2XIGA

The structure of the helicobacter pylori ferric uptake regulator fur reveals three functional metal binding sites
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
148
structure length
146
Chain Sequence
MKRLETLESILERLRMSIKKNGNSKQREEVVSVLYRSGTHLSPEEITHSIRQKDKNTSISSVYRILNFLEKENFISVLETSKSGRRYEIAAKEHHDHIICLHCGKIIEFADPEIENRQNEVVKKYQAKLISHDMKMFVWCKECQES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERRIC UPTAKE REGULATION PROTEIN
publication title The Structure of the Helicobacter Pylori Ferric Uptake Regulator Fur Reveals Three Functional Metal Binding Sites.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transcription
total genus 42
structure length 146
sequence length 148
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2xigA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2xigA02
4WXHA 4P5OA 4LD5A 3IC7A 4M9ZA 5L3GA 3VOEA 2ZMEB 4XLNF 4CICA 5DDGA 4U0WA 4HA8A 3CUQC 2J5OA 2K4BA 4DQ2A 3U9GA 1USTA 1MDMB 3L7WA 3HHHA 1LVAA 1K78B 3HYIA 2XAHA 1IXRC 1R1UA 4IF4A 5TJJA 5ERIA 4RB1A 2XAGA 3FM5A 1ZN2A 3HOSA 5D8KB 2CYYA 2M5WA 5H6QA 3RPQA 3E6CC 4I2OA 1WI9A 2ZNZA 2FNAA 2NYXA 2NAZA 3JTGA 4HQMA 3ZP5A 1O7FA 2O61A 2CWEA 2IRFG 1JGSA 4HZFA 3FXQA 1R36A 1J75A 4AIKA 1J59A 3BOQA 4GYIA 2DO7A 1S7OA 1ZAOA 3CUOA 2CO5A 1IN8A 1J9IA 3J81Z 4KA4A 1U78A 1B1BA 2HYFA 4A6EA 3HRMA 2CSOA 2NNYA 4HF2A 3BPXA 1ZRDA 1BI2A 1OPCA 2XAJA 4Q48A 3QRFF 5LGUA 1I27A 1U5TA 2QVOA 1G3WA 1RUNA 5ICFA 4KFCA 2RVCA 3WU0A 1P2FA 4RGSA 4UV9A 1QZZA 4L18B 1DPUA 1QO0D 1F1ZA 1FWZA 2L4AA 2XVCA 1Y0UA 2L02A 2A68F 2YSRA 4HF1A 3WTXC 5CVUA 1MJBA 3HRTA 5FD5A 4RB0A 1ODDA 1RUOA 1R00A 2HYGD 2FOKA 2A5YB 3LAJA 1STZA 2K02A 1O57A 2IJLA 2F5EA 5L3FA 4A5NA 3RJPA 2A69F 3HRUA 4M6YA 2L3DA 1LB2A 4M9SA 3V7SA 3G73A 2YU3A 2GAUA 2O3FA 1O3SA 2FA5A 3U2RA 2UZKA 2QBYB 3M8EA 4KT5C 1FYLA 3QU6A 1P4AA 2DTRA 2IPQX 4IXAA 4HAMA 1LEAA 4ENNA 4A0XA 4BYYA 4L9VA 5AONA 1P4XA 4EQQA 2OAZA 2FSWA 5E18F 3P9CA 1LNWA 4ZZDA 4N9IA 1K7AA 1QQIA 3ABTA 3SQNA 4ASNA 2IA1A 2QWWA 5LHIA 4N0BA 2H27A 3DPTA 4PCQA 2KIFA 5ILSA 4GO1A 2JPBA 1TQPA 2XKPA 5E1XA 3KP4A 3IL2A 4I09A 1MJAA 4IVNA 1AOYA 5DCMA 4LB5A 3J80Z 2ESNA 1G4DA 3K2ZA 1J0RA 4EGZA 2C6YA 3D0SA 4ON0A 1G3SA 4F7ZA 2XAQA 4L9TA 4IRHA 4M71A 4Y15A 1R1VA 5ILVA 2TDXA 3MEXA 4WXCA 1R5HA 2A6EF 3LFKA 3G3ZA 2OD5A 1TQMA 3EDPA 1W5SA 2MD5A 4PZJA 2V1XA 2EFQA 2H09A 3BJ6A 1PP8F 5D8LB 2RN7A 1Z05A 1CF7B 2HKXA 2QQAA 1O3RA 2ZXJA 1RI7A 1P92A 4HLYA 4EVIA 3PQJA 3VODA 2VBWA 3ZMSA 3KP2A 2A61A 3D5LA 5LGTA 4EJVA 3HIFA 4AWXB 1BI3A 2BYVE 2DT5A 1FLIA 2AXLA 3MCZA 3R61A 4HF0A 4PGHA 2W25A 1ZRCA 1K6OA 1WKMA 2M8EA 4UVAA 1T0FA 2ZMEA 3I0TA 2MA3A 3F8FA 3BJAA 2K27A 3F8BA 5J8CA 1OYIA 1KU3A 5FO5A 2W57A 3TDUC 1O7LA 4FHTA 3GFIA 1TBXA 3BDDA 1K78A 3LWFA 3EQLF 4ZZLA 1IN4A 5L3DA 4B09A 2W85A 2LSOA 5F6FA 3J81K 1LEBA 1Q1HA 4WK8F 1R22A 3F72A 1SD5A 4MQVA 4I7HA 4OIOF 2EK5A 2EFWA 2PMHA 1YYVA 2ADUA 2IA0A 1XSXA 1XGMA 3EYIA 2L4MA 3E3VA 3GFJA 5E1ZB 3I71A 3ISPA 4AD9A 1P4WA 1YQAA 1D5VA 4MGRA 4BH9A 2VONA 4KN7X 2ETHA 4ZYHA 4BQAA 4A0ZA 5K1YA 2FXAA 3GYHX 1IXCA 1UCRA 1XB4A 2A07F 1JHFA 5L3CA 4IHSA 3BJOA 2IT0A 2YX4A 1SFUA 3LA7A 2YR2A 4FT8A 2VODA 4CXFA 1SD4A 1JHHA 1RZ4A 4MTEA 4U0VA 5CJ9A 2M87A 3QOPA 3PFIA 2D45A 2OU2A 2QENA 4CZZA 3U1DA 1EH8A 2IVMA 4A12A 3GW2A 4UHTA 3C1DA 2OQRA 3LA2A 4LB6B 2XGXA 3RKYA 2PN6A 3OOPA 2VE8A 3L2CA 1HBXG 4M72A 2P6SA 3R6SA 3I4PA 3R0AA 1QNTA 5AIQA 4OIPF 2PMUA 1Z6TA 1RNLA 3DPLC 2EWNA 1SFEA 4EV0A 2CQKA 2GXBA 3CUQA 5K5RA 2XV4S 1E17A 4KICA 5ICEA 4HX4A 2VN2A 3TOBA 3KP3A 2RNJA 2QUFA 2CFXA 1GHCA 5D4SA 4G94A 4WXDA 4LJZF 4YFXF 1R58A 2LKPA 4MTDA 3F8NA 4L0YB 3Q9VA 4Y17A 3J80K 4ZYEA 3DXJF 3HTSB 1XGOA 4EGYA 2RDPA 2W84A 3WTSC 1G3YA 4EJTA 2XHKA 1FPQA 2EV0A 2MC3A 4KUMA 2VOOA 1B6AA 3ZMVA 4M73A 2HFHA 3DF8A 1Z91A 1BI0A 2DQRA 5CVIA 4KIGA 1UFMA 2X0LA 4LLGF 3WGIA 3WTVC 4XSZF 4KNYA 4NB5A 3V8LA 3PQKA 1H9TA 3GXOA 3E6DA 3CO7C 5DV5A 1ZGAA 5HVQC 2ESHA 5HS7A 3TKYA 1MZBA 1I5ZA 3RKWA 1GXQA 4UXNA 2HKOA 1F5TA 5CYVA 4EM0B 1ON1A 3GFMA 4M74A 4TV7A 5ICCA 4L9NA 3S2WA 5H6RA 2FEZA 3FMRA 5ILUA 1R5GA 2P5KA 1U3EM 2E1NA 3GO5A 5DCFA 2NNNA 3HOTA 2G7HA 5HDGA 4YIFA 1CF7A 1KU7A 5FLXK 3QP6A 1KQ9A 4RAZA 4CGZA 5BOXA 5D5XB 1OYYA 1R1TA 4Q5SF 4OINF 3KP5A 1XN7A 3FMQA 2FQ3A 3W6KB 1ZYRF 4OMYA 3GLXA 1L3LA 3WE3A 1IN7A 3JAMZ 4MQ9F 3O3KA 1WQ2A 2NS0A 4IRIA 4XRFA 1XSDA 2WTEA 3T8RA 4DNCA 4BHCA 1QPMA 4AVPA 3O6BB 2J5PA 1T39A 1YS6A 5D5WB 3WTTC 1JXSA 4L5JA 3RDIA 4QWQA 1SMYF 2GWRA 5L3BA 2HTSA 4HYEA 4I98B 4RB3C 2V9VA 1XDSA 1U8RA 2P7CB 1TLHB 2EFOA 5BQTA 1PP7U 3CTAA 5HOOA 4XSXF 2QZ8A 3F6VA 1QBJA 4GXOA 2FRHA 2P5VA 3W6JB 3K1PA 1I6XA 3HSEA 4IRGA 1NHAA 1RIOH 1ZH5A 3Q9SA 3WGGA 3CUQB 5FFZA 1W5TA 4L5IA 1B9NA 2IW5A 2Y48A 4KIFA 4HBLA 1WSUA 2HQNA 1F9NA 2B0LA 3LSTA 4KIBA 4EJWA 3B02A 4M9XA 3JSPA 3LQQA 2ISYA 2QQBA 2IP2A 1GVJA 1BM9A 1WRJA 1HSJA 2L01A 3RYRA 3I54A 3RPUA 1U5TC 5ED4A 4P9UA 1L0OC 4E70A 2O0YA 5IT3A 2RV8A 5D6FA 1HQCA 2P6TA 4ZYDA 2DFIA 3OV8A 4OMZA 1FX7A 1V3FA 1OYWA 1XDUA 3C18A 5A2QZ 4O6JA 3RTRA 5JFRA 1Z1DA 3V7CA 2ZBKA 2V79A 1H9GA 3K1MA 2STTA 2VC1A 2OZUA 3MZYA 2Q8KA 2DI3A 1DPRA 1KQ8A 1MD0A 2E7XA 5DEQA 2ZNYA 2BBYA 3I58A 2F5DA 1X3UA 3FWEA 1EH6A 