2XIGA

The structure of the helicobacter pylori ferric uptake regulator fur reveals three functional metal binding sites
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
148
structure length
146
Chain Sequence
MKRLETLESILERLRMSIKKNGNSKQREEVVSVLYRSGTHLSPEEITHSIRQKDKNTSISSVYRILNFLEKENFISVLETSKSGRRYEIAAKEHHDHIICLHCGKIIEFADPEIENRQNEVVKKYQAKLISHDMKMFVWCKECQES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Helicobacter Pylori Ferric Uptake Regulator Fur Reveals Three Functional Metal Binding Sites.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Transcription
molecule keywords FERRIC UPTAKE REGULATION PROTEIN
total genus 42
structure length 146
sequence length 148
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2010-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2xigA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 2xigA02
2FE3A 2K7LA 1WRJA 3B73A 2EFNA 3W6KB 5HVQC 1KGSA 1KQ9A 2RNJA 5ICEA 4L9NA 2EK5A 2V1DA 3JTHA 3GEZA 1FWZA 5LGTA 4P55A 4N9IA 5IT9Z 2ZJ2A 4N0BA 4G7HF 2IA0A 3KP7A 3NQOA 4HX4A 3TO6A 5HLHA 1LEBA 5JHUA 1YQAA 1QZZA 2F5EA 1W5TA 2L02A 4OIOF 2G9WA 4M72A 1R5GA 4EM0B 3ZMDA 4H0EA 4CGZA 3VODA 4GO1A 4LD5A 2CWEA 1IXRC 3F72A 5L3GA 2FEZA 5CJ9A 1R5HA 3IC7A 1TTYA 4KYWA 2Z9OA 1S8NA 2Y0MA 3ML6A 2YU3A 4AIHA 3KP6A 1ZH5A 2UZKA 4ZH4F 2UXXA 5L3CA 5LLQA 2RN7A 1YW8A 1J5YA 4KMFA 3V8LA 5DCMA 4CO8A 4F7ZA 3D0SA 2B0LA 4LB6B 4LGWA 3NEUA 1FYMA 1MJAA 4XBFA 4G8XA 4HZFA 4CXFA 1O3RA 4M9XA 3K1PA 2F5FA 1U8RA 5K1YA 2C6YA 2GA1A 5BPDA 3C3WA 3GUDA 3TKYA 3JSOA 3M7GA 4KDPA 1WI9A 1KYWA 1S6LA 1T6SA 4XLNF 2EJRA 4ENNA 4WXCA 4KN7X 2QVOA 4LLNA 1R00A 2P5LC 5BOXA 2EWNA 1GVJA 2ZO4A 4BYYA 2G7HA 3FMRA 4EMSA 2MH2A 1J59A 3P9KA 4IHTA 1W4MA 2CSOA 1TNTA 3IKTA 1RNLA 4M9SA 3BWGA 4UXNA 3HTUA 1Z1DA 4WXDA 3GXOA 1UHWA 1O7FA 2OQRA 3U2RA 3WGGA 2V9VA 1ZREA 2Q8KA 2GAUA 2J5OA 3JW4A 4XLPF 3E6BA 5F6FA 3ABUA 1O3QA 2Z5UA 3RDIA 4IJAA 4S04A 5LGUA 3SZPA 1LDDA 2FRHA 3EYYA 2WV0A 3DF8A 3LQQA 5AIPