E6OL 3FT2A 2YWYA 4MNGE 5FKAB 5IB3B 5KVDH 2P7TB 3T3PE 1WF5A 1LILA 4WEMB 4RGNC 5DK3A 1RJLB 2GUOA 4XHQA 2R29H 2HG5B 4H1LB 4Y1AD 1MIEH 1X4ZA 1R3JA 5EZOL 3WXVH 4CADB 3BJ91 3T08A 4KZEH 2VXQH 4FXGB 3S8WA 5CEYB 4HXAH 4MXQC 4ODTH 4F9PC 2R8SL 4V1DA 4Z76B 5A3ID 4U2YA 4F7TA 4LEXL 3ROLA 1TTGA 2EO9A 1YEGL 3QIWB 1T0NB 3HZMA 1QFWM 3S4SB 4X5WB 3S96B 2DLEA 2ESVA 4HG4J 1I85A 4F7EA 2D0HA 1HHKB 2RJMA 4P5KB 4G8GE 3OJDB 3S34L 2NQCA 1U95B 1Z9SA 4JKMA 4MJ5A 3TA3A 1NGZA 2UYLB 1A9BB 4OCRL 5D7JB 5DMJB 5J6HA 4B0MM 1KPRB 1KFAL 1KXQE 2XA8L 2J7LA 4K9EH 2XWJA 5GRUH 1NQBA 4MB4A 4ZPVB 3KLAA 1OW0C 4OZHB 2A83A 1IL1B 4GUPB 4U2ZA 1GGTA 1KCUH 5J6HB 2HJLA 3SE4C 4KDTC 4NNYA 4O00A 1S9WB 3G6JF 5DK2A 3SGKC 3WFDL 1NAKL 2EE3A 3KPTA 1A6UL 3RY4A 4R96B 2AJSH 3WDJA 3U30C 3O6MH 5HYJD 4NJ9L 3GSNH 2B2XH 3V4PH 4JZOB 1Q0XL 4H1LG 4APQB 4YAQB 3RWEA 3PV6A 3T77A 2VXSL 5ACMA 4NT6A 1I3GL 4XCNA 2D2OA 3EDFA 2IGFH 1JYNA 4ZG1A 2YPKA 1HXMB 4XVSL 2E3VA 2AJUL 2BC4B 1T0MB 4FQXC 1CFQB 2PXYD 5D96B 3VE0A 3WHE0 3WSQH 1T0PB 1CVSC 4AL8H 5EOCL 3RL2B 3BGFC 3QWOB 1WTGT 5KJRL 1NDMA 4MXWL 2A6IB 5C0CB 4Y5YC 4JQIH 4RAHA 4NZDA 4CUCA 2WLYA 3I02A 5DUPH 2F8XC 5DMYA 1J0HA 1LO0H 3QEUB 1WZKA 3E0GA 2VMFA 1GRWA 5IEHA 4GW1A 1A7RH 4PRHD 3SGDI 1KGCE 5MENA 3B3IB 3PNWA 5HHQA 1FPTH 4J2XA 3OAZH 1IFHL 2GFBA 5E9DD 4NOBA 3FB6A 3RUGE 1LO2H 1YEEH 3RVXD 3NTCL 5FYLL 3Q48A 2IANE 1LO4H 2DQHL 1U93B 1U3HD 1JCKA 3LQZA 5JDSB 3FL7A 2J4WH 5D1ZC 3T2PA 3MLRL 3TIEB 2OR9L 5I18H 5IVXB 1BQLL 4JFPB 4MWFA 1PD6A 3M8OL 2VL5B 5DWUH 1QBMH 5CEZL 2BNQB 2CDEA 3CK0L 5J3HC 4AMKH 1PLGL 3SO3C 4U6HA 4Z0BL 3DX7A 3VWKB 5CGYD 3FQWB 1YY8A 3ARBB 2R1YB 1ODAA 4AIOA 1S9XB 4GBXD 4LRIC 4PB0L 3MJ9L 2Z92B 1MCHA 1RK0B 4MNGB 1QG3A 1MJJB 3KNBB 3I75B 4TNWF 4YFLF 1CLYL 1CGUA 1YDPA 4Y16B 3VD3A 3V52H 1LEGB 3CXDL 2JB5H 5FYKE 4GG6E 5E8DL 4FQJL 5T5NF 5L7XH 4KZDH 2DLFH 1NH6A 4V2CB 5CIPA 4HWZA 5TF1H 1D5MB 1WSST 3S36L 2DJ4A 5FV2A 1N3NB 4GMSH 3RWDA 4XAWL 4H26A 1T4KB 4DK3A 4PP2A 4WEBL 1MWAA 4XTRC 2Q20A 4GSDL 