2XIGA

The structure of the helicobacter pylori ferric uptake regulator fur reveals three functional metal binding sites
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
148
structure length
146
Chain Sequence
MKRLETLESILERLRMSIKKNGNSKQREEVVSVLYRSGTHLSPEEITHSIRQKDKNTSISSVYRILNFLEKENFISVLETSKSGRRYEIAAKEHHDHIICLHCGKIIEFADPEIENRQNEVVKKYQAKLISHDMKMFVWCKECQES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Helicobacter Pylori Ferric Uptake Regulator Fur Reveals Three Functional Metal Binding Sites.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transcription
molecule keywords FERRIC UPTAKE REGULATION PROTEIN
total genus 42
structure length 146
sequence length 148
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2xigA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2xigA02
1IUYA 2K02A 4LG0A 3IKVA 1STZA 2YU3A 1K78B 4ZH4F 4IVNA 4KMFA 3MAJA 3E6BA 3PFIA 3R0AA 4OINF 4MQ9F 5HS9A 1UFMA 1KYZA 1H9GA 4HOBA 3F72A 4ENKA 4L9TA 1ZRDA 2EB7A 4XSZF 5KVRA 2EV0A 5L3GA 4O3MA 1XGOA 1B6AA 1J59A 1GHCA 5D8LB 4QLCU 3VOEA 2R3SA 2OQGA 2IJLA 2OZUA 1QGPA 2RDPA 2H27A 1W7PA 4XLNF 4BH9A 4EGZA 5HDKA 1BC7C 4UNOA 4U88A 1XDSA 2QENA 1SD4A 3RIRA 1MZBA 5IT3A 4MNUA 1RZ4A 4HLYA 4B09A 3TOBA 2KIFA 2TDXA 2RVCA 2PI0A 3ULQB 2WV0A 5FB2A 3COAC 1K79A 2L54A 3LAJA 1OR7A 4P96A 4JQFA 1WKMA 2FRHA 1K78A 2UWMA 2Z9OA 3BDDA 5KK1A 4LD5A 4F7ZA 2PMUA 1FBQA 3SFZA 4HA8A 2M87A 1BI3A 4LGWA 5ERIA 2GAUA 2D45A 2R7FA 3EETA 1UCRA 2YPRA 3DP7A 3QP6A 1O3QA 4PZJA 3JSPA 5F64A 2AS5F 4XLPF 2D1VA 2IPQX 1X3UA 3AAFA 4NHJA 2MH9A 1BIBA 2PLYA 2EWNA 1XMKA 1V3FA 5FLXK 4BAYA 3LQQA 2K4BA 3ZP5A 3BZ6A 3DF8A 2IVMA 2WTEA 2LKPA 1FSHA 1YO5C 4G7ZF 4HF2A 1BOAA 4G9YA 2LDUA 5ILUA 1YW8A 4HX8A 3GFIA 2KIMA 4IJAA 3KEOA 3C18A 4M9SA 2HKXA 4P5OA 1O3SA 1IN7A 2G7HA 3J81K 3WTWC 3B02A 2CO5A 4PGGA 5TJJA 2VONA 2RGVA 3TDUC 2VOOA 4LFUA 5E1WA 3GLXA 2R7DA 1G3WA 1F5TA 3WU1B 1U3EM 2LNBA 1ZG1A 2DI3A 1R58A 4AIKA 1R22A 2QYOA 3L9FA 5L3FA 3KLOA 2UXNA 3GUDA 1B59A 3FWEA 3CLOA 3I58A 4EGYA 2A6HF 2EJRA 1IN8A 1F9NA 3KP5A 4TV7A 5CJ9A 2JT1A 3E97A 4UVBA 3HRMA 2ADUA 5CVRA 1IRFA 1RUNA 4A12A 4Y15A 5ILSA 1SFXA 4UV9A 1D8KA 4KICA 2A68F 2F5EA 4JBAA 4XSXF 2YR2A 4OOIA 1BI1A 4U7DA 3FM3A 2LF7A 4HDUA 1LNWA 4I0AA 5CVVA 1P4AA 1ZARA 3V7SA 4ESBA 2P8TA 1FNNA 2NRAC 2HQRA 4L18B 1W7PB 1E17A 5DUIA 4OIPF 5D5WB 3J80K 2DQRA 5EEHA 3CO7C 1YG2A 5LGNA 3LA2A 4ZYGA 4FHTA 4EJVA 4H0EA 2VE9A 1IAWA 1DUXC 1AWCA 2O03A 3GZ6A 1TW3A 4P9FA 3RYRA 1XSDA 1LB2A 4I0BA 2L02A 2Y48A 3LA3A 4CDGA 4LB6B 4EMSA 4ASNA 2EFNA 3J81Z 2P6TA 4G7HF 3HSRA 2COMA 1TLHB 3O2PE 3IKTA 1FX7A 1I5ZA 5E1ZB 3GX4X 2BBYA 3BROA 1BC8C 3SZPA 2W85A 3QP5A 3JW4A 4KDPA 3I5UA 2O0YA 4I2OA 3EUHA 2FMLA 5E18F 1FC3A 2BYVE 2NNNA 1O7LA 3F23A 5FLXZ 2FA5A 3E5UA 4G6DA 2QUFA 2W25A 3DQVC 3GF2A 5ED4A 1F4KA 4S04A 2NAZA 1UHWA 3P9IA 5CVIA 2ZO4A 3MQ0A 2XKPA 4HQEA 4GYIA 3WTVC 4IF4A 2WC2A 2FNAA 5L3BA 3F8NA 1LDJA 4KMUX 2JZYA 2A6EF 5A2QK 3ROUA 1CF7B 1XGSA 3PQJA 3N4MA 5LGTA 3G3ZA 3E6CC 4WXDA 4U7BA 3TO6A 4XBFA 5DD8A 1JE8A 4AIJA 4KT5C 1HKTA 3QU3A 4MQVA 3J80Z 4A0YA 3I59A 1DPUA 2XIGA 4A6EA 1LQ1A 2GQQA 1FLIA 5CVUA 4WXHA 2JRTA 3U2RA 1ON2A 4MEYF 2P7VB 1R1VA 1EV7A 5HOOA 3L7WA 3LFKA 2QWWA 1C0WA 2PMHA 3HTSB 3FXUA 2QVOA 3LWFA 2DPUA 2BGCA 4UHTA 4ENNA 4Q48A 1ZGJA 3FM5A 5DD4A 1TW2A 4G7OF 2RNJA 1P6RA 3ABTA 2IA1A 4HV5A 2H94A 1KU9A 3SZTA 1U6GA 3FXRA 2OAZA 1ON1A 3QOPA 1HKQA 2MLGA 3I0TA 5D5VB 1FOKA 5AONA 3M8FA 4AIHA 1I1GA 1QPMA 2XHKA 2VBWA 1KU3A 3V8JA 3T5XA 1XD7A 1HKSA 3OOPA 1XCBA 1DP7P 2X4HA 1FT9A 4MTDA 3FX3A 3ELKA 4A5MA 3ZMZA 4WK8F 3G73A 1USSA 3LA7A 2A07F 1YIOA 4MHGA 4XRFA 3QAHA 1QQIA 1YW7A 3K0LA 2H6CA 1YFHA 2VE8A 3M1EA 3DV8A 5DCMB 2A61A 4I7HA 2PJPA 3HSFA 3IRRA 5J8CA 2YSRA 1O3RA 1J0RA 2E7WA 2FU4A 3MWMA 1XSXA 2Z3YA 1W5SA 5FFXA 1ZN2A 2V1XA 5JR3A 4WX9A 1IW7F 3EQLF 3E3VA 1P2FA 3HUGA 2W24A 2VXZA 1XN7A 4EJOA 1ZH5A 4GXOA 2EV6A 3K2ZA 1T0FA 4NB5A 3VEPA 5FD6A 4IRHA 1QO0D 2QLZA 3DXJF 3CO6C 2PG4A 1E2XA 4EJTA 4Q47A 5IT9Z 1I1SA 1G6NA 3CUOA 1TNSA 1XMAA 4YG2F 1USTA 4RB1A 1OYIA 4CXFA 3HOTA 4RB3C 1XB4A 1SMYF 2JSCA 3MEXA 1IN5A 3R0JA 2A5YB 1DPRA 1FBSA 4E70A 3RTRA 2EFQA 1R7JA 3ZQ7A 3FMRA 3SHFA 2V79A 3HSEA 5K5RA 1GXQA 1P92A 5LHHA 1FY7A 5HS8A 4IHSA 3HYIA 3MCZA 2DQLA 4ZZDA 2P5LC 1SMTA 3KZYA 3C1DA 5D6FA 1K7AA 3KP2A 2GXGA 1S8NA 3KP7A 2HWVA 5LGUA 3RYPA 5HLHA 3WTUC 5E1XA 1U8RA 2STWA 2VC0A 3RPUA 2RN7A 2M8EA 4U0YA 4GYGA 3WU0A 1YYVA 2H09A 1OYWA 2DK8A 4UXNA 4YIFA 2L4AA 4FT8A 3LAPA 4KFCA 1OMIA 4HX7A 4AVPA 1TTYA 4HF0A 3F3XA 3KLNA 2V1UA 1U78A 2ZMEB 2XGXA 5EEGA 2VODA 1FP2A 2XVCA 2HKOA 3JAMK 1ODDA 1K6OA 3GO5A 2ZNZA 1G3YA 3TO9A 3VFZA 3FZVA 2F5CA 2JTVA 3MZHA 3IL2A 4L5IA 4CYDA 1G3TA 3U1DA 4L0YB 2FBIA 3RJPA 1O7FA 1R1TA 3J7AO 4L5JA 5H6RA 2Q2EA 1HW2A 1FSEA 4ZYDA 4IRGA 1B9MA 5D8KB 1YLFA 4LG0B 1SD6A 5FO5A 4RAZA 1LDDA 2F5FA 2QQBA 4GGGA 3PQKA 3ZN0A 1GVJA 2K86A 3O6BB 3WTZA 3K1PA 5HDGA 4S05A 2J5PA 1RNLA 5H6QA 5BOXA 5BS6A 3QU6A 4M6YA 4M6XA 2W57A 4KYWA 3BJ6A 1FPQA 4OMYA 5FFZA 3MZYA 5JFRA 4HYEA 2UXXA 4R8HA 5HLGA 2HR3A 4WWCA 3F8MA 1FBUA 4Z2YA 2FBKA 3KE2A 5D4RA 5LHIA 4MGRA 3R61A 2XAQA 4KNYA 4WF2A 3KZZA 3BJOA 2J5OA 1VTNC 2K7LA 4UVCA 2P6SA 3JSOA 