2XIGA

The structure of the helicobacter pylori ferric uptake regulator fur reveals three functional metal binding sites
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
148
structure length
146
Chain Sequence
MKRLETLESILERLRMSIKKNGNSKQREEVVSVLYRSGTHLSPEEITHSIRQKDKNTSISSVYRILNFLEKENFISVLETSKSGRRYEIAAKEHHDHIICLHCGKIIEFADPEIENRQNEVVKKYQAKLISHDMKMFVWCKECQES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Helicobacter Pylori Ferric Uptake Regulator Fur Reveals Three Functional Metal Binding Sites.
pubmed doi rcsb
molecule keywords FERRIC UPTAKE REGULATION PROTEIN
molecule tags Transcription
source organism Helicobacter pylori
total genus 42
structure length 146
sequence length 148
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2xigA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2xigA02
1ZGJA 2XVCA 3D0SA 1HSTA 3TGNA 2M1BA 1OYWA 1IXCA 2IJLA 1J59A 1CF7B 1IN5A 1G4DA 4ZYDA 5KK1A 3E3VA 4RS8A 2LNBA 2RC4A 3N4MA 1QQIA 3FMSA 4F7ZA 3WTZA 4PGHA 1U8RA 4ESFA 1ZN2A 5LLQA 3F8NA 3GXOA 1MJBA 1TQPA 1LEBA 1SD6A 2EK5A 4EM1A 2J5PA 4D0PA 3V8KA 1YYVA 3L00A 3D5LA 1MDMA 5FGMA 4BHBA 5FD6A 3KEQA 3T0YA 4WCGA 4I98B 1D3YA 3Q5FA 3ECHA 2IA1A 2TDXA 1P2FA 3DEUA 3TDUC 3WGIA 4LJZF 3GZ5A 2VBXA 1IN7A 1FX7A 1EV7A 1W7PA 2IVMA 2H94A 3BZ6A 2DPDA 4L9JA 3K0LA 1YW8A 2YX7A 1QO0D 3M7GA 4LK0F 4M71A 4ASNA 4LG0A 1BBYA 3MCZA 3RKXA 3W6JB 3HRMA 2HFHA 4HBLA 4EJUA 3E6DA 2FMLA 1KU7A 3ML6A 2HTSA 4BYYA 3REOA 2OD5A 4HYEA 3KE2A 3WE2A 3COAC 3V7SA 5ICCA 2CFXA 2DQRA 3GFIA 3MQ0A 3E5UA 2RQPA 1RUNA 1Z6RA 1Z1DA 5D5XB 2OQRA 3ZQ7A 2FMYA 2YX4A 4R1HA 2AXLA 2PG4A 4A5MA 5F6FA 1T0FA 5L3GA 2A6HF 4PGGA 2COMA 4OIPF 4ENJA 3FXUA 2EA2A 5E18F 3QRFF 3MFKA 4M6YA 3K69A 2FNPA 2VT2A 1FPQA 4EJOA 5HS8A 1T6SA 1ZREA 2FRHA 1D5VA 2QWWA 1RI7A 2STTA 2ZCWA 5D6FA 4OIRF 4K2EA 1K78A 3LFKA 4UVAA 4L9VA 1BIBA 3HSEA 1IN8A 3LQRA 4A2UA 1YO5C 2HQRA 4QWQA 1FBQA 1ON1A 3HTUA 2DBBA 2ELHA 1USTA 3HRTA 3ZMVA 5DUKA 3VFZA 2ETHA 4KICA 5L3EA 3HUGA 1FYKA 2O3FA 3WTUC 1FZPB 4RGXA 2Q8KA 1KYZA 1MJ9A 2MD5A 1O57A 2STWA 4Q48A 5KVRA 4KIGA 3GFLA 2PEXA 2BYVE 3PFIA 2A5YB 2XKOA 4IJAA 4WXDA 3K2ZA 1ZLJA 2RV8A 1GVJA 1HSJA 1U5TC 3DQVC 2H09A 4G6QA 4A6DA 1HBXG 1OKRA 2IA2A 2HQNA 2JZYA 4U0VA 5L3FA 1BJAA 5LGUA 1IAWA 4ENKA 2JTVA 3I5UA 4I01A 3KZYA 1JE8A 2KJBA 4N9IA 1EH8A 4RAZA 2IW5A 3K9TA 3TDZC 3CUQA 2P5KA 5LHHA 1AOYA 2VC0A 2O6GE 5ERIA 2OBPA 3J81Z 1R22A 3VEPA 2RGVA 4EQQA 3JW4A 4M73A 3SZTA 2NNNA 4IF4A 1K79A 1W5TA 1HKQA 2DPUA 2K02A 4MEYF 4KMUX 5HS7A 1OYIA 5DD8A 1IXSB 3QOPA 3ZN1A 3GYHX 4RB1A 1B6AA 5HLIA 1P4AA 2QVOA 1RNLA 1XCBA 1KGSA 2EV5A 3R4KA 1YW9A 4YFXF 3RPUA 2FF4A 2BEOA 2MC3A 4R8HA 2RKHA 4HW0A 1SMYF 3HOSA 2VT3A 2LF8A 5LEKA 1FP2A 1K7AA 1QZYA 1R5GA 3I53A 4LK1F 2ZBKA 1D8JA 3C3WA 5E1ZB 3MAJA 1ON2A 3WTVC 4OMYA 2EJRA 3ISPA 5JI6A 4UXNA 3ERED 5E8IA 2VBYA 1J2XA 5DCMB 2HYGD 1T38A 3LA7A 2M30A 3MZYA 1SFXA 1R1VA 4HF2A 3HOTA 4KIBA 5ILVA 2BE5F 2P5LC 4GCVA 1FOKA 4G94A 5AONA 2L01A 3CUOA 2KIMA 4MHGA 3BDDA 3CDHA 1PP7U 4EJVA 3JAMZ 1T39A 3GEZA 5BPDA 4EGZA 3ULQB 1OR7A 1FT9A 1XN7A 3HRUA 1YS6A 3F72A 3R0JA 5FLXZ 5ILSA 5E17F 5HLHA 1J75A 4KMFA 1BIAA 2CWEA 2HTJA 3N97A 2NAZA 4QLCU 1BOAA 2XASA 2FEZA 3F23A 1XSDA 4ZYEA 1F5TA 2DTRA 1KU3A 2W25A 5AIPA 1S29A 2Y75A 2UXNA 1W7PD 3DXJF 1TNTA 2GWRA 2VOPA 3L09A 3J81K 1GHCA 4S05A 1LB2A 3HRSA 2XIGA 4EVIA 4I0BA 2MH9A 3FX3A 5CLSA 5AIQA 3J80Z 2NNYA 4AIKA 3P7NA 1E2XA 1FBSA 1R00A 3KP6A 5D6EA 5LBQA 4XLPF 3I64A 2VODA 1ZG1A 2XV4S 1YLFA 3GF2A 1FP1D 4EM0B 1EH6A 4KN4X 4ESBA 4IVNA 2HWVA 2B0LA 4OIOF 1KYWA 1TQIA 4G8XA 2P7CB 4IXAA 4ZH4F 1A04A 1BM9A 3GLXA 1XSXA 5CVUA 2Z33A 5E20A 1Z9CA 1IN4A 1FNNA 1RZ4A 4KN7X 2UZKA 4P9FA 3WTTC 2VE9A 2P8TA 3HHHA 2UWMA 2XAJA 3C7JA 3ZPLA 3HSFA 5FFXA 2ZKZA 4YFKF 2HDCA 4ZZLA 2DAOA 2OZ6A 4YIFA 2G9WA 4BHCA 3ECOA 2IRFG 2A68F 2CG4A 4Y17A 3RPQA 2CGPA 4RB0A 1ZRDA 4BQAA 3LSTA 2BV6A 4A0ZA 2NS0A 5K1YA 3WODF 3WU0A 3JAMK 3R60A 2O0YA 3WE3A 3J7AO 4IRIA 3HSRA 4HA8A 2W85A 1PUEE 5FLXK 3GX4X 4CDGA 4GGGA 4A5NA 5LEJA 1B9MA 2ZXJA 5CYVA 3E5XA 1WI9A 1NHAA 4M6XA 3TQNA 2O03A 1ZARA 1U78A 3EYYA 4GO1A 3ABUA 1UCRA 2FBKA 2JT1A 5HDNA 4L0ZB 1B4AA 1WSUA 1BI0A 5CVRA 2V1XA 3ZMZA 3K1NA 2K27A 3ZP5A 5HS9A 4MQ9F 2PI0A 1FSEA 1MDMB 2HR3A 4U0YA 3CTAA 3DF8A 3J80K 2K4JA 4XRFA 4CO8A 1LDJA 2A69F 2CYYA 2HKXA 5ICGA 2WTEA 1V3FA 4I0AA 1B9NA 3KEOA 4AVPA 3K1MA 4KNYA 1W7PB 3ELKA 3ABTA 4P96A 1F1ZA 5E1WA 4M9SA 3O6BB 2ZJ2A 1I27A 4CZZA 3C1DA 3F22A 3ROUA 5ED4A 5D5VB 2L02A 4LG0B 4PDKA 5EEGA 4OIQF 3QPTA 2D2WA 4IRGA 2XAFA 4MQVA 3BPXA 5JR3A 1IRGA 2JRTA 3C18A 3KP2A 3EETA 1IN6A 2R7FA 1F4KA 4L18B 2L54A 3TO9A 2Y48A 2HS5A 5D8LB 3VODA 3RDIA 2ZNZA 3RTRA 4HDVA 2W84A 1I1GA 5CVIA 4Q4ZF 1GXQA 1XSVA 2Z9OA 5IT3A 4KT5C 4RGSA 4LB5A 3T1BA 3ZMUA 1MGTA 1SMTA 4HX7A 3V8JA 2J5OA 4EJTA 3FM3A 2PN6A 4CXFA 1XGMA 1X3UA 3EUHA 4BXUA 4U7BA 4M9ZA 2XROA 1FBUA 2G7HA 2D1VA 2P4WA 5J6XA 1J7KA 1MJAA 1OPCA 1UHWA 1L3LA 2Q0OA 4P55A 4WWCA 4WXCA 2KIUA 2V79A 5H6QA 1G3SA 1ZG5A 1TQMA 4AWXB 4KDPA 4LLNA 5JVTA 2EFWA 1FC3A 1ZHFA 1G3YA 3M1EA 3WTYC 2M8EA 4P9UA 1FWZA 1AWCA 3WGHA 4L0YB 1K78B 5K5QA 4HX4A 2QENA 2IA0A 1SD7A 3IKTA 5DEQA 3F3XA 3RYRA 1WQ2A 4O5VA 2W24A 4BNCA 3RJPA 