1FO0L 3WKNA 1BAFH 2WQ8A 1V7MH 1KTDB 2DIAA 4YC2C 5F88B 5F1NA 3QRFM 4IMLB 4YFDB 3JV0A 4JM2F 1QNZH 1OTTD 4LNVA 5SX4I 4NZRH 4WHYG 4IOIA 4WGWB 1RZKH 4LSTH 2DKMA 3MLUH 4Y4HA 3RWHB 2VYRE 2DYPD 3F8UB 3LY6A 4ELMF 2D7QA 3EYVB 3HE6B 3MLYH 4LCIL 2W59A 4XVTH 4WFGE 1CE6A 3MOQA 4NO3B 1I8LC 3PWJA 2EC9U 4JRYB 1LP9E 2I26N 2NW3B 1T80A 5FYJU 1X5ZA 5H2BA 1X5XA 5KOMC 3L3OA 3HMXH 4QRQB 2BJMH 3Q0HA 4OAWB 2IH1A 5H35A 4JG1L 1F3DJ 4P4RA 3RZCC 1KJ2B 1G9NC 1OT1A 3X3GH 2JJUA 1OGAE 3SY0A 5J13C 4RMTA 2X4OA 5MP6H 2YC1B 4KMTL 3JXAA 4HHAB 3S35L 3FQRA 3QQ4B 5A16A 5C9JA 2AJXH 4Z7VB 3QHTC 3JUZA 5TFSH 3V0VA 1KIQA 1NC2B 5HYJA 1YA5A 2HYMA 2BNUB 3N50A 4PJDA 4YXKL 3RZCD 4MJ6B 5DJCB 3UZQA 3DXAA 1WIPA 4M1GL 4NWTH 1IT9L 1WLHA 5HPMB 5C3TA 4AG4L 5KW9H 1KN2H 3JVGA 5DR5H 3R4DA 1YEKH 2FATH 2EYSB 1EMTH 1VFUA 2DMBA 4PV8B 4GKNA 4RSVA 1EXUB 5EBWB 4XVUD 4XZUA 4KMQA 5IB5A 1RULL 4PJDB 2AVGA 3F12A 3MRBB 4HS3B 1NC2A 5HYJB 3SE8L 3MV8D 1BFOB 3ARPA 2UUDH 4X6FA 5E00A 4OD3H 4OZFH 3T0EC 4Z7VA 5GZOC 5I1IH 3EOTH 1GAFL 2OI9B 3H0TB 4MGXA 5MEPB 3C6SA 1A9EB 5C07A 5SWQA 1INQA 3V7AG 4HV8A 1I7TA 4L4VD 4N1HB 3PV7A 3W5MA 4IRJA 4X5XA 3TCLA 2IMMA 1UACL 3MV7D 3VFUA 4IHOB 4ONGH 4HGKC 1LDSA 2EIDA 5ESAA 4S1SL 3MRHB 1D9KB 3HE7B 1FYHB 3TWCL 1S5IH 3WNNA 2CUIA 3MREB 3UZVB 4E41A 1O5DT 4S10A 5EO9B 3G5XB 1F11A 4H5SB 4OZHF 3BGAA 1MQKL 1UADC 1DE4B 4J4PA 5HYSB 3QUML 4H25B 1NGWB 2H9GA 1MQ8A 2EC9T 1IGMH 3D85D 3WFHB 4GKZB 3EO9H 2JTDA 5GSVB 5IG7A 2VXVL 4Y5VA 3HC3H 1RZJH 4QF1A 1SEQL 5JW3H 5FECA 5IOPB 1B6UA 2Y06H 3EYQC 3GMNB 5IIEA 4R3SB 4KHTH 4F7MB 4Y1AE 1DVFD 5GRJH 2BSED 5DHVH 1JGDB 5HHXL 5I8OH 2X1XR 3C60A 2YPLE 3D3VA 4OB5H 1A1OB 4Z95L 2XY1A 4AENA 2P49B 4K94C 3MBXH 1BIHA 4NFCA 1VACA 4PJFB 5JIIA 3QPQC 3VFTA 3HNVH 2I9TA 4IMKC 5FB8A 1X5YA 4HF5L 2DTMH 1MCPL 1S8DA 4PGDB 4C56A 3DMMD 4HLZG 1YNKH 1R3HB 2BVEA 1OOAA 1BEYL 1DBBH 3VGDA 1BZQK 1KCRH 4RAVA 1MCBA 1IC4H 4JCMA 4PRIB 5LQBL 5FYLD 5FOBB 4GXUM 2E9WA 3KPRE 4I4WB 5EC2B 3VJ6B 3FN3A 3SDCB 4JCLA 5GGQL 3VWKA 