2PEXA 2EA4A 3WU1B 4L0ZB 2V6CA 5IT9Z 3IWFA 1BI1A 3F8MA 1DDNA 1ZGJA 4A6DA 2DK8A 4RGRA 4OU0A 4PDKA 1UHMA 4ENKA 3KFWX 3B73A 3M9AA 1ZLJA 3RIRA 3NEUA 5D5UB 4G8XA 2ACJA 3F8CA 4G9YA 4D0PA 1PUEE 1B4AA 4O5VA 4H0EA 2A3SA 1A04A 3KETA 3HHGA 2ZJ2A 2LF8A 1TNTA 5JR3A 3FMSA 3BPVA 4Y13A 2D2WA 1BC8C 2LF7A 2E1CA 1KU2A 2O8XA 2VOPA 4ETSA 2HS5A 1KA8A 5EEGA 4LGWA 2M1BA 1J5YA 3K9TA 3L9FA 1IF1A 1SD6A 3H3ZA 1KQ0A 3V8JA 4YG2F 1UHWA 5DD4A 4BHBA 2FU4A 5K5QA 3C7JA 3HUGA 2PG4A 3MQ0A 5JI6A 1U2WA 1QZYA 4G6DA 2DQLA 3FM3A 2GZWA 5F1RA 3GVAA 2EFNA 3F22A 3WG9A 6PAXA 3KLNA 1EH7A 2F5CA 2HEOA 1FYMA 1Z9CA 1T98A 2Q2EA 4IHTA 1D3YA 2FBKA 2V1DA 5DUIA 3F3XA 3AAFA 3WGHA 1ZG1A 1BIAA 4JK1X 1FSHA 2PJPA 1FNNA 1FP1D 3CLOA 3KEQA 4NHJA 2EA2A 2KKOA 2ZCWA 2IA2A 5DYMA 2BGCA 5JVTA 3BROA 2OBPA 5BMZA 2KIUA 2XAFA 3WODF 2P7VB 1R23A 1KGSA 4UVCA 1W7PA 5BS6A 1BJAA 4HV6A 1SD7A 4KMUX 4FX0A 1LQ1A 1T2KA 3WTYC 1OMIA 2COMA 3GF2A 4ESBA 3ML6A 4ESFA 5FD6A 2QLZA 1H0MA 4LMYA 2XUBA 1OKRA 3T8TA 2QM3A 1MKMA 4KMFA 3N4MA 3FXRA 1G3TA 4P96A 1ULYA 3VEPA 2FBHA 2OZ6A 2H6CA 4UVBA 4BAYA 3P7NA 4OIQF 5HS8A 5DD8A 2E7WA 1SMTA 3E5UA 4NQWA 4I0BA 1WWXA 3L09A 3EUHA 3DQVC 3KZZA 5LLQA 2HOEA 4MHGA 3GEZA 3KP7A 1ZG3A 4JBAA 1IN6A 1UB9A 5LEJA 5A2QK 5BPIA 1XSVA 1YS7A 3ABUA 5HLIA 2EJRA 3HRSA 4G6QA 4HX8A 3QP5A 4N9HA 5KK1A 3K1NA 3KLOA 2VT2A 4LFUA 3IWZA 4HDUA 3I53A 5J6XA 4Q4ZF 3EYYA 1IUYA 3F23A 4HOBA 1TTYA 2HWVA 3EETA 5E17F 1S7AA 3FX3A 2HR3A 4P55A 1REPC 3JTHA 1XGNA 1J2XA 3TO9A 4R79A 2ZO4A 1U6GA 3DP7A 4XLPF 2O03A 2EV6A 1P6RA 2KRFA 4PGGA 5CVRA 3GZ5A 4Z2YA 2GIVA 1SAXA 2EB7A 2LDUA 2RKHA 2DK5A 5D5VB 3TO7A 3KCCA 2R3SA 1YG2A 5HLHA 3JW4A 3O2PE 1YW7A 4U7DA 4YFKF 3IRRA 1FP2A 4IJAA 1YW8A 2VE9A 2GA1A 1C0WA 2XRNA 3CJNA 2VT3A 2MLGA 3QU3A 1XCVA 2VBXA 1K79A 3GZ6A 2KIMA 2HQRA 3H92A 4CO8A 2JPCA 1HKQA 1Z7UA 4RGXA 4ENMA 2P4WA 2DPUA 4U88A 4ZH4F 3LQRA 1XMKA 3WTZA 4EJUA 2UXNA 2CW0F 1HXDA 3MAJA 4P9FA 3FZVA 4QLCU 3DKWA 1XMAA 3BZ6A 2GQQA 4B8XA 4WCGA 2UXXA 3LAPA 5JHUA 1MJ9A 1S6LA 1W7PB 2Z5UA 3SXYA 1SFXA 4CDGA 3BP8A 1B9MA 2EV5A 3FF5A 4I01A 4UUVA 3I64A 2WWYA 3CDHA 4KDPA 2CGPA 2BEOA 4RAYA 1IZ1A 5E20A 5HS9A 1CGPA 2YX7A 5LGNA 3ERED 2H94A 2HDCA 3SFZA 2MH9A 3NQOA 2K4JA 1FOKA 3F21A 4MEYF 5HLGA 2K7LA 3V4GA 1G6NA 4EMSA 3REOA 3GX4X 4LG0B 1TW2A 2DU9A 3E5XA 4L9JA 3TO6A 2HGCA 1BN5A 4RB2C 5LHHA 3R4KA 1YIOA 4WX9A 2XROA 1OR7A 3RKXA 5LBQA 1FSEA 4U7BA 1FY7A 1LDJA 3COAC 1V4RA 4LK0F 3FXUA 3I59A 1DUXC 4S05A 2O6GE 4GYGA 2AS5F 2QYOA 3MZHA 2ZFWA 3P9IA 4UV8A 1T38A 1GXPA 3MWMA 2DPDA 4HDVA 4K2EA 3ROUA 4RS8A 3BWGA 1S29A 3WTWC 4KYWA 4GCVA 3ZMUA 2STWA 3BY6A 3I5UA 2VBYA 4BNCA 1ZHFA 4WWCA 3IHUA 1YO5C 1AWCA 5DUKA 4ESJA 3IKVA 1IN5A 2FMYA 3ECOA 1ZREA 1HSTA 1BC7C 2A6HF 4A5MA 4BHPA 3V7RA 2FE3A 4GGGA 4MNUA 3IKTA 2VBZA 3C3WA 2HZTA 1YLFA 2K86A 1HKSA 4O3MA 1IXSB 2XASA 4XBFA 3SHFA 1BBYA 2ELHA 1FC3A 3GUDA 1D8KA 2MLKA 2V1UA 3HTUA 3SZPA 1FBQA 5F64A 4CYDA 2JRTA 3NRVA 1XD7A 2QQ9A 5ICGA 3SZTA 1Z6RA 2LNBA 3ZMDA 3ZQ7A 3M8FA 1LDDA 3ELKA 1ZARA 1S8NA 2Y0MA 3FHZA 2P8TA 2RGVA 2XIGA 3TOAA 4G7HF 1DP7P 3Q5FA 4G7OF 1TQIA 1T6SA 3LA3A 5BPDA 3N97A 4R1HA 2F2EA 4ENJA 3E6BA 1B59A 3MFKA 4A0YA 3T0YA 4LLNA 2M30A 5LRRA 2MBFA 2G7UA 3E6MA 2ISZA 3ZN0A 2YPRA 4YFNF 2L54A 2WC2A 5E8GA 2VXZA 1PDNC 4OIRF 3E5QA 2R7DA 1D8JA 2WV0A 3T5XA 1I1GA 1VTNC 1JE8A 3DFGA 4G7ZF 4M6XA 5KVRA 2GXGA 5K5OA 2DAOA 5EEHA 4KN4X 3K0LA 1FT9A 3CO6C 1HKTA 1USSA 2JSCA 5D6EA 3K69A 2JZYA 2OA4A 2DBBA 2Z99A 3HSRA 2D1HA 1XCBA 1FBUA 3TQNA 3HSFA 3RI4A 1U5TB 3H3UA 2RC4A 1KYZA 5L3EA 2PBIA 4FX4A 2Z33A 4ZYGA 1MDMA 2OQGA 5D4RA 5FLXZ 1HW1A 2DW4A 5LEKA 5J8FA 2CG4A 2W24A 3M1EA 2P5LC 3JAMK 5E8IA 3DV8A 3P9KA 1LDKB 4LK1F 1XGSA 5LRSA 5E1WA 3R60A 1IAWA 3KE2A 3GWZA 3I59B 1EV7A 2G9WA 2RQPA 4AIJA 2FNPA 1TW3A 2FBIA 5FGMA 1FYKA 4Q47A 4EM2A 2X4HA 3QPHA 4CHUA 2JT1A 4IPAA 2BV6A 1FBSA 3J7AO 4HQEA 2PQ8A 3RYPA 1I1SA 4HV5A 1HW2A 2Z9OA 4EJOA 3V8KA 1ZRFA 4HLXA 1S3JA 3TGNA 2Z3YA 3T1BA 1YW9A 1LJ9A 4EM1A 2H6BA 3ZPLA 5CVJA 1YTYA 3KZYA 3WE2A 3ECHA 1FZPB 5H20A 3F6OA 4BXUA 3ULQB 1R7JA 3ZN1A 2JTVA 4HW0A 1J7KA 4HX7A 1F4KA 2VC0A 4S04A 2D1VA 2Y75A 1O3QA 1QGPA 1IW7F 2EFPA 5FB2A 3DEUA 1IRGA 4LG0A 1ONVA 3VB2A 3E97A 2R7FA 4I0AA 1W7PD 4LLLA 5LHGA 2UWMA 3QPTA 3GFLA 2HTJA 1ZLKA 5CLSA 5TRDA 4R8HA 3L00A 1BIBA 3QAHA 3WTUC 4A2UA 5HDKA 4I02A 4U0YA 3VFZA 4OOIA 5DCMB 1IRFA 2Q0OA 2F5FA 2DLLA 4RGUA 1BOAA 3ZMTA 5AIPA 2BE5F 1ON2A 1MGTA 4WF2A 2FF4A 5IT9K 3KEOA 2MH2A 2QBYA 2ZKZA 5FFXA 3IRQA 1O3TA 4YIIA 5CVVA 2NRAC 4AIHA 1KYWA 1YFHA 1HW5A 3JSOA 1E2XA 2PFBA 4MEXF 3ZMZA 3M7GA 1TNSA 2PLYA 3KP6A 2XKOA 2PI0A 1W4MA 2KJCA 1KU9A 2M45A 5HDNA 1ZG5A 4UNOA 3R0JA 3TDZC 2FMLA 4JQFA 2KJBA 2GA2A
chains in the Genus database with same CATH superfamily