2RN7A 2Y0MA 2DQLA 5A2QZ 3EQLF 1SD5A 2XRNA 4ETSA 1I6XA 3IC7A 3QAHA 4PCQA 4NQWA 2FSWA 1ZRCA 1XD7A 2EFQA 2VBWA 1DP7P 3KLNA 2EV0A 4UUVA 2VONA 2YR2A 2FBHA 4HF1A 1WWXA 2GIVA 4WF2A 4I02A 4CICA 1UB9A 3S2WA 4OMZA 5BMZA 4UVBA 2PLYA 3E6MA 4UV9A 5DCFA 3DFGA 2WWYA 1H9GA 4M9XA 2P6TA 1UHMA 2JPBA 2QBYA 4BAYA 3U1DA 2H6BA 1MZBA 2DU9A 1FYMA 3F8FA 1R7JA 4RB2C 4FX4A 2IT0A 4IPAA 1P4WA 2UXXA 5CJ9A 4MTEA 1KU2A 1R36A 1QGPA 1DDNA 2FE3A 2K86A 2RVCA 3H92A 2RDPA 1E17A 3CUQB 3DP7A 1MD0A 1LQ1A 1ZRFA 4WX9A 3FF5A 4GXOA 1P4XA 2M45A 1USSA 5DV5A 2D1HA 1B1BA 1S7AA 2A6EF 3I58A 1LDDA 5H6RA 1UFMA 1STZA 5BOXA 3LAPA 2OU2A 2OQGA 5TJJA 3U2RA 3BY6A 1XGOA 5LHIA 1ZYRF 1O3QA 4Q5SF 4NHJA 2QBYB 1SD4A 2Z5UA 3M8EA 4AD9A 2C6YA 4TV7A 2X0LA 3NEUA 1U2WA 3LQQA 3OV8A 2KIFA 4HLXA 1EH7A 3TKYA 3E5QA 2ZMEA 2GXBA 2GZWA 4HOBA 3T8TA 2EV6A 3B73A 4EM2A 3P9CA 2L4MA 1KA8A 1XMKA 2V9VA 1SFEA 2FNAA 3T8RA 2H27A 2EB7A 3WGGA 3V4GA 5A2QK 4FX0A 5HOOA 1L0OC 4YIIA 4Y15A 2ISZA 2GAUA 5FD5A 2X4HA 3WTXC 1JHHA 4I7HA 3P9IA 2QZ8A 2K7LA 2Z3YA 3IWFA 1I1SA 1T98A 3AAFA 2OAZA 4I2OA 2PJPA 4MTDA 3BJOA 2ZMEB 4CYDA 2LKPA 2E1CA 2F5DA 5ICFA 1U5TA 1DPRA 1HXDA 4YG2F 4Z2YA 1VTNC 1J0RA 4GYIA 3RI4A 1P6RA 2GA2A 4I09A 3DKWA 1CF7A 1LJ9A 3L9FA 5HDKA 3G3ZA 2F5EA 3MZHA 1REPC 4G6DA 3EDPA 3GWZA 1R23A 4MNUA 3KP3A 2PMHA 3GW2A 1HW5A 3NRVA 1ONVA 4RGRA 2ZNYA 5K5OA 3IL2A 1GXPA 4HQEA 3RKWA 3L7WA 2VE8A 3HYIA 2A07F 2DK5A 1OMIA 1RIOH 4DNCA 4G9YA 4BHPA 1S8NA 2DFIA 4ZYHA 5D5UB 1C0WA 1QNTA 4L9TA 1YQAA 2LSOA 1BI1A 1IXRC 1T2KA 2FBIA 4OINF 2VOOA 2JPCA 1WKMA 4HDUA 1J9IA 2DW4A 5F1RA 1DUXC 3VOEA 5FFZA 3K1PA 1ZLKA 2F5FA 1LNWA 1R1UA 1XGSA 3KLOA 5LRRA 1RUOA 2R7DA 2HYFA 3WG9A 3F8MA 1V4RA 2DI3A 4HV5A 5HDGA 2RNJA 2PQ8A 1I5ZA 2VN2A 3GO5A 2LF7A 2MLKA 4Q47A 1O3SA 1F9NA 2CSOA 1O3TA 2XAHA 5L3DA 4LLLA 3F8BA 3ZMTA 1QBJA 2JSCA 4LLGF 2VC1A 4ZYGA 3TOAA 3ZMDA 4HF0A 1HKSA 4JBAA 4B09A 2FA5A 2QUFA 4P5OA 3WTWC 3PQKA 2FXAA 2LDUA 3VB2A 4UVCA 1SFUA 1JGSA 2HOEA 4FT8A 2QYOA 5F64A 2ESNA 3CUQC 1R1TA 3CJNA 3Q9SA 2CQKA 1U3EM 2MH2A 1XDSA 2Z99A 2M87A 3BOQA 5LHGA 2IP2A 5ILUA 2EFPA 5IT9Z 3PQJA 3JTGA 2GXGA 1ZH5A 2GQQA 1TBXA 1IZ1A 3SXYA 2QQAA 3M8FA 4ENNA 3JSOA 5H20A 3G73A 3HTSB 3R0AA 1P92A 1OYYA 1WRJA 3F8CA 1XMAA 2FU4A 3LWFA 3FMQA 5ICEA 4MGRA 1LVAA 3I71A 2A3SA 2DLLA 3O2PE 1FSHA 4Y13A 2Q2EA 1FLIA 4HX8A 4UV8A 3FMRA 1IF1A 4G7ZF 3DPLC 2P6SA 1J5YA 5D4SA 3IWZA 1FYLA 1O7LA 3BJAA 2XGXA 4E70A 3KP7A 3TO6A 1QZZA 2YSRA 1Z6TA 4IHSA 2CW0F 3HHGA 3E6CC 1Z05A 2XHKA 2L4AA 2EFNA 3IHUA 3TOBA 2O61A 4HV6A 2FOKA 2QQ9A 3HIFA 4JK1X 3CO7C 2DK8A 4XSXF 4NB5A 1YG2A 1SAXA 4EV0A 1G3TA 1TNSA 3O3KA 3BJ6A 3KETA 3GUDA 5L3CA 1KQ0A 4IHTA 4XBFA 1BI2A 4A0XA 3GVAA 2F5CA 1XCVA 1ZAOA 1TW2A 4YFNF 1XB4A 1YTYA 3EYIA 1YIOA 4M72A 5J8FA 4KYWA 4JQFA 5DYMA 3KFWX 3SQNA 2W57A 1BI3A 3ZN0A 3FXRA 3BWGA 4CGZA 1IUYA 1MKMA 2IPQX 4B8XA 3FZVA 1BC7C 4LD5A 4N0BA 3CLOA 3F6OA 4WK8F 4A0YA 2M5WA 2KJCA 4KIFA 1D8KA 3JTHA 4N9HA 1HKTA 4EJWA 3I0TA 2XUBA 1Q1HA 3KCCA 3U9GA 3BPVA 5JHUA 1HQCA 3M9AA 5HVQC 1B59A 3SHFA 1K6OA 2WV0A 2CO5A 5IT9K 4O3MA 1LEAA 3MWMA 5BS6A 2QQBA 1YW7A 2EA4A 4KFCA 4EMSA 1S7OA 5J8CA 4FHTA 2P7VB 2L3DA 3BP8A 3I59A 4HAMA 2AS5F 1JHFA 3IKVA 4IRHA 3GZ6A 3E97A 3OOPA 4UHTA 3KP4A 1PDNC 4L9NA 5CVVA 2E1NA 1R5HA 4LFUA 2MBFA 2NRAC 2HEOA 1CGPA 5DDGA 4RGUA 2V1UA 2QLZA 4L5JA 3FXQA 1KQ9A 2V1DA 2ADUA 5D5WB 5D8KB 3LA2A 4S04A 4OU0A 2EWNA 1G3WA 3TO7A 1H9TA 4RAYA 2H6CA 2VBZA 2MLGA 3QP6A 1TTYA 5K5RA 5DCMA 1S6LA 4G7HF 1BN5A 3IRRA 1Z91A 1U6GA 2QM3A 2K4BA 2BBYA 1TW3A 5BPIA 5E1XA 3F21A 3R61A 5LGTA 3CO6C 4AIJA 1ODDA 3I59B 2YU3A 3FHZA 2KKOA 2ISYA 1O7FA 3ZMSA 4OOIA 3H3ZA 3KP5A 3GFJA 1ZGAA 2ZO4A 3LA3A 2O8XA 1YS7A 2WC2A 3DV8A 3V7RA 1PP8F 2D45A 4XLNF 4CHUA 2F2EA 2FQ3A 4LB6B 3BROA 1TLHB 4R79A 4WXHA 5HLGA 5JFRA 6PAXA 4HQMA 2DO7A 2P5VA 2HKOA 4ZZDA 2OZUA 2GA1A 1IW7F 1IRFA 2ESHA 3V7CA 1HW1A 1KU9A 3T5XA 2V6CA 3WU1B 4G7OF 1DPUA 3MEXA 2A61A 2HZTA 3FM5A 4M74A 1YFHA 5CVJA 4U7DA 4BH9A 5EEHA 2PMUA 2YPRA 3RIRA 1G6NA 1ULYA 2KRFA 3SZPA 2G7UA 4HLYA 3FWEA 3B02A 2R3SA 1W5SA 4AIHA 3JSPA 2XAGA 3QU6A 3QU3A 5DUIA 4H0EA 1H0MA 2DT5A 4U0WA 2VXZA 3F6VA 4GYGA 4ESJA 1R58A 3RKYA 2PBIA 3QPHA 1XDUA 4KUMA 3KZZA 3SFZA 4DQ2A 5LRSA 4ON0A 2HGCA 5L3BA 3I54A 2XAQA 3DPTA 3IRQA 3P9KA 3LAJA 1Y0UA 2EFOA 2OA4A 1FY7A 1HW2A 4O6JA 2MA3A 3H3UA 5DD4A 1ZG3A 4PZJA 4A12A 5LGNA 2BGCA 4U88A 3L2CA 4L5IA 3W6KB 3V8LA 3Q9VA 5E8GA 2E7WA 4HZFA 4LGWA 2XKPA 4ENMA 1JXSA 1W4MA 3GFMA 4A6EA 3I4PA 1LDKB 5FB2A 4UNOA 4EGYA 4KA4A 1Z7UA 2PFBA 3QP5A 1S3JA 5BQTA 1KQ8A 2ACJA 1QPMA 1XGNA 3R6SA 5FO5A 2NYXA 5D4RA 3RYPA 2ZFWA 1O3RA 3WTSC 3E6BA 1BC8C 2E7XA 5TRDA 4RB3C 4MEXF 3NQOA 1U5TB 4XSZF 4LMYA
chains in the Genus database with same CATH superfamily