2Q7NA 3GSXB 3ARVA 3TVMD 4KTEH 3P30H 4M1DH 4Y4KA 2HFFA 1D6VH 1NCCL 5DQJA 3C8KA 4Z6AT 4RFEA 1K8DA 5FYKU 1RIHL 5DRNA 3J7HA 4XB7A 3U4EB 1YYLH 4MWFB 5IM7A 4M6OL 3IRPX 2A9NL 1AY1L 3MJ8B 1RIUH 3GO1H 1JPFA 3VG0H 4RQQB 3MNVA 4A2LA 3L6FB 4TSCL 2AV7A 4JVPA 4HUVB 4FZEL 5EB9A 4YWGL 1ZVSA 5EUKB 4GAJL 1E4KC 2AK4A 2VRAA 5EWIH 5EULV 1MF2H 1ZA6B 3T1FB 4JGMA 2QEJA 5C0AA 3IFPA 5D7KE 4M6NL 5MEND 3MRLA 3O11A 2OP4L 3AAZA 3PP4L 2CLRB 4NO5A 5E99L 2OJEB 4ZFGH 1A4KA 1NKOA 3RTQD 1JWMB 4RX4A 3ZT6A 2OSLB 1MQKH 2DAVA 3TN0C 1G7LB 2XQYK 3C6LB 1TCMA 3FO9A 4UIMB 3TO2A 3VFRB 5LVEA 3C5ZA 3L5IA 1AD9B 4OF0A 4B7IA 4M6ML 4P5TC 5K9QG 5ICYB 3Q6GH 3QXDA 2EH7H 1FNFA 5IFHH 4ZPTA 4M7JL 4HIHB 5E8OA 2CKBA 4QGTA 3MUHL 1BF8A 1CLZL 2WBJD 3PIQB 5I1JL 1IAOB 4P2QD 1ZTXL 4MD0B 1E4XH 2PKDA 3MLZL 1UJ3A 3EOAA 1ZMYA 4F33B 2IF7A 3UTZA 4OT1L 4JFQB 1Q94B 3CX5K 4ODUB 1CZ8H 4PRHE 3DV4A 2Y5TB 5I1IL 3CFBA 2CLZB 4Y2DD 4UT6H 1SJHB 1KTKE 2YD3A 2E7LA 1JFQL 4NT6B 4HBCH 2AGJH 5E2TL 1AXTL 5E5RB 1DZBA 5GGTH 5FDWB 1AGCA 3FOMA 3QIBA 4PJIA 1IGIL 2HVJB 4W6XB 2P8MB 3V5HA 4HKBB 5D7IA 4D2NA 2HLFD 4NKIL 5IB4B 3QHFL 1PY9A 5DMGD 5SWSB 1ZHNB 1S3KL 2LAAA 2BVUA 1JZ2A 4UTAH 4NUJA 3BT2H 2FX9L 3MLVH 3BZFB 5D71L 2XWJB 1V3KA 4J3WA 4A6YL 2YS4A 4CVUA 5DQ9A 5C09B 3V6OA 3RKDD 5C0BA 2XXMB 4ZO8A 1IJ9A 4I0KA 3VXME 1ZANH 2C1PA 1M6OB 4K94H 4DN4H 1JGEA 1BOGA 5KS9A 1RFDH 1N7ML 5BZDB 1UYWH 2A9MH 4NQSB 2A73B 1N64L 2Y4SA 4ODUA 4U0RB 4XC3L 4Y19D 1OAUH 1FLRH 2X40A 1T0NA 4WY7L 1JZ3A 1ZLSL 1B0GA 1C5BL 2AJYL 4YLQT 1NAML 2VIRB 3QEHA 3TV3H 3VXNA 4G6MH 5TQ2L 4WFED 1B0RB 3RWFB 1DQJA 5CLTA 3PJSB 2ZP0T 1ZS8B 4HWBA 5DMKB 3VGAC 4KTDH 2UZXB 4X7TA 3ZE0F 4X98A 3WCYA 2PXYB 4LCUA 5CP7B 2G60L 3ZE2E 3EW3B 1T21B 4JAMA 4ZXBA 5GGVY 2K7QA 3G5YA 4KY1H 4M5YL 3OGCA 4U6YB 4PGEB 1DQQA 2CLRA 4TNVK 2HT4D 5E5UB 5D2LF 3QFJA 3WS3A 4LCCC 4HWBL 2N7AA 1ZT1A 4GKOA 2P4AB 3ZE1E 4TUKL 3U4BL 4GKSA 4PJEA 3NACL 3VDCA 3KPSD 2OL3L 1CLYH 1RVFL 2FNBA 2ITCA 2HT3D 3CD4A 1XCQA 2QTEA 1P4BL 4XAWH 4G9FE 2C5DC 2OQJA 