4WXHA 2EILH 4P5OA 4LD5A 3SDGA 3IC7A 4M9ZA 5L3GA 3Q8QB 5FPRA 1MSEC 3VOEA 2ZMEB 5DG8A 3MZ8A 4XLNF 1X3WB 1VQPI 3GMEA 2H8WA 4LH6A 2GXAA 4CICA 5DDGA 1ZQ7A 4U0WA 4HA8A 3JZIA 2V9KA 5DM7F 4YELA 5GONF 3CUQC 4DYRA 2J5OA 3GLLA 2K4BA 2JVGA 3U9SA 4DQ2A 4NUBA 4B3MH 3PSFA 3PW4A 3AL0C 4XL9A 2XGCA 2FKLA 1I50A 2W1OA 3Q2OA 3U9GA 1Y6IA 1USTA 3Q8RB 1MDMB 4UCTA 4DR5H 2KDZA 3L7WA 3HHHA 1YJ9I 1LVAA 3RZDJ 3H5RA 4LFBH 1V55H 1K78B 3HYIA 1ZK8A 2R7OA 1BNCA 2XAHA 1TL8A 1IXRC 1R1UA 4IF4A 5TJJA 4IR1A 5ERIA 4CCNA 4RB1A 3TEDA 2XAGA 3FM5A 1ZN2A 1RJQA 1SFOA 2JEJA 3HOSA 4FTHA 2JK3A 5D8KB 4UCVA 3T5HA 2CYYA 2M5WA 5H6QA 1YITI 4XR6A 3RPQA 3E6CC 4I2OA 1WI9A 2ZNZA 3GTPJ 4X6AJ 3CJQB 2W7PA 1KONA 2FNAA 2E2JJ 4DV2H 5H80A 2NYXA 4EG0A 4RUAA 5L1KA 2NAZA 4HR7A 3JTGA 4HQMA 4LF7H 3ZP5A 1JGGA 2O5RA 1O7FA 3FXJA 2CWEA 2IRFG 2O61A 3S93A 1JGSA 4HZFA 4IHXA 1MSFC 2JA8J 3HG9A 3FXQA 1ULZA 3FXLA 1R36A 2FLLA 1KJ9A 3WO1A 2OPTA 1J75A 2DCEA 2V59A 4XYMB 4BBSJ 3OMYA 4BACA 2WBMA 4AIKA 1J59A 2F48A 3BOQA 2AGOA 4GYIA 2ZB9A 2DO7A 1S7OA 1ZAOA 3CMYA 3CUOA 2CO5A 3MWEA 1IN8A 3G1OA 1J9IA 4RZRA 3J81Z 4KA4A 4ZI7F 1I3QJ 2ELJA 1T8IA 1FOXA 1S9FA 1U78A 1EJ9A 4M9UA 1B1BA 1IBKH 4QJFA 2PJRB 3LMMA 2HYFA 4A6EA 3HRMA 2CSOA 3OSPA 5KFRA 3PM1A 2NNYA 4HF2A 1MMGA 3BPXA 1ZRDA 2YS9A 1BI2A 2DYRH 1RPWA 1OPCA 2XAJA 4Q48A 1IRZA 1W5CC 3QRFF 4DL4A 2P0WA 4ZDOA 3GV5B 2R82A 5LGUA 1I7NA 4FS2A 3L2QA 3GTJA 1I27A 2FMAA 2CQYA 3T5KA 5E3MA 5C8YF 3HDDA 1U5TA 4A3CJ 2QVOA 1G3WA 1RUNA 2R7KA 2W9BB 5ICFA 2FJZA 3AG2H 3CCVI 4IHJF 1WH2A 4KFCA 3IP4B 2BY2A 2ECCA 4OAZA 2RVCA 4B3XA 3BQ0A 1FTZA 1X4PA 1UJ8A 3WU0A 1P2FA 4RGSA 4UV9A 2MD0A 2ICWG 1QZZA 3PNYA 2WE6A 1BR1A 4L18B 3RGXA 1DPUA 5IY5H 5C4XG 5F0HA 1GSAA 2JQ7A 1QO0D 3QPSA 5LFAA 1F1ZA 5M3FJ 1FWZA 3O8HA 2ASDA 2V6EA 2L4AA 2V4JC 3RIZA 3GV8B 4XLHA 2XVCA 1Y0UA 4X65H 2VIXA 2L02A 3RAXA 1RETA 4EBEA 2A68F 2EINH 5FJ8J 2YSRA 4HF1A 2GIZA 4HQ6A 3FHNA 4N4OB 1KJ8A 4QIWE 3KPHA 3WTXC 4RLQA 3OHAA 5CVUA 1MNMC 1MJBA 3HRTA 5FD5A 4RB0A 5FKKA 1ZQ3P 2OF7A 4XQFA 1ODDA 4QW8A 2NVXA 1RUOA 1R00A 2BQRA 2M4GA 2HYGD 2ME6A 1WJFA 2FOKA 4F4WA 2A5YB 4C2MA 3LAJA 1STZA 4RUCA 1WJEA 2K02A 2VB6A 1LE8B 1O57A 4PJMA 2FLNA 1Y1WJ 2IJLA 2F5EA 2AQ4A 5L3FA 1JX4A 4A5NA 3N05A 3RJPA 2BW3B 4TQRA 2A69F 5KFNA 5LYJF 3HRUA 4N4NB 3E5NA 1XNQH 4M6YA 5HODA 3DBLB 2L3DA 3K3PA 1LB2A 4M9SA 3V7SA 3G73A 3OYMA 3DCFA 1YJWI 4I99C 2YU3A 2GAUA 2O3FA 2K9LA 2UUCH 3OYEA 3VPCA 1O3SA 1VQ4I 3BR3A 1ENHA 2XPVA 4DV0H 2JEFA 1IV8A 1Y1VG 2FA5A 3KYCB 2GBYA 1VQKI 4DGWB 3U2RA 4AIDA 3OL4A 3L2WA 3K3VA 2UZKA 5KHDA 2R8JA 5CPRB 4D9JA 2QBYB 1WCMG 3GIMA 4ZC3A 3M8EA 2KLOA 4KT5C 3G1MA 1FYLA 1Y39A 4UB8C 4BXXG 3QU6A 1E3HA 1X19A 1WJCA 4HNUA 1P4AA 5KFIA 2DTRA 2IPQX 3DEWA 2COBA 4HEA2 1EYZA 4IXAA 1K83J 4HAMA 2JUGA 4MO7A 4O4IF 3K10A 4BDZA 5BR8H 1LEAA 2OTJI 1EUCB 4JV1A 2HDDA 4ENNA 4A0XA 3PO2J 1OFCX 2DA6A 2OC6A 3FK6A 3CCMI 2RQQA 2FLPA 4BE0A 4BYYA 4C9YA 2BZTA 1P9QC 1P4XA 4L9VA 5AONA 4EQQA 2W7OA 4ZTFA 2OAZA 2FSWA 2K9SA 1WZ2A 2R93G 5E18F 2RDIA 3P9CA 5HNHA 2BXYA 1WHUA 1LNWA 4ZDLA 4ZZDA 3G2BA 4N9IA 3SI8A 2R7RA 2E60A 4XLAA 1K7AA 4B3AA 2NU9B 3TQ1A 3RB3A 1QQIA 2DWCA 3ABTA 2JN6A 3TBIA 3SQNA 5GP9A 4GFBA 4ASNA 5IYDJ 1MBEA 4JI7H 4PFOA 4A3LG 3A1YA 2DA1A 3UR3C 4R8UB 1SEIA 1SEUA 1POGA 3BA8A 2W70A 5KFUA 4HPQA 4XN3A 2FB9A 2CMPA 3GTLA 5KCMA 2CS3A 3RQ4A 2IA1A 2QWWA 2VKEA 5LHIA 5FLMJ 4N0BA 2QSHX 4YAKB 4ED2A 5JLWA 2H27A 3DPTA 3MKWB 2QF7A 4BDYA 1I6UA 4PCQA 1Y1VJ 1G2HA 2KIFA 4O3QA 5ILSA 2QA4I 1GT0C 5JVLA 1TWFA 4GO1A 1D0XA 1V9PA 2DLNA 3GTQJ 2JPBA 1TQPA 2I10A 2XKPA 3KX2A 5E1XA 2W6QA 3KP4A 2Y69H 2JA2A 5C44G 2W6MA 3IL2A 4I09A 1MJAA 4IVNA 1TWCA 3JREA 4DL7A 2CQQA 2DMUA 5DCMA 1AOYA 3S14J 2R7ZG 4DIQA 2OCEA 1E4EA 4LB5A 1IBLH 4FU0A 4IOCF 3J80Z 3FMAA 5JLXA 4GRIA 2ESNA 4DZJA 3GTKJ 2B63G 1G4DA 1A6IA 3K2ZA 1J0RA 3L1PA 2C22A 3MJFA 4LITA 2NVTJ 1HC8A 4EGZA 5IYCG 2C6YA 3D0SA 5HV6A 3QOEA 4ON0A 2IGMA 2Q1ZB 4W1UA 1G3SA 5KFPA 4F7ZA 4J9SA 2XAQA 5KKNB 4WD3A 4LF9H 4L9TA 4IHWA 2HJWA 2EIMH 3ZXSA 2GLOA 4F3QA 4IRHA 4M71A 4Y15A 1S72I 4ED1A 1R1VA 4M3EA 5ILVA 1FJGH 5KFJA 2VQHA 2NVYJ 2ZXWH 2TDXA 3MEXA 1ZR4A 2R7QA 4WXCA 4ECZA 1R5HA 2A6EF 3J7YJ 3LFKA 3G3ZA 1N33H 2OD5A 1TQMA 3EDPA 1W5SA 5FKNA 3ETJA 2MD5A 4PZJA 1FJLA 2V1XA 2EFQA 2H09A 3BJ6A 1PP8F 3RFCA 3BTIA 5DLFA 5D8LB 5F1JA 4MFDA 2RN7A 2HHHH 1F36A 1Z05A 1CF7B 2HKXA 1YX5A 2QQAA 1O3RA 3VPBA 2ZXJA 1HLVA 3UQ8A 3A0BC 3I55I 1RI7A 1P92A 4HLYA 1WCMA 4EVIA 3PQJA 2KHMA 3VODA 1UG2A 4F4XA 1ZETA 2VBWA 3ZMSA 4CCOA 3KP2A 2A61A 3D5LA 5LGTA 4EJVA 3HIFA 4A3GJ 4LG3A 4AWXB 4BS9A 1BI3A 2BYVE 2R7XA 1W36C 2R87A 2DT5A 1FLIA 2AXLA 2IGNA 3MCZA 2KFDA 4UCRA 5C5JA 4F4YA 2RNGA 2YYAA 1LUJB 2I80A 2V4QA 1Z3YA 5IYBJ 3R61A 4HF0A 2OCCH 4PGHA 2R5YA 2W25A 1ZRCA 1K6OA 1WKMA 2M8EA 4UVAA 1T0FA 3L4KA 2ZMEA 3I0TA 3M9OB 1NG6A 2MA3A 3BJYA 1WJAA 3F8FA 4A3IG 4LF4H 2R93A 4DV6H 5KG4A 2L0KA 2ZFUA 3CDLA 5DS9A 3BJAA 1J5EH 2M05A 2WY8Q 3V6HA 4B43A 4BE2A 3GQCA 2K27A 4M3GA 1AA7A 5KFMA 4HSTA 3IH2A 2DJIA 1X9NA 3U21A 2HPMA 1JT6A 3F8BA 5J8CA 1C30A 3S1MJ 4PFPA 5FLXW 1OYIA 1KU3A 4QWBA 1N48A 2O7OA 3R5FA 5FO5A 2ZXIA 2W57A 5IP9G 3TDUC 4JOMA 4I76A 1K1QA 1O7LA 4FHTA 3GFIA 1TBXA 3C0FB 2DJNA 3BDDA 1K78A 3K70D 3LWFA 3S3MA 1JI8A 1ZTRA 1KJJA 4BY7G 3EQLF 3GV7B 3DWLE 4Y4RA 1IN4A 4ZZLA 4EEYA 5L3DA 4B09A 3AKZA 5J2TF 2W85A 2LSOA 5F6FA 4PSXA 3J81K 2LD5A 3MWDA 1LEBA 1Q1HA 4J9LA 2OH2A 4WK8F 1R22A 3F72A 5K7HA 1SD5A 2KZGA 5J3LA 4MQVA 4E6KG 4I7HA 3DTEA 2E34A 4OIOF 4IWXA 2M3AA 3A01A 3AG1H 2MW8A 2EK5A 2EFWA 2PMHA 3HGGA 1YYVA 2R7ZA 3FKJA 5TISC 3DTKA 2ADUA 2IA0A 1XSXA 2M7BA 1XGMA 3EYIA 2HXIA 1E0EA 2L4MA 2JA5G 2B63A 1QVUA 1BW5A 2YZNA 4BE1A 4YHHH 3E3VA 4ZJZA 1VQNI 3GFJA 