3QPHA 1ZYRF 1P4WA 3BPVA 2A3SA 5DEQA 4N0BA 4LLLA 3ZMTA 4ZZLA 4IPAA 4I02A 2GA2A 3WGGA 2OU2A 5LHGA 3CUQC 3RPQA 1WSUA 3IWFA 1SFEA 2M1BA 3GXOA 3VB2A 2ESHA 4U0WA 2DTRA 4BHPA 3HRSA 3I53A 2ESNA 3QRFF 2BE5F 3JTGA 1ZRFA 4M72A 1OKRA 3C7JA 5HS7A 1U5TB 5ICCA 1CGPA 1ZLKA 1IN4A 3WTXC 4P55A 2HDCA 5ICEA 3IWZA 1R23A 2CWEA 3K1MA 5D5UB 5L3CA 2GZWA 1B4AA 2XV4S 1WI9A 1KU2A 2VN2A 2CSOA 2VT3A 4A2UA 1IRGA 2V6CA 4LLGF 1B9NA 2AXLA 5CYVA 2YX7A 4KN4X 4O6JA 5L3DA 2P5VA 3HTUA 4BQAA 3GYHX 4EM0B 1MJ9A 1O57A 1Z91A 2RC4A 4A0ZA 1R00A 1S7OA 1KQ8A 5DV5A 3HRTA 3V8LA 5DDGA 2K27A 5ILVA 4Q5SF 3E6MA 4ZYEA 2FXAA 3LQRA 2XRNA 2P7CB 3EYIA 4P9UA 4N9IA 2P5KA 4WXCA 1U5TC 1Z6RA 3GWZA 2EA4A 4A6DA 2STTA 3CJNA 5JVTA 1L0OC 3T1BA 2HQNA 4RGSA 5ICFA 1QZYA 3D5LA 4CGZA 1RIOH 1V4RA 1SAXA 1T2KA 3I71A 2VBXA 3W6KB 3M8EA 2VBYA 3VODA 1FYLA 3RDIA 2H6BA 3ZN1A 3U9GA 4RB0A 2KRFA 5DYMA 4KUMA 2OZ6A 3RI4A 1MJBA 2HOEA 1TQIA 1LDKB 3WG9A 1CF7A 1BI0A 2QZ8A 5AIPA 1YS7A 2Q8KA 4GO1A 3B73A 1J2XA 1IXRC 3NQOA 2V1DA 4ESJA 4ZYHA 1AOYA 3FMQA 2HS5A 2Z33A 2ZNYA 1H9TA 4D0PA 1W4MA 2CQKA 1T38A 2YX4A 3BOQA 5HLIA 3I59B 1Q1HA 1JHHA 4IRIA 2MH2A 1LJ9A 3F22A 1T6SA 1DDNA 5BPDA 2XUBA 3WE3A 2F2EA 5BQTA 1IXCA 4LB5A 4HAMA 4L9VA 1ZGAA 5TRDA 2ZKZA 5D6EA 4U0VA 1KU7A 3JAMZ 2BEOA 3E5XA 5J8FA 2HZTA 2PBIA 3Q9VA 3V7CA 2O6GE 3L09A 2VBZA 5CLSA 2DPDA 3CDHA 2MD5A 2L3DA 3HRUA 2Q0OA 3CUQA 3ABUA 1WRJA 1QBJA 3RKYA 1T98A 3V8KA 1KYWA 4IXAA 1D8JA 4EM1A 1ZRCA 1BM9A 3KP3A 2FMYA 1XCVA 5K1YA 5BPIA 4LMYA 4R1HA 2IRFG 2CFXA 3NEUA 4HBLA 1F1ZA 2IT0A 2ETHA 3R6SA 1U5TA 1S29A 2EFPA 2ZJ2A 1A04A 4M9ZA 2CW0F 3P7NA 1ONVA 1U2WA 1BIAA 4NQWA 2OBPA 4I98B 3WE2A 4MTEA 3BY6A 1B1BA 4WCGA 3LSTA 1J7KA 5FD5A 1IXSB 3IC7A 5J6XA 1HXDA 1YS6A 2ACJA 2F5DA 3WGHA 3KP4A 1Z9CA 3CUQB 5L3EA 5LEJA 5JI6A 3REOA 2BV6A 3ZPLA 2LSOA 5F1RA 4M9XA 3DKWA 1L3LA 2RQPA 2OD5A 4MEXF 3K69A 1YTYA 3S2WA 1IZ1A 3IHUA 2M30A 1T39A 3FF5A 2L01A 3E6DA 3K9TA 2W84A 1KQ0A 2GWRA 1P4XA 2O61A 4OIRF 3ISPA 4AD9A 3ERED 2PN6A 3DPLC 4YFXF 2ZXJA 4R79A 4K2EA 4YIIA 4PCQA 4CO8A 1J75A 1Z1DA 2QBYA 3KETA 5E8IA 2Y75A 2ISZA 2GIVA 1TQPA 2D1HA 3KEQA 5K5OA 1S6LA 3T8TA 5D5XB 3F6VA 1FWZA 2ZFWA 2HTSA 3RKWA 1JHFA 1Z05A 2FSWA 1BN5A 4OU0A 3WTTC 4FX4A 4YFKF 1KA8A 1ZG5A 2EA2A 4UV8A 1O3TA 2EFOA 3I64A 4L9NA 2DLLA 3TKYA 2OA4A 1QZZA 4EV0A 2FEZA 1FYMA 4HX4A 4KIFA 1PDNC 4PGHA 3CTAA 2PEXA 1W7PD 4CHUA 1KGSA 4L0ZB 1LEAA 3W6JB 4BXUA 2HFHA 1RI7A 2ELHA 1ULYA 1PP8F 2V9VA 3O3KA 2MC3A 4HZFA 2XAGA 2E1NA 3KFWX 2M45A 2QQAA 3D0SA 4ESFA 3GVAA 1OPCA 3V7RA 3L2CA 3FXQA 2QM3A 5DCMA 2D2WA 5LRRA 2NS0A 2QBYB 1WWXA 5DCFA 2MA3A 1ZG3A 3K1NA 5ICGA 4EJUA 2XROA 4HV6A 5LBQA 5JHUA 3ZMVA 1MD0A 3F8CA 4EJWA 3M7GA 1HSJA 5E17F 3TOAA 2KIUA 3H3UA 2O8XA 2DU9A 1TBXA 3GFMA 2E7XA 2XKOA 4RGRA 1R36A 4HQMA 2ZBKA 2M5WA 5HDNA 4B8XA 5LLQA 3H92A 1SFUA 4BHCA 1W5TA 3GFLA 3TDZC 3TQNA 2EK5A 3DPTA 4DNCA 3GW2A 2NYXA 3GEZA 1UB9A 1NHAA 1BI2A 4BNCA 2FF4A 1WQ2A 3KP6A 3KCCA 2DW4A 5FGMA 2MLKA 1S3JA 4ON0A 3HHHA 3BWGA 4LK1F 3MFKA 2FQ3A 3H3ZA 3BJAA 4A0XA 1R5HA 3ECOA 1MJAA 2CGPA 2NNYA 2EV5A 1MDMA 1FYKA 3F8FA 4Y17A 4OMZA 3WTSC 4HLXA 2KKOA 1HQCA 4LJZF 1ZAOA 3DEUA 2VOPA 2LF8A 5DUKA 4M74A 1G4DA 3R4KA 4LLNA 1H0MA 1UHMA 4EVIA 1EH8A 3L00A 1FP1D 3HHGA 4RAYA 4ENJA 4G8XA 3QPTA 4Q4ZF 3RKXA 2WWYA 4A5NA 1GXPA 1IF1A 2CG4A 2XASA 1SD5A 2QQ9A 2IA2A 2PFBA 3SXYA 1HW5A 2DFIA 2HTJA 4CICA 1KQ9A 3FHZA 1BBYA 2P4WA 1ZREA 2ZMEA 2HGCA 1XGMA 4FX0A 3F8BA 5HVQC 3EYYA 1J5YA 3M9AA 1BJAA 4I01A 3ML6A 4N9HA 3SQNA 5LEKA 5LRSA 4EM2A 1I27A 2JPCA 2A69F 2VT2A 4M73A 5A2QZ 4YFNF 1XGNA 1R1UA 1MDMB 3Q9SA 5CVJA 3HIFA 4Y13A 2VC1A 4HF1A 3WGIA 3BPXA 4OIQF 4BYYA 4ENMA 4LK0F 2Z99A 3GZ5A 1YQAA 3T0YA 2FOKA 2HEOA 5E8GA 2B0LA 2OQRA 4G6QA 1TQMA 1XDUA 1LVAA 3ZMSA 2XAHA 2Z5UA 4O5VA 4HW0A 3ECHA 2ISYA 3TGNA 1S7AA 1LEBA 2FNPA 4AWXB 2K4JA 2XAFA 1YW9A 2IA0A 3OV8A 1MKMA 2FBHA 3WTYC 2UZKA 2ZCWA 4PDKA 4RS8A 2DAOA 2FE3A 3F6OA 5IT9K 1HW1A 2DT5A 4G94A 1ZHFA 5E20A 4M71A 1SD7A 3IRQA 4IHTA 2HYGD 3P9KA 4L9JA 4UVAA 1FZPB 2DBBA 1EH7A 4KA4A 1PP7U 1XSVA 4GCVA 5AIQA 3BP8A 3NRVA 2CYYA 2G9WA 3I4PA 4QWQA 3P9CA 3GFJA 1JXSA 3FMSA 1REPC 2Y0MA 2DO7A 2E1CA 6PAXA 3C3WA 3N97A 3ZMDA 3R60A 2G7UA 1I6XA 5K5QA 3ZMUA 2IP2A 1QNTA 3E5QA 2DK5A 4JK1X 2KJCA 1D3YA 3HOSA 4KIGA 1J9IA 1D5VA 2JPBA 1Y0UA 1R5GA 2RV8A 1OYYA 2MBFA 4BHBA 2PQ8A 1IN6A 2X0LA 5H20A 4DQ2A 2HYFA 4KN7X 2RKHA 3I54A 4UUVA 1ZLJA 1TNTA 4I09A 1Z7UA 3WODF 4CZZA 5D4SA 3JTHA 1HSTA 1JGSA 1MGTA 1RUOA 1G3SA 4EQQA 3F21A 4OIOF 3EDPA 4KIBA 4RB2C 4RGUA 3V4GA 2GXBA 3T8RA 4ETSA 3TO7A 4RGXA 3DFGA 4HDVA 1PUEE 2L4MA 2KJBA 1EH6A 2C6YA 2O3FA 3Q5FA 2XAJA 2IW5A 5F6FA 1HBXG 5BMZA 2GA1A 1Z6TA 2EFWA
chains in the Genus database with same CATH superfamily