1OARH 3SJVE 1MJUH 1RJZA 1T83A 3HZYA 4YH6A 3F62A 4CVXA 3U2SB 32C2A 2EEBA 3DVGA 1YQ2A 1AFVH 3DGGB 3ZYZA 4KKCD 2BVPB 3M1BA 4P3CL 2H2PC 4G6JL 1XT5A 4JFEE 3WUZA 3DHMA 4ODSH 5MI0B 1B0WA 3UTTB 3WIFB 3QI9C 2VWEC 4G7YH 4UBDC 2FZ3A 1JRHH 4YR6B 4R97B 5BZWA 2X9WA 3PWUA 5AD0A 4I48A 5EIIA 3VI3E 2VLJD 2HJFB 3V4VH 4N0RA 1S8DB 5F7DB 3ARGD 4RMRA 2ICEA 1I7ZB 3SE9L 4LK4A 2FX8L 5JXEA 3VFTB 2K3TA 1A2YB 4GLRI 4P23B 5I1DA 4HUUA 4JKKA 4F3FA 4UT9H 3NCYS 1DLFL 3IDJB 3MODH 1G6RA 1NGXB 1W2KT 3DOSA 1WBYA 1MFBL 4YDKL 4PG2C 5K9KB 4C58B 3IETA 3QI9B 4FTVE 4F7PA 3CFCL 3KR3L 1TJHL 3WLBA 4TVSa 2IEPA 3ZL4H 4AEIL 2W9DH 4ORGA 1FH5H 4XHJD 3O6FC 4XPAL 3ZYIA 3P0VL 5DJ8B 3I2CL 1ZA3A 4OCYL 4PRHB 3GSNB 2Z9TA 5GSRA 5IKCA 4U1KB 5IG7B 4WHDA 1CFVH 4RNRA 3LD8C 4XX1E 1U41A 1KOAA 3MOBH 3DMMC 4NQED 5HYSA 1W72B 3I3BA 1TZGH 3QR2A 4XCYA 1GOFA 4D0CB 2A6KA 3AREA 3KYMA 4LLYB 4NQCA 2CR3A 4X6CA 4R7NA 2HKFH 4YDJB 3QH3B 5GRZA 4K7FA 3S3PA 4MNQE 4YO0B 2CUHA 3SKOA 4KJWD 2Y07L 3D39E 1XIWC 4X0KB 4DK6A 5EBGA 1CXLA 3HE7A 3RBSA 2VDOL 4IOFC 1FDLH 2ZSVA 3BEVA 1E4WH 1UZ8A 1A7QH 3BEWA 2X7LB 4M8QB 3HNTH 5IF0A 1ORQB 3QDJA 4NQEA 2HFEB 1ADQL 5JPNB 4GG6A 1DBAL 3L9RA 1N2RA 3CZJA 5T3XE 5K9JL 3UO1H 2AQ1A 1QBLH 1D6EA 1Q1JL 3X12A 4NN6C 3RWCA 2FX7L 15C8L 3QUXC 5TDOA 4N9GA 1DDHB 3EO1A 2E9JA 4HGWA 2I9LA 5AZEL 5IHUH 1LHZA 5ENWB 5JXEC 2NY7H 3L3DB 4KJQC 3KPRA 1A4JB 1JRHL 2MCPH 3MNWB 4PJGF 1FL5A 4JY6B 3MR9A 5GGTL 1KB5B 3QWRA 5JOFA 5JOFB 1G7QA 1NLDL 3RI5F 5GJSH 3NBNA 3LSOB 5JHDD 3V0VB 1JFQH 4P4KA 2BMKB 3OAUL 4Y4FD 1INEH 1MHEB 2EDHA 3QQ4A 3TNMA 4Z7QE 4LQFH 5J4MA 1BFVL 5E2VL 1MCWW 4PFEA 1FL3B 5F7WC 2R2BA 4G6KH 1FSKB 5ACZB 4KC3B 3TPUA 1LEKB 5JA9A 3TBTB 1KEGL 5FUOH 4EUPH 5B4MC 1L0XA 1VGEH 3BMVA 4ZUTA 3H3PL 3IB4A 3VMNA 2L7UA 1V7NH 3Q6GL 4JRYA 1JBJA 3RBGA 2BVOB 3QNYA 1X9QA 4LEXH 5EFIA 4O51A 3T3ME 3IDGA 4YNYA 5MENE 1H5BC 4JRWA 2YN5A 2D7MA 2UY6A 4TN9A 3IDIA 1Q72H 1TQCB 3TZVC 5LGHL 5DRZA 3IAPA 4YO0A 3VWJD 5CEXB 2OP4H 3PP4H 4ZOEA 5DJAA 3RVUC 4N8CH 1V8HA 