2JUCA 5E1ZB 3I71A 2R7WA 3ISPA 2J9GA 4AD9A 1LFUP 1P4WA 1YQAA 3HOUG 4FE4A 3VPDA 2BY1A 1D5VA 3KALA 2IAIA 4MGRA 3OR2C 3VYRB 4BH9A 2VONA 3RF2A 4ED8A 4A3MG 4KN7X 3RGZA 3UNGC 4CSWA 2ETHA 3CQZJ 4ZYHA 4BQAA 5EYRA 3H4DA 4A0ZA 3KYLA 3K4LA 2QGUA 5GTHC 1N78A 4BXFA 5K1YA 2FXAA 3FDYA 3BG9A 1IXCA 3H9JA 3GYHX 4RZQA 1Z3XA 2CZGA 2PBZA 2DMQA 1UCRA 1RJPA 1AN7A 1XB4A 2A07F 1SANA 4KITB 4P1WA 3JRWA 3CCUI 4IR9A 1JHFA 3K4BA 5L3CA 2VJ5A 3NARA 1TP4A 1FMWA 3EPZA 2ZJQF 4IHSA 3N8DA 3H40A 1JDBB 3BJOA 1TT5B 2IT0A 3L4JA 2YX4A 1SFUA 3LA7A 2YR2A 2YCHA 4FT8A 3LSRA 3OS2A 2LK2A 2X51A 1ZHSA 3BAAA 2VQGA 4O3OA 2CFOA 3QODA 2VODA 2W9BA 1R71A 2XPUA 1Y14B 1RYRA 2K9MA 2YW2A 1XMOH 2JEGA 4CXFA 4MIMA 1SD4A 4DV1H 3W2AA 4EYHB 5EZYF 1JHHA 3K2AA 2RREA 2JA5J 1VAJA 1MBFA 1RZ4A 1ZKGA 4PUSA 5K7FA 4A3JJ 4MTEA 3JRAA 2HOAA 4UCUA 1WR2A 2CUJA 4U0VA 5CJ9A 4Q0YA 2M87A 2W9CB 2DMPA 3QOPA 2R92G 1WJBA 1JJ6C 3PFIA 3HOUJ 1S0NA 2D45A 4IOAF 1S68A 1T56A 2OU2A 2QENA 4CZZA 3PW5A 3LSKA 1X1BA 2K40A 2BQUA 4IQJA 3U1DA 1EH8A 2R8HA 2IVMA 4A12A 3GW2A 3PW0A 4CCKA 4UHTA 3C1DA 2OQRA 3LA2A 4LB6B 4DR4H 5FKOA 1TWGJ 1KC7A 3FBNB 2XGXA 2DMTA 2JEIA 3BZCA 3RKYA 2PN6A 3QFFA 3OOPA 4A3DJ 2CKZB 2VE8A 4A3BJ 1ACIA 3L2CA 1X58A 1HBXG 3I4NJ 4M72A 2HOSA 2P6SA 3DTIA 1SVOA 3FISA 4IZZA 4QSHA 3R6SA 3T5JA 2R7UA 3I4PA 2DA7A 2K5CA 1QNTA 3R0AA 3RSNA 5J4YA 3HOZJ 2FPIB 2GPSA 4A2BA 5LP6F 5AIQA 4OIPF 4DR3H 1V54H 1Y8QB 2PMUA 1Z6TA 2M8GX 1RNLA 4BJ6C 2E19A 2C28A 3DPLC 2JA6J 3PO3G 3FXMA 3K6GA 2C2EA 2EWNA 3ZQIA 4Q8FA 3CD6I 4DLKA 1SFEA 4EV0A 2CQKA 4NDLA 2GXBA 3CUQA 4YJ3F 5K5RA 1X1PA 3GTGA 2XV4S 1E17A 1KJIA 3LSGA 4KICA 2H1KA 2DT6A 4IRCA 5ICEA 1MH3A 4O3RA 4ME6A 2CW7A 4HX4A 2OWOA 2VN2A 1D1AA 2FOWA 1EZ1A 5DQHA 2AXTC 3D5SC 4XKVA 1JLLB 3TOBA 1OLTA 3KP3A 3LSIA 1I50J 2RNJA 4XLFA 2M9HA 3H5NA 2QUFA 1AUXA 2CFXA 2Q2TA 5J47A 2Y9ZA 5KG3A 4DR1H 1GHCA 4TV8F 3BZKA 5EF6A 1BJTA 2CQ7A 2OLSA 4A3KG 2BY0A 5D4SA 4G94A 5KFLA 2E2HA 4WXDA 4LJZF 5GAGJ 3KXYT 4YFXF 1OJLA 1R58A 4DZPA 2RF4A 3QYFA 4BY1G 2LKPA 4MTDA 3G71I 3ORQA 3JSNA 2L7ZA 3ZQCA 4IAJA 3BQYA 4D1QA 3MR5A 1GDTA 4XLEA 5K7ZA 3EUKL 3VPRA 3F8NA 1SFOJ 4L0YB 2VQCA 2A05A 4J19A 4M6VA 3Q9VA 4BQQA 3AG4H 2R7SA 1B04A 5FROA 4Y17A 3J80K 1WGXA 4ZYEA 3DXJF 2DFHA 1OISA 3CCYA 3HTSB 2V7FA 1XGOA 1FTTA 4I4TF 3Q8PB 2W8LA 4EGYA 2RDPA 2W84A 1YRNB 5KAIC 3WTSC 1G3YA 2AGPA 2G0EA 2V9WA 4MFEA 4EJTA 2XHKA 1BOBA 1E3OC 3JRIA 1WH7A 1FPQA 3WHCA 2EV0A 2MC3A 2LBFB 3C2GA 1YJNI 4KUMA 3EPGA 2VOOA 1B6AA 4R8UA 2R5YB 2X1DA 3ZMVA 3CCQI 4M73A 2HFHA 3DF8A 2K3PA 1Z91A 1GLVA 4LF5H 1BI0A 2DQRA 2IGOA 2LFBA 2KQRA 1DGRM 3LSMA 2LOOA 4KIGA 5CVIA 2HI3A 1UFMA 3ZQFA 3OUUA 2R8KA 4ECYA 2R7TA 2X0LA 4LLGF 3OYCA 2CUFA 3WGIA 1OCZH 1OWTA 3WTVC 2R92A 4XSZF 4EGQA 3JCUC 3OIOA 4KNYA 4O2BF 1N77A 3OR1C 4NB5A 2WB1E 3ASNH 3GIJA 4CA0A 5C3EJ 3V8LA 1X4OA 2K9NA 3PQKA 1H9TA 5LMNH 5HLTA 3GXOA 3E6DA 1XTAA 3CO7C 3AYHB 5KX5F 1DQUA 1NK3P 5DV5A 2GLTA 3RQIA 3BTJA 3S2HJ 4XZ3B 4ED0A 5D1PA 1ZGAA 1R9TA 2R8IA 4B3TH 3GILA 3WG7H 2W7NA 2KPMA 5HVQC 2ESHA 2X85A 1R4MB 4JYKA 2K9QA 5HS7A 3TKYA 4UUSB 2V26A 4OX9H 3A4CA 4BBRJ 3I9V2 3MVPA 1MZBA 4Y3OA 5T14A 1I5ZA 2R84A 4ZYAA 3RKWA 1GXQA 2IP4A 3BR5A 3GTJJ 4RM2A 3M1CA 4UXNA 4ANJA 2HKOA 4IQ4A 3SYTA 1F5TA 5CYVA 3HJEA 5KT7A 5KFVA 3ZQGA 4EM0B 1ON1A 2W00A 1NTCA 2Q2EB 3GFMA 4M74A 4BKXA 5EEAA 3A01B 2ZM6H 4TV7A 4E4HA 3BG3A 2X9DA 5ICCA 1WI3A 2MABA 5EJCA 4TQSA 1VFCA 2NS8A 4L9NA 3W6VA 3S2WA 5H6RA 2Z1DA 2XGDA 3GTOA 2FEZA 1RESA 2DTZA 4XORA 3OIQA 3FMRA 5ILUA 1R5GA 5F0CA 2DYSH 2E1MB 2P5KA 3HGYA 3K7AJ 4UCOA 1U3EM 2E1NA 3GO5A 5D8DA 3MN2A 2NNNA 5DCFA 3HOTA 2LRDA 5KAFC 2G7HA 1VBHA 2C2DA 5HDGA 4YIFA 4AC0A 1BW6A 3IH3A 5B5EC 3QYBA 5M5XJ 1CF7A 2J6SA 1P8LA 4DR7H 1KU7A 5FLXK 3QP6A 3OSGA 1KQ9A 2CQXA 4RAZA 4E7LA 3HOYG 2VLAA 4CGZA 5BOXA 3R5XA 3J81W 2WAQE 4S0HB 2JA7G 1Y0NA 5D5XB 3TQTA 1OYYA 1R1TA 2OUMA 2N8GA 4Q5SF 4OINF 2ID3A 1XN7A 3FMQA 2ID6A 3KP5A 2FQ3A 2NVXJ 2ZDHA 4F4ZA 3PW2A 3W6KB 3GBGA 1U9NA 2O9LA 4X62H 1ZYRF 4OMYA 3A02A 3GLXA 4C2MJ 2UXDH 1L3LA 2NS7A 2FUG2 4Q44A 3CCEI 1DV2A 5GAHJ 5GAEJ 3WE3A 1QZEA 2K85A 1IN7A 3JAMZ 3DF7A 4MQ9F 3O3KA 3VYTB 5FLVA 2ZJTA 4GKKH 2VUMA 4DL6A 1WQ2A 4IRDA 2IMWP 2NS0A 4XOTA 4IRIA 4XRFA 3U9TA 1XSDA 2WTEA 4XRMA 3T8RA 4DNCA 4ECVA 2IGKA 4BHCA 5KG7A 4APMA 5H2FC 3T1HH 1QPMA 4AVPA 4DR6H 3O6BB 2LREA 2J5PA 4YIRX 4B4CA 1T39A 1YS6A 5D5WB 3WTTC 3PSIA 1JXSA 4L5JA 4CZCA 3RDIA 4D7NA 4QWQA 5KNLA 3GCMA 5E3OA 2A6TA 1SMYF 2GWRA 5L3BA 4AYBE 2HTSA 3E7LA 4HYEA 4I98B 3CZ6A 4RB3C 2NU7B 2EZKA 2V9VA 3Q0UA 2CU7A 4GKJH 2CQNA 2NXNB 3GZNB 4NXNH 4Q45A 1XDSA 1C3OA 1MBKA 1I3AA 1M1EB 1U8RA 5I47A 2P7CB 1KBLA 2IEKA 3K4MA 1IJWC 3RJ0A 2E2IA 1TLHB 2EFOA 2WA0A 4CCMA 5BQTA 4NQWB 1PP7U 2LKXA 3CTAA 4II2A 5HOOA 3K5HA 4XSXF 2PMZN 2QZ8A 3F6VA 3OYDA 1QBJA 4M3DA 4GXOA 3G8CA 1S03G 3NGDA 1APLC 2FRHA 2P5VA 3W6JB 3K1PA 1HF0A 2UVVA 1I6XA 1V4YA 5KT3A 2Y0SA 3HSEA 1RC9A 5F04A 1T94A 3ZQHA 4IRGA 4O3SA 1NHAA 1RIOH 1GLNA 4ITVA 4FS1A 4V2FA 1ZH5A 1WPKA 1BR2A 3Q9SA 3ZR8X 1PJRA 3WGGA 3KEYA 1Z67A 5D1OA 1TWAA 3CUQB 3GTLJ 5FFZA 1ETOA 1W5TA 4L5IA 3PNTA 3Q3SA 1B9NA 2IW5A 5EWGA 3AL0B 2Y48A 4KIFA 4L5EA 4DL5A 2DN0A 1OCCH 4HBLA 4BGDA 4KT6A 4TV9F 4H4KC 1WSUA 2LP0A 2HQNA 3BG5A 