2PMZN 1OQYA 2K02A 4LG0A 1IUYA 2W6ZA 3M4IA 2HVRA 4J19A 1VQLI 3CJRB 4B3RH 3QZ8A 3IKVA 3OS0A 1ITYA 4EEFG 1WCMG 2NXNB 1VAJA 1STZA 2YU3A 2AO9A 2DPIA 1K78B 4ZH4F 5LMNH 4IVNA 2K9LA 1W36C 3N44B 5D1OA 3U9SA 4OAZA 4KMFA 3MAJA 4I76A 4A3FG 3E6BA 2LBFA 3J80W 3FK6A 3PFIA 2KFDA 2VPRA 5D1PA 3R0AA 4OINF 1Z21A 3CCEI 4MV9A 2V4RA 4B43A 4MQ9F 4J00A 5HS9A 2HU9A 1UG0A 1UFMA 1KYZA 3L1PA 4DV4H 3V42A 1H9GA 3G2BA 2HZDA 5KFOA 1Z3YA 4UFZA 4HOBA 3F72A 2LH9A 4ENKA 1B6RA 3SEZA 1VQOI 4L9TA 1ZRDA 2EB7A 4XSZF 4A3MG 4IR9A 1WFXA 1E0EA 5KVRA 2UVWA 4EGQA 2VQHA 4XRSA 2EV0A 5L3GA 1DGRM 4O3MA 4QW8A 1XGOA 4CCLA 3T5KA 4BE0A 1B6AA 2CUJA 3K6GA 1VQ9I 3OIOA 1MNMC 4DZJA 1J59A 4NC7A 2ZDQA 1GHCA 2R8HA 3K4BA 2NU8B 2W48A 4EFEA 5D8LB 4QLCU 3VOEA 4CCMA 1Q1VA 2R3SA 2OQGA 2XGEA 4V19K 4QPQA 5FKMA 3S3MA 2IJLA 1AKHA 1UELB 2OZUA 4X1EA 4AU7A 1QGPA 2RDPA 4A3CG 1OLTA 2H27A 1MMAA 3DKXA 3RGXA 1BR4A 1W7PA 2KT0A 3EUHC 4XLNF 3QWLA 4BH9A 4UUSA 4EGZA 2X48A 5HDKA 2NVQJ 1T36A 4DR6H 5M5XJ 1BC7C 4GC7A 4UNOA 5FROA 4U88A 3WG7H 2UXCH 3RIZA 1XDSA 2QENA 4IZOA 5DTDA 5KT6A 1SD4A 3CQZA 3RIRA 1MZBA 3LSJA 1SVLA 2B63J 2YS7A 4QIWE 2E1OA 5IT3A 5KKNB 3PW7A 2KL4A 2M34A 4MNUA 1RZ4A 1VQPI 4HLYA 3AL0B 3N6XA 3CP8A 1J09A 4B09A 3TOBA 4CYCB 2KIFA 2TDXA 2V9PA 4HYKA 4BBSG 2RVCA 3FKIJ 4B48A 3K5HA 5KG2A 4XLCA 2ZJRF 2DA5A 2PI0A 2VJ4A 4C5BA 4BJTA 2ZXIA 3ULQB 5K7ZA 4IAJA 2WV0A 3JZIA 5FB2A 3VDXA 3COAC 1K79A 2L54A 4BU2A 1RK5A 3VSLA 3LAJA 3RQ4A 3SZGA 3W2WA 4IHVA 2QGUA 1OR7A 4P96A 5DM7F 4X62H 2DXIA 4JQFA 4BDYA 1WKMA 2FRHA 1K78A 3BQ1A 2UWMA 2Z9OA 5B3SH 2WYOA 1S9HA 4ECWA 1ZR2A 4NXMH 3OS2A 4O3PA 2IGNA 1YJ9I 1WH7A 3BDDA 4RUCA 3L2QA 4F4XA 1MSFC 5KK1A 4LD5A 2LK2A 4F7ZA 4MV7A 2PMUA 1B8IB 1FBQA 3SFZA 2YRWA 2R84A 4BJ6C 1B72A 4F4ZA 2JMWA 1F43A 3W2AA 2LG4A 3M8JA 4HA8A 2A5WA 2M87A 4DBQA 1BI3A 3OYHA 4LGWA 4A3GJ 3OYCA 1D5YA 2M4GA 2CRGA 2QEXI 5L1KA 5ERIA 1FOXA 5FPRA 1OCZH 2GAUA 2ZJPF 2D45A 1RKWA 2R7FA 3EETA 2JA7A 2FP4B 1UCRA 2L2OA 1AA7A 3CLQA 4Q0YA 2YPRA 3ABLH 3DKYA 3EPIA 3DP7A 2BOLA 2LLKA 2KSWA 3QP6A 3OMYA 4IO9F 5TGTA 4BQNA 1O3QA 4PZJA 5GONF 4I4TF 1IO2A 3HOXJ 5FLXW 4UCUA 5F04A 3JSPA 1S97A 5F64A 4XNFA 2AS5F 4XLPF 4MIMA 1ERDA 1YE9A 2D1VA 3AG3H 3HOWG 3MWDA 3IAM2 1V51A 2IPQX 1X3UA 2ASJA 2V4JC 5DGBA 3AAFA 4XMYA 2MH9A 4NHJA 2Z16A 1BIBA 4ZC3A 1ACIA 4F4YA 1APLC 2PLYA 1Y0NA 3VYTB 2ZM6H 2EWNA 2NVYJ 2ATLA 1XMKA 3GTPJ 3BQYA 3HZJA 1V3FA 3GTQA 1OFCX 4BAYA 3KIOA 5FLXK 3RBEA 2DOFA 4E6KG 1V5FA 2HYJA 5E3NA 2Q2UA 3LQQA 2XF5A 2K4BA 1VBGA 1J5EH 4JI5H 1TZLA 4JV5H 3ZP5A 3BZ6A 3DF8A 4J01A 2IVMA 2WTEA 2JVHA 2LKPA 3A1YA 3BCBA 2I80A 1R49A 2BHZA 3GIPA 3I55I 4XM3A 1FSHA 2ZXHA 1YO5C 5KG0A 2OWOA 4G7ZF 4HF2A 1BOAA 1YITI 2ZB9A 1ZQ3P 2V26A 4LFBH 1JGGA 5EJCA 4LF8H 1WR2A 2F4IA 3PJRA 4G9YA 3FXOA 1UG2A 2LDUA 2HNHA 5ILUA 1I50J 4PFPA 1YW8A 4HX8A 2CUEA 2QF7A 3ZQGA 3GFIA 5KFNA 1CS0A 2DFEA 2YZMA 3DU5A 2UU9H 2KIMA 4IJAA 3PNVA 2NVYA 4YR3A 1N36H 2LR8A 3KEOA 3C18A 4M9SA 5KFHA 1B8IA 3FHNA 1A6QA 2ZFUA 5KFIA 4ECSA 2DN0A 2HKXA 4P5OA 1O3SA 4XKWA 3SJMA 1K4SA 4ED8A 1JXLA 3SEQA 1IN7A 1T56A 3LSKA 2G7HA 3OSGA 3HGYA 4FCYA 5GTIC 3J81K 3GIQA 3ORQA 2LOOA 3WTWC 3B02A 2CO5A 2V9KA 3VYSB 4O3SA 4PGGA 5TJJA 1OISA 1PUFA 4E7KA 5E79C 4BXFA 2VONA 4M9UA 2XF6A 2JWTA 2RGVA 3I56I 3TDUC 2VOOA 3CCVI 4LFUA 2W6MA 3BABA 2EZLA 5E1WA 3GLXA 2R7DA 5GP9A 1G3WA 3PNTA 1F5TA 4KJZA 3WU1B 1IG7A 2LNBA 1U3EM 1ZG1A 2DI3A 1R58A 1XX5A 3KYCB 4AIKA 1DU0A 4ED2A 1R22A 2XD4A 2QYOA 3L9FA 5L3FA 1V5GA 4CZCA 2E71A 1YOVB 3R5XA 3BR5A 3K3VA 1MNDA 4O3RA 2Q2TA 1I6HJ 3KLOA 2EIMH 5FKKA 4XIDA 2UXNA 3IUOA 4IWYA 2IS2A 3L2PA 3GUDA 2LKXA 1B59A 3CCLI 2W9BA 4AUXA 3R23A 3FWEA 2UUAH 1E4GT 2E34A 3CLOA 3I58A 1IGNA 4EGYA 1EUDB 3I9V2 1GO3E 4IHJF 4YAKB 1EJ9A 3RB6A 3OSPA 4QIWA 2W00A 2OUMA 2XF7A 1WJFA 2A6HF 1NTCA 2XCLA 2EJRA 2NVTJ 1IN8A 1F9NA 3LOCA 3KP5A 4TV7A 5CJ9A 2JT1A 3J7YJ 2XPVA 3E97A 4Q8EA 4EBDA 3BAAA 4UVBA 3HRMA 2ADUA 4PFOA 2QA4I 3R5HA 2MW8A 4XRSG 2VQGA 5CVRA 1SFKA 1IRFA 4Y7NJ 4LSAA 4YEJA 1RUNA 3JCUC 4IKFA 1CQJB 2GLTA 5LA6F 1LE8A 3Q8SB 2FLLA 5HBRB 3BG7A 2HQAA 1BNCA 2HJWA 3K4LA 1K1QA 4A12A 4Y15A 1UNNC 3PUFA 5ILSA 3R5FA 5T14A 1KJ8A 2L5QA 1SFXA 4UV9A 1ULZA 1D8KA 4KICA 3DF7A 2A68F 2KIQA 3RGZA 4DL5A 3CCQI 2ZC2A 2F5EA 2KZVA 4JBAA 4XSXF 3LSRA 4BGDA 2PJRA 2YR2A 3OYBA 2RGRA 2CUZA 4II3A 3M07A 3TBIA 2CV1A 2XGPA 4OOIA 2QSHX 1BI1A 1NG6A 3HM5A 4U7DA 2FPIB 4HSRA 3FM3A 3H0GG 4KHPH 1MBKA 1U0JA 3QYEA 1FTTA 1A6IA 3KALA 3MR5A 2LF7A 4YR2A 4HDUA 3ASOH 1X1PA 2N8GA 5DG9A 1LNWA 4I0AA 5CVVA 1P4AA 4JX5A 1ZARA 3V7SA 4ESBA 2P8TA 3L2VA 1FNNA 2BY3A 2HQRA 3PUBA 2NRAC 3OUUA 1IDYA 4J9OA 4L18B 5KFJA 3GLKA 2DT6A 3TINA 2E5NA 1W7PB 2FUG2 1E17A 1AUXA 4D5CA 4Y33A 2TRTA 4AC0A 5DUIA 4OIPF 5D5WB 3J80K 3IG0A 2DQRA 2WB1E 4XOPA 5EEHA 2NS7A 3CO7C 1YG2A 2FOWA 5LGNA 3HXLA 3LA2A 2R7ZJ 4ZYGA 4FHTA 4EJVA 4AYBE 3EPZA 4H0EA 4AYBA 2VE9A 1IAWA 1VQ5I 4XR6A 1DUXC 3UFXB 4TQRA 1AWCA 4EFBA 3L4KA 3HOUG 2LP0A 2J9GA 2Z1DA 2O03A 3GZ6A 4J9MA 1TW3A 5FPOA 4RMNA 4C2TA 2FD5A 3OYLA 4P9FA 3TQ1A 3RYRA 3FXMA 1XSDA 5BPFA 1LB2A 2VL8A 3SI8A 4I99C 2VIXA 4I0BA 3JRCA 4O2AF 1KJJA 2JEJA 1A0IA 2E19A 1SEIA 3PO2J 2L02A 2AQEA 1W1WE 2GLOA 5IYZF 3RZDJ 2BZTA 5KT3A 3PW0A 2Y48A 3BR6A 3RF2A 2BR0A 2NU6B 1JTXA 2LRDA 1IC8A 3LA3A 4CDGA 3A4CA 1ZR4A 4LB6B 2VASA 4BL0B 4EMSA 5LOVF 2W7PA 3M9MB 5C44G 1ZQ7A 1GUUA 4ASNA 2EFNA 3Q0WA 3CCUI 3UNGC 5J2TF 2WAFA 2L9NA 2KQRA 3PR4A 2A6TA 2EIKH 3J81Z 2P6TA 4G7HF 3HSRA 2Y9ZA 2IEKA 1B6SA 4ECTA 2COMA 1GGOA 4JI4H 1TLHB 3O2PE 3IKTA 3G6YA 3OL4A 3FKIA 1FX7A 1I5ZA 5E1ZB 3GX4X 2BBYA 1FMWA 3BROA 5H2FC 1BC8C 5K7HA 2VOBA 3SZPA 2W85A 2K9NA 3QP5A 3DTEA 1E3OC 3JW4A 2JN6A 2DLNA 1T95A 2YL2A 4KDPA 3HOYG 2ZDGA 3I5UA 4BE1A 2O0YA 