4XNXL 4YDJA 5CSGA 4ZFFB 3WHXB 2ZUUA 2D0FA 3MUZ1 3OWEA 1DQLL 1EVTC 2VLMD 4IOIB 1MUJB 4OM1L 1PBYA 4PUBL 5GGSY 3FHAA 4DTGL 4WWKB 1QFPA 5DI8A 4F7CA 4IMLA 2XWTA 1OY3B 4QOKB 2MMXA 1MLCA 1NGYB 1KB9K 3RY5A 4OUUA 5JNYB 2MQCA 3BH9B 3NIGF 5IKCB 1S78C 3AXLA 2AJZB 3RWDB 1YYLL 5DDHA 1FZMA 1NUNB 1HKFA 1VKXB 3LS4H 1OGAD 4Z7VE 4ALAH 4BSJA 4HZLA 5DHVA 3K1DA 4XCCH 4X99A 3TBTA 5ADPL 2YD1A 3P77A 2XRAL 3T4AA 2Q76B 1YDPB 1YPZE 4A6YB 2G5RA 2ZUQB 2AEQH 2D03H 1R24B 5CSBA 5IP4A 4J12A 1A14H 4P23A 1A2YA 4UOJA 4M7LH 1J87A 1LO3H 4MD5A 3S37H 3GBNL 4GRLB 4YHIB 5FA4A 1DP0A 2BNRA 3V4UL 1N4XL 2FX9H 3MLVL 5EO0B 5IMKA 3LOWA 1OAKL 4ZOCA 3SGDH 4N0CD 3QDME 1XEDA 3KAAA 3HUJA 3VXTA 1A4JA 4YBLB 1X7QA 1HNGA 3MZGB 4G7VL 3BH8A 3MV8E 3QXVA 1CDIA 1U92A 3DUUB 2O5XL 1KBGH 2YXFA 1NGQH 1INDL 4AJ0A 5JDSA 3LQZB 4EN3B 1M7DA 1D6EB 4MQXD 4G6FB 1I9JL 3KWWA 3TBWB 2V17H 2LVCA 3MV7E 2QJDA 5SWZB 2FECI 3OR7A 3DNKA 3KXFB 3SJVA 4NPYA 1V7NL 5DRXA 3GGWA 1AXIB 1LVEA 4N8VA 3MLZH 4BFBD 5J06A 4UDTB 1JVKA 4LAJH 4LSVH 4K7PH 2IFFH 1ZEAL 3QDHA 4YBQD 2YPLA 1AKJD 5E7BA 1LNUB 1JF5A 3LIZH 2GYSA 3OG6B 1A6WL 2IQAB 2PUQT 2VLRD 5EO1A 4LRIA 3O81A 1I9EA 3VRLF 4JO3H 4XCYB 3B2VH 3QFDB 1GGIH 3S88L 3T4YB 3HNSL 5I0DA 4YHPB 2BHUA 1EGJA 2X89D 1U8PA 3QYCA 4GBXB 4J7RA 3SCMC 3OKLA 4FFVD 4JGJA 5IESL 3PABB 1P6AB 5FGBC 1DQJB 1I1AC 1MF2L 4ZS7H 3I6GB 3QEHB 3JWNC 1KTLA 4EUPB 1EFXA 1H0DA 3FFCB 5KSAB 3BWAA 3BRFA 3A6BL 5D5MA 4Q6IB 1SEBB 5GS0L 1IGCL 4UV4L 4I2XA 5I1DB 3V4UH 2GI7A 3AS1A 2YBRB 1B2WH 3T8XA 3S36X 4LHUG 1J7VR 4OLXL 1T83C 1RUQL 3I6KA 1S9WA 5DK2B 2V2TA 5I8EA 2P43B 3CDGB 2R39A 4XRCA 3KPRD 3TBVB 1VDGA 2RAMA 1OGAB 4X80H 1HE7A 3ILQC 4DGYL 4ZDHA 1ZVHA 5KSVB 4O9HL 3KYOA 1OAQH 1X44A 1CGSH 2EICA 1AC6A 4O4YH 1CFBA 4U6TA 3IFNH 3VD7A 3BIBX 1NGZB 3KHQA 3VXUA 1M05B 5GZNC 1DQMH 1DBML 3QRGL 1EUTA 4CVXB 4LCCB 2X4RB 1U91B 3O4LD 1WT5A 1MWAH 3EFDH 3NCYP 4WV1B 1X5KA 2P8MA 2EC8A 5DMIH 3V5HB 1WGOA 3QDJD 4QEGA 1RU9L 1FNEB 2ESVB 1AD0B 4NKQB 2VLJE 1U58B 5L6YH 3S4SA 2V5MA 