4XYLB 2VKHA 1ZGJA 2XVCA 3D0SA 1HSTA 3TGNA 1D0YA 2M1BA 1OYWA 1IXCA 2IJLA 3LFUA 2LBFB 1J59A 1IN5A 1JT0A 1CF7B 2JRMA 1G4DA 4ZYDA 4GC6A 5KK1A 1T56A 3E3VA 2M7AA 1Z3XA 4IR1A 3FISA 4RS8A 3CJQB 2LNBA 2RC4A 3G1LA 3N4MA 4V2GA 1QQIA 3FMSA 4F7ZA 3BABA 2Y0SN 3WTZA 2CS3A 2LYCA 2HVQA 4PGHA 2BW3A 1U8RA 4ESFA 3ETHA 1ZN2A 3ABMH 1RYRA 2EILH 3K6GA 2W6MA 3RB3A 4F92B 1S7EA 5LLQA 2JA6J 4NC7A 3K4CA 3F8NA 3T5LA 4BXXG 5HNFA 1Z67A 3IH2A 3GXOA 1MJBA 2XF6A 1P8LA 1MSFC 3VPRA 1TQPA 1LEBA 1SD6A 1ZKGA 2EK5A 4EM1A 1JGGA 4PWQA 4UCVA 5KFFA 1JKRC 2OWOA 5KFQA 1TAEA 2J5PA 3KALA 1WCMG 3V6HA 2KMUA 4O2BF 4D0PA 3V8KA 1YYVA 3NGDA 1JTYA 3L00A 2R85A 3D5LA 1MDMA 4XLHA 1I7NA 4ED8A 1RR7A 4NLGA 5FGMA 4BHBA 5KT3A 1N56A 3H20A 4RDUA 4EFBA 2YS7A 1P7JA 1OCTC 2HXIA 5FD6A 3ZQCA 1IGNA 3KEQA 4EGJA 3KHHA 1IC8A 3T0YA 4WCGA 4I98B 1D3YA 3Q5FA 1VQOI 4UY8I 1A5JA 3ECHA 3ZQQA 1WSCA 4YR0A 2Y31A 2IA1A 4F91B 1SC7A 2TDXA 2HPIA 1N33H 2JA5G 1P2FA 3CCYA 5FRMA 2X6XA 2DMQA 2VIXA 3DEUA 3TDUC 4QW8A 3WGIA 2XRLA 3CVZA 4LJZF 4HRIA 3GZ5A 2VBXA 1IN7A 1SAUA 1FX7A 1EV7A 1W7PA 2IVMA 2NVYA 4CCLA 2H94A 3H0GG 3FXJA 3N05A 3PR5B 5J4YA 3BZ6A 5BNGA 2DPDA 1UJ8A 2CV2A 4L9JA 3K0LA 4J0MA 2WTFA 1VQPI 1X4OA 1YW8A 3P5JA 2YX7A 3BG7A 1WCMA 1QO0D 1QZEA 3M7GA 1YJNI 4LK0F 4M71A 4YB8B 4ASNA 3K4BA 4LG0A 1BBYA 4QW9A 4UCUA 5KCMA 2VASA 3OHAA 4QTRA 2E34A 1X4PA 3MCZA 3RKXA 4BWSC 3W6JB 3VYSB 3KYLA 1SFOA 1TT0A 5DG9A 4P1WA 1VQNI 2FK2A 3HRMA 1BA5A 2HFHA 2H1LA 4HBLA 4EJUA 4A3IJ 1AUVA 3E6DA 2FMLA 3T5KA 1KU7A 3ML6A 1GYFA 2HTSA 2F48A 4MV1A 4BYYA 1U9OA 2WV1A 5IP6A 2YZMA 3REOA 2OD5A 4ZHQF 3JSLA 4HYEA 5FKLA 2GM4A 3KE2A 4LIVA 2MG4A 1AHDP 2AU0A 2JA5A 2VKEA 3CJRB 4X66H 3WE2A 3COAC 4BDYA 2YS6A 3V7SA 5ICCA 2CFXA 2DQRA 3GFIA 3MQ0A 2R8GA 1QVTA 1R4MB 4BY7G 3E5UA 2RQPA 4GC7A 2DT7B 1RUNA 1Z6RA 3H0GA 3N43B 1Z1DA 4I55F 1HNZH 4AIDA 5D5XB 2SCUB 4IX7A 4ECYA 1VQMI 3GTGA 1JUMA 4L5EA 3QZ7A 5M3FJ 4YQWA 3RZDJ 4OX9H 2ELKA 2OQRA 2NUAB 3OYMA 2L9SA 4DZPA 4XK4A 4CYCA 4EEQA 3ZQ7A 5KFWA 1QVUA 2FMYA 2YX4A 2DOAA 3RV4A 4YY3H 4DV7H 2CV0A 4R1HA 2LC2A 4A3CJ 3GLKA 2AXLA 4N4OB 2PG4A 4A5MA 5F6FA 3FIWA 4J19A 1T0FA 1DGRM 2KZGA 1WVRA 5L3GA 2A6HF 4PGGA 3BT9A 3SDGA 3RIZA 2COMA 4OIPF 4ENJA 2FK3A 5KAFC 3FXUA 2EA2A 1FIPA 5E18F 3QRFF 3GTLA 1ZTRA 1T3NA 3ESWB 3MFKA 4M6YA 1WPKA 3VYUB 5LMUH 3K69A 2FNPA 4XORA 1Y1WJ 4M7EA 2VT2A 5FKNA 2YCHA 1FPQA 1R6RA 4EJOA 5HS8A 5GP9A 1T6SA 2FJZA 1ZREA 3A0BC 4MIMA 5KFSA 2FRHA 4Y8VB 1D5VA 2K9SA 2QWWA 1RI7A 2STTA 4UUSB 1TZLA 2E5ZA 2ZCWA 2R7SA 1CS0A 1TWCJ 2BHZA 1WJFA 3HB9A 4XMYA 2DA7A 1I50A 2P0AA 2YL2A 3MMYB 5D6FA 1WGXA 2N8GA 4ECTA 4OIRF 1W1WE 1JDEA 4IEJA 4K2EA 2FKLA 1K78A 3K5HA 1WFXA 1Y0NA 2XF7A 2KSWA 2UUCH 3LFKA 2X1DA 2ASDA 2CMPA 2JVGA 3PW0A 4UVAA 3SFIA 4L9VA 3HM5A 1DIKA 2HJWA 2ZMEC 1P7IA 3JRIA 1BIBA 2X51A 3IUOA 3CCRI 5B5EC 4XLEA 2W9CB 5M3MJ 3HSEA 1M0TA 3CQZJ 3PNTA 1RK5A 3TW6A 3HGYA 2WAQA 1IN8A 3ABLH 3CESA 2DYRH 3Q3SA 2KIQA 1OFCX 3LQRA 4A2UA 2DOFA 2VQGA 5EG0A 3JRCA 3GTJA 4Q0YA 1RETA 1WHUA 5JUMA 2QCOA 1YO5C 2HQRA 5FJ8J 4QWQA 4U7CA 1FBQA 1ON1A 4CCJA 2GLOA 1VQ8I 4A3JJ 1F43A 2CKZB 3VPCA 3HTUA 4XICA 2DBBA 2ELHA 2KDZA 1USTA 1QHGA 2M4KA 2JN6A 3ZRGA 2WAQE 2QYZA 1R71A 1WJBA 3HRTA 4EFEA 3FDYA 2E71A 5KFGA 4S0HB 3ZMVA 2O8KA 5DUKA 3OS2A 4GFBA 4JP0A 4DV5H 2E2IA 4EBCA 1XNRH 3VFZA 2ETHA 4KICA 3AG2H 4DUZH 5L3EA 2KHMA 1TWGA 4CCNA 2KDOA 3HUGA 3OS1A 1FYKA 2C35B 2O3FA 5KFZA 1AKHA 2VPSA 3RJ0A 1G2HA 3WTUC 1FZPB 3HXLA 4RGXA 2Q8KA 4ED2A 2F4IA 3HKZN 3N42B 1KYZA 1MJ9A 1UG0A 2MD5A 3CP2A 4APMA 1O57A 2XGEA 2STWA 1Z2PX 4Q48A 5KVRA 4KIGA 3J7ZI 3GTMJ 3S3OA 3GFLA 2PEXA 2BYVE 1X1CA 5F04A 5KFMA 2H8WA 3PFIA 2A5YB 2UUAH 2XKOA 2X48A 4IJAA 4WXDA 1TA8A 2LH9A 2R4GA 3K2ZA 1VQ7I 1EA3A 1ZLJA 2RV8A 1GVJA 3R5HA 1HSJA 3GV7B 4A3DJ 2V1NA 4ED1A 4I50F 4JX5A 5FLVA 4G3IA 2W00A 1RKWA 1U5TC 3DQVC 3IG0A 1WJAA 2H09A 4EG0A 3FKIJ 4G6QA 1GV5A 5C4JJ 5C5JA 1IDZA 4A6DA 1HBXG 4A3IG 1OKRA 2DA2A 2IA2A 1GLNA 3OSPA 2F5VA 1JJ6C 1K1QA 2HQNA 2JZYA 4U0VA 5L3FA 1BJAA 2QK4A 5LGUA 3CCUI 5GAGJ 3M1CA 3A2KA 2QKMB 2E2HJ 2RF4A 2M3AA 4IHXA 2FX0A 1IAWA 3IAM2 3HDDA 5C4XG 3RKQA 4KITB 4CSWA 2GOXB 2JTVA 4ENKA 3GLLA 4ECWA 3PW5A 3LMMA 4E6KG 1ZGWA 3WHCA 1PUFA 4HQ6A 4QWCA 2JUGA 3I5UA 4B47A 3HL2A 4I01A 1GO3E 3UR3C 1WH2A 1VQ9I 3KZYA 1JE8A 2VQEH 3RBDA 2KJBA 2VOBA 5LA6F 4JI5H 4N9IA 4DW6A 1EH8A 4RAZA 2IW5A 3K9TA 4ECZA 4DL5A 2ZSIB 3TDZC 3JRFA 3CUQA 1YHQI 4IQJA 2MCTA 2XSJC 3QZ8A 3MR3A 2P5KA 3HOZG 4OAYA 3A01B 2EIKH 3MKWB 5LHHA 1AOYA 2VC0A 1LFUP 2LR8A 3JRXA 3V6JA 2O6GE 5ERIA 2OBPA 4QIWA 3J81Z 3RTXA 3K4MA 3QPSA 2RAEA 1R22A 3HOWG 3VEPA 2WA0A 2V5AA 4J9NA 4GKKH 2RGVA 4EQQA 3JW4A 2BQUA 1Y1VJ 4J9LA 4M73A 3SZTA 2NNNA 3CMYA 4IF4A 2LLKA 1K79A 3ZQIA 4EBEA 1CE8A 1W5TA 1U0JA 1T94A 4JX6A 1V55H 3LSHA 1HKQA 2DPUA 1GSOA 4EGQA 1VZ0A 2CQYA 2RGRA 2UVRA 3CCJI 2K02A 1RC9A 3CJTB 4QIWE 5KT4A 1JKOC 2ZFUA 4KMUX 4MEYF 1YRNA 2WAFA 1D1AA 1Y1WG 1H8AC 5HS7A 5F1JA 1OYIA 5CA0F 4MFDA 5DD8A 3GIDA 5CB4F 1IXSB 3QOPA 4RM2A 3ZN1A 4E7SA 3GYHX 4TV8F 1S9HA 4RB1A 4JV2A 2HXOA 2GLTA 1B6AA 4IZOA 1D0ZA 5HLIA 4FASD 3BG3A 1JKJB 1S97A 1P4AA 2AXTC 2HI3A 2QVOA 4UUTA 1RNLA 5BPHA 5KFPA 4LF4H 2AO9A 3TIGA 4B3MH 1XCBA 3VPBA 1KGSA 5D1OA 2W7PA 2Y30A 3QQAA 1WJEA 3L2QA 2EV5A 1ITYA 4A3EJ 3I4NJ 1IRXA 1YW9A 2VKDA 3R4KA 2ATLA 4DBQA 4JV5H 1Y56A 4YFXF 4HPQA 3PL8A 2FF4A 3RPUA 5CAEB 2WBMA 5I47A 3NWSA 2BEOA 5EZYF 2MC3A 1PUFB 4R8HA 2RKHA 4HW0A 3R5FA 1SMYF 3HOSA 2E5LH 2VT3A 4XKBA 2LF8A 3LWBA 1RKTA 1OLTA 2X85A 5LEKA 1FP2A 1UMQA 3ZQLA 1K7AA 4RNMA 2BQRA 2VQLA 1HLVA 1QZYA 1R5GA 3I53A 2XD4A 4LK1F 2ZBKA 1D8JA 5KFHA 3C3WA 4JI0H 2K9QA 1BOBA 1HCRA 5E1ZB 4A69C 3MAJA 2ZXWH 4ECQA 5KT5A 2ZJPF 1ON2A 3KTMA 3WTVC 2JEGA 