5EG0A 3KAKA 4BUPA 3HOVG 1F9NA 2B0LA 2DMNA 4C2TA 3LSTA 4AUXA 4KIBA 4EJWA 5C4XJ 1TWFJ 1CS0A 3B02A 4M9XA 3JSPA 3LQQA 5F0FA 3W3CA 2ISYA 4O3PA 2Y9YA 4IL6C 2QQBA 3TW6A 2IP2A 2ATLA 2YS7A 1GVJA 1BM9A 3S2DJ 3PR5B 3LWBA 1WRJA 1HSJA 1TWCJ 1Z21A 2L01A 3RYRA 4JV5H 2MCTA 3I54A 3VMMA 2R7VA 3RPUA 1U5TC 5ED4A 4ECWA 4P9UA 3S3OA 3H36A 4ECXA 1L0OC 2LVSA 5J4VA 4E70A 2O0YA 5IT3A 2BR0A 2JA7A 2DT7B 1NH3A 1ETQA 2RV8A 2WYOA 4J9KA 3FXKA 3IUOA 5D6FA 1HQCA 2P6TA 4ZYDA 5CB4F 3KHGA 1RK6A 4JYAH 1BR4A 2LMDA 2XCPA 2DFIA 3OV8A 4OMZA 1FX7A 2CV0A 1HA8A 1V3FA 1OYWA 1XDUA 1VZ0A 2E71A 3C18A 4XICA 2WB1N 1LFPA 3OYIA 2V4RA 4J0MA 5A2QZ 5LOVF 4O6JA 3RTRA 5JFRA 1OCOH 1Z1DA 3V7CA 5GADJ 2ZBKA 3AG3H 2MSYA 2W9CA 2Y30A 2V79A 1IO2A 1H9GA 3ASOH 2L2OA 3K1MA 2STTA 2VC1A 1CQJB 2ECBA 1M0TA 2VJJA 1M6VA 4JX4A 2OZUA 3MZYA 2Q8KA 4F91B 2DI3A 1OR7C 1DPRA 3CCRI 1KQ8A 2MGQA 1MD0A 3BG7A 1PX2A 3G1LA 4BEHA 2I87A 1VKZA 2LY2A 2GA2A 5KFAA 1RYSA 2E7XA 4ABZA 3PNVA 1BXRA 5DEQA 4GDFA 2ZNYA 5M5WJ 4Y8VB 4YEJA 1W96A 1X1CA 3M4IA 4MV9A 1Z2PX 2BBYA 3I58A 1QHHD 3ABLH 2F5DA 2JWTA 5JVGF 4A3EG 1SFKA 1X3UA 3FWEA 3G6YA 1EH6A 1N25A 1ORKA 1WCMJ 1S10A 2PEXA 2EA4A 3WU1B 1Z2OX 2YS6A 4ECRA 2XB5A 4L0ZB 4JI0H 2V6CA 1UC8A 3LSHA 3OTOH 4LSXA 1AKHA 4BXXJ 5IT9Z 3S8PA 5IPAA 3IWFA 5KFGA 1MNEA 2UV1A 2DXIA 3VSLA 3JRFA 4E7JA 4DBQA 3RPUD 3J80W 1BI1A 1UHSA 3F8MA 1WSCA 2V58A 4LSAA 3MR6A 1AU7A 3MD2A 1DDNA 1ZGJA 2DOEA 4QWDA 4DL2A 3BA9A 2BQ3A 4A6DA 3OYLA 2DK8A 4UUTA 4RLFA 1VI0A 4RGRA 4OU0A 1QPIA 1GO3E 3EPIA 2YRWA 4DYCA 5HNFA 5F9LA 4PDKA 1UHMA 1LPQA 2R93J 1X1AA 1D1CA 1IOVA 3DBRB 3KFWX 2I8DA 4ENKA 1IV6A 2ZSHB 3B73A 1T36A 3OYHA 3M9AA 3V42A 4Q43A 1ZLJA 2HPIA 3RIRA 1DU0A 4A93G 2WADA 3ABMH 3E0JB 3NWSA 1YI2I 2VA3A 3N43B 3NEUA 3N42B 5D5UB 4G8XA 4XMYA 2ACJA 3M9MB 1T08B 3HEFA 2VPRA 3F8CA 4G9YA 4D0PA 1PUEE 1B4AA 4O5VA 1MH4A 2IS6A 4A3LJ 4XRSG 2R5ZA 1X2NA 3S17J 4H0EA 3WO0A 2L7MP 1QU3A 1SCUB 2A3SA 3BQ2A 2NOJB 3BT9A 5JQWA 5IP6A 1A04A 3KETA 3HHGA 2ZJ2A 3BABA 2LF8A 1TNTA 1A31A 5JR3A 3TL4X 2KRHA 1VF9A 3ZCOA 3FMSA 4HRIA 2XF6A 5IOYA 3BPVA 1N56A 4B47A 4Y13A 3HKZE 2D2WA 2DA2A 2VJIA 3ORRA 1B6RA 5DQIA 1BC8C 5KFOA 1ETWA 2LF7A 4EATA 2E1CA 1KU2A 1X2MA 4CCJA 2O8XA 5C44J 4MA5A 3FKIG 1IDYA 2VOPA 4ETSA 3RBEA 2HS5A 1D0YA 1YRNA 1KA8A 4YR2A 5EEGA 2X48A 2R7ZJ 2XCLA 4LGWA 2WV1A 2NOGA 2M1BA 1PUFB 3EUAA 2W6PA 1PVEA 2LBFA 1HCRA 1J5YA 2B63J 2FP4B 2YRXA 4AYBN 1ETVA 5IWAH 4XIDA 2IS4A 2W8KA 1K4SA 3K9TA 1M7JA 1JIHA 2UUBH 1ETXA 3DU5A 3L9FA 1IF1A 1SD6A 5IYCJ 3H3ZA 1JKQC 3DKYA 2W71A 1KQ0A 3ABKH 2NUAB 2R86A 3V8JA 4YG2F 5DQGA 4QIWN 1UHWA 3MKZA 1EF4A 2CUEA 4J9PA 1IGNA 4II3A 3H1CA 3K4KA 2XF7A 5DD4A 3H3VH 2IBKA 4A93J 2L5QA 1JKRC 3Q0VA 4ECSA 3CF5F 2XGEA 1IBMH 4BHBA 3OHBA 2FU4A 4FE7A 3C7JA 5K5QA 2ZDQA 5FPOA 3HUGA 5KT5A 2PG4A 4DV5H 3MQ0A 5JI6A 3MFHA 2QSGX 2QYZA 1GV2A 1U2WA 4G6TB 2IS1A 1QZYA 4G6DA 2DQLA 4J9QA 3MFIA 4YP3A 3FM3A 3HM5A 2GZWA 1H8AC 5F1RA 3QQAA 1XG1A 3GVAA 1LFBA 2EFNA 4MV8A 3HOXG 3F22A 4A3FG 4JX6A 3WG9A 2UVRA 1DGWY 6PAXA 3ZOBA 3X2QH 4UUSA 3TIIA 3RBDA 4CH7A 3KHHA 2VQEH 3KLNA 2L9NA 2IS2A 1VBGA 1EH7A 2F5CA 3CCJI 2HEOA 2VPQA 1A36A 1LKXA 1RKWA 1CQTA 2VA2A 1IRXA 1FYMA 1Z9CA 3GTMA 1T98A 1MNDA 2Q2EA 4IHTA 2F4OB 3JR9A 1D3YA 4LFCH 2D5VA 2OV7A 2FBKA 4A69C 2R4GA 4AQYH 4EBCA 2V1DA 5DUIA 1MW7A 1F43A 3KIOA 4EGJA 3F3XA 3BCAA 3AAFA 2C00A 4NLGA 3WGHA 1D5YA 1ZG1A 3N41B 2AGQA 1BIAA 1A0IA 4JK1X 1FSHA 4MA0A 5JH7F 2PJPA 1FNNA 1FP1D 3CLOA 3KEQA 3UKGA 2HOTA 4NHJA 2P0AA 3K70C 1FIAA 2PN1A 2EA2A 2KKOA 4A3IJ 2JJ7A 1FOYA 1XPXA 1VQOI 4RU9A 2ZCWA 4D5CA 5FKLA 2IA2A 1I6HJ 5DYMA 3H0GA 5KFEA 1MMAA 2BGCA 1TT0A 1EKEA 1WFXA 5JVTA 3PVXA 1V5EA 5D1OB 2LYCA 3BROA 2OBPA 4UY8I 1BA5A 2AO9A 2DDBA 5BMZA 3L2VA 2DA5A 3TW7A 3Q8SB 4ED7A 5DGAA 4AVZA 2PMZA 2KIUA 2ZJPF 4XRSA 2XAFA 5TGTA 3WODF 2P7VB 3PL8A 3JRHA 1R23A 5EG0B 1KGSA 4UVCA 5IP9J 5KG2A 2W6OA 1V5GA 2GPWA 4QPOA 4RNOA 1W7PA 2VOBA 5BS6A 3QZ8A 2QEXI 4BY7J 1BJAA 1CQIB 4U87A 4RA2A 4HV6A 3FDSA 5GPCA 5LD2C 1SD7A 1RJRA 2CUZA 4KMUX 1KEEA 4FX0A 3BR1A 4BWSC 1J09A 3OYJA 1T0FC 1LQ1A 1ETYA 2ZMEC 1T2KA 3WTYC 2BHYA 1OMIA 2COMA 3PZPA 1AUVA 2J6UA 3CC7I 3B6CA 3GF2A 3H9GA 2KP6A 5KFWA 3BTCA 4ESBA 3FKIA 1XNRH 4DJAA 3ML6A 2OTLI 4ESFA 5FD6A 3FIWA 2QLZA 3DPUA 4LMYA 1H0MA 1TWHA 4ECQA 4XNFA 4IKFA 2M2EA 2HXOA 3GTGJ 2XUBA 5EWFA 1OKRA 3LFUA 1GYFA 4BQOA 2A5WA 3T8TA 2QM3A 1MKMA 4KMFA 2HVSA 3Q1KA 3N4MA 2HQ5A 1A6QA 3FXRA 1G3TA 4P96A 3WNZA 1ULYA 4EFEA 1V51A 3VEPA 2FBHA 3CMMA 2OZ6A 4V19K 3TIGA 3HPGA 2V1NA 4A3MJ 2H6CA 4I6ZA 2XGPA 4UVBA 4BEHB 3S1RJ 2E2HJ 4J9NA 4BAYA 3GIQA 1HDDC 4IHVA 3P7NA 3H5AA 1JKJB 2WB1A 4OIQF 5HS8A 5DD8A 3DEEA 2RDJA 2E7WA 4M7EA 2LY9A 1SMTA 3E5UA 3U1KA 3K5IA 2L7KA 4NQWA 4I0BA 1WWXA 3L09A 4YJ2F 4V2GA 4U6PA 3EUHA 2EH3A 3NAUA 3DQVC 3KZZA 5DTDA 1GSOA 5LLQA 2HOEA 2RAEA 1AKHB 4MHGA 2LH9A 3GEZA 2F6CA 3KP7A 4CYCA 4D5FA 2VPSA 1ZG3A 4FBTA 4JBAA 1E4FT 1JJ8C 5EOYA 2QK4A 1W0UA 1ZELA 2YZMA 4JI2H 4B44A 3RV3A 1IN6A 2VKVA 1UB9A 5LEJA 5A2QK 3SJMA 1XSVA 1YS7A 5BPIA 3HKZN 3ABUA 5HLIA 2EJRA 1A9XA 3HRSA 4G6QA 4HX8A 4EYIB 1XC5A 2RGRA 1JUSA 3QP5A 4N9HA 4OAYA 5KK1A 3KHRA 2FJ1A 1UNNC 3K1NA 4IRKA 2UUAH 3KLOA 2VT2A 4LFUA 4ZDPA 2R92J 3IWZA 4E7HA 3QYEA 4MV6A 4HDUA 3I53A 5J6XA 5JHFA 2V9PA 4Q4ZF 3EYYA 4Z6YA 1SC7A 2R5ZB 1H89C 3F23A 3ESWB 1IUYA 2V5AA 4HOBA 2YU9A 1TTYA 5DG7A 3P5JA 2HWVA 2EQRA 3BG6A 3EETA 5M3MJ 5E17F 1S7AA 1RKTA 3FX3A 2HR3A 1R9TJ 3H3VK 4P55A 4DOZA 4J9RA 2CW8A 1REPC 3JTHA 3QWLA 1XGNA 2DIKA 3I56I 2X1CA 1J2XA 3ETHA 3TO9A 4E7IA 4R79A 2ZO4A 1U6GA 1ZHQA 2DFFA 3K4CA 1SVLA 3I4MG 2I8CA 2VUMG 1O75A 3DP7A 4XLPF 2O03A 2EV6A 2GM4A 5EGOB 1DU6A 5KT2A 1P6RA 3OL3A 2KRFA 4ED6A 2NU6B 4PGGA 3T5LA 5CVRA 2E5NA 1E3PA 3GZ5A 4Z2YA 2FK2A 2FX0A 2GIVA 1SAUA 5KT6A 2BHZA 1SAXA 4X1EA 3PO3J 5CA1F 3V4SA 3BQ1A 2R0QC 4B3SH 2EB7A 2LDUA 3GTOJ 2HQAA 2RKHA 2DK5A 2E5ZA 5D5VB 3S1QJ 3OSFA 4BJ5C 5LA6F 3TO7A 4QWCA 3LSPA 2WDTA 2X6YA 4YBZB 3H35A 2XF5A 3KCCA 2R3SA 4J9MA 1YG2A 2MYSA 3AFHA 1DP3A 1WVRA 3E1SA 4NBQA 5F08A 4HSRA 4B48A 5HLHA 1FOWA 2XD4A 3JW4A 4PJLA 2VASA 3O2PE 1YIJI 2LG4A 4UCSA 1YW7A 4U7DA 3S1NJ 5KFYA 1GUUA 2YL2A 3HUGB 4YFKF 3RB6A 3IRRA 1FP2A 3M3YJ 1BJZA 2VQDA 5LL6b 1IG7A 4IJAA 4LIUA 2BVLA 1YW8A 1R49A 2GA1A 2VE9A 3F9KA 4A3KJ 3FXOA 4XM3A 3N40P 3R23A 3RB4A 1C0WA 2XRNA 2JA8G 3CJNA 4PJJA 1VQ8I 2VT3A 4XKBA 2VKHA 3TP0A 2MLGA 3QU3A 1XCVA 3Q0WA 2GOMA 1S97A 2VBXA 1K6YA 4BY1J 4QIWA 4PJNA 1K79A 1XMQH 4BBSG 1OCRH 3IV5A 2KIMA 3GZ6A 1DV1A 5DG9A 4DV4H 2ALZA 2EPFA 2HQRA 2AHQA 2EIKH 3H92A 1UC9A 4F93B 3I4MJ 4CO8A 2JPCA 1D0ZA 4J01A 2B9SA 2VUMJ 2NVUB 3KYDB 2CV1A 4FBUA 1HKQA 1Z7UA 1IOWA 4RGXA 1OQYA 2P4WA 4ENMA 2DPUA 4A2AA 4AM3A 1YHQI 4U88A 2L9SA 2XCAA 1ITYA 5FKMA 3C2BA 4ZH4F 4I50F 3LQRA 4JP0A 3IN5A 2BOLA 5CAEB 5E3NA 2OJED 1S0OA 1XMKA 3WTZA 4EJUA 2LTPA 1GV5A 1HNZH 2UXNA 4EEQA 2XC7A 2LKSA 1IDZA 3LNQA 2CW0F 4NC7A 1HXDA 1M0WA 3MAJA 4A3CG 4P9FA 4DV3H 2QKMB 3H0DA 1MIJA 1HNXH 5KFZA 3FZVA 2UVWA 1MBGA 4QLCU 2R8GA 4C5AA 3VDXA 3DKWA 1XMAA 1NK2P 1RR7A 3BZ6A 2GQQA 1NG7A 4B8XA 4WCGA 2UXXA 3BR0A 3V6JA 3QPLA 3LAPA 1DIKA 5KT4A 5JHUA 1B8IB 2E2IJ 1MJ9A 1S6LA 4JI8H 4R7RA 1OCPA 1W7PB 2DODA 1PUFA 4DUZH 4C3HJ 2Z5UA 1W0TA 5J1UA 3SXYA 4WBNF 3JAMW 1SFXA 4NXMH 4CDGA 3BP8A 2E1OA 1X1DA 1ERDA 1XX5A 5FJ8G 1B9MA 3HBLA 1P7IA 2EV5A 3FF5A 4I01A 3I64A 2WWYA 4UUVA 2KRCA 2VI6A 1DGSA 3CDHA 4D7MA 4XLCA 3TINA 2QQ8A 1JKPC 2E35A 5B1BH 3VYSB 3BQZA 3OYBA 4TUYF 3MR2A 4X64H 2Y31A 1TWAJ 4BL0B 2CGPA 4KDPA 4Q8EA 2BEOA 4RAYA 3T1YH 1IZ1A 1JUPA 5E20A 1VS0A 2R6FA 5HS9A 3ZRGA 5B3SH 2KMUA 2MC4A 1CGPA 3OUZA 2XB0X 2YX7A 5LGNA 2H94A 3ERED 1JKOC 2DOFA 3DBHB 3B6AA 2HDCA 5K2MA 3RB0A 1QVTA 1Y1WG 3JRDA 3SFZA 1IC8A 1TC3C 2C35B 1VQMI 2MH9A 3BR6A 3NQOA 1KJQA 2K4JA 2FQ4A 3C2HA 4IWYA 1MMNA 1JDEA 4DBRA 4C30A 1FOKA 3F21A 4MEYF 4U7CA 2FPGB 5HLGA 4IEJA 2K7LA 2W9AA 1G8XA 3V4GA 1G6NA 1YE9A 4PJ0C 4EMSA 3REOA 5KFSA 2AQEA 4G3IA 3GX4X 3GTPA 4HG2A 3HOYJ 3LMLA 4LG0B 1TW2A 3JRGA 3PR4A 3CLQA 2DU9A 2JA7J 3E5XA 4L9JA 1HNWH 1X3ZB 2UXBH 3TO6A 1R6RA 2HGCA 3CCLI 3ZQQA 4HYKA 1BN5A 2DFEA 2R7LA 5C1OA 4RB2C 5LHHA 2Z16A 3R4KA 3M9NB 2WY7Q 3BTLA 3WU2C 1UELB 1YIOA 3LL7A 4E7ZA 4XOPA 4WX9A 2XROA 1OR7A 1VQ7I 1KZHA 4C5CA 3RKXA 4LIVA 5LBQA 5KFCA 1FSEA 4U7BA 4GC6A 1FY7A 2ME0A 1LDJA 1R4NB 2PX9A 3COAC 2H8RA 4CYCB 1V4RA 5L1JA 4XX0B 4LK0F 3FXUA 1MBJA 4QTRA 4MV3A 3I59A 2FK1A 5C1PA 1DUXC 3V6KA 1I3QA 3PO2G 4S05A 3A0HC 2O6GE 4GYGA 2WAFA 3OYKA 2AS5F 4DV7H 2QYOA 3MZHA 2IBDA 4XN0A 2ZFWA 2XSDC 2R7MA 3P9IA 5DLGA 4UV8A 2DOAA 1YOVB 1T38A 1OCTC 2DPJA 2DZDA 1A5JA 1GXPA 1UMQA 2FK3A 4EFBA 3J7AY 1QHGA 3MWMA 4F55A 2DPDA 4HDVA 4MV7A 4DW6A 4K2EA 2W6NA 4JV2A 3ROUA 4RS8A 5IYDG 5JVDF 3BWGA 1S29A 3WTWC 1B72B 1AHDP 2ASLA 3CC4I 4KYWA 2NU8B 4NC8A 4XK4A 3L2RA 3CCSI 4LF8H 4GCVA 3ZMUA 4CC6A 3HC7A 2STWA 3KHLA 3HKZA 3G6VA 2CV2A 5FLMG 3BY6A 3I5UA 2VBYA 4BNCA 1ZHFA 4WWCA 3IHUA 1YO5C 1AWCA 5DUKA 4ESJA 2M4KA 1N36H 3IKVA 4QW9A 2JRMA 1IN5A 2KT0A 2FMYA 3ECOA 1ZREA 1VQ5I 4JI3H 1HSTA 1BC7C 2A6HF 5A2QW 4A5MA 4BHPA 1K1SA 3V7RA 2FE3A 4HNVA 3M4OJ 4GGGA 4I55F 4MNUA 3IKTA 1FKAH 2VBZA 3HOWG 1B6SA 1S7EA 2QCOA 2VXDA 2AQFA 2BY3A 3C3WA 5GPAA 2HZTA 4GC7A 1YLFA 2K86A 5L1LA 1HKSA 4O3MA 1IXSB 1ZR2A 1PYVA 2XASA 4XBFA 1GGOA 2XGQA 4RAGA 3SHFA 4YB8B 3QZ7A 1HR0H 3DU6A 4C3JJ 4C2UA 4EEFG 2UUZA 4NNJA 4MLOA 1BBYA 2ELHA 1Y1WA 5J2UF 1FC3A 3GUDA 3MMYB 3HOVJ 4RDUA 1D8KA 1RK5A 2MLKA 2V1UA 5DGBA 4DUYH 3HTUA 4DL3A 2IA6A 2ZSIB 3SZPA 1FEXA 2M0CA 3MR3A 1FBQA 4YR3A 1Y8RB 5IT9W 5F64A 4CYDA 2JRTA 1A35A 4W97A 3NRVA 2X6OA 3PUFA 1TZLA 3SDBA 2O8KA 3JSLA 5KG6A 1XD7A 1S9HA 2X6XA 2QQ9A 4FETA 2K3FA 4E4TA 2F4VH 4FISA 5ICGA 3SZTA 1Z6RA 2LNBA 3ZMDA 3ZQ7A 3HL2A 3M8FA 3M8JA 2HVRA 3H4BA 1LDDA 3J7AK 3ELKA 2HU9A 1ZARA 3BLYA 4Y33A 2I5UA 1TAEA 3DLAA 1S8NA 2JSPA 3L2UA 3H20A 2AU0A 2Y0MA 3SZGA 1I39A 3TMOA 3FHZA 1EUDB 2P8TA 2RGVA 3UFXB 2XIGA 3TOAA 3OYFA 4G7HF 3CP2A 2EZHA 1DP7P 4A3GG 3RAQA 3Q5FA 1CE8A 2WAQN 2W4SA 4G7OF 1E4GT 4MV4A 1N34H 3H0GG 1TQIA 1T6SA 3LA3A 2W6ZA 5BPDA 3I3LA 3N97A 4LH7A 4R1HA 4BJTA 1K83A 3HOWJ 2XDVA 2F2EA 2ZXHA 3IAM2 4ENJA 5FRMA 3CDIA 3E6BA 2TCTA 1B59A 4PSWA 3MFKA 4A0YA 3HB9A 5IYBG 4M3BA 3T0YA 4LLNA 2M30A 5LRRA 2Y0SE 2MBFA 3D5RC 2G7UA 1R5ID 4JV0A 3E6MA 3M07A 3O8GA 5KFKA 2ISZA 5KFFA 2F4MB 3ZN0A 2ELKA 2TRTA 5IOZA 3OY9A 2YPRA 4YFNF 2SCUB 2C2RA 3MKLA 3OWTA 1S5LC 2L54A 1Z2NX 2WC2A 4X0GA 2JVHA 5DM6F 2HGSA 5E8GA 4A3EJ 2VXZA 1W36D 5FRNA 1XDNA 4M3FA 1K4TA 