3MRNB 4DZBA 3EJZC 1FZJB 4L3EB 2ITCB 4LGRB 1NAMA 1UQSA 1FE8L 3P0VH 3PXJA 2LU3A 3H3KA 3ARZA 2X70B 5I1HH 2X89A 1A3LH 2CIIA 1BQHA 3G6DH 2W0FB 3CJJA 3KLSA 4KV5F 4JFQA 2FO4B 2F15A 5T3XH 1GJIA 1I9IL 1NANH 1NUDA 3BO8B 2GCYA 2WW8A 3B2UD 3QZWG 4WHTA 2GT9B 1IC5H 5JW4M 4JPVL 3U46B 4HPYL 1A1MA 4TUJA 5TE7L 1F4YH 4U6YA 3KPOB 2ZG3A 3BWUC 3BQUD 3ARXA 2J8UA 1SYSA 3SQBA 3D39A 3GNMH 3FQUB 1JWUB 1HK6A 1YEDB 5ERWB 4H1LH 1KNOB 4X6CE 3IJSA 5ACLA 1MNUL 3G5VB 4QOKD 4ODSL 3WKMH 3HI5H 1QFWL 5ALBL 2GKIA 3JTTA 5CCKH 4NO5B 5D96C 3WFZA 3I3EA 4S0SD 1CR9H 4W4OA 1MRDL 4PV9B 2P42B 1G7PA 3OHXB 3IFPB 5C0AB 2EIZA 2XFXB 5HHNA 4JQVA 1ZWIB 4BYHA 2AEWA 4XNMA 3QUMA 4JKPL 3ZYOA 1J1PL 4NQSA 2H32B 4P2OC 1Z0NA 1JN6B 4GAYB 5EOCJ 1XF3B 2NY7L 3MNVB 5EOQH 1M6OA 3NA4A 2R4SL 5T3XD 3H42H 1R5IA 2ZCLL 3MJ8A 3V0WL 3W9DB 4YHMH 1BM3L 3U1SL 1Z0MA 4PLNC 1A6AA 1CIDA 5EIVA 3NPSC 4G8FB 3C09C 3ECBB 1NSNL 1QEWA 3RNKB 4RWYL 1HOCB 3MRDA 5AG9A 4LLWA 5DR5L 4YIQA 5IHZA 3H42L 5SWSA 1CGWA 5CUSL 2AXFB 5B22A 1QBAA 1R5WA 4KRPB 3OXSB 2CR6A 2Q6WB 3VWJC 3VXMD 2ENSA 1GC1H 3ILQD 4DOHE 3LKNA 4S2SB 1AGCB 4I1NB 3CC5A 4NBYB 4OM0L 3MBEA 4K07A 5HGGS 4GG8B 1QO3B 4JG1H 2FRGP 1Z5LA 3BD4A 4WTXA 2DL2A 3HPLB 3VWKC 1QYGL 1VADB 5I1GH 2AJYH 1RK1A 3CIQA 3QCTH 1NC4B 2GITB 5CGTA 5DO2C 3N9GL 3LQAH 5J0BA 3B4NA 2CRYA 1N26A 4JZJB 3B6SA 4X9BA 2AJ3B 4PJEE 5FCUH 3RGVA 1D5ZA 1UFUA 2APXA 5C92A 2MQ0A 5LCVH 4XMPL 1YQVH 3BAEL 4NQTA 1XF4A 3QO1B 5CILL 1RMFL 2HTLC 4KPHL 5CUSH 1UB5A 4HT1L 5JOEA 4NBXB 2ITDB 3O41B 4QHNA 1EHNA 3VU2A 2B8OT 2FGWL 1BPVA 2IALB 3M07A 3TVMC 3UTSD 1FJ1B 3ZKQD 1U42A 5CJQH 3HMWL 4IEFB 1QNZL 4JHAH 4LDOB 4Z78B 1QP1A 5DT1L 1ACYL 5MEOB 3QULB 4L29A 4D9RE 1KLGB 3CXHK 2DYPA 4K7PY 5DD6B 1OM3H 5D7IF 1J1PH 1FFNA 4TSAL 1F13A 3RZWA 4U6VH 5EOTA 4FRWA 1T89C 3LAFA 1KB5L 3P2TA 1R3KB 1KIRA 4G9FD 1DBMH 1TVHA 3NA9L 3PL6A 3V52L 4G6FD 5HY9A 3NVQA 4DZ8B 5D1QB 4HH9A 1JGLL 2GAZB 2DDQL 4GJTB 3BVNA 5I30H 4L29B 3B9KD 2YXMA 1PZ5B 2FL5B 3LHPH 4JDZB 3MC0A 5E4EC 3RRQA 3ZSTA 