3MZ8A 4OMYA 5FLMJ 4FM9A 2EJRA 3ISPA 5JI6A 4UXNA 3ERED 1R49A 5D1PA 1W36C 2BQ3A 5E8IA 1N34H 2VBYA 1J2XA 5FJ8G 5KAIC 4UB8C 5IP9G 5DCMB 2HYGD 2E1MB 4IOAF 5EWGA 3GIKA 2C28A 2RQQA 2AGOA 1T38A 3CZ6A 3LA7A 2M30A 3UKGA 2VKVA 3TQTA 2WAEA 3MZYA 3A4CA 3K4NA 3RGZA 1SFXA 1R1VA 1X3ZB 4HF2A 3M3YJ 2VPQA 2KT0A 1RRJA 1BNCA 2R92J 3PO3J 4KJZA 4KIBA 4Y3OA 3HOTA 2R7UA 3BA8A 1ZQ7A 5ILVA 2BE5F 4RNOA 5KG5A 3A0HC 3M8JA 5KG6A 1KZHA 4ZC3A 3DU6A 3CF5F 2P5LC 2R86A 3GCMA 4GCVA 3A1YA 3OYKA 3L2RA 1FOKA 2VPLA 4G94A 1XDNA 5AONA 2L01A 5J40A 1TWHA 2R87A 3K5IA 3J81W 3CUOA 2HOTA 2KIMA 2NVQJ 1DQUA 4MHGA 1B04A 4QWBA 5EEAA 3LP8A 3Q8SB 3BQ1A 2W6ZA 2R93G 1N77A 3BDDA 1Q1VA 1FEXA 3CDHA 1Z2NX 4J01A 1IBLH 5IP7G 1PP7U 1S10A 5F0FA 1GDTA 4EJVA 3JAMZ 5GTHC 1T39A 4YIRX 3BA9A 3GEZA 3HOVJ 2HNHA 2OCCH 1VQLI 3H0DA 2V9KA 1K61A 3L4JA 5BPDA 4C5BA 3GTPA 4EGZA 3ULQB 1OR7A 4RM3A 1FT9A 1XN7A 2VJIA 2JMWA 3G1MA 4IHYA 3HRUA 3TIIA 1KBLA 1YS6A 3F72A 3R0JA 5KFTA 2E19A 2V7FA 5B3SH 4AUXA 2MD0A 5FLXZ 5ILSA 5E17F 4XZ3B 3FKIG 5HLHA 3CD6I 1JUSA 1J75A 3TINA 4KMFA 3U9SA 1BIAA 3N44B 3H9JA 4NXNH 2CWEA 2EZKA 2HTJA 3MKYB 3ZQFA 3IN5A 2CW7A 3N97A 2E2JJ 3G71I 5FKMA 4Y7NJ 5FRNA 2FLLA 2NAZA 3ASOH 4QLCU 4YAKB 2YZGA 2IGKA 1UHSA 1BOAA 2CZGA 3OS0A 1MBEA 2XASA 1PX2A 2FEZA 3F23A 1XSDA 4J9OA 4ZYEA 1GSAA 3BG5A 4FTHA 1F5TA 1TWAA 2DTRA 1V4YA 4BDZA 1KU3A 2XCAA 1S0NA 2W25A 3LL7A 2R93A 2JA7A 2DA6A 5AIPA 3MWDA 1C3OA 1S29A 3OIQA 1B33N 2Y75A 5L1JA 2UXNA 4A3KG 2DIKA 1W7PD 3DXJF 4BU2A 1TNTA 5DTDA 4Y52J 3M07A 2YU9A 2GWRA 2HZDA 2Y0SA 4V2FA 3D1NI 1MMSA 2ALZA 3JRAA 2VOPA 3OHBA 4LF8H 1K4SA 2M8GX 2QSHX 3L09A 3J81K 3PIOF 1GHCA 4AVZA 4S05A 3HRSA 1LB2A 2XIGA 5E79C 2PN1A 4EVIA 3M9OB 1OISA 2FJ1A 2W7NA 4E7ZA 3N6XA 4I0BA 2MH9A 1T8IA 2IS2A 3FX3A 5CLSA 4DJAA 5AIQA 3J80Z 3KXYT 2NNYA 3OYBA 3P7NA 4AIKA 1E2XA 2JA2A 1FBSA 5IYDJ 1R00A 2Y0SE 1A6IA 5LP6F 3KP6A 3JR9A 5D6EA 5F9NA 5KG2A 1A6QA 2CQQA 4FS1A 5KFJA 3BTIA 5LBQA 1W0UA 1S0OA 4XLPF 3I64A 2VODA 1ZG1A 2XV4S 2EBIA 1DV1A 1I3AA 4M3BA 4XQFA 1I94H 1YLFA 1B72A 4A3GJ 4PSXA 3DCFA 4EEFG 3GF2A 2I80A 1FP1D 4B3XA 4EM0B 5KFOA 1IBKH 3L4KA 1EH6A 3LSJA 3RGXA 4IRCA 4KN4X 3OYIA 4CUGA 4ESBA 5C1OA 2Y69H 3RAXA 4IVNA 2HWVA 2B0LA 4OIOF 4NBQA 4XKCA 1KYWA 1TQIA 3DEEA 1D0XA 1JJ8C 4G8XA 2P7CB 2NU6B 2VXDA 4E7IA 5KFVA 3PIPF 3KAKA 4LFAH 4IXAA 3I4NG 5IYCG 4ZH4F 2F4MB 1A04A 4B1RA 1G59A 3S17J 1BM9A 3M9NB 3GLXA 4W1UA 1WJ5A 1SEUA 3JAMW 5JHFA 1WJDA 1XSXA 5CVUA 2Z33A 3F0CA 5E20A 2F6CA 1Z9CA 1IN4A 1FNNA 5GADJ 1RZ4A 2DFEA 4KN7X 2W1OA 3W6VA 3M9MB 1Y8RB 1EKEA 2WADA 4P9FA 2UZKA 3AG4H 2R0QC 3S2DJ 3WU2C 4KHPH 3WTTC 2IP4A 5FLXW 3S32A 2VE9A 1WI3A 5BR8H 2P8TA 3HHHA 2FK1A 4QWAA 2CUZA 3Q0UA 2UWMA 4YP3A 1TC3C 2XAJA 3C7JA 3ZPLA 4A3MG 1CQIB 3HSFA 1UELB 3EPIA 2BHYA 5FFXA 3JRGA 3KYDB 2ZKZA 2IA6A 4YFKF 2HDCA 5GAEJ 5C44J 4XLAA 4ZZLA 1BJTA 2B7EA 2FD5A 2XB0X 5LYJF 1CQTA 4IKFA 2EIMH 2DAOA 2OZ6A 1Z3YA 1B72B 4YIFA 5GAHJ 1DGWY 2G9WA 2IGMA 2R84A 4A3FG 5C3EG 2KISA 3ECOA 4BHCA 1BL0A 2IRFG 2HHHH 4DR4H 2A68F 2CG4A 3Q2OA 3TBIA 3H5RA 3HGGA 4Y17A 2KPMA 3RPQA 5KFIA 2CGPA 4RB0A 4BE1A 3H1CA 4LF9H 1ZRDA 4ECVA 1OJLA 4BQAA 2IGNA 3LSTA 4U87A 3PW2A 1OCRH 2BV6A 2QSFX 2NS0A 4A0ZA 2K9MA 5K1YA 5KFAA 3J80W 3WODF 2YYAA 1ETVA 2W82A 2QKLB 4XONA 3RCOA 2K9NA 3WU0A 4YRVA 3JAMK 1D1BA 3Q8PB 1XX5A 3R60A 4XN0A 2B63J 2OLSA 4NNJA 1HA8A 2O0YA 3WE3A 4HNVA 3J7AO 4IZZA 2W70A 3OL3A 5J1RA 4ZQIA 1I3QJ 1OCCH 2EZHA 4IRIA 1C30A 1X3WB 2QF7A 3HSRA 1KJ9A 3PW7A 2HDWA 4HA8A 1K83A 3CDLA 2W85A 3PW4A 1PUEE 4IWXA 5FLXK 2VUMG 3GX4X 5J2UF 2O9LA 4CDGA 3TMOA 3OYGA 4GGGA 4A5NA 4EYHB 1V51A 1HNXH 1RR8C 2ECBA 5LEJA 4M6VA 3L2UA 1B9MA 2ZXJA 3H5AA 5CYVA 2BY0A 5HLTA 2VQCA 3E5XA 3S15J 1WI9A 1NHAA 3FK6A 1X58A 4M6XA 2X6OA 2BW3B 4OAZA 3TQNA 2O03A 3FBIB 3UNGC 1ZARA 1U78A 3EYYA 4GO1A 2NVTJ 3ABUA 1UCRA 2Z1DA 2FBKA 2JT1A 5HDNA 2FLNA 5GPAA 4HR7A 1UC8A 1X1DA 3LMLA 1UAAA 3D5RC 2NU8B 3X2QH 2V6EA 4L0ZB 2KLOA 4BJ5C 1B4AA 3ERMA 1WSUA 2Y9YA 1BI0A 4LOCA 5CVRA 2V1XA 1XS9A 3ZMZA 3K1NA 1V5FA 3OIOA 3G1OA 2K27A 1WH5A 3ZP5A 2R7TA 3RAQA 1WJCA 1TWFJ 4NXMH 1VI0A 5HS9A 2BZTA 4BBSJ 3FKJA 4MQ9F 2Q2UA 3K10A 3OOUA 5L9XA 3H4BA 2PI0A 1FSEA 2XF5A 4DYCA 1MDMB 2DTZA 2HR3A 4U0YA 3GTKA 1YI2I 3CTAA 5KFLA 2VUMA 3DF8A 3J80K 3PJRA 1UG2A 2K4JA 4XRFA 3FDSA 4RZQA 4CO8A 4I6ZA 1EJ9A 1LPQA 1RK6A 1LDJA 2A69F 2CYYA 3DLLF 5KG3A 4DV4H 3ABKH 1S72I 5IYDG 5KNLA 1LFPA 2HKXA 5ICGA 4DR7H 2WTEA 3AL0C 1ZR2A 1V3FA 3L2WA 3CC7I 4CA0A 1ETQA 2DMUA 2E5NA 3OYAA 4MV7A 1LE8A 4I0AA 4HNTA 2R5YA 1B9NA 5LOVF 2R7NA 3KEOA 3DU5A 4AVPA 3K1MA 4A3GG 2QA4I 4KNYA 1W7PB 5CPRB 4B44A 3ELKA 1ZQ3P 4DR6H 3ABTA 4XRMA 4P96A 1F1ZA 4C3IJ 5E1WA 4GDFA 4BEHA 4M9SA 3O6BB 2UXDH 2ZJ2A 4BE0A 1I27A 4CZZA 1VNDA 3C1DA 3PNYA 5EZGA 4RU9A 3F22A 3ROUA 5ED4A 5E3MA 4C2MA 5D5VB 2L02A 3BG9A 4PDKA 1YITI 4LG0B 1A0IA 2M0CA 2DLNA 4JUZA 5EEGA 3SDBA 3T1HH 2RNGA 4MO7A 4OIQF 2F4VH 3L2PA 3QPTA 2D2WA 4IRGA 2EPFA 4J9KA 2XGCA 3U21A 2XAFA 2FMAA 4MQVA 3BPXA 3LSKA 4LSXA 5JR3A 1IRGA 3QYEA 4JI7H 5EWEA 2JRTA 2ZSHB 1AU7A 3MFIA 3C18A 4O3SA 2R7ZG 3KP2A 3EETA 3CCMI 3E1SA 1IN6A 4D7NA 2H1KA 3QOEA 2R7FA 4E4TA 2O5RA 5KFUA 1F4KA 3RQ4A 3LSMA 1NK2P 4L18B 2W9AA 2L54A 3TO9A 3HG9A 3OYDA 1X2NA 4E7HA 