4I2OA 3ASNH 1JLLB 3OYEA 3W2VA 5IWAH 1BL0A 3EUHA 2FMLA 3B6CA 5E18F 4XKCA 5E3LA 3A0BC 1H89C 1RESA 1FC3A 2BYVE 4FBUA 2I10A 3NWTA 3OYDA 2NNNA 4PSWA 2CKZB 1O7LA 4ZI7F 1IBMH 3F23A 3IV5A 5FLXZ 4UCSA 5C3EG 2FA5A 3E5UA 3RQIA 2DFHA 3ETJA 4M6VA 3KAJA 4G6DA 4XLFA 4CC6A 2QUFA 4B3TH 2W25A 1MMNA 3DQVC 2JA6J 2ASLA 2UUCH 4ZQIA 4LH7A 5HODA 2ZMEC 3BR1A 1GT0C 3VPCA 3GF2A 1WJBA 3NWSA 5ED4A 1F4KA 3GTLA 4S04A 2NAZA 1UHWA 2IGKA 3P9IA 5CVIA 3CP2A 4NDLA 2JEIA 5JVGF 2ZO4A 2ZXWH 1MMDA 5IYDG 1NH3A 3BG9A 2HOSA 2X1CA 1V5EA 1W0TA 3MQ0A 2UXDH 2OC6A 2XKPA 4BDZA 1GLVA 2V5AA 1DQUA 4C3JJ 2R7KA 4C5CA 4HQEA 4GYIA 1IRZA 3WTVC 2GM4A 3DCFA 4IF4A 1E4EA 2WC2A 1D1AA 2FNAA 4J9LA 4IEJA 4E7LA 3FBIB 5BPHA 5L3BA 3F8NA 4QJFA 2ZSIB 2HPIA 1LDJA 1WCMA 3TIIA 4KMUX 2JZYA 1BW5A 2A6EF 2CFOA 2F4VH 5A2QK 2UVVA 3CQZJ 3FBNB 3PL8A 3ROUA 1CF7B 2DWCA 1WZ2A 2ASDA 1XGSA 4U87A 3PQJA 4RM3A 2NOJB 1ZKGA 5J47A 1Y1VJ 3N4MA 4QWCA 2FK2A 3C0FB 2L7MP 5LGTA 1L2ZA 3G3ZA 1SFOJ 3E6CC 2BQUA 4WXDA 1F36A 4U7BA 2EZKA 3TO6A 1QVUA 4GC6A 3VSKA 1XPXA 4XBFA 3ZR8X 4EYIB 5DD8A 2DMTA 1JE8A 3S1MJ 1PUFB 1RETA 3CMAI 5EDWA 4AIJA 4KT5C 1HKTA 2XPUA 2AQ4A 3QU3A 4MQVA 3J80Z 3HKZA 4A0YA 3S32A 5DQHA 3I59A 1DPUA 1EUCB 3LFUA 2XIGA 4A6EA 1LQ1A 4J0MA 5IP9G 2GQQA 1IRXA 4GDFA 3HG9A 1FLIA 5CVUA 3H9GA 4WXHA 1A5JA 2YYAA 5EWEA 3HB9A 2BW3B 4PWQA 4G3IA 3HPGA 2JRTA 3U2RA 2R7MA 1ON2A 1K4TA 4WBNF 2C2RA 4MEYF 2P7VB 1R1VA 4YQWA 4O3OA 3A03A 1I50A 1EV7A 1Z7LA 5HOOA 3L7WA 3LFKA 2UVUA 2ECBA 3ZQLA 2ME0A 3CF5F 4J9NA 4A3JG 5K2MA 2M9HA 3FKJA 2QWWA 1C0WA 2PMHA 3HGGA 3M3YJ 1WH2A 3HTSB 3FXUA 4XN3A 2NS8A 3RSNA 2AXTC 2CW8A 2QVOA 4QSHA 3BTLA 3LWFA 2DPUA 4V2FA 4X65H 1VZ0A 4TUYF 2RAEA 4JV2A 1QA6A 4L5EA 2BGCA 4UHTA 3KYLA 4ENNA 2H1KA 2IP4A 2JSPA 2W4SA 3A2KA 3HOYJ 1U9OA 4Q48A 1ZGJA 3FM5A 5DD4A 1TW2A 5KFSA 2R8KA 3RV4A 3G71I 5EWFA 2ME6A 4Q43A 2Y30A 5TISC 1ETVA 5M3MJ 5FJ8J 2R7TA 2MCTA 4G7OF 3WHBA 2RNJA 1P6RA 3OTOH 4ED1A 3ABTA 2JA5G 1M0TA 1ZHQA 1IBLH 2W7NA 3GTLJ 5JLWA 2R8IA 4BY7J 2IA1A 3TMOA 3KTMA 4HV5A 1KC7A 3T1YH 1RYRA 1ETXA 3GTMA 3K10A 2H94A 3MR6A 1ETWA 1KU9A 4BBRG 3ZOBA 5EF6A 3K4MA 3SZTA 1U6GA 3FXRA 3HUGB 2ID3A 5F9LA 3N8DA 2OAZA 1GV2A 2DYSH 4IQJA 5DG8A 4MV3A 4RNNA 1VI0A 2PBZA 1ON1A 2R7UA 1WGXA 1HKQA 3QOPA 3CDLA 3SYTA 2MLGA 4A3EJ 1YX3A 1RJPA 3ZQFA 3A01A 4RNMA 3I0TA 1LFBA 5D5VB 2X1DA 1FOKA 5AONA 4E7JA 3M8FA 3OHBA 3PW2A 4MV1A 5C4JJ 4Y52J 4AIHA 3BC8A 3MKYB 1I1GA 1JDBB 1QPMA 3A0HC 4A3JJ 2R7LA 2WTFA 3HOVJ 3Q8QB 3HOZG 1U8BA 3MKWB 3MJFA 2XHKA 2VBWA 1KU3A 3V8JA 3T5XA 2YRXA 3CC4I 1SEUA 4HG2A 2VUMG 5C4XG 1XD7A 1XS9A 1HKSA 3KHGA 2OCCH 3RAQA 3MD2A 1XCBA 2BW3A 2KISA 3OOPA 1HLVA 2X4HA 1DP7P 1FT9A 3JSNA 4MTDA 4DOZA 3FX3A 3ELKA 4A5MA 2GOXB 3ZMZA 3G4SI 2QCOA 4WK8F 2E2JJ 3G73A 3ORRA 5KFYA 2R7NA 1USSA 1TWFA 3LA7A 2A07F 1YIOA 4MO7A 3G1MA 4XRFA 3QAHA 4MHGA 1QQIA 1V4YA 4M3EA 2CQQA 1YW7A 3E1SA 3KXYT 2NU9B 3RCOA 3BR3A 3H5RA 3K0LA 4MV8A 1TT5B 4FBTA 2E1MC 2H6CA 1YFHA 4YBZB 3L4JA 2VE8A 3M1EA 4AYBN 3DV8A 1ZELA 5DCMB 2O5RA 2A61A 3KEYA 4I7HA 3CMEI 4QPOA 3DLLF 2PJPA 1S03G 3M4OJ 4XICA 2OCEA 3HSFA 4IL6C 4BQOA 5J8CA 3IRRA 2YSRA 4XYMB 1O3RA 2X85A 1J0RA 3SDBA 2JEFA 2E7WA 1VQNI 4BXXG 4W1UA 2FU4A 3MWMA 1XSXA 2Z3YA 1W5SA 1UC9A 1KBLA 3OYJA 5FFXA 5KFZA 1ZN2A 1BGWA 1Z2OX 1ZETA 2V1XA 5JR3A 4R8UA 4WX9A 1IW7F 4E4HA 3EQLF 4S0HB 3E3VA 1P2FA 1EKEA 4G6TB 3JRHA 4DYCA 4BKXA 1T08B 5I47A 3GTQJ 3HUGA 5C1OA 1DV1A 1VQMI 2W24A 2VXZA 1XN7A 9ANTA 3TP3A 5IYDJ 2XB0X 4EJOA 1ZH5A 4K0KH 4GXOA 1X1AA 2L9VA 2EV6A 5F08A 3CF2A 1QHGA 3GIDA 5IY5H 2L7ZA 3K2ZA 4F55A 2YS9A 1VKZA 3WHCA 1T0FA 1MBFA 2HXIA 4NB5A 3VEPA 3QOEA 3GILA 5FD6A 4IRHA 1QO0D 2QLZA 4RDUA 3IAS2 3GZNB 3DXJF 4RU9A 3CO6C 1JDEA 3KX2A 4I6ZA 1UJ8A 1PK8A 2PG4A 1C3OA 3TIGA 4XLEA 4RZQA 1E2XA 3JRIA 4EJTA 4Y8VB 4Q47A 5GPAA 2DA4A 4MFDA 2IS1A 4PDBA 5IT9Z 1X19A 2BHYA 2JA2A 1G6NA 4UB6C 5J1RA 1I1SA 5J2UF 3CUOA 1TNSA 1XMAA 4YG2F 4V2GA 5IOZA 3K5IA 1USTA 4TQSA 4RB1A 1OYIA 4CXFA 2EPFA 4MAMA 3HOTA 4RB3C 5KFDA 1XB4A 5LMUH 3RAXA 5KFLA 1SMYF 2JSCA 3MEXA 1IN5A 3R0JA 2M2EA 2A5YB 1DPRA 4UCRA 3JRWA 1FBSA 4FETA 3NGDA 4E70A 3FXJA 4YHHH 2X6WA 3RTRA 3S1RJ 2EFQA 1R7JA 3ZQ7A 3FMRA 2OTLI 3SHFA 4CSWA 1A9XA 2V79A 3HSEA 5K5RA 3CVZA 1GXQA 2R5YB 3CC7I 1P92A 3W6VA 2FB9A 2DJNA 1PX2A 5LHHA 3QODA 3BR2A 5D8DA 3ZQQA 2XAUA 3KHHA 1MMGA 1X1BA 3L2RA 4YRVA 2DTZA 1FY7A 5HS8A 3Q8RB 4IHSA 3K4NA 3HYIA 1RR7A 4JI8H 5F0HA 3MCZA 2IS4A 3T5HA 2L9SA 3W3CA 2DQLA 4ABZA 4ZZDA 3HL2A 4BXXJ 2R87A 2P5LC 3GTJA 4RA2A 3DBHB 5C44J 4F50A 1JT0A 1JUPA 3NARA 1IOWA 3OSNA 1SMTA 3KZYA 5FLMG 1W0UA 3C1DA 5D6FA 1FIPA 3KP2A 1K7AA 2HOTA 3GTKJ 4IQ4A 2GXGA 3ABKH 5KAFC 4CYCA 4GRIA 5L1LA 5IP7J 2YZGA 1S8NA 1HNZH 5EZGA 2WB1N 3KP7A 2ZSHB 2W9AA 2HWVA 4KT6A 5LGUA 2BXZA 3RYPA 5HLHA 3WTUC 2B63A 5E1XA 4CA0A 3AL0C 4QWBA 3OYAA 2KMUA 1U8RA 2STWA 2VC0A 3RPUA 1HF0A 2RN7A 2W7OA 2R5ZB 4JI7H 2M8EA 3DEEA 4U0YA 4GYGA 1BJTA 1W96A 3WU0A 1YYVA 4ECZA 2H09A 1OYWA 2DK8A 4UXNA 4YIFA 3JSLA 1IBKH 2L4AA 4FT8A 3LAPA 3AFHA 3CMYA 4KFCA 3V4ZA 1OMIA 4IHXA 2VJIA 3VPBA 1GSOA 4HX7A 3MR3A 2OTJI 5DLFA 3DWLE 4XN0A 2M0MA 3IP4B 3I12A 4AVPA 2BXYA 2LYCA 1S68A 1TTYA 5KG6A 4HF0A 3F3XA 3DBRB 3PVXA 3HOVG 2VKVA 2VQLA 2WA0A 3KLNA 5CPRB 1XDNA 2RF4A 5A2QW 2V1UA 3K3PA 1U78A 3E0JB 1JKOC 1WH5A 2FX0A 2ZMEB 5HNFA 3N42B 3F9KA 3U9TA 1TWCJ 2XGXA 5EEGA 1FP2A 2VODA 1O75A 3UKGA 2XVCA 2HKOA 3JAMK 3JAMW 5CQGA 1ODDA 1S7EA 1K6OA 2BQ3A 3GO5A 2NOGA 2ZNZA 1G3YA 3TO9A 3VFZA 2R92G 5KT4A 2L0KA 3FZVA 5KFEA 1TP4A 4YY3H 1GSAA 3IH4A 2F5CA 2JTVA 3MZHA 5DM6F 4L5IA 2HDWA 2LTPA 1WHUA 3IL2A 4CYDA 4A3BG 4BY7G 2EILH 4JI2H 1R5ID 3T1HH 1G3TA 3U1DA 1D0YA 3BZCA 4MLOA 4O4LF 3C2BA 4L0YB 4YP3A 1S5LC 4QWAA 2FBIA 3RJPA 1FMVA 4A3GG 4ME6A 4JI3H 3AG2H 4IZZA 2BY1A 1O7FA 1R1TA 3J7AO 2DMQA 2F6CA 4L5JA 5H6RA 2KRHA 2Q2EA 4LF5H 1G2HA 1HW2A 4DV7H 1FSEA 1XNRH 4MFEA 4ZYDA 4AIDA 4IRGA 1B9MA 4U6PA 4G12A 1X3WB 5D8KB 1FEXA 1RJRA 3GTPA 1YLFA 2KP6A 1SD6A 2YU9J 4LG0B 2VUGA 3KPHA 5IYCG 1HR0H 3H3VH 5FO5A 4RAZA 1LDDA 2UUBH 2NVUB 4F52A 4OWRB 4E7HA 3MWEA 1S0NA 3A01B 2X51A 2R92J 3F0CA 4L1KA 4M3BA 2EINH 5KG5A 4DV3H 2F5FA 3BA9A 2QQBA 4XOTA 3GV5B 4GGGA 2FLNA 1RC9A 3PQKA 3ZN0A 2R82A 4X0GA 4DLKA 4DR7H 2XDVA 1S10A 1GVJA 2K86A 1CE8A 2JK3A 3O6BB 3WTZA 2WDTA 4RLFA 3FKIG 1D1BA 3K1PA 5HDGA 1JIHA 4S05A 2UXBH 5IP9J 3V6JA 5LP6F 2J5PA 2QQ8A 5EGOB 2CZGA 1RNLA 2XCPA 2V6EA 5KFVA 3MKZA 5H6QA 5BOXA 2KHMA 2CH0A 3UR3C 5BS6A 4QTRA 4KISA 3JREA 3QU6A 4M6YA 4M6XA 4PJLA 2W57A 4B3SH 4KYWA 2WB1A 3H1CA 4TV9F 3G6EI 5EOYA 4AQYH 4ED7A 1JKJB 3BJ6A 1FPQA 2JA7G 4OMYA 1N32H 2R8GA 5FFZA 5JQWA 3MZYA 3BG6A 3RB4A 2X0SA 5JFRA 5KHDA 2VQDA 3K70C 2XC9A 3CZ6A 4HYEA 3B6AA 1Y1VG 2G0EA 3N41B 3S8PA 2UXXA 3DEWA 4PSXA 4R8HA 5HLGA 4IX7A 2HR3A 5IP7G 2F4OB 2AQFA 4WWCA 2VPSA 3F8MA 1N75A 4O3NA 1FBUA 1T0FC 4Z2YA 5EDNA 1X1DA 2FBKA 3KE2A 5D4RA 5LHIA 3OR1C 4MGRA 3R61A 3GBGA 3JRAA 2XAQA 4WF2A 4KNYA 1JJ8C 3KZZA 2E2IA 4E4TA 3BJOA 2J5OA 2M05A 5EG0A 2X6YA 1VTNC 3U21A 2K7LA 1FVIA 4DL4A 1I6UA 3GV7B 2GBYA 4PJJA 2O8KA 4UVCA 3CCSI 1NG7A 2E2HJ 1UAAA 2P6SA 3JSOA 5L1JA 2NU7B 3QPHA 2XC7A 5GPCA 1ZYRF 1P4WA 2MFZA 4C30A 4O4IF 3H3VK 4ITVA 4MA5A 5C4XJ 1VQ8I 3BPVA 1TWAA 2A3SA 3QZ7A 4A2BA 2JA6G 5DEQA 1W5CC 5JH7F 4N0BA 3D1NI 3DTIA 1FJLA 4LLLA 1FOYA 1XG1A 2VR1A 3ZMTA 5B66C 4NXNH 5FLVA 4ZZLA 4XKVA 3L2UA 2E35A 3EPGA 1K61A 3MVPA 1UC8A 5KNLA 4IPAA 4I02A 2KRCA 2GA2A 1KONA 3Q3SA 4PJNA 5DGAA 1P7IA 3AG4H 3WGGA 1YRNB 1OWTA 4ZTFA 1N25A 3BTCA 5E3MA 2EZHA 2ECCA 4UCVA 1IUFA 2OU2A 4NNJA 5LHGA 4JYAH 3CUQC 3RPQA 5EGOA 1WSUA 3FDSA 1X1CA 3RFCA 3IWFA 1D0ZA 1WSCA 2H1LA 1SFEA 2M1BA 4UCTA 3GXOA 3VB2A 4WD3A 3VYUB 4QIWN 2ESHA 1H8AC 4A3IJ 2OF7A 4FQGA 2DTRA 4U0WA 3BQ2A 5DG7A 2I8DA 4BHPA 1YX5A 5LXTF 4A3KG 2FLPA 3HRSA 2EH3A 3RKQA 1FIAA 2JA5J 3I53A 2M3AA 4KITB 2MABA 3ABMH 4D9JA 3K70D 4EBCA 2ESNA 3QRFF 2BE5F 2V4QA 3JTGA 3N40P 4RBOA 4ZDPA 3S3NA 5L9XA 2F5VA 1LKXA 2O7OA 1OKRA 4M72A 1ZRFA 3HBLA 3C7JA 5CB4F 2QKLB 5HS7A 1U5TB 5ICCA 1W36D 1CGPA 2XGDA 1Y1WJ 1ZLKA 1IN4A 3LNQA 4R7RA 2UV1A 3V4SA 3K4KA 3WTXC 2K85A 4P55A 2HDCA 3J7AK 5ICEA 1I94H 2VA3A 3IWZA 1Z3XA 2QK4A 1R9TJ 1R23A 3PO2G 1JJ6C 2CWEA 3K1MA 1Z77A 1X9NA 5D5UB 4DV6H 5L3CA 1TC3C 2GZWA 1B4AA 2XV4S 1WI9A 4LSXA 1IJWC 1MH4A 1KU2A 4ECQA 4EEYA 2VN2A 2VLAA 4FS1A 1TWHJ 2CSOA 2YS6A 2VT3A 4NUBA 4A2UA 3OS1A 5KFCA 1E3HA 2NVXA 1WJEA 1IRGA 2V6CA 4LLGF 2AGQA 4MA0A 1B9NA 4BBSJ 2R7ZG 4O2BF 2UVRA 2AXLA 2C28A 1OCPA 3NAUA 2YX7A 4KN4X 5CYVA 4O6JA 5L3DA 2JQ7A 5B1BH 2P5VA 1RRJA 4X6AJ 1K83A 4J9KA 3HTUA 2RREA 4BQAA 4O3QA 2MSYA 2DT7B 4B4CA 3RJ0A 5HNHA 3GYHX 5LD2C 2OH2A 2X9DA 4EM0B 3D5RC 2KDOA 5E3OA 1N34H 1MJ9A 1O57A 1ENHA 1YRNA 1Z91A 5F9NA 3VYRB 2RC4A 2HVQA 1EYZA 3RZOJ 1OCOH 4A0ZA 4AVZA 4A3CJ 2DYRH 3MZ8A 4DIQA 3T5JA 1R00A 3WO1A 1S7OA 1KQ8A 5DV5A 3BQ0A 5IP6A 2VJJA 1LPQA 5J4YA 1MBJA 3E5NA 4CC5A 2R86A 3HRTA 3V8LA 1OCRH 5DDGA 1NK3P 2K27A 5ILVA 4Q5SF 3E6MA 3HKZN 4ZYEA 4I50F 2FXAA 1HC8A 3LQRA 2XRNA 2IBKA 2Y9YA 2P7CB 3EYIA 4QWDA 1QVTA 2J6TA 4P9UA 1Y1WG 2JRMA 3RPUD 4N9IA 1Y14B 2P5KA 2EBIA 1AN7A 4WXCA 3GQCA 1U5TC 2VUMJ 4A3DG 1Z6RA 3ETHA 3CCJI 1WJCA 2C2DA 1FKAH 3GWZA 4B1RA 2BY2A 2EA4A 3OOUA 4A6DA 2KPMA 2OJED 5FKLA 2STTA 3CJNA 5JVTA 2XSDC 2FJZA 4AM3A 2PMZE 4RZRA 2VQEH 2XCAA 2E5LH 2MGQA 1L0OC 3BJYA 1I7NA 3T1BA 3ERMA 2HQNA 4EG0A 4DL6A 4RGSA 5KG7A 5ICFA 3WU2C 5EZHA 1QZYA 1Y6IA 3D5LA 1TAEA 4CGZA 5BR8H 3H40A 4A3FJ 1X58A 1RIOH 1V4RA 1SAXA 5J40A 1T2KA 2LC2A 3I71A 2VBXA 1LFPA 3CMMA 3TW7A 3M8EA 3W6KB 4B44A 4JV0A 4DV5H 3H35A 1MBEA 2VBYA 5C3EJ 5FKNA 3VODA 1ETYA 1FYLA 2DDBA 5BNGA 4DL2A 3FMAA 3U1KA 4ECVA 5EYRA 3OYFA 3RDIA 2Y31A 1GVDA 2H6BA 2R93A 2PMZA 2FKLA 2R7OA 3ZN1A 2QSFX 3U9GA 4A3LJ 4RB0A 5KFUA 1BW6A 2KRFA 5KFKA 2WV1A 3GCMA 1JUSA 2M0CA 4M3DA 5DYMA 2COBA 4KUMA 2OZ6A 1P8LA 3ZQCA 3RI4A 4I55F 4A69C 1E4FT 2P0WA 1MJBA 2HOEA 2L7FP 1TQIA 1LDKB 2OV7A 1I3QJ 3WG9A 4D7NA 1CF7A 5KT7A 5JVDF 3ZCOA 4DBRA 3DPUA 2R7SA 3DU6A 1BI0A 2QZ8A 5AIPA 1YS7A 2Q8KA 1MMSA 4GO1A 2HHHH 1TWGA 2WAEA 3B73A 3MR2A 2JA5A 5J1UA 5LL6b 1J2XA 1IXRC 3NQOA 3FXKA 2V1DA 4RAFA 2GPWA 4ESJA 4ZDOA 3ESWB 4ZYHA 4RUAA 1AOYA 3GTOJ 5CAEB 3FMQA 2HS5A 3VPDA 4LFCH 2VUMA 2Z33A 4APMA 2ZNYA 5C8YF 3M9OB 1EHIA 1H9TA 1TWGJ 3H9QA 4D0PA 3OR2C 2R0QC 4A3LG 1MBGA 5EEAA 2CV0A 2VI6A 1W4MA 2CQKA 1T38A 2YX4A 3LSHA 3BOQA 5HLIA 4XRMA 1WJAA 3I59B 3HJEA 3IH2A 1Q1HA 4ZTJA 1JHHA 3QYFA 4IRIA 2MH2A 1FOWA 2V1NA 4P1WA 1LJ9A 4J9QA 4W97A 4CCKA 3F22A 3FK7A 