1PDNC 2R85A 1EA3A 4OIRF 3E5QA 3MKYB 4UFZA 2R7DA 5B66C 1D8JA 2WV0A 5JUMA 5EGOA 3GTMJ 3OS0A 5KG0A 1W93A 4YR0A 4J9OA 3T5XA 1I1GA 2IXSA 1VTNC 1JE8A 1UAAA 2UXCH 2GOXB 4J00A 2ZJRF 1U9OA 4CCLA 3DFGA 3IH4A 2DA4A 4QPQA 4YQWA 4MAMA 3BC8A 4KJZA 3KAJA 4G7ZF 1XMXA 1Y1VA 4JI1H 4LF6H 4ZTJA 3N6XA 4M6XA 4XKWA 3A2KA 2F4IA 1VQLI 5KVRA 1N32H 1U0JA 2H1LA 2F5VA 3SFIA 1T95A 2GXGA 3GTQA 3BCBA 3K4NA 4F52A 9ANTA 1MMDA 5K5OA 2DAOA 5EEHA 4KN4X 4BQNA 4QWEA 3H0GJ 3K0LA 2NVQJ 3SEQA 1FT9A 3PFYA 3OIPA 3CO6C 1WJDA 1HKTA 1USSA 5BPFA 2JSCA 5D6EA 2LR8A 3K69A 2WTFA 3GTKA 3KZIC 2JZYA 3I12A 2Z99A 2OA4A 2ZC2A 2DBBA 3HSRA 2Z2SB 2DPIA 5BPHA 4KHPH 3H9QA 2FD5A 4X66H 2D1HA 2VR1A 3CJTB 4PDBA 1W1WE 3W2WA 1XCBA 4UB6C 1FBUA 4G12A 3SEZA 3HSFA 3TQNA 1U5TB 3RI4A 3H3UA 5KFHA 3W2VA 3RZOJ 3OYAA 2LY1A 4JX5A 1ETKA 2RC4A 1KYZA 5L3EA 2PVPA 1MBHA 2PBIA 5GTIC 3CVZA 4RAFA 4FX4A 3S15J 4ECUA 2NVYA 1UZCA 3OSNA 2Z33A 1P7JA 2VPLA 4ZYGA 4C5BA 1D1BA 1MDMA 1SVMA 2OQGA 5D4RA 5FLXZ 3FKIJ 4RMNA 4KISA 1HW1A 2DW4A 5LEKA 3N44B 4DR2H 5J8FA 2DA3A 1LVKA 2CG4A 4PWQA 1TWHJ 2W24A 3M1EA 2P5LC 3JAMK 5E8IA 3DV8A 5E3LA 3RKQA 1GVDA 4HNTA 3P9KA 3GIDA 4IX7A 1JXLA 2Q2UA 4FQGA 3VWBA 1LDKB 4LK1F 3FBIB 1XGSA 5LRSA 4RNMA 5E1WA 1VQ6I 3GIPA 3R60A 5KFXA 5EWEA 5BNGA 2MG4A 1IAWA 1JTYA 2HNHA 3NWTA 1N75A 4K0KH 5KFDA 1WJ5A 3KE2A 1JT0A 4F50A 1WH5A 5E79C 3GWZA 2P81A 3I59B 4O3NA 1EV7A 2E36A 2G9WA 3CMEI 3R5HA 2RQPA 4AIJA 3LOCA 2FNPA 1TW3A 2FBIA 1B33N 2XRLA 5FGMA 1U8BA 2XPWA 1FYKA 1QRYA 2FPPB 4A3JG 1JUMA 4Q47A 4EM2A 3LP8A 5KG1A 2X4HA 2LC2A 4RM3A 3ZGKA 3QPHA 3DLLF 1B8IA 4CHUA 3ZQLA 3WHBA 2XC9A 2EBIA 2JT1A 4IPAA 4XONA 2BV6A 2EZLA 1FBSA 1TA8A 1FMVA 4O2AF 3OOUA 2X6WA 3HOXJ 2M34A 1L2ZA 3J7AO 4HQEA 4A3FJ 1Z7LA 1O4XA 3JRBA 2PQ8A 3RYPA 2M7AA 4HV5A 1I1SA 1S0MA 1G59A 1HW2A 2Z9OA 3F0CA 3S3NA 2Y2ZA 2HZDA 3V8KA 4EJOA 2EIJH 4L1KA 1ZRFA 4ZQIA 4HLXA 1S3JA 3A03A 2CH0A 3TGNA 3V4ZA 2Z3YA 2E5LH 2YZGA 3T1BA 1YW9A 3HZJA 4E7KA 1LJ9A 5IYZF 3GIKA 4EM1A 2H6BA 4YAJB 3ZPLA 1QA6A 2QSFX 5CVJA 3PN1A 5HBRB 2ZDGA 1YTYA 3KZYA 2PJRA 3WE2A 4A3DG 1Y56A 4EBDA 3ECHA 3PW7A 4A3BG 1HOMA 4YY3H 3I4NG 5IP7G 4B3RH 1FZPB 5H20A 2KIQA 3G6EI 3F6OA 5CKTA 1HDPA 1JTXA 4BXUA 3ULQB 4E7SA 2LLKA 5EZHA 1R7JA 3ZN1A 2KDOA 5KFBA 3HOZG 2JTVA 4HW0A 1J7KA 3IAS2 4HX7A 1F4KA 2VC0A 5F9NA 4S04A 2R7NA 4Y7NJ 2D1VA 4FM9A 3TP3A 3RUPA 3GIIA 2Y75A 2UVUA 2JA6G 3CF2A 3OYNA 3DKXA 1O3QA 1QGPA 2YU9J 1IW7F 2EFPA 3HPHA 5FB2A 3DEUA 1BL0A 1YX3A 1IRGA 5KG5A 4LG0A 1ONVA 2XAUA 2B7EA 2YUSA 3VB2A 3E97A 3PJRA 2R7FA 3JRCA 3L2PA 4QWAA 3JRXA 2UU9H 3S16J 5EDWA 3RTXA 4I0AA 1EHIA 2X1EA 1W7PD 3FK7A 5CQEA 4LLLA 5L1IA 4C3IJ 4IO9F 5CA0F 2HYJA 5LHGA 5J1YA 1XS9A 3CC2I 4Y52J 2KISA 2X0SA 2Y0SN 1K61A 4XKCA 1VQ9I 2E1MC 2UWMA 2W82A 3CQZA 2MFZA 3QPTA 3GFLA 4CC5A 2L9RA 2VQFH 2HTJA 2VL8A 5EDNA 4JUZA 1FIPA 1BGWA 5J40A 1ZLKA 2KZVA 5CLSA 1SYXB 1VNDA 5TRDA 4R8HA 3L00A 4O4HF 2VJ4A 1BIBA 2CRGA 2CJJA 3QAHA 5IP7J 3OYGA 3WTUC 4A2UA 5HDKA 5CQGA 1LE8A 4I02A 2QKLB 4U0YA 1Z0XA 3VFZA 5LMUH 4OOIA 4ZHQF 3RCOA 1T3NA 2L9VA 5DCMB 3G6XA 1Q1VA 2BW3A 1RRJA 1IRFA 1Z77A 1E4EB 1PK8A 4JI5H 2Q0OA 1V5FA 5B1AH 3CJRB 5L9XA 3PIOF 2F5FA 2DLLA 4RNNA 4RGUA 1GSHA 1BOAA 1B72A 2HVQA 4ECTA 3G4SI 3VYUB 3IG0A 4B1RA 3ZMTA 2BVMA 4O4LF 3ERMA 3ONQA 4LOCA 3PIPF 5KFTA 1IUFA 5AIPA 2BE5F 1ON2A 2VKDA 1MGTA 2JA5A 2VUGA 2J6TA 2KL4A 4WF2A 2FF4A 2M0MA 4BU2A 4RBOA 1H88C 4IHYA 3K4JA 4PK4A 5J1RA 3SE7A 2WAQA 5M5YJ 1I7LA 2L7FP 3BR2A 2VQLA 5IT9K 3KEOA 2JMWA 2MH2A 2QBYA 5KFQA 1I94H 4ZOLF 2PMZE 2ZKZA 1FVIA 1UG0A 2ASJA 5FFXA 5C3EG 3IRQA 3CMAI 1O3TA 4FASD 2KSWA 5EZGA 4YIIA 5CVVA 4GLXA 4FCYA 4AIHA 2NRAC 2BXZA 1KYWA 4F92B 3D1NI 4LFAH 1YFHA 1HW5A 4IZOA 5C4JJ 3JSOA 3J7ZI 3OS1A 2W48A 4NC6A 3CP8A 2WAEA 4DYQA 3VSKA 1TWGA 3KTMA 4YRVA 4XYLB 4AU7A 4BBRG 1E2XA 2PFBA 4MEXF 3ZMZA 3M7GA 1TNSA 2HDWA 3HXLA 2PLYA 3KP6A 4JI4H 3CESA 2XKOA 2PI0A 1W4MA 2XSJC 2KJCA 2DDAA 1MMSA 1KU9A 2M45A 4ED3A 4CUGA 3PUBA 3S32A 5HDNA 4MV1A 1RR8C 4OWRB 3GLKA 3EUHC 1ZG5A 4UNOA 3R0JA 1T33A 3LSJA 1ZGWA 5F27A 3RV4A 3TDZC 2JA6A 2FMLA 4JQFA 5BMVF 4JI6H 5LXTF 2KJBA 2EZIA 4AYBA
chains in the Genus database with same CATH topology
4WXHA 4P5OA 4LD5A 3IC7A 4M9ZA 5L3GA 5FPRA 3VOEA 2ZMEB 4XLNF 4LH6A 4CICA 5DDGA 4U0WA 4HA8A 3CUQC 2J5OA 2K4BA 4DQ2A 4B3MH 4LFBH 3U9GA 1USTA 1MDMB 4UCTA 4DR5H 3L7WA 3HHHA 1LVAA 1K78B 3HYIA 2XAHA 1IXRC 1R1UA 4IF4A 5TJJA 5ERIA 4RB1A 2XAGA 3FM5A 1ZN2A 3HOSA 5D8KB 4UCVA 2CYYA 2M5WA 5H6QA 3RPQA 3E6CC 4I2OA 1WI9A 2ZNZA 2FNAA 4DV2H 2NYXA 2NAZA 3JTGA 4HQMA 4LF7H 3ZP5A 1O7FA 2O61A 2CWEA 2IRFG 1JGSA 4HZFA 3FXQA 1R36A 1J75A 4AIKA 1J59A 3BOQA 4GYIA 2DO7A 1S7OA 1ZAOA 3CUOA 2CO5A 1IN8A 1J9IA 3J81Z 4KA4A 1IBKH 1U78A 1B1BA 2HYFA 4A6EA 3HRMA 2CSOA 2NNYA 4HF2A 3BPXA 1ZRDA 1BI2A 1OPCA 2XAJA 4Q48A 3QRFF 5LGUA 1I27A 1U5TA 2QVOA 1G3WA 1RUNA 5ICFA 1WH2A 4KFCA 2RVCA 3WU0A 1P2FA 4RGSA 4UV9A 1QZZA 2WE6A 4L18B 3RGXA 1DPUA 1QO0D 1F1ZA 1FWZA 2L4AA 3RIZA 4X65H 2XVCA 1Y0UA 2L02A 2A68F 2YSRA 4HF1A 3WTXC 5CVUA 1MJBA 3HRTA 5FD5A 4RB0A 1ODDA 1RUOA 1R00A 2HYGD 2FOKA 2A5YB 3LAJA 1STZA 2K02A 1O57A 2IJLA 2F5EA 5L3FA 4A5NA 3RJPA 2A69F 3HRUA 1XNQH 4M6YA 2L3DA 1LB2A 4M9SA 3V7SA 3G73A 2YU3A 2GAUA 2O3FA 2UUCH 