4B3TH 2Y48A 2HS5A 1KJJA 5D8LB 3VODA 3IAS2 3RDIA 3G6YA 2ZNZA 1RPWA 4AYBN 3RTRA 3CMEI 3GTQJ 3PNVA 4HDVA 1A36A 2W84A 2M0MA 1I1GA 5DG8A 3OL4A 5CVIA 4Q4ZF 2VLAA 1GXQA 3GTOJ 1XSVA 2Z9OA 4RNNA 2JQ7A 5IT3A 2X6WA 4KT5C 4RGSA 4ZYAA 1FMVA 4LB5A 3T1BA 3ZMUA 1N48A 3I56I 1MGTA 3HOYJ 2JJ7A 1SMTA 5IYBJ 2JA6G 3CF2A 3D5SC 4F4WA 4M3GA 4HX7A 3V8JA 5EYRA 2J5OA 4EJTA 2MYSA 4CYCB 2CQXA 2R7XA 4HEA2 3FM3A 4F4XA 2PN6A 4ED3A 1FMWA 3PSIA 4CXFA 3S2HJ 1XGMA 1ZHSA 1VAJA 1X3UA 3EUHA 3RPUD 4LFBH 4BXUA 4U7BA 4M9ZA 2XGQA 3FXLA 2XROA 1FBUA 4JI1H 2R7ZA 2G7HA 1M0WA 2AQFA 2D1VA 2P4WA 4PJ0C 2LKXA 1IO2A 2VPRA 4FISA 2DYSH 5J6XA 5J1YA 4BACA 1GSHA 1HOMA 3RB6A 2MC4A 2VQHA 1J7KA 1MJAA 1OPCA 1UHWA 5EDNA 2L7ZA 1L3LA 3PFYA 4QPQA 1NK3P 4UCTA 2ID6A 2GXAA 2Q0OA 4P55A 2UVUA 1F36A 4WWCA 2C2DA 1GV2A 4WXCA 2KIUA 4EBDA 3QPLA 2PMZN 2V79A 1G3SA 4JYKA 5H6QA 1T08B 5B1BH 5JVGF 1ZG5A 1R9TJ 1RJRA 2R82A 1TQMA 4AWXB 4KDPA 4XX0B 1HDDC 3DBHB 3H3VH 4LLNA 3AYHB 5JVTA 2DXIA 2DDBA 2EFWA 4XIDA 2AQ4A 1FC3A 3FMAA 1OWTA 1FTZA 1ZHFA 4D5FA 3K4JA 1G3YA 3GILA 2JA6A 3M1EA 3WTYC 3OUZA 2M8EA 4NC8A 4P9UA 1FWZA 3S16J 1AWCA 3WGHA 3PO2J 4L0YB 4BJ6C 3K2AA 1K78B 3HPHA 3CC2I 5K5QA 2OTLI 2NVXJ 4HX4A 1I39A 4IHVA 4XKVA 2JVHA 2QENA 5K7FA 2W9BA 2IA0A 2DOEA 3HOUJ 1BR1A 1SD7A 3OYCA 3IKTA 4HSTA 4BY1J 4MV6A 1M6VA 3ZXSA 4C2UA 5DEQA 3N40P 3F3XA 4FE7A 3RYRA 2HOSA 1WQ2A 4O5VA 2W24A 2GPSA 2XC9A 4BNCA 3RJPA 2WDTA 5EG0B 1J5EH 4FBUA 4LITA 2R7OA 3S8PA 4ZDOA 2RN7A 2LG4A 2Y0MA 2DQLA 1I6UA 5A2QZ 3EQLF 4UFZA 1SD5A 4ED7A 5EGOA 2JUCA 1VQ4I 3WO1A 3TL4X 3UFXB 2XRNA 2DWCA 3M4OJ 3HOXJ 4ETSA 3LSRA 1I6XA 3IC7A 3QAHA 4PCQA 3BG6A 4NQWA 2UUZA 4LIUA 3CMAI 2FSWA 5IY5H 2FB9A 3AKZA 1ZRCA 1XD7A 3RZOJ 1VFCA 4X6AJ 2V59A 2EFQA 2VBWA 5LMNH 1IRZA 1DP7P 3KLNA 1OCZH 3BC8A 2EV0A 2LOOA 3DKXA 4UUVA 2R7MA 4FQGA 3HUGB 2VONA 2YR2A 3MD2A 3BZCA 1TL8A 4CCMA 1AKHB 2FBHA 5JLXA 1EUCB 4AC0A 3LSIA 3U1KA 4HF1A 1WWXA 2GIVA 4A3LJ 4WF2A 4I02A 3NARA 3ZGKA 2ZDQA 4CICA 1X1BA 1UB9A 3S2WA 4OMZA 3PUBA 5BMVF 2DCEA 2Q1ZB 1QRYA 4DR3H 1MMGA 2VUGA 4XR6A 2R7KA 5BMZA 4A2AA 3W2VA 4UVBA 4MV9A 3A02A 2PLYA 4A3CG 2BOLA 3E6MA 3H9GA 4C9YA 3CCVI 4UV9A 3N8DA 3MR5A 4HSRA 3MFHA 2ZB9A 3LSGA 1KONA 1T95A 1X1PA 2GIZA 3KX2A 5DCFA 4WD3A 4J9PA 5E3LA 3RSNA 2YZNA 2QQ8A 3DFGA 2WWYA 1U8BA 3KHGA 1H9GA 1QPIA 1T33A 2OCEA 3FK7A 4M9XA 4F50A 2P6TA 1N32H 1UHMA 2JPBA 2L0KA 3DF7A 3ORRA 2YW2A 4O3RA 2QBYA 3VSLA 4XRSG 4BAYA 3U1DA 1YJWI 3KHRA 4NDLA 4DV0H 5C8YF 3KIOA 2WB1N 2E36A 3QWLA 4HNUA 5EF6A 1IOVA 2ZDGA 4DV6H 2H6BA 1MZBA 5LFAA 5EGOB 2DU9A 1FYMA 2FPIB 3F8FA 1R7JA 4RB2C 4FX4A 1SVMA 4E4HA 2IT0A 2IS4A 4C5AA 1LFBA 2V58A 4YAJB 4IPAA 3GV5B 2Y2ZA 4IRDA 3M4IA 1P4WA 4MA0A 2UXXA 2L7KA 5CJ9A 1KU2A 2KRCA 4YEJA 1R36A 4MTEA 4I4TF 1QGPA 4LH7A 4F55A 2ME6A 5M5YJ 2J6UA 1DDNA 1DV2A 4BKXA 5DG7A 1GLVA 1QHHD 2LY9A 2FE3A 2K86A 2RVCA 3IH4A 4LF5H 1GUUA 3H92A 2XAUA 2RDPA 1E17A 4D1QA 3CUQB 3DP7A 1MD0A 1LQ1A 1K4TA 2HYJA 2BXYA 4WX9A 1ZRFA 2B9SA 3FF5A 1JIHA 4GXOA 5M5XJ 1P4XA 2M45A 1USSA 5DV5A 2D1HA 3EPZA 2OF7A 1B1BA 3KZIC 5EWFA 4JI6H 5A2QW 2O7OA 1S7AA 3KHLA 1Y1WA 1JLLB 2A6EF 3I58A 4XRSA 1LDDA 5H6RA 4C3JJ 1UFMA 1STZA 5BOXA 2YRWA 1DU6A 3SEZA 3LAPA 3SE7A 1P9QC 4D7MA 2OU2A 2LD5A 1BJZA 4A3JG 2QSGX 5H80A 2OQGA 4PFOA 2C2RA 2A5WA 5TJJA 3U2RA 3SJMA 3BY6A 1EYZA 3BTLA 3DTEA 2KRHA 2HVSA 1TWCA 1XGOA 5LHIA 4O4HF 4ECRA 1ZYRF 1O3QA 4Q5SF 5CQGA 4NHJA 2CH0A 3PVXA 1E3HA 2XGPA 4ABZA 1YRNB 2WY8Q 1SD4A 2HOAA 2Z5UA 3M8EA 4BL0B 4E7LA 2QBYB 1IV8A 2R5ZA 2L7MP 3V4SA 4PJNA 5CKTA 3FXKA 4AD9A 3S1RJ 1MNMC 4TV7A 2C6YA 2X0LA 3NEUA 1UC9A 4G12A 1U2WA 2NS8A 3LQQA 3OV8A 2V4QA 5KG4A 3ETJA 2KIFA 4ZTJA 5D1OB 1Y6IA 4HLXA 4BXXJ 1IV6A 1EH7A 3CQZA 3TKYA 4MV3A 1T36A 3E5QA 4DZJA 2VA3A 2I8DA 2ZMEA 2H8RA 2NVYJ 3UQ8A 2GXBA 2GZWA 3OMYA 3MVPA 4UCRA 2J6TA 3BR0A 1JX4A 1N78A 4HOBA 3T8TA 2EV6A 3B73A 5EDWA 4EM2A 3P9CA 1DP3A 2ZM6H 5DGBA 1WCMJ 2NVUB 2ZJRF 5KFBA 2LKSA 2L4MA 1D1CA 4GRIA 4IQ4A 1XMQH 1KA8A 4BY1G 1OCOH 1XMKA 1KJIA 4DL4A 2V9VA 4A3DG 2LY2A 4ECSA 1SFEA 2FNAA 4B3AA 3T8RA 2JWTA 1B8IA 5J4VA 2H27A 5KFEA 2UUBH 2EB7A 2M7BA 2W48A 1VS0A 3PSFA 3WGGA 1SFOJ 3V4GA 4O3PA 2MABA 2OH2A 1MSEC 3JRWA 5A2QK 4FX0A 4RAGA 2P81A 3KPHA 4XOTA 5J1UA 5HOOA 1JDBB 1L0OC 5KFKA 4YIIA 3QODA 4Y15A 1HNWH 4UB6C 3TP0A 2ISZA 2E1OA 2CJJA 2JA5J 1IJWC 2E60A 3DPUA 3ZQGA 3HOXG 1V5GA 1ORKA 2GAUA 4H4KC 5FD5A 4FU0A 3NWTA 3OYJA 2K40A 2EINH 2ELJA 2X4HA 3WTXC 1FVIA 3R5XA 5KG0A 3H0GJ 3GTMA 2R5ZB 1JHHA 4I7HA 3P9IA 1XTAA 1KC7A 1SVOA 2K7LA 2QZ8A 2Z3YA 3IWFA 1T98A 2NS7A 4F52A 5K7HA 3GTGJ 3AAFA 1I1SA 1SCUB 2OAZA 3BR6A 3FXOA 4I2OA 2WY7Q 2KFDA 4ZOLF 2R7RA 4MTDA 2PJPA 4O3QA 3BJOA 2EH3A 3BCBA 2XB5A 4IHJF 3LNQA 5IOYA 2ZMEB 2UVVA 4CYDA 2LKPA 3TEDA 2E1CA 1T0FC 1A35A 2F5DA 2IGOA 1ETXA 3DKYA 4BQQA 4PJLA 4RA2A 2GPWA 3FKIA 4LF7H 5ICFA 4EATA 4RUAA 2Z16A 3T1YH 4IWYA 3VMMA 1U5TA 1DPRA 4J9QA 1HXDA 4YG2F 1Y1VG 4U6PA 4Z2YA 1VTNC 1J0RA 4GYIA 3RI4A 1P6RA 2GA2A 1LUJB 5KT6A 2CUFA 4I09A 3DKWA 1CF7A 1KJ8A 1LJ9A 3L9FA 1HF0A 4FE4A 2E2HA 2ZC2A 3GTLJ 4CCOA 5HDKA 2BY2A 3G3ZA 2F5EA 2QGUA 4CH7A 4BY7J 3MZHA 3VSKA 1REPC 5KG7A 1X9NA 4G6DA 3EDPA 3OR2C 3GWZA 1R23A 4MNUA 3KP3A 2PMHA 3GW2A 4YHHH 1HW5A 1MBKA 1YE9A 2M9HA 2Q2TA 4O4LF 3NRVA 1ONVA 2W8KA 1I50J 2G0EA 4RGRA 4RBOA 1FIAA 3GIMA 3ZR8X 2ZNYA 2BR0A 3C2GA 1XNQH 5K5OA 2PVPA 1YOVB 4A3EG 3IL2A 1GXPA 2R7WA 3J7AK 4HQEA 3RKWA 2NXNB 2HPMA 4LH6A 3L7WA 2VE8A 3HYIA 2V26A 2A07F 2KL4A 2DK5A 1OMIA 4PDBA 2CU7A 4II2A 1RIOH 4GKJH 3VYRB 4DNCA 4G9YA 4QSHA 2HQ5A 3JCUC 3GQCA 4BHPA 1Y1VA 1S5LC 2CFOA 1S8NA 2DFIA 4ZYHA 4PUSA 3VWBA 5D5UB 1YX5A 3G4SI 1C0WA 4O3NA 4IRKA 1FKAH 1QNTA 2LFBA 4L9TA 4ED0A 1YQAA 4D9JA 2LSOA 2VQDA 1BI1A 2LMDA 2CRGA 1IXRC 1LVKA 5IOZA 3K4LA 3QYBA 3GTJJ 5E3OA 2FBIA 4OINF 1T2KA 3MKLA 2VOOA 2JPCA 5IYZF 5FLMG 4DL6A 1WKMA 4HDUA 5GTIC 1J9IA 4B3SH 1SANA 4YBZB 2DW4A 2FOWA 5F1RA 3IH3A 3O8GA 1DUXC 2K3PA 4PJJA 3VOEA 4DYRA 2IS1A 2VB6A 3DTKA 3K1PA 2XPVA 5FFZA 1ZLKA 4V19K 3CLQA 2F5FA 1LNWA 1R1UA 1XGSA 3HJEA 3KLOA 3NAUA 5CQEA 5LRRA 1RUOA 5HV6A 1Y8QB 2R7DA 2HYFA 1TT5B 2Z2SB 3F8MA 2OV7A 4I99C 3WG9A 3OSFA 1V4RA 2DI3A 4HG2A 2OC6A 3F9KA 3OY9A 1X1AA 5DQHA 1MNDA 2V9PA 3BTJA 4HV5A 5F0CA 3T5HA 5HDGA 4Q43A 2E2IJ 3GIJA 2RNJA 3J7AY 4Y4RA 2R92G 2PQ8A 3PO3G 1UZCA 3E0JB 3PZPA 2K9LA 1I5ZA 3DEWA 2X0SA 1N25A 1TWGJ 2VN2A 5TGTA 5FROA 5DLFA 3BQ2A 3VPDA 3GO5A 2W6QA 2LF7A 4LG3A 2MLKA 4Q47A 1O3SA 1M7JA 3G8CA 1M1EB 1BXRA 1F9NA 2CSOA 2VJJA 1O75A 1IG7A 2RDJA 1X2MA 2ICWG 1O3TA 1LKXA 2XAHA 4W97A 1VKZA 2DPIA 2UXBH 2EZLA 4C2TA 5L3DA 4LLLA 3F8BA 1EF4A 2DFHA 4DV3H 3ZMTA 1QBJA 2JSCA 3H4DA 3Q0VA 1B6SA 4LLGF 2LTPA 2VC1A 2I5UA 3MN2A 3H36A 3HOVG 1VBGA 4F93B 2XPUA 3BR1A 4ZYGA 3TOAA 3DTIA 3ZMDA 2TRTA 4HF0A 1W0TA 3C2HA 4MV4A 1RESA 1HKSA 2ASJA 4E7KA 4UCOA 4JBAA 2W71A 2YUSA 4CC5A 4DIQA 2VI6A 4B09A 3ASNH 3JRBA 5B66C 2CQNA 2FA5A 2QUFA 4P5OA 3GIQA 4HYKA 3TQ1A 3WTWC 2R92A 1K6YA 3H9QA 3PQKA 2IBDA 2FXAA 4ME6A 4MFEA 4J00A 2MFZA 1HDPA 5FPOA 2LDUA 2RREA 3VB2A 1H88C 3S3MA 4UVCA 1SFUA 1JGSA 2HOEA 4FT8A 2UVWA 4ZJZA 5M5WJ 4DL7A 4M3EA 2HGSA 4A3BJ 3B6AA 2QYOA 3FBNB 5F64A 1EHIA 1Y14B 5KX5F 2DJNA 4FETA 2I8CA 5JVLA 3BJYA 2ESNA 5JQWA 3BR3A 2X6YA 1S0MA 2V4RA 1BGWA 3DBRB 1HR0H 4ZDPA 3WHBA 3CUQC 1R1TA 3GMEA 5DGAA 4XKWA 4FBTA 4L1KA 2CW8A 3CJNA 4AYBA 3Q9SA 2CQKA 1U3EM 1N75A 2MH2A 1XDSA 1E3OC 2Z99A 5KT7A 2R8IA 2M87A 3BOQA 4ECUA 1SYXB 5LHGA 4O4IF 2IP2A 5ILUA 2ECCA 4IL6C 1MBFA 1R5ID 3JZIA 1IBMH 2R8JA 2EFPA 2X1EA 5IT9Z 5L1KA 1S03G 3PQJA 4BUPA 1H89C 2E1MC 2TCTA 2GXGA 2W4SA 2HU9A 3RQIA 3JTGA 5KFNA 2DA1A 1ZH5A 5DM6F 2GQQA 1TBXA 1IZ1A 5LL6b 1UNNC 3MKZA 4AYBE 1XPXA 3SXYA 2L2OA 2DZDA 2XDVA 3BTCA 2QQAA 3M8FA 4ENNA 3JSOA 5H20A 3G73A 5J3LA 1A31A 3HTSB 5J2TF 1PJRA 3R0AA 4UUSA 1BW6A 1P92A 1OYYA 1WRJA 3F8CA 1XMAA 2FU4A 3I9V2 3FMQA 3LWFA 2E35A 5ICEA 3V4ZA 4DV2H 2JEFA 2JEIA 4MGRA 1LVAA 1E4EA 3I71A 2A3SA 5C4XJ 3CMMA 2DLLA 3O2PE 4CZCA 3QYFA 1FSHA 5BPFA 4Y13A 2Q2EA 1FLIA 3KAJA 4HX8A 4JX4A 2FPPB 4UV8A 3FMRA 1IF1A 4X0GA 4G7ZF 3PN1A 2YS9A 3DPLC 5JLWA 2DODA 4KT6A 2PMZA 1ZK8A 4JI4H 2W9CA 2P6SA 1J5YA 3HOZJ 4IHWA 3L1PA 2LK2A 5D4SA 1DU0A 3T5JA 1SFKA 1XC5A 3IWZA 1VQ6I 1FYLA 3BLYA 1O7LA 3BJAA 3HKZA 5KKNB 4DGWB 3CCSI 2GBYA 2XCPA 2VJ4A 4LF6H 3A03A 3GIIA 5KFCA 2XGXA 2ID3A 4RLQA 4E70A 3KP7A 3HOWJ 3TO6A 4BE2A 4TQSA 1QZZA 3O8HA 3RB0A 4E7JA 2LVSA 4JOMA 2DDAA 2YSRA 1Z6TA 2XSDC 4JV1A 1BR2A 4IHSA 4BJTA 2PMZE 4JV0A 2CW0F 2MGQA 3HHGA 4YELA 3RBEA 4JI2H 4I76A 4ANJA 4LFCH 3E6CC 1E4FT 1Z05A 2XHKA 4N4NB 1FJLA 3JREA 2DMTA 3LOCA 3HKZE 5LXTF 4NUBA 2EIJH 2L4AA 3OSNA 2QEXI 1A9XA 3U9TA 2EFNA 2DMNA 3CDIA 3IHUA 4UCSA 1D5YA 2BVMA 3TOBA 2O61A 1MNEA 2PX9A 4HV6A 2FOKA 4LSAA 5L1LA 4Q44A 2AGPA 2QQ9A 3RV3A 2FUG2 2K5CA 3HIFA 3SYTA 4AQYH 4JK1X 4BQOA 3CO7C 3H3VK 2DK8A 2OJED 2ZXHA 1JKQC 2R7QA 1VBHA 4XSXF 1AUXA 4NB5A 5LD2C 1YG2A 1SAXA 4EV0A 2JSPA 4DOZA 2C22A 1G3TA 1TNSA 2BXZA 2MSYA 5C44G 1LE8B 3O3KA 3BJ6A 1S9FA 1E4EB 4EYIB 2R5YB 3OYEA 1ULZA 3B6CA 5K2MA 2AGQA 2R8HA 3GBGA 3KETA 1ZHQA 3GUDA 5L3CA 2W8LA 1KQ0A 4IHTA 2Q2EB 2KQRA 4XBFA 2UU9H 1BI2A 2MW8A 4A0XA 1BR4A 3DBLB 5TISC 1ACIA 2L7FP 3GVAA 3ORQA 2F5CA 1XCVA 1ZAOA 1PK8A 1TW2A 3BQYA 4YFNF 3IP4B 2WYOA 1XB4A 4BEHB 1YTYA 5EOYA 4Q8EA 5IT9W 3EYIA 1YIOA 1TWHJ 4M72A 3VDXA 2IXSA 5J8FA 2IAIA 2ME0A 2HVRA 2OUMA 1Y39A 4KYWA 4ITVA 4DL2A 4PK4A 2B63G 4JQFA 1OR7C 3R23A 3SZGA 5DYMA 3KFWX 5IP9J 1FOXA 3SQNA 2W57A 1BI3A 1VF9A 1Z21A 3AG1H 3ZN0A 2LY1A 3GTPJ 3Q0WA 2ZJTA 1U9NA 1JTXA 3FXRA 3QFFA 3BWGA 2OTJI 5DQGA 2A05A 4CC6A 4CGZA 2LREA 1IUYA 1MKMA 3OWTA 5GPCA 2AHQA 4XLCA 1I6HJ 5IPAA 2IPQX 2PBZA 4B8XA 2NU9B 3FZVA 2ASLA 2M34A 1BC7C 4LD5A 4N0BA 4FCYA 3DLAA 3CLOA 4RAFA 4XNFA 4BGDA 3F6OA 4WK8F 4A0YA 3Q8RB 5F27A 1SEIA 2XGDA 1ZETA 3HZJA 2M5WA 2KJCA 4A93J 5KFYA 4KIFA 2KZVA 2X9DA 2IS6A 1ZELA 4PFPA 4C30A 2ZJQF 2D5VA 4ZDLA 1D8KA 1W93A 2WB1A 3JTHA 4N9HA 4XYMB 1N36H 1HKTA 1DGSA 2FLPA 3A01A 2XCLA 4EJWA 4JI8H 2CUJA 4B43A 1TWAJ 3I0TA 4IAJA 4A3BG 2XUBA 4MLOA 2JEJA 1XMXA 3CCQI 1KEEA 3E7LA 2R93J 2IMWP 2JA7J 2VA2A 1Q1HA 3KCCA 1NH3A 4Q45A 3BZKA 3U9GA 1APLC 4PSWA 3BPVA 2XPWA 1J09A 5IP7J 1HQCA 5JHUA 2DA3A 3H35A 3M9AA 2IEKA 3BR5A 1CQJB 2YU9J 5HVQC 5KG1A 1B59A 2B63A 3K3VA 3SHFA 1E3PA 2JA8J 1K6OA 3RUPA 2VL8A 1I3QA 1WH7A 2M4GA 2WV0A 3S93A 2WB1E 3WG7H 4BBSG 1NG7A 2BVLA 2CO5A 5HNHA 5IT9K 1OQYA 4O3MA 1VQ5I 1LEAA 3MWMA 5BS6A 2DA4A 2QQBA 1YW7A 2K3FA 1FOWA 1FTTA 2EA4A 4KFCA 4EMSA 2DFFA 3OUUA 