3PZPA 4CUGA 4M7EA 1W93A 1T6SA 2YUSA 3OYIA 1WJ5A 1DDNA 2MC4A 5BPDA 2XUBA 3WE3A 5DQGA 2F2EA 3HOUJ 2L7KA 5BQTA 1IXCA 1DV2A 4N4NB 5K7FA 2TCTA 1S0OA 1Y8RB 2L9RA 2PX9A 3G1OA 4DV0H 2IA6A 4LB5A 4C5AA 4HAMA 3LSGA 1ZTRA 3PW5A 4L9VA 3LSPA 1ZGAA 5TRDA 3ZXSA 2ZKZA 3PIOF 2FPGB 3Q1KA 5D6EA 3GV8B 4U0VA 3CJTB 1KU7A 2R8JA 2Y2ZA 3H20A 5F1JA 3IH3A 1V55H 3JAMZ 2NVXJ 3TEDA 2BEOA 2CJJA 3E5XA 5J8FA 3HEFA 2HZTA 4ZDLA 3JRBA 2HDDA 4HQ6A 1X3ZB 2PBIA 3Q9VA 1B04A 4ECRA 3FISA 2I8CA 3GTGA 4E7ZA 4RNOA 1XMXA 2W8LA 3LMMA 2EQRA 1QZEA 3V7CA 3MMYB 4ECUA 2O6GE 1ORKA 2VKHA 3L09A 2VBZA 2OLSA 5CLSA 1BA5A 4DR1H 2E60A 2DPDA 1WPKA 3CDHA 4JI1H 2MD5A 2IS6A 2L3DA 3HRUA 2Q0OA 3CUQA 2DOEA 3AYHB 3HOWJ 3ABUA 2ZJTA 2M4KA 3A02A 5F27A 1WRJA 3H0GJ 3HC7A 5KX5F 4ZJZA 3H4DA 1QBJA 4DR4H 1R6RA 3RKYA 1WJDA 2W6OA 1T98A 4F93B 5IYCJ 3GIMA 3V8KA 1KYWA 4IXAA 1D8JA 4EM1A 2DFFA 1ZRCA 4FE4A 1BM9A 3V6HA 3KP3A 2FMYA 1XCVA 1R4NB 5K1YA 3OY9A 1YIJI 2C00A 4M3FA 2D5VA 5BPIA 4LMYA 3DLAA 4R1HA 2ZJQF 4DUYH 2IRFG 4RAGA 4YELA 2CFXA 3NEUA 3WO0A 4HBLA 1MW7A 1F1ZA 3I4MG 2DZDA 1YJNI 2BY0A 2IT0A 2BVLA 3N05A 3ZQIA 1X4OA 2DA2A 2ETHA 3DBLB 4LITA 1ZHSA 3R6SA 4A3BJ 1AUVA 3OYKA 1U5TA 1S29A 2EFPA 2WBMA 1JKRC 4JP0A 2GPSA 2K40A 3PIPF 2LMDA 1DIKA 4NC6A 2DA1A 4DUZH 2ZJ2A 1TT0A 2GXAA 1A04A 5DLGA 1XMOH 2DPJA 2R92A 3GTJJ 4M9ZA 2JEGA 2CW0F 3P7NA 5F0CA 1ONVA 1U2WA 1BIAA 4NQWA 2W9BB 2A05A 1SVMA 2OBPA 2ZDHA 1BR1A 1PJRA 3GIIA 2R7QA 4EBEA 1JKPC 2ELKA 3CJQB 5HLTA 4X66H 4B3AA 4I98B 2FK3A 3RBDA 2GOMA 3LP8A 3WE2A 4MTEA 3I4NG 3BY6A 1B1BA 4RLQA 4WCGA 3LSTA 3KHRA 1J7KA 4JX6A 3H9JA 2DJIA 3J7ZI 5FD5A 2XSJC 5BMVF 4HPQA 1IXSB 3IC7A 4FTHA 4F91B 4A3KJ 2R85A 1B33N 1K83J 5J6XA 1C30A 5KT5A 1GV5A 1HXDA 4Y4RA 3GTGJ 2FPPB 4BY1G 4U7CA 2HQ5A 5EWGA 2HGSA 1YS6A 3PW4A 2ACJA 2F5DA 1H88C 1P7JA 3WGHA 4IOAF 1BJZA 2E2IJ 2K5CA 3KP4A 5CQEA 1Z9CA 3CUQB 2IXSA 2DOAA 4UB8C 1JX4A 2AHQA 4XK4A 4CCOA 5L3EA 5LEJA 1B72B 5JI6A 5CA0F 3CCMI 4Q45A 2ALZA 3REOA 2BV6A 3ZPLA 2LSOA 5F1RA 4M9XA 3DKWA 2P0AA 1MH3A 4XLHA 1L3LA 4C9YA 4FM9A 4ECXA 2C22A 3C2HA 2O9LA 2RQPA 2OD5A 5FLMJ 2XRLA 4MEXF 4LFAH 5GAGJ 3K69A 2HOAA 1YTYA 4FS2A 4O4HF 1BR2A 3S2WA 3SFIA 4ANJA 3JRXA 4JI0H 1IZ1A 4YIRX 1VNDA 1Y1WA 3FIWA 3G1LA 4CCJA 5GAHJ 3MN2A 3J7AY 1V9PA 3IHUA 2M30A 4ED6A 2ELJA 1T39A 3N43B 4GLXA 4UCOA 3FF5A 2L01A 3E6DA 3K9TA 1UZCA 2W84A 1KQ0A 2RNGA 2Q1ZB 2GWRA 2IBDA 2Y69H 3P5JA 1EA3A 2CW7A 1P4XA 2XB5A 2O61A 3OSFA 1A35A 4OIRF 3ISPA 3IN5A 3RUPA 4AD9A 4IRKA 2PVPA 3S2HJ 3TL4X 3ERED 2DCEA 4OX9H 3I3LA 1JUMA 2QKMB 2FJ1A 2V59A 2VXDA 5FKOA 5L1IA 2M7BA 1WCMJ 2PN6A 4NQWB 3DPLC 4YFXF 2ZXJA 1FTZA 3TQTA 2C2EA 1UMQA 2UUZA 4K2EA 4R79A 2X1EA 2CQYA 4YIIA 3GTKA 4PCQA 3BR0A 3CC2I 1RJQA 1HNXH 1XTAA 1VQKI 4CO8A 1J75A 2E5ZA 3S3OA 3PN1A 4PJMA 1PVEA 5KFAA 1T33A 1Z1DA 4ZYAA 4B47A 3SE7A 2MYSA 4J9SA 4BS9A 2QBYA 4YJ2F 4C2MJ 3KETA 4JYKA 3OYGA 2B9SA 4HNVA 4DR2H 5E8IA 4PUSA 2Y75A 2ISZA 2HXOA 1Z2NX 3OYMA 5M5WJ 4XX0B 2GIVA 2LD5A 1TQPA 1I39A 2D1HA 2R4GA 5KFRA 4IR1A 3KEQA 2W6PA 2YCHA 5K5OA 1S6LA 4XONA 3T8TA 2VA2A 5D5XB 2R93J 2F4MB 1KZHA 1BXRA 3F6VA 3ONQA 3V6KA 1FWZA 2WY7Q 4EATA 1ETQA 1N33H 2ZFWA 2HTSA 3RKWA 3PO3J 2C35B 1JHFA 1Z05A 2FSWA 5KG1A 3AKZA 2DA7A 1BN5A 4OU0A 3WTTC 3H5AA 4BE2A 4FX4A 1VQ4I 4LOCA 4Y3OA 4YFKF 1KA8A 1ZG5A 2DDAA 2EA2A 4F92B 4DR5H 2QYZA 3KAKA 4UV8A 4HNTA 1O3TA 2EFOA 3S15J 3OUZA 3I64A 4L9NA 5HV6A 4ZOLF 2DLLA 3HKZE 1GLNA 1POGA 1QZZA 2OA4A 3TKYA 2R7WA 2F48A 2R5ZA 4EV0A 2FEZA 1FYMA 4HX4A 2M7AA 2R7RA 1UHSA 4KIFA 1PDNC 1KEEA 4PGHA 3GTOA 3CTAA 2P81A 1KJ9A 3C2GA 2FQ4A 2PEXA 4JX4A 1W7PD 2W8KA 4IOCF 4JV1A 1TWCA 2YZNA 2EZIA 4HNUA 4CHUA 1A36A 2BQRA 1KGSA 5M3FJ 4L0ZB 1LEAA 3W6JB 4QW9A 4BXUA 2HFHA 2AGPA 1RI7A 4JUZA 2ELHA 1ULYA 4BJ5C 1PP8F 4XYLB 2IMWP 3JRDA 2XGQA 1S9FA 3JRGA 2V9VA 2JA8G 3O3KA 4LIVA 2VPQA 2MC3A 2I5UA 4HZFA 5KFQA 2XAGA 2E1NA 3VPRA 3KFWX 4EGJA 1S0MA 2M45A 2E36A 4CH7A 4HSTA 1P9QC 2K3FA 2CUFA 2QQAA 3D0SA 3E7LA 4CCNA 3KHLA 3O8HA 4ESFA 1KJIA 3GVAA 1OPCA 2J6SA 3V7RA 4DGWB 3L2CA 5EZYF 3FXQA 2QM3A 5KFPA 5DCMA 2D2WA 3RV3A 5LRRA 2NS0A 1XMQH 4E7SA 1GDTA 3BTIA 3K2AA 2QBYB 1WWXA 5DCFA 2V7FA 3GMEA 3HOZJ 2MA3A 3H4BA 1ZG3A 3K1NA 5ICGA 4C2MA 4EJUA 1E4EB 2XROA 2DIKA 1N77A 1YHQI 1JTYA 4HV6A 3D5SC 5LBQA 1LE8B 4C3IJ 5JHUA 1Z2PX 5JHFA 4B3XA 1LFUP 4BWSC 3S93A 3ZMVA 4JI6H 1EF4A 1SCUB 1DU6A 1MD0A 3F8CA 4XKBA 4E7IA 4EJWA 3M7GA 5B5EC 1HSJA 1Z67A 5E17F 2Q2EB 3TOAA 4A3EG 2KIUA 1SVOA 4ED3A 3H3UA 2O8XA 2DU9A 4BUPA 2PJRB 1TBXA 1QPIA 3HDDA 3GFMA 2E7XA 3MFHA 4DZPA 3HOXG 3KZIC 2XKOA 1HNWH 4RGRA 2VKDA 1R36A 4HQMA 2ZBKA 1GYFA 4D5FA 2M5WA 2CU7A 1TL8A 1IOVA 5DQIA 5HDNA 4B8XA 1T94A 2JUCA 3GLLA 2V9WA 3TW6A 2CQXA 5KT2A 5LLQA 1K1SA 3H92A 1SFUA 2LY1A 2IGMA 4BHCA 1W5TA 3GFLA 1S72I 3MFIA 3G8CA 3UQ8A 5FJ8G 4IRDA 3TDZC 2X6OA 5LFAA 4F4WA 2DMNA 2CV2A 3H36A 3TQNA 1N56A 2JA8J 2EK5A 3DPTA 4DNCA 3GIKA 3GW2A 4EYHB 4LF7H 3BTJA 4ED0A 1IDZA 3CD6I 2NYXA 3GEZA 2MD0A 1T8IA 1IV6A 3S14J 4IWXA 1UB9A 2AGOA 3M1CA 2YW2A 1NHAA 1Y39A 1BI2A 2VQFH 4BNCA 1XNQH 1OCCH 1WQ2A 2FF4A 3KP6A 4F3QA 3H0DA 3KCCA 3QFFA 2DW4A 2R7VA 5FGMA 4DR3H 2MLKA 1S3JA 5KFGA 4DYQA 4UUTA 1R71A 4ON0A 1RPWA 3K7AJ 2RDJA 1MIJA 3HHHA 5F0FA 3BWGA 4M3GA 3H5NA 3LSIA 