1O3SA 4DV0H 2FA5A 3U2RA 3K3VA 2UZKA 2QBYB 3M8EA 4KT5C 1FYLA 3QU6A 1P4AA 2DTRA 2IPQX 4IXAA 4HAMA 5BR8H 1LEAA 4ENNA 4A0XA 4BYYA 4L9VA 5AONA 1P4XA 4EQQA 2OAZA 2FSWA 5E18F 3P9CA 1LNWA 4ZZDA 4N9IA 1K7AA 1QQIA 3ABTA 3SQNA 4ASNA 4JI7H 1SEIA 3BA8A 2IA1A 2QWWA 5LHIA 4N0BA 2H27A 3DPTA 1I6UA 4PCQA 2KIFA 5ILSA 4GO1A 1V9PA 2JPBA 1TQPA 2XKPA 5E1XA 3KP4A 3IL2A 4I09A 1MJAA 4IVNA 1AOYA 5DCMA 4LB5A 1IBLH 3J80Z 3FMAA 2ESNA 1G4DA 3K2ZA 1J0RA 4EGZA 2C6YA 3D0SA 4ON0A 1G3SA 4F7ZA 2XAQA 4LF9H 4L9TA 4IRHA 4M71A 4Y15A 1R1VA 5ILVA 1FJGH 2TDXA 3MEXA 4WXCA 1R5HA 2A6EF 3LFKA 3G3ZA 1N33H 2OD5A 1TQMA 3EDPA 1W5SA 2MD5A 4PZJA 2V1XA 2EFQA 2H09A 3BJ6A 1PP8F 5D8LB 2RN7A 2HHHH 1Z05A 1CF7B 2HKXA 2QQAA 1O3RA 2ZXJA 3UQ8A 1RI7A 1P92A 4HLYA 4EVIA 3PQJA 3VODA 2VBWA 3ZMSA 3KP2A 2A61A 3D5LA 5LGTA 4EJVA 3HIFA 4AWXB 1BI3A 2BYVE 2DT5A 1FLIA 2AXLA 3MCZA 4UCRA 3R61A 4HF0A 4PGHA 2W25A 1ZRCA 1K6OA 1WKMA 2M8EA 4UVAA 1T0FA 3L4KA 2ZMEA 3I0TA 4LF4H 2MA3A 3F8FA 4DV6H 3BJAA 1J5EH 2K27A 1X9NA 3F8BA 5J8CA 5FLXW 1OYIA 1KU3A 5FO5A 2W57A 3TDUC 1O7LA 4FHTA 3GFIA 1TBXA 3C0FB 3BDDA 1K78A 3LWFA 3EQLF 4ZZLA 1IN4A 5L3DA 4B09A 2W85A 2LSOA 5F6FA 3J81K 1LEBA 1Q1HA 4WK8F 1R22A 3F72A 1SD5A 4MQVA 4I7HA 4OIOF 2EK5A 2EFWA 2PMHA 1YYVA 2ADUA 2IA0A 1XSXA 1XGMA 3EYIA 2L4MA 4YHHH 3E3VA 3GFJA 5E1ZB 3I71A 3ISPA 4AD9A 1P4WA 1YQAA 1D5VA 3KALA 4MGRA 4BH9A 2VONA 3RF2A 4KN7X 3RGZA 2ETHA 4ZYHA 4BQAA 4A0ZA 5K1YA 2FXAA 3GYHX 1IXCA 4RZQA 5FPOA 1UCRA 1AN7A 1XB4A 2A07F 1JHFA 5L3CA 4IHSA 3BJOA 2IT0A 3L4JA 2YX4A 1SFUA 3LA7A 2YR2A 2YCHA 4FT8A 1ZHSA 3BAAA 2VODA 1XMOH 4CXFA 4DV1H 1SD4A 1JHHA 1RZ4A 4UCUA 4MTEA 4Q0YA 4U0VA 5CJ9A 2M87A 3QOPA 3PFIA 2D45A 1S68A 2OU2A 2QENA 4CZZA 3U1DA 1EH8A 2IVMA 4A12A 3GW2A 4UHTA 3C1DA 2OQRA 3LA2A 4LB6B 4DR4H 2XGXA 3RKYA 2PN6A 3OOPA 2VE8A 3L2CA 1HBXG 4M72A 2P6SA 3R6SA 3I4PA 3R0AA 1QNTA 4A2BA 4DR3H 5AIQA 4OIPF 2PMUA 1Z6TA 1RNLA 3DPLC 2EWNA 1SFEA 4EV0A 2CQKA 2GXBA 3CUQA 5K5RA 2XV4S 1E17A 4KICA 5ICEA 2CW7A 4HX4A 2OWOA 2VN2A 3TOBA 3KP3A 2RNJA 2QUFA 2CFXA 2Q2TA 4DR1H 1GHCA 1BJTA 5D4SA 4G94A 4WXDA 4LJZF 3KXYT 4YFXF 1R58A 2LKPA 4MTDA 3JSNA 4IAJA 3F8NA 4L0YB 3Q9VA 1B04A 4Y17A 3J80K 4ZYEA 3DXJF 3HTSB 1XGOA 4EGYA 2RDPA 2W84A 3WTSC 1G3YA 4EJTA 2XHKA 1FPQA 2EV0A 2MC3A 4KUMA 2VOOA 1B6AA 3ZMVA 4M73A 2HFHA 3DF8A 1Z91A 4LF5H 1BI0A 2DQRA 5CVIA 4KIGA 1UFMA 2X0LA 4LLGF 3WGIA 3WTVC 4XSZF 4KNYA 4NB5A 3V8LA 5LMNH 3PQKA 1H9TA 3GXOA 3E6DA 3CO7C 5DV5A 5D1PA 1ZGAA 4B3TH 5HVQC 2ESHA 5HS7A 3TKYA 4OX9H 1MZBA 1I5ZA 3RKWA 1GXQA 4UXNA 2HKOA 1F5TA 5CYVA 4EM0B 1ON1A 3GFMA 4M74A 2ZM6H 4TV7A 5ICCA 4L9NA 3S2WA 5H6RA 2FEZA 3FMRA 5ILUA 1R5GA 4UCOA 2P5KA 1U3EM 2E1NA 3GO5A 5DCFA 2NNNA 3HOTA 2G7HA 5HDGA 4YIFA 1CF7A 4DR7H 1P8LA 1KU7A 5FLXK 3QP6A 1KQ9A 4RAZA 4CGZA 5BOXA 3J81W 5D5XB 1OYYA 1R1TA 4Q5SF 4OINF 3KP5A 1XN7A 3FMQA 2FQ3A 3W6KB 4X62H 1ZYRF 4OMYA 3GLXA 2UXDH 1L3LA 3WE3A 1IN7A 3JAMZ 3DF7A 4MQ9F 3O3KA 2ZJTA 4GKKH 1WQ2A 2NS0A 4IRIA 4XRFA 1XSDA 2WTEA 3T8RA 4DNCA 4BHCA 4APMA 3T1HH 1QPMA 4AVPA 4DR6H 3O6BB 2J5PA 1T39A 1YS6A 5D5WB 3WTTC 1JXSA 4L5JA 3RDIA 4QWQA 1SMYF 2GWRA 5L3BA 2HTSA 4HYEA 4I98B 4RB3C 2V9VA 4GKJH 4NXNH 1XDSA 1U8RA 2P7CB 3RJ0A 1TLHB 2EFOA 5BQTA 1PP7U 3CTAA 5HOOA 4XSXF 2QZ8A 3F6VA 1QBJA 4GXOA 1S03G 2FRHA 2P5VA 3W6JB 3K1PA 1I6XA 3HSEA 4IRGA 1NHAA 1RIOH 1ZH5A 3Q9SA 3WGGA 5D1OA 3CUQB 5FFZA 1W5TA 4L5IA 1B9NA 2IW5A 2Y48A 4KIFA 4HBLA 1WSUA 2HQNA 3KAKA 1F9NA 2B0LA 3LSTA 4KIBA 4EJWA 3B02A 4M9XA 3JSPA 3LQQA 2ISYA 2QQBA 2IP2A 1GVJA 1BM9A 1WRJA 1HSJA 2L01A 3RYRA 2MCTA 3I54A 3RPUA 1U5TC 5ED4A 4P9UA 1L0OC 4E70A 2O0YA 5IT3A 2RV8A 2WYOA 5D6FA 1HQCA 2P6TA 4ZYDA 4JYAH 2DFIA 3OV8A 4OMZA 1FX7A 1V3FA 1OYWA 1XDUA 3C18A 4J0MA 5A2QZ 4O6JA 3RTRA 5JFRA 1Z1DA 3V7CA 2ZBKA 2V79A 1H9GA 3K1MA 2STTA 2VC1A 1M0TA 2OZUA 3MZYA 2Q8KA 2DI3A 1DPRA 1KQ8A 1MD0A 2E7XA 5DEQA 2ZNYA 3M4IA 4MV9A 1Z2PX 2BBYA 3I58A 2F5DA 1X3UA 3FWEA 1EH6A 2PEXA 2EA4A 3WU1B 1Z2OX 4L0ZB 4JI0H 2V6CA 3OTOH 4LSXA 5IT9Z 3IWFA 3J80W 1BI1A 3F8MA 4LSAA 1DDNA 1ZGJA 3BA9A 4A6DA 2DK8A 4RGRA 4OU0A 4PDKA 1UHMA 4ENKA 3KFWX 3B73A 3M9AA 1ZLJA 3RIRA 3N43B 3NEUA 3N42B 5D5UB 4G8XA 2ACJA 3F8CA 4G9YA 4D0PA 1PUEE 1B4AA 4O5VA 4H0EA 2A3SA 1A04A 3KETA 3HHGA 2ZJ2A 3BABA 2LF8A 1TNTA 5JR3A 3FMSA 3BPVA 4Y13A 2D2WA 1BC8C 2LF7A 2E1CA 1KU2A 2O8XA 2VOPA 4ETSA 2HS5A 1KA8A 5EEGA 4LGWA 2M1BA 1J5YA 5IWAH 3K9TA 2UUBH 3L9FA 1IF1A 1SD6A 3H3ZA 1KQ0A 3V8JA 4YG2F 1UHWA 5DD4A 1IBMH 4BHBA 2FU4A 5K5QA 3C7JA 3HUGA 2PG4A 4DV5H 3MQ0A 5JI6A 1U2WA 1QZYA 4G6DA 2DQLA 3FM3A 2GZWA 5F1RA 3GVAA 2EFNA 3F22A 3WG9A 6PAXA 2VQEH 3KLNA 1EH7A 2F5CA 2HEOA 1FYMA 1Z9CA 1T98A 2Q2EA 4IHTA 1D3YA 4LFCH 2FBKA 4AQYH 2V1DA 5DUIA 3F3XA 3AAFA 3WGHA 1ZG1A 3N41B 1BIAA 1A0IA 4JK1X 1FSHA 2PJPA 1FNNA 1FP1D 3CLOA 3KEQA 4NHJA 2EA2A 2KKOA 2ZCWA 2IA2A 5DYMA 2BGCA 5JVTA 5D1OB 3BROA 2OBPA 5BMZA 2KIUA 2XAFA 3WODF 2P7VB 1R23A 1KGSA 4UVCA 1W7PA 2VOBA 5BS6A 1BJAA 4HV6A 1SD7A 4KMUX 4FX0A 4BWSC 1LQ1A 1T2KA 3WTYC 1OMIA 2COMA 3GF2A 4ESBA 1XNRH 3ML6A 4ESFA 5FD6A 2QLZA 1H0MA 4LMYA 2XUBA 1OKRA 1GYFA 3T8TA 2QM3A 1MKMA 4KMFA 2HVSA 3N4MA 3FXRA 1G3TA 4P96A 1ULYA 4EFEA 3VEPA 2FBHA 2OZ6A 2H6CA 4UVBA 4BAYA 3P7NA 4OIQF 5HS8A 5DD8A