1S7OA 5J8CA 1V9PA 4X62H 4DR2H 4FHTA 2PJRA 4AU7A 5T14A 4XN3A 3OYFA 4BBRJ 2VJ5A 1MH3A 1MH4A 2P7VB 4NC6A 1ENHA 3RB4A 2L3DA 1SVLA 2CUEA 2DN0A 3BP8A 3EUAA 3I59A 4Y33A 2WAQN 4HAMA 2NOJB 3CCLI 2AS5F 3WNZA 3OIPA 1JHFA 3IKVA 4IRHA 3OSGA 1B6RA 3GZ6A 3E97A 3OOPA 4UHTA 3JSNA 4QPOA 2R8KA 1JUPA 3KP4A 1PDNC 3FXMA 4L9NA 2F4OB 5CVVA 2JK3A 2E1NA 1R5HA 4LFUA 2MBFA 3OYNA 3JRDA 2NRAC 2HEOA 2W6NA 3N41B 1CGPA 3HBLA 5DDGA 1XG1A 4RGUA 1PYVA 3TW7A 4JYAH 4A3KJ 2V1UA 2QLZA 4L5JA 4B3RH 3FXQA 4F4ZA 1NG6A 4MA5A 5H2FC 1KQ9A 2V1DA 2ADUA 3IV5A 1ERDA 1R4NB 5D5WB 5D8KB 3LA2A 1RJQA 1TWFA 4S04A 3OR1C 3BR2A 4OU0A 4O2AF 2I10A 1AA7A 3PUFA 1K1SA 5KFDA 2EWNA 1G3WA 5K7ZA 2BY1A 1WR2A 2J6SA 1POGA 3TO7A 2M05A 1ZR4A 3RF2A 1H9TA 5JVDF 4RAYA 2HDDA 2H6CA 2VBZA 2MLGA 3QP6A 1OCPA 4EEYA 5E3NA 4BQNA 2GOMA 1TTYA 3PM1A 3C0FB 4YR3A 5K5RA 2V9WA 4J9MA 5DCMA 1S6LA 3CCEI 4G7HF 1BN5A 2VR1A 3IRRA 1Z91A 2Y9ZA 3S1MJ 1U6GA 3I4MJ 1Z0XA 1PVEA 1EUDB 2QM3A 2K4BA 2VQFH 9ANTA 3SI8A 2C2EA 4XL9A 2BBYA 4NQWB 4QWDA 3E5NA 1TW3A 4IO9F 2X1CA 4OWRB 5BPIA 5D8DA 5E1XA 3WO0A 2PJRB 1IOWA 3F21A 3ZQHA 3R61A 5LGTA 1QA6A 2W6PA 4YJ3F 3OYLA 3CO6C 4B4CA 4ECXA 4AIJA 1V54H 1ODDA 3I59B 2W9BB 2YU3A 5HBRB 4GLXA 3K4KA 3FHZA 2KKOA 3HOYG 3S3NA 2ISYA 5IYBG 5IYCJ 1O7FA 3ZMSA 1RJPA 4OOIA 3H3ZA 1BW5A 3KP5A 3GFJA 3EUKL 1ZGAA 2ZO4A 2FP4B 3LA3A 2O8XA 2L5QA 4DYQA 4DR1H 1YS7A 2ZDHA 2WC2A 5HODA 4B48A 4R7RA 4TUYF 3DV8A 4CCKA 3V7RA 1PP8F 1AN7A 2D45A 3BAAA 1RYSA 4M9UA 5KT2A 1JXLA 3K70C 1MMAA 4XLNF 1GGOA 4ZTFA 4CHUA 5B1AH 2F2EA 2FQ3A 1JI8A 1Z7LA 1GT0C 1YX3A 4LB6B 3BROA 1TLHB 4R79A 4DLKA 3MR2A 4WXHA 5HLGA 1S68A 5JFRA 3S1NJ 6PAXA 2CQ7A 5DM7F 1JT6A 4HQMA 2DO7A 2P5VA 4A3MJ 5KFXA 1ETWA 3GTQA 4BXFA 2HKOA 3HPGA 4ZZDA 3G6XA 2OZUA 4IR9A 4JI3H 2GA1A 1ETYA 1MIJA 4TQRA 1XMOH 1IW7F 1K83J 3GTOA 1IRFA 2ESHA 2UV1A 3V7CA 3S1QJ 2IBKA 5JH7F 1HW1A 1KU9A 3T5XA 1QU3A 4F3QA 2V6CA 4QIWN 1MBHA 4M3DA 1E4GT 1G8XA 3WU1B 5KHDA 4KISA 4G7OF 4FS2A 2DT6A 2AQEA 1DPUA 3AL0B 4R8UA 4A3FJ 3PO2G 3I55I 5C3EJ 3MEXA 1WZ2A 5L1IA 2A61A 3KYCB 2KP6A 3LSPA 3V42A 4O3OA 4X64H 1FJGH 1O4XA 2HZTA 3FM5A 4M74A 5F0HA 4K0KH 3G2BA 3RFCA 2DMPA 1YFHA 5CVJA 4U7DA 4A93G 2YRXA 4BH9A 3HOUG 5EEHA 1MMNA 2PMUA 1VQKI 2R7VA 2YPRA 3SEQA 3G6EI 3Q1KA 3RIRA 4DL3A 1G6NA 1ULYA 2KRFA 5CA1F 3OTOH 3SZPA 3PR4A 4XM3A 3HC7A 4DV1H 2G7UA 4HLYA 4J9SA 3FWEA 3GV8B 3B02A 2JA7G 2R3SA 1W5SA 3MR6A 1E0EA 4AIHA 4RMNA 3K70D 3JSPA 2EQRA 4XOPA 4WBNF 4X1EA 5F08A 1R9TA 3GZNB 2XAGA 3QU6A 3J7YJ 2JA8G 3QU3A 5DUIA 2FPGB 3K7AJ 4BS9A 1Z77A 1Z2OX 4H0EA 1H0MA 3GTKJ 2I87A 3I12A 2DT5A 4U0WA 2J9GA 2VXZA 4RLFA 2VUMJ 3F6VA 4GYGA 1W36D 4ESJA 4M3FA 2EZIA 2NU7B 1R58A 3DWLE 4DBRA 3GIPA 3RKYA 1IUFA 4RUCA 1JKPC 3EPGA 2PBIA 3QPHA 2R7LA 4BBRG 2RDIA 2OPTA 5EZHA 1XDUA 4KUMA 2NVXA 3KZZA 4MV8A 4ED6A 5KFRA 1MW7A 4G6TB 2V4JC 2DJIA 3SFZA 4DQ2A 5LRSA 3TP3A 4ON0A 1ETKA 3C2BA 2HGCA 2LRDA 4YR2A 4A3LG 5L3BA 2XC7A 4II3A 3I54A 2XAQA 3DPTA 3IRQA 4F4YA 4QWEA 3P9KA 3LAJA 1Y0UA 2EFOA 2OA4A 3S14J 1FY7A 3W2AA 4R8UB 2P0WA 4DR5H 2LP0A 3AFHA 5DQIA 3W2WA 1HW2A 4O6JA 2MA3A 4C5CA 3BQ0A 3H3UA 3KEYA 5DD4A 1ZG3A 1IDYA 3MWEA 3Q8QB 4PZJA 4A2BA 1MMDA 4A12A 2R6FA 4C2MJ 2LBFA 3CC4I 5LGNA 2BGCA 2K85A 3G6VA 5FKKA 4U88A 3L2CA 3MJFA 1B8IB 2FQ4A 3H5NA 4L5IA 1YJ9I 5FKOA 3ZCOA 3ONQA 1KJQA 3W6KB 3V8LA 3L2VA 3Q9VA 1NTCA 3OYHA 1MBGA 2W6OA 1TP4A 5E8GA 1YIJI 2E7WA 4HZFA 3K3PA 4LGWA 4D5CA 2XKPA 1HC8A 2L9VA 4X65H 4ENMA 3BCAA 1JXSA 1W4MA 3GFMA 4A6EA 1V5EA 2HQAA 5DS9A 2BY3A 1W5CC 3W3CA 1W96A 5GONF 1L2ZA 3I4PA 1LDKB 3AG3H 2DPJA 1MBJA 3I4MG 4QJFA 3ZOBA 5FB2A 5J47A 4UNOA 3BQZA 4AM3A 5EJCA 5C1PA 4J9RA 2L9RA 2C00A 4EGYA 4KA4A 3I3LA 4ZI7F 1Z7UA 2PFBA 3QP5A 4MAMA 1S3JA 3HEFA 2NOGA 5BQTA 1KQ8A 3JRHA 4Q8FA 2ZXIA 2ACJA 1FOYA 2A6TA 4PJMA 4IOCF 2CV1A 4Z6YA 1QPMA 4XLFA 2DA5A 4RZRA 1XGNA 2M2EA 3R6SA 1ETOA 5F9LA 2COBA 5FO5A 2NYXA 3EUHC 5D4RA 3VYTB 4TV9F 4DUYH 3CP8A 2UXCH 3RYPA 2ZFWA 2L9NA 2W7OA 5DLGA 3V6KA 4YJ2F 1O3RA 1EZ1A 3WTSC 3E6BA 1BC8C 1GVDA 2E7XA 4RB3C 5TRDA 4MEXF 1I7LA 2WE6A 3NQOA 5FPRA 3H40A 3FHNA 4C3HJ 2R7ZJ 1U5TB 5IWAH 4XSZF 1X19A 4LMYA
chains in the Genus database with same CATH topology
1ZGJA 2XVCA 3D0SA 1HSTA 3TGNA 2M1BA 1OYWA 1IXCA 2IJLA 1J59A 1CF7B 1IN5A 1G4DA 4ZYDA 5KK1A 3E3VA 4RS8A 2LNBA 2RC4A 3N4MA 1QQIA 3FMSA 4F7ZA 3BABA 3WTZA 4PGHA 1U8RA 2HVQA 4ESFA 1ZN2A 5LLQA 3F8NA 3GXOA 1MJBA 1P8LA 1TQPA 1LEBA 1SD6A 2EK5A 4EM1A 4UCVA 2OWOA 1TAEA 2J5PA 3KALA 4D0PA 3V8KA 1YYVA 3L00A 3D5LA 1MDMA 5FGMA 4BHBA 3H20A 4EFBA 5FD6A 3KEQA 3T0YA 4WCGA 4I98B 1D3YA 3Q5FA 3ECHA 2IA1A 2TDXA 1N33H 1P2FA 3DEUA 3TDUC 3WGIA 3CVZA 4LJZF 3GZ5A 2VBXA 1IN7A 1FX7A 1EV7A 1W7PA 2IVMA 2H94A 3BZ6A 2DPDA 4L9JA 3K0LA 1YW8A 2YX7A 1QO0D 3M7GA 4LK0F 4M71A 4ASNA 4LG0A 1BBYA 4UCUA 3MCZA 3RKXA 4BWSC 3W6JB 3HRMA 2HFHA 4HBLA 4EJUA 3E6DA 2FMLA 1KU7A 3ML6A 1GYFA 2HTSA 4BYYA 3REOA 2OD5A 3JSLA 4HYEA 3KE2A 4X66H 3WE2A 3COAC 3V7SA 5ICCA 2CFXA 2DQRA 3GFIA 3MQ0A 3E5UA 2RQPA 3N43B 1RUNA 1Z6RA 1Z1DA 1HNZH 5D5XB 4OX9H 2OQRA 4EEQA 3ZQ7A 2FMYA 2YX4A 4YY3H 4DV7H 4R1HA 2AXLA 2PG4A 4A5MA 5F6FA 1T0FA 5L3GA 2A6HF 4PGGA 3RIZA 2COMA 4OIPF 4ENJA 3FXUA 2EA2A 5E18F 3QRFF 3MFKA 4M6YA 5LMUH 3K69A 2FNPA 4M7EA 2VT2A 