4LK1F 3MFKA 2FQ3A 3H3ZA 2W6QA 5JVLA 2RQQA 3BJAA 4A0XA 1R5HA 1WI3A 1MJAA 3ECOA 1I3QA 2CGPA 2Y0SA 4HEA2 4YJ3F 2NNYA 2EV5A 1MDMA 1FYKA 1HA8A 2RDIA 4HR7A 2HVSA 2KLOA 2W1OA 2Y0SN 4LG3A 3F8FA 1DGSA 2E1MB 4Y17A 4OMZA 3PO3G 1HDPA 2W6NA 4MV4A 3WTSC 4H4KC 4HLXA 2KKOA 1HQCA 4LJZF 4OAYA 3Q0VA 1M1EB 1SFOA 2B63G 4FASD 1ZAOA 3M9NB 3DEUA 3CCRI 5FRMA 3OYNA 2VOPA 1SYXB 2LF8A 5DUKA 2LY9A 4M74A 1G4DA 1YI2I 1CQIB 3R4KA 4LLNA 1H0MA 1QRYA 3FDYA 2QSGX 1UHMA 5EG0B 5H80A 5JUMA 5J4VA 4J9RA 2NUAB 2PN1A 2BVMA 4EVIA 1AU7A 1D1CA 4LF4H 4YR0A 1EH8A 3L00A 1VFCA 1FP1D 3RB3A 3HHGA 4RAYA 4ENJA 3KYDB 4G8XA 3QPTA 4Q4ZF 3K4JA 2XPWA 1LUJB 3BZKA 2R7ZA 5IT9W 2IGOA 3RKXA 3BQZA 2WWYA 4A5NA 4DL7A 4GKKH 4XLAA 2LFBA 1GXPA 4IRCA 1IF1A 1VBHA 3Q8PB 2W82A 4NLGA 4A3MJ 4EEQA 3OHAA 2CG4A 3PSFA 2XASA 1SD5A 2JUGA 4MV6A 2QQ9A 2IA2A 2PFBA 3SXYA 3CDIA 2FMAA 5DS9A 5J3LA 2DMPA 3CCYA 2K9SA 1HW5A 2VKEA 4A3DJ 3G6XA 2DFIA 2HTJA 1QU3A 4CICA 1KQ9A 3ZGKA 3FHZA 3CESA 4YAJB 1BBYA 3BT9A 1HDDC 4LF9H 2ID6A 2P4WA 1ZREA 2SCUB 1O4XA 2ZMEA 2HGCA 1X4PA 5GADJ 5IYBG 1XGMA 4FX0A 1M7JA 5KFWA 3F8BA 5HVQC 1RYSA 2Z2SB 1J5YA 3EYYA 3M9AA 2WY8Q 1QHHD 4C3HJ 3BLYA 2V58A 1BJAA 4I01A 1IV8A 2LVSA 3ML6A 5KFFA 1MBHA 4N9HA 3SQNA 5LEKA 1A31A 2VPLA 2WAQA 3H0GA 5LRSA 4Q44A 4EM2A 2W9CA 1I27A 1SAUA 4XL9A 3JR9A 2JPCA 2WAQN 2A69F 2VT2A 3RTXA 1K6YA 1WVRA 4M73A 3QYBA 4YFNF 5A2QZ 1XGNA 4LH6A 2KZGA 3L2WA 1I3AA 2ICWG 2R7XA 4Q8FA 2E2HA 1R1UA 1AKHB 3S17J 1MDMB 3GIJA 1NK2P 2GIZA 1E3PA 1EZ1A 3Q9SA 2EIJH 5CVJA 4UUSB 3HIFA 4Y13A 2VC1A 4HF1A 3WGIA 3PSIA 3BPXA 1ZGWA 2W71A 4OIQF 4BYYA 4ENMA 5KG3A 4LK0F 3JRFA 1TWHA 4PJ0C 2Z99A 1ETOA 4BY1J 4DL3A 3GZ5A 4D7MA 3J81W 1LVKA 1YQAA 2VQCA 3T0YA 2FOKA 2WADA 2HEOA 1VQ6I 1M0WA 4R8UB 3T5LA 5E8GA 1ZK8A 2B0LA 2OQRA 4G6QA 2VB6A 3QQAA 1TQMA 2OPTA 5IOYA 2WE6A 1XDUA 1R9TA 1LVAA 1VF9A 4N4OB 3I4NJ 2R6FA 3ZMSA 2K9MA 3OIPA 2XAHA 3PR5B 2Z5UA 4XQFA 4FU0A 4O5VA 2X6XA 3ECHA 1Z0XA 4HW0A 2ISYA 1CQTA 3TGNA 1OJLA 1R4MB 4Z6YA 2JJ7A 1TA8A 5GAEJ 3S1NJ 2I87A 1S7AA 1V54H 2XGCA 2FNPA 3BG5A 3ZRGA 4AWXB 2KDZA 1LEBA 3LMLA 4A93G 2K9QA 1YJWI 4TV8F 4LIUA 3QPLA 2K4JA 2XAFA 3PM1A 4FE7A 4DW6A 1YW9A 4BBRJ 2IA0A 3OV8A 4X64H 2H8RA 3LL7A 3PNYA 1MKMA 3K4CA 2FBHA 3WTYC 3Q2OA 3WNZA 1X2NA 2UZKA 5KFTA 2ZCWA 4PDKA 4RS8A 2DAOA 2FE3A 1RKTA 3F6OA 5IT9K 3I4MJ 1RR8C 1HW1A 2DT5A 4G94A 1G59A 2LKSA 1ZHFA 3OIQA 1TWFJ 5E20A 2WAQE 3ZQHA 1JT6A 4M71A 4ZHQF 1SD7A 3IRQA 4A2AA 4IHTA 2W9CB 4DV1H 3S2DJ 2HYGD 2MG4A 3P9KA 4II2A 4L9JA 4UVAA 2J6UA 1FZPB 2DBBA 1EH7A 1G8XA 4KA4A 2YU9A 1PP7U 1VQ7I 2K3PA 2R5YA 1XSVA 1FJGH 4BEHB 4GCVA 4UY8I 5AIQA 3OWTA 3AG1H 1DGWY 2M8GX 2DA3A 3BP8A 1SANA 3VMMA 3NRVA 2B7EA 1Y1VA 1TWAJ 1RK6A 3TP0A 5KFXA 2CYYA 2IAIA 3G6VA 2G9WA 3I4PA 4QWQA 3P9CA 3GFJA 1MNEA 5KCMA 1DP3A 1JXSA 4GFBA 1Y8QB 1GSHA 3FMSA 5KFBA 1REPC 1T3NA 4BACA 4BQQA 2HPMA 2DMUA 4YB8B 2Y0MA 3O8GA 2DO7A 2LY2A 2E1CA 5M5YJ 5IYBJ 2JVGA 6PAXA 3BA8A 3C3WA 3N97A 3ZMDA 5J1YA 4PK4A 3FXLA 2H8WA 3R60A 3S1QJ 4D1QA 2G7UA 1I6XA 3BCAA 5K5QA 3ZMUA 2CMPA 1M6VA 1SC7A 2IP2A 1QNTA 3BG3A 3E5QA 2DK5A 5D1OB 4JK1X 2KJCA 2AU0A 5JLXA 3MKLA 3EUKL 4IHYA 2FK1A 1D3YA 2LBFB 4GKJH 3HOSA 3PFYA 4KIGA 4C2UA 1D5VA 1J9IA 5KFMA 1D0XA 2DODA 4QWEA 1KJQA 2JPBA 1Y0UA 4DYRA 1R5GA 2RV8A 4XORA 1OYYA 2MBFA 4BHBA 1OR7C 2PQ8A 1IN6A 3X2QH 2X0LA 5H20A 4DQ2A 2HYFA 4KN7X 2W70A 4NBQA 3SDGA 5C5JA 2RKHA 3I54A 1JI8A 5CA1F 4UUVA 5LYJF 3QPSA 1ZLJA 1JKQC 4DV2H 3OL3A 5C1PA 3RB0A 4A93J 1TNTA 4I09A 2JA7J 2Y0SE 1ETKA 1Z7UA 1VS0A 3WODF 4CZZA 1MSEC 4ECYA 1Y56A 2CS3A 5D4SA 3JTHA 2DA6A 5IPAA 1HSTA 2CQ7A 1N48A 1JGSA 2LREA 3DTKA 1MGTA 1RUOA 5CKTA 1G3SA 2VJ5A 4EQQA 4J9PA 4FISA 3F21A 4OIOF 3EDPA 4XZ3B 4LF6H 4KIBA 1OCTC 4RB2C 5KG4A 4RGUA 3V4GA 2GXBA 5FRNA 1I7LA 3S16J 1XC5A 2R93G 1U9NA 4BEHA 3T8RA 4ETSA 1N78A 5KAIC 3TO7A 3EUAA 4NC8A 4RGXA 3GTMJ 3Q0UA 3DFGA 4A3IG 4HDVA 3LWBA 1PYVA 3VWBA 1PUEE 2L4MA 4HRIA 4RM2A 2KJBA 5B1AH 1EH6A 2C6YA 2O3FA 3Q5FA 1HCRA 2XAJA 2IW5A 5F6FA 1X2MA 5GTHC 1BOBA 2CQNA 1HBXG 1AHDP 4B3MH 5BMZA 1HOMA 4JOMA 3HPHA 4DJAA 2JA6A 2GA1A 1Z6TA 2HI3A 3LSMA 2EFWA 4IHWA
chains in the Genus database with same CATH topology
1IUYA 2K02A 4LG0A 3M4IA 4B3RH 2HVRA 3IKVA 1STZA 2YU3A 1K78B 4ZH4F 5LMNH 4IVNA 3N44B 5D1OA 4KMFA 3MAJA 3E6BA 3J80W 3PFIA 5D1PA 3R0AA 4OINF 4MV9A 4MQ9F 5HS9A 1UFMA 1KYZA 4DV4H 1H9GA 4UFZA 4HOBA 3F72A 4ENKA 4L9TA 1ZRDA 2EB7A 4XSZF 5KVRA 2EV0A 5L3GA 4O3MA 1XGOA 1B6AA 1J59A 1GHCA 4EFEA 5D8LB 4QLCU 3VOEA 2R3SA 2OQGA 2IJLA 2OZUA 1QGPA 2RDPA 2H27A 3RGXA 1W7PA 4XLNF 4BH9A 4EGZA 4DR6H 5HDKA 1BC7C 4UNOA 4U88A 2UXCH 3RIZA 1XDSA 2QENA 1SD4A 3RIRA 1MZBA 5IT3A 4MNUA 1RZ4A 4HLYA 3N6XA 4B09A 3TOBA 2KIFA 2TDXA 2RVCA 2PI0A 3ULQB 4IAJA 2WV0A 5FB2A 3COAC 1K79A 2L54A 3LAJA 1OR7A 4P96A 4X62H 4JQFA 1WKMA 2FRHA 1K78A 2UWMA 2Z9OA 2WYOA 4NXMH 3BDDA 5KK1A 4LD5A 4F7ZA 4MV7A 2PMUA 1FBQA 3SFZA 4HA8A 2M87A 1BI3A 4LGWA 5ERIA 5FPRA 2GAUA 2D45A 2R7FA 3EETA 1UCRA 4Q0YA 2YPRA 3DP7A 2KSWA 3QP6A 1O3QA 4PZJA 5FLXW 4UCUA 3JSPA 5F64A 2AS5F 4XLPF 2D1VA 2IPQX 1X3UA 3AAFA 4NHJA 2MH9A 1BIBA 2PLYA 2ZM6H 2EWNA 1XMKA 1V3FA 5FLXK 4BAYA 2Q2UA 3LQQA 2K4BA 1J5EH 4JI5H 4JV5H 3ZP5A 3BZ6A 3DF8A 2IVMA 2WTEA 2LKPA 1FSHA 