2E27L 1F4XL 3DV6A 1A6TB 1MCRA 2R0KL 1ZLWH 3ORJA 1ZK9A 4J6RH 1FGNL 4UMGA 2EDKA 4OLYH 4L9LA 5DS8A 3S34H 4PG2A 2DM3A 3WHE1 3MA7B 1HINL 4PRBB 2ITDA 3O41A 4QHNB 5F72S 5EORH 3TZVA 2W60B 4WWKC 2VUYA 3P9MA 1RJYA 1S3KH 4HWBH 4CMHC 1JHKL 2HKHH 4HPOH 3FO1B 1KN4H 1OGTA 1IC7H 1ZHBB 2CD0A 4ODHH 1EA9C 4QHUB 3VI4E 1KIQB 1IAKB 4ZODA 1T6VN 3ALWA 4NO0B 2BNRD 3IAGC 3GKWH 4JFOB 3T1WA 4L1HA 1JPSL 1NC4A 1FAIL 4MLSA 2LABA 4L3ED 2BDNH 2IAMD 4M03A 2CK0L 2O5XH 5E2UL 1VADA 3RWGB 5GGVL 1BMGA 1J12A 1NUGA 1QRNA 2R23B 1XH3A 4HJJH 3WLWD 1YEJL 2BFVH 2VXUH 1OTTC 3B2VL 4P5MB 3CCHB 3CMOH 2VDPL 2MFNA 5E8EB 4CMHB 3GMNA 1O7SA 3GJFK 5CZVH 1CD9B 5F7YC 3RHWF 4RFNC 3D9AL 5C2BL 4RX4D 2H1PH 3UPAA 3AMLA 2HLFC 5IVZA 1WWCA 1N59B 4MAYA 2YD7A 3IGAB 5F3BA 3EOBA 1U3ZA 4RGMC 4XP1L 4L8BB 1DEDA 4PJ9A 3EYVA 1TETH 3HE6A 4PYHA 3IJYB 2D03L 2FR4A 4CJ0A 1K4CB 1AC0A 4TUOB 3QUZC 1DSFL 3O2DA 1GPOL 4OZGE 3Q3GA 1S7RA 3F6LA 3ALXA 1EZVX 4OJFH 1CXEA 3HRZB 3LKQA 1DN0B 5EC1B 1TXKA 2EDLA 3MO1B 1WWWX 3SOBL 1H9VA 3QUMB 4U4BA 2FHCA 4KFZC 2XFXA 1DQDL 5HHNB 3TVMA 3BUYB 1QBBA 4MJ4A 3D5OF 5F1KC 5HD8C 3VFPA 3AFLA 4G3YH 1MCLA 4TPRH 3SDDC 3MMEB 3K7UA 1P69B 2EYRA 3KNBA 1RZFH 2DS4A 3QEQA 4WI9A 1KNOA 1MJ8L 4MA3A 5CJOL 3BP5B 4PV8A 4OJFL 3TZVB 4JDTL 3F7PC 1KSRA 3CLEL 4ODXA 3RIAF 5HPMA 2ZOLB 5JHDE 4QRRA 1JZ7A 1XF2B 3GSWB 3DX7B 2E6JA 3GBNH 5DVKA 4K2UH 4XPTL 3BSZL 2D7TH 2VISB 3IVKB 3PDGA 3IXAB 3T2NH 1OP3K 3PWPA 1AGDB 2J3SA 3BVNB 4FQXA 4QYOB 3QDGA 1CFSA 1F58H 3QUYB 1TQBC 4OZGF 2FO4A 1Z3GL 2UVFA 5IVXA 5L2KE 5SWZD 3WNKA 4N5UA 3GJFB 1R3KA 4Y2DC 3AS2A 1HSBA 4NRXA 4NJAL 5CZVL 2BCKB 4ZS7L 1ADQA 4PD4J 1KF9B 5HHQB 5FHBL 4LFHG 5H2BB 5IESH 1QPXA 3VI4F 3PG2A 2IANA 4YHOL 4I2XE 4OGYH 5I8CB 1CYGA 4NQDB 4JB9L 4AQ1B 4KWUA 4XC1H 2ATPB 3WO4C 2V7NB 2ZCHH 3GBML 5DMGC 5KVDL 3SE8H 3CFEA 3TBSA 3QG7L 2NY3C 2NCMA 4FZEH 3FCTA 5IHBA 2E9IA 1V3LA 4LSRL 3KJ6H 4X4YB 1IILE 3KYOB 5M94B 5ANMA 4OKVB 2BVQB 2BY0A 3E6HA 1HHGB 1OAZH 5KG9A 3V6ZA 5I75C 2MPAL 5AG8A 1KJVB 5DVMA 2HAZA 