2YCHA 1FPQA 4EJOA 5HS8A 1T6SA 1ZREA 2FRHA 1D5VA 2QWWA 1RI7A 2STTA 2ZCWA 5D6FA 4OIRF 4K2EA 1K78A 2KSWA 2UUCH 3LFKA 4UVAA 4L9VA 1BIBA 3HSEA 1M0TA 1IN8A 3LQRA 4A2UA 4Q0YA 1YO5C 2HQRA 4QWQA 1FBQA 1ON1A 3HTUA 2DBBA 2ELHA 1USTA 3HRTA 4EFEA 3ZMVA 5DUKA 4DV5H 1XNRH 3VFZA 2ETHA 4KICA 4DUZH 5L3EA 3HUGA 1FYKA 2O3FA 3RJ0A 2VPSA 3WTUC 1FZPB 4RGXA 2Q8KA 3HXLA 3N42B 1KYZA 1MJ9A 2MD5A 4APMA 1O57A 2STWA 1Z2PX 4Q48A 5KVRA 4KIGA 3GFLA 2PEXA 2BYVE 3PFIA 2A5YB 2UUAH 2XKOA 4IJAA 4WXDA 1TA8A 3K2ZA 1ZLJA 2RV8A 1GVJA 1HSJA 1U5TC 3DQVC 3IG0A 2H09A 4G6QA 4A6DA 1HBXG 1OKRA 2IA2A 2HQNA 2JZYA 4U0VA 5L3FA 1BJAA 5LGUA 1IAWA 4ENKA 2JTVA 3I5UA 4I01A 1WH2A 2VQEH 3KZYA 1JE8A 2KJBA 2VOBA 4JI5H 4N9IA 1EH8A 4RAZA 2IW5A 3K9TA 3TDZC 3CUQA 2MCTA 2P5KA 5LHHA 1AOYA 2VC0A 2O6GE 5ERIA 2OBPA 3J81Z 3RTXA 1R22A 3VEPA 4GKKH 2RGVA 4EQQA 3JW4A 4M73A 3SZTA 2NNNA 4IF4A 1K79A 1W5TA 1HKQA 2DPUA 2RGRA 2K02A 4MEYF 4KMUX 5HS7A 1OYIA 5DD8A 1IXSB 3QOPA 3ZN1A 3GYHX 4RB1A 1B6AA 5HLIA 1P4AA 4LF4H 2QVOA 1RNLA 4B3MH 1XCBA 1KGSA 5D1OA 2EV5A 3R4KA 1YW9A 4JV5H 4YFXF 3RPUA 2FF4A 2BEOA 2MC3A 4R8HA 2RKHA 4HW0A 1SMYF 3HOSA 2E5LH 2VT3A 2LF8A 5LEKA 1FP2A 1K7AA 1QZYA 1R5GA 3I53A 4LK1F 2ZBKA 1D8JA 3C3WA 4JI0H 5E1ZB 3MAJA 1ON2A 3WTVC 4OMYA 4FM9A 2EJRA 3ISPA 5JI6A 4UXNA 3ERED 5D1PA 5E8IA 1N34H 2VBYA 1J2XA 5DCMB 2HYGD 1T38A 3LA7A 2M30A 3MZYA 3RGZA 1SFXA 1R1VA 4HF2A 3HOTA 4KIBA 3BA8A 5ILVA 2BE5F 2P5LC 4GCVA 1FOKA 4G94A 1XDNA 5AONA 2L01A 3J81W 3CUOA 2KIMA 4MHGA 1B04A 3BDDA 3CDHA 1Z2NX 1IBLH 1PP7U 4EJVA 3JAMZ 1T39A 3BA9A 3GEZA 3L4JA 5BPDA 4EGZA 3ULQB 1OR7A 1FT9A 1XN7A 3HRUA 1YS6A 3F72A 3R0JA 5FLXZ 5ILSA 5E17F 5HLHA 1J75A 4KMFA 1BIAA 3N44B 4NXNH 2CWEA 2HTJA 2CW7A 3N97A 2NAZA 4QLCU 1BOAA 2XASA 2FEZA 3F23A 1XSDA 4ZYEA 1F5TA 2DTRA 1KU3A 2W25A 5AIPA 1S29A 2Y75A 2UXNA 1W7PD 3DXJF 1TNTA 2GWRA 2VOPA 4LF8H 3L09A 3J81K 1GHCA 4S05A 1LB2A 3HRSA 2XIGA 4EVIA 3N6XA 4I0BA 2MH9A 3FX3A 5CLSA 5AIQA 3J80Z 3KXYT 2NNYA 4AIKA 3P7NA 1E2XA 1FBSA 1R00A 3KP6A 5D6EA 5LBQA 4XLPF 3I64A 2VODA 1ZG1A 2XV4S 1I94H 1YLFA 3GF2A 1FP1D 4EM0B 1IBKH 3L4KA 1EH6A 3RGXA 4KN4X 4ESBA 4IVNA 2HWVA 2B0LA 4OIOF 1KYWA 1TQIA 4G8XA 2P7CB 4LFAH 3KAKA 4IXAA 4ZH4F 1A04A 1BM9A 3GLXA 3JAMW 1XSXA 5CVUA 2Z33A 5E20A 1Z9CA 1IN4A 1FNNA 1RZ4A 4KN7X 2UZKA 4P9FA 4KHPH 3WTTC 5FLXW 2VE9A 5BR8H 2P8TA 3HHHA 2UWMA 2XAJA 3C7JA 3ZPLA 3HSFA 5FFXA 2ZKZA 4YFKF 2HDCA 4ZZLA 1BJTA 2DAOA 2OZ6A 4YIFA 2G9WA 4BHCA 3ECOA 2IRFG 2HHHH 4DR4H 2A68F 2CG4A 4Y17A 3RPQA 2CGPA 4RB0A 4LF9H 1ZRDA 4BQAA 3LSTA 2BV6A 4A0ZA 2NS0A 5K1YA 3J80W 3WODF 3WU0A 3JAMK 3R60A 2O0YA 3WE3A 3J7AO 4IRIA 3HSRA 4HA8A 2W85A 1PUEE 5FLXK 3GX4X 4CDGA 4GGGA 4A5NA 1HNXH 5LEJA 1B9MA 2ZXJA 5CYVA 3E5XA 1WI9A 1NHAA 4M6XA 3TQNA 2O03A 1ZARA 1U78A 3EYYA 4GO1A 3ABUA 1UCRA 2FBKA 2JT1A 5HDNA 3LMLA 4L0ZB 1B4AA 1WSUA 1BI0A 5CVRA 2V1XA 3ZMZA 3K1NA 2K27A 3ZP5A 4NXMH 2Q2UA 5HS9A 4MQ9F 2PI0A 1FSEA 1MDMB 2HR3A 4U0YA 3CTAA 3DF8A 3J80K 2K4JA 4XRFA 4RZQA 4CO8A 1LDJA 2A69F 2CYYA 4DV4H 2HKXA 5ICGA 4DR7H 2WTEA 1V3FA 4MV7A 4I0AA 1B9NA 3KEOA 4AVPA 3K1MA 4KNYA 1W7PB 3ELKA 4DR6H 3ABTA 4P96A 1F1ZA 5E1WA 4M9SA 3O6BB 2UXDH 2ZJ2A 1I27A 4CZZA 3C1DA 3F22A 3ROUA 5ED4A 5D5VB 2L02A 4LG0B 4PDKA 1A0IA 3T1HH 5EEGA 4OIQF 2F4VH 3L2PA 3QPTA 2D2WA 4IRGA 2XAFA 4MQVA 3BPXA 4LSXA 5JR3A 1IRGA 4JI7H 2JRTA 3C18A 3KP2A 3EETA 1IN6A 2R7FA 1F4KA 4L18B 2L54A 3TO9A 4B3TH 2Y48A 2HS5A 5D8LB 3VODA 3RDIA 2ZNZA 3RTRA 4HDVA 2W84A 1I1GA 5CVIA 4Q4ZF 1GXQA 1XSVA 2Z9OA 5IT3A 4KT5C 4RGSA 4LB5A 3T1BA 3ZMUA 1MGTA 1SMTA 4HX7A 3V8JA 2J5OA 4EJTA 3FM3A 2PN6A 4CXFA 1XGMA 1ZHSA 1X3UA 3EUHA 4LFBH 4BXUA 4U7BA 4M9ZA 2XROA 1FBUA 4JI1H 2G7HA 1M0WA 2D1VA 2P4WA 5J6XA 1J7KA 1MJAA 1OPCA 1UHWA 4UCTA 1L3LA 2Q0OA 4P55A 4WWCA 4WXCA 2KIUA 4J0MA 2V79A 5H6QA 1G3SA 1ZG5A 1TQMA 4AWXB 4KDPA 4LLNA 5JVTA 2EFWA 1FC3A 3FMAA 1ZHFA 1G3YA 3M1EA 3WTYC 2M8EA 4P9UA 1FWZA 1AWCA 3WGHA 4L0YB 1K78B 5K5QA 4HX4A 2QENA 2IA0A 1SD7A 3IKTA 5DEQA 3N40P 3F3XA 3RYRA 1WQ2A 4O5VA 2W24A 4BNCA 3RJPA 2WDTA 1J5EH 2RN7A 2Y0MA 2DQLA 1I6UA 5A2QZ 3EQLF 4UFZA 1SD5A 2XRNA 4ETSA 1I6XA 3IC7A 3QAHA 4PCQA 4NQWA 2FSWA 1ZRCA 1XD7A 2EFQA 2VBWA 5LMNH 1DP7P 3KLNA 2EV0A 4UUVA 2VONA 2YR2A 2FBHA 4HF1A 1WWXA 2GIVA 4WF2A 4I02A 4CICA 1UB9A 3S2WA 4OMZA 4DR3H 2VUGA 5BMZA 4A2AA 4MV9A 4UVBA 2PLYA 3E6MA 4UV9A 5DCFA 3DFGA 2WWYA 1H9GA 4M9XA 2P6TA 1N32H 1UHMA 2JPBA 3DF7A 2QBYA 4BAYA 3U1DA 4DV0H 4DV6H 2H6BA 1MZBA 2DU9A 1FYMA 3F8FA 1R7JA 4RB2C 4FX4A 2IT0A 4IPAA 3M4IA 1P4WA 2UXXA 5CJ9A 4MTEA 1KU2A 1R36A 1QGPA 4LH7A 1DDNA 2FE3A 2K86A 2RVCA 4LF5H 3H92A 2RDPA 1E17A 3CUQB 3DP7A 1MD0A 1LQ1A 1ZRFA 4WX9A 3FF5A 4GXOA 1P4XA 2M45A 1USSA 5DV5A 2D1HA 1B1BA 4JI6H 5A2QW 1S7AA 2A6EF 3I58A 1LDDA 5H6RA 1UFMA 1STZA 5BOXA 3LAPA 2OU2A 2OQGA 5TJJA 3U2RA 3BY6A 2HVSA 1XGOA 5LHIA 1ZYRF 1O3QA 4Q5SF 4NHJA 2QBYB 1SD4A 2Z5UA 3M8EA 4AD9A 2C6YA 4TV7A 2X0LA 3NEUA 1U2WA 3LQQA 3OV8A 2KIFA 5D1OB 4HLXA 1EH7A 3TKYA 3E5QA 2ZMEA 3UQ8A 2GXBA 2GZWA 4UCRA 4HOBA 3T8TA 2EV6A 3B73A 4EM2A 3P9CA 2ZM6H 2L4MA 1XMQH 1KA8A 1XMKA 2V9VA 1SFEA 2FNAA 3T8RA 2H27A 2UUBH 2EB7A 1VS0A 3WGGA 3V4GA 5A2QK 4FX0A 5HOOA 1L0OC 4YIIA 4Y15A 1HNWH 2ISZA 2GAUA 5FD5A 2X4HA 3WTXC 1FVIA