1YO5C 2OWOA 4G7ZF 4HF2A 1BOAA 4LFBH 4LF8H 4G9YA 2LDUA 5ILUA 1YW8A 4HX8A 3GFIA 2UU9H 2KIMA 4IJAA 1N36H 3KEOA 3C18A 4M9SA 2HKXA 4P5OA 1O3SA 1IN7A 2G7HA 3J81K 3WTWC 3B02A 2CO5A 4PGGA 5TJJA 2VONA 2RGVA 3TDUC 2VOOA 4LFUA 3BABA 5E1WA 3GLXA 2R7DA 1G3WA 1F5TA 3WU1B 1U3EM 2LNBA 1ZG1A 2DI3A 1R58A 4AIKA 1R22A 2QYOA 3L9FA 5L3FA 3K3VA 2Q2TA 3KLOA 2UXNA 3L2PA 3GUDA 1B59A 3FWEA 2UUAH 1E4GT 3CLOA 3I58A 4EGYA 2A6HF 2EJRA 1IN8A 1F9NA 3KP5A 4TV7A 5CJ9A 2JT1A 3E97A 3BAAA 4UVBA 3HRMA 2ADUA 5CVRA 1IRFA 4LSAA 1RUNA 4A12A 4Y15A 5ILSA 1SFXA 4UV9A 1D8KA 4KICA 3DF7A 2A68F 3RGZA 2F5EA 4JBAA 4XSXF 2YR2A 2RGRA 4OOIA 1BI1A 4U7DA 3FM3A 4KHPH 3KALA 2LF7A 4HDUA 1LNWA 4I0AA 5CVVA 1P4AA 1ZARA 3V7SA 4ESBA 2P8TA 1FNNA 2NRAC 2HQRA 4L18B 1W7PB 1E17A 5DUIA 4OIPF 5D5WB 3J80K 3IG0A 2DQRA 5EEHA 3CO7C 1YG2A 5LGNA 3HXLA 3LA2A 4ZYGA 4FHTA 4EJVA 4H0EA 2VE9A 1IAWA 1DUXC 1AWCA 4EFBA 3L4KA 2O03A 3GZ6A 1TW3A 5FPOA 4P9FA 3RYRA 1XSDA 1LB2A 4I0BA 1A0IA 1SEIA 2L02A 2Y48A 3RF2A 3LA3A 4CDGA 4LB6B 4EMSA 4ASNA 2EFNA 3J81Z 2P6TA 4G7HF 3HSRA 4JI4H 2COMA 1TLHB 3O2PE 3IKTA 1FX7A 1I5ZA 5E1ZB 3GX4X 2BBYA 3BROA 1BC8C 2VOBA 3SZPA 2W85A 3QP5A 3JW4A 4KDPA 3I5UA 2O0YA 4I2OA 5IWAH 3EUHA 2FMLA 5E18F 1FC3A 2BYVE 2NNNA 1O7LA 1IBMH 3F23A 5FLXZ 4UCSA 2FA5A 3E5UA 3KAJA 4G6DA 4CC6A 2QUFA 4B3TH 2W25A 3DQVC 2UUCH 4LH7A 3GF2A 5ED4A 1F4KA 4S04A 2NAZA 1UHWA 3P9IA 5CVIA 2ZO4A 3MQ0A 2UXDH 2XKPA 4HQEA 4GYIA 3WTVC 4IF4A 2WC2A 2FNAA 5L3BA 3F8NA 1LDJA 4KMUX 2JZYA 2A6EF 2F4VH 5A2QK 3ROUA 1CF7B 1XGSA 3PQJA 3N4MA 3C0FB 5LGTA 1L2ZA 3G3ZA 3E6CC 4WXDA 4U7BA 3TO6A 4XBFA 5DD8A 1JE8A 4AIJA 4KT5C 1HKTA 3QU3A 4MQVA 3J80Z 4A0YA 3I59A 1DPUA 2XIGA 4A6EA 1LQ1A 4J0MA 2GQQA 1FLIA 5CVUA 4WXHA 2JRTA 3U2RA 1ON2A 4MEYF 2P7VB 1R1VA 1EV7A 5HOOA 3L7WA 3LFKA 2QWWA 1C0WA 2PMHA 1WH2A 3HTSB 3FXUA 2CW8A 2QVOA 3LWFA 2DPUA 4X65H 2BGCA 4UHTA 4ENNA 4Q48A 1ZGJA 3FM5A 5DD4A 1TW2A 2MCTA 4G7OF 2RNJA 1P6RA 3OTOH 3ABTA 1M0TA 1ZHQA 1IBLH 2IA1A 4HV5A 3T1YH 2H94A 1KU9A 3SZTA 1U6GA 3FXRA 2OAZA 1ON1A 3QOPA 1HKQA 2MLGA 3I0TA 5D5VB 1FOKA 5AONA 3M8FA 4AIHA 1I1GA 1QPMA 2XHKA 2VBWA 1KU3A 3V8JA 3T5XA 1XD7A 1HKSA 3OOPA 1XCBA 1DP7P 3JSNA 2X4HA 1FT9A 4MTDA 3FX3A 3ELKA 4A5MA 3ZMZA 4WK8F 3G73A 1USSA 3LA7A 2A07F 1YIOA 4MHGA 4XRFA 3QAHA 1QQIA 1YW7A 3KXYT 3K0LA 2H6CA 1YFHA 3L4JA 2VE8A 3M1EA 3DV8A 5DCMB 2A61A 4I7HA 2PJPA 1S03G 3HSFA 3IRRA 5J8CA 2YSRA 1O3RA 1J0RA 2E7WA 2FU4A 3MWMA 1XSXA 2Z3YA 1W5SA 5FFXA 1ZN2A 1BGWA 1Z2OX 2V1XA 5JR3A 4WX9A 1IW7F 3EQLF 3E3VA 1P2FA 3HUGA 2W24A 2VXZA 1XN7A 4EJOA 1ZH5A 4K0KH 4GXOA 2EV6A 3K2ZA 1T0FA 4NB5A 3VEPA 5FD6A 4IRHA 1QO0D 2QLZA 3DXJF 3CO6C 2PG4A 4RZQA 1E2XA 4EJTA 4Q47A 4PDBA 5IT9Z 1I1SA 1G6NA 3CUOA 1TNSA 1XMAA 4YG2F 1USTA 4RB1A 1OYIA 4CXFA 3HOTA 4RB3C 1XB4A 5LMUH 1SMYF 2JSCA 3MEXA 1IN5A 3R0JA 2A5YB 1DPRA 4UCRA 1FBSA 4E70A 4YHHH 3RTRA 2EFQA 1R7JA 3ZQ7A 3FMRA 3SHFA 2V79A 3HSEA 5K5RA 3CVZA 1GXQA 1P92A 5LHHA 1FY7A 5HS8A 4IHSA 3HYIA 4JI8H 3MCZA 2DQLA 4ZZDA 2P5LC 1SMTA 3KZYA 3C1DA 5D6FA 1K7AA 3KP2A 2GXGA 1S8NA 1HNZH 3KP7A 2HWVA 5LGUA 3RYPA 5HLHA 3WTUC 5E1XA 1U8RA 2STWA 2VC0A 3RPUA 2RN7A 4JI7H 2M8EA 4U0YA 4GYGA 1BJTA 3WU0A 1YYVA 2H09A 1OYWA 2DK8A 4UXNA 4YIFA 3JSLA 1IBKH 2L4AA 4FT8A 3LAPA 4KFCA 1OMIA 4HX7A 4AVPA 1S68A 1TTYA 4HF0A 3F3XA 3KLNA 1XDNA 5A2QW 2V1UA 1U78A 2ZMEB 3N42B 2XGXA 5EEGA 2VODA 1FP2A 1O75A 2XVCA 2HKOA 3JAMK 3JAMW 1ODDA 1K6OA 3GO5A 2ZNZA 1G3YA 3TO9A 3VFZA 3FZVA 4YY3H 2F5CA 2JTVA 3MZHA 3IL2A 4L5IA 4CYDA 4JI2H 3T1HH 1G3TA 3U1DA 4L0YB 2FBIA 3RJPA 4JI3H 1O7FA 1R1TA 3J7AO 4L5JA 5H6RA 2Q2EA 4LF5H 1HW2A 4DV7H 1FSEA 1XNRH 4ZYDA 4IRGA 1B9MA 5D8KB 1YLFA 4LG0B 1SD6A 2VUGA 1HR0H 5FO5A 4RAZA 1LDDA 2UUBH 4DV3H 2F5FA 3BA9A 2QQBA 4GGGA 3PQKA 3ZN0A 4DR7H 1GVJA 2K86A 3O6BB 3WTZA 2WDTA 3K1PA 5HDGA 4S05A 2UXBH 2J5PA 1RNLA 5H6QA 5BOXA 5BS6A 3QU6A 4M6YA 4M6XA 2W57A 4B3SH 4KYWA 5EOYA 4AQYH 3BJ6A 1FPQA 4OMYA 1N32H 5FFZA 3MZYA 5JFRA 4HYEA 3N41B 2UXXA 4R8HA 5HLGA 2HR3A 4WWCA 2VPSA 3F8MA 1FBUA 4Z2YA 2FBKA 3KE2A 5D4RA 5LHIA 4MGRA 3R61A 2XAQA 4KNYA 4WF2A 3KZZA 3BJOA 2J5OA 1VTNC 1I6UA 2K7LA 1FVIA 4UVCA 2P6SA 3JSOA 3QPHA 1ZYRF 1P4WA 3BPVA 2A3SA 4A2BA 5DEQA 4N0BA 4LLLA 3ZMTA 4NXNH 4ZZLA 4IPAA 4I02A 2GA2A 3WGGA 4UCVA 4JYAH 2OU2A 5LHGA 3CUQC 3RPQA 1WSUA 3IWFA 1SFEA 2M1BA 4UCTA 3GXOA 3VB2A 2ESHA 4U0WA 2DTRA 4BHPA 3HRSA 3I53A 2ESNA 3QRFF 2BE5F 3JTGA 3N40P 1ZRFA 4M72A 1OKRA 3C7JA 5HS7A 1U5TB 5ICCA 1CGPA 1ZLKA 1IN4A 4R7RA 3WTXC 4P55A 2HDCA 3J7AK 5ICEA 1I94H 3IWZA 1R23A 2CWEA 3K1MA 1X9NA 5D5UB 4DV6H 5L3CA 2GZWA 1B4AA 2XV4S 1WI9A 4LSXA 1KU2A 2VN2A 2CSOA 2VT3A 4A2UA 1IRGA 2V6CA 4LLGF 1B9NA 2AXLA 5CYVA 2YX7A 4KN4X 4O6JA 5L3DA 2P5VA 3HTUA 4BQAA 3RJ0A 3GYHX 4EM0B 1N34H 1MJ9A 1O57A 1Z91A 2RC4A 2HVQA 4A0ZA 1R00A 1S7OA 1KQ8A 5DV5A 4CC5A 3HRTA 3V8LA 5DDGA 2K27A 5ILVA 4Q5SF 3E6MA 4ZYEA 2FXAA 3LQRA 2XRNA 2P7CB 3EYIA 4P9UA 4N9IA 2P5KA 1AN7A 4WXCA 1U5TC 1Z6RA 1FKAH 3GWZA 2EA4A 4A6DA 2STTA 3CJNA 5JVTA 2VQEH 2E5LH 1L0OC 3T1BA 2HQNA 4RGSA 5ICFA 1TAEA 1QZYA 3D5LA 5BR8H 4CGZA 1RIOH 1V4RA 1SAXA 1T2KA 3I71A 2VBXA 3W6KB 4DV5H 3M8EA 2VBYA 3VODA 1FYLA 3FMAA 3RDIA 2H6BA 3ZN1A 3U9GA 4RB0A 2KRFA 5DYMA 4KUMA 2OZ6A 1P8LA 3RI4A 1E4FT