1F58L 5FK9B 4LSVL 1HWGB 5I73C 4AG4H 2F53D 2IADB 3IU4L 5KSAD 5E2WL 5FUOL 2X05A 3O3EB 1ORSA 1CFTA 5I71B 3O3BA 3KXFD 1JUFA 2YPKB 3O45B 1LE5A 2ZCKH 4MAYD 1BIIB 5MEQB 4LQFL 5CFHA 5D7LB 1AHWB 4FP8L 5CIPB 4WNQB 1EFXB 1H0DB 2R56H 3BESR 4JM2B 2PNDA 3GI9L 3RWEB 2VN4A 1DBJL 1YN7B 5E8NB 4LSPL 1PVHA 3IDMA 4ETQA 2R0WL 4PRDB 5FO9A 1T2XA 3MRFB 3L7EA 4IRSC 1G1YA 1X5GA 4WUUD 5DD0H 1SYVA 2XZCH 2DQGH 1S9XA 5IJVA 3DWTA 3PGDA 2IADA 4N0FA 1PG7X 1IQWL 2AXFA 5JTWA 2X5PA 2NX5D 4XPFL 4B41A 2YRLA 2GTZA 3HG1D 5E6IC 4HCRA 5DFVD 4P9ML 4K3JL 2IQAA 1T5XB 5CP3A 5LGHH 3HPJA 2YEZB 2BVQA 3H6JA 3JUYA 4OKVA 4MXVF 1KCKA 2FB4H 4G8EB 1DBAH 1KPRA 4EVNA 3WN5A 5JMRA 3MV7B 4LGPB 3QDMA 4M62H 1UXWA 1P5VA 1B4JH 3D3VE 4GAYA 5ADPH 2QADB 2A77L 5EORL 4OLUL 4Y4KC 3BDYL 5DFVC 4R90L 1IAII 4GRWE 3SQOL 2F53B 3K8KA 1NMCC 1FGVL 2VAAA 3PE9A 5M7QA 5C08B 4L4TA 3VGEA 1BD2A 2OL3A 5KVGL 2J8OA 3WXWH 3LQAL 5CJ8A 3O9WB 4NRXB 3MYZA 4WW2C 1E6JL 1TZGL 4F9LC 4U1IA 1E0OB 5BS0D 1QYGH 3BGMB 3BYYA 3NPSB 4KGJA 2ATKB 4ODWA 1JI1A 1X7QB 5F8RC 4LSSL 2GUOB 5EU7C 2BP3A 1ZHLA 5ITFA 4XH2A 1I85C 1TVDA 2BDNL 3A67L 2ZUSA 4R0LA 2H26A 1PKQB 1IQDA 5GGVH 3DVNA 4EDXA 4TUJB 5C0RH 2BVTA 3KLHC 5ISZE 1EFQA 2FHFA 3ZLQC 3VE0B 3V5KA 2RGSA 4GRLA 5I1EH 3MODL 3EZJB 4RA0C 2A74A 2C4FT 1NSNH 3CFJB 5EA0L 5KTEH 1IEHA 1KTRL 4OKDA 1IAIM 2YK1L 1QBLL 1I1AA 4JFXB 4D9RD 2Q76A 2YOCA 1BX2B 4PGBB 2DN7A 4ERSH 4R2GD 2RQ8A 3PQYB 2Q8BH 3KLHD 4YDLB 3UTQB 3VFOA 4L3EA 5L9DH 3FFCD 2WWMC 4YE4H 3UJTL 4ZSOA 1F4XH 4CDGC 1H8OA 3BI9X 1LO4L 2AJZA 4Q9QL 2XZAH 1WZ1L 5DJYA 4PGZA 1O7VA 3CX5J 3DURB 2PYEE 3F7VB 2IBZX 4R96A 3OAUH 1NGYA 5EN2A 2V2WA 3VI3F 2XG4A 4LVOB 5GGSB 2X4SB 5CD5C 5B38B 3QEGL 3QUZD 5CJBA 5D7SL 5F9WC 3TZVD 1C16B 4NNYB 3MJGX 3QXUA 1KJ2H 3GHEL 1BHGA 3O6LH 3VXOB 1JF6A 4QTIH 4Q9QH 4O02H 2VLLB 3FMGL 2SEBB 3TV3L 1G9NL 1TMCB 4PJ8B 3TBVA 3CFDA 2VDRL 4OFIA 1A9BA 3FOLB 2OX5A 3MQIA 3MJ6A 3VD5A 2PR4L 4JANA 1FGVH 1ACYH 1N0XL 4MA1C 5D70L 4Q7DA 4OIIH 2C1OB 2RCSH 4POZC 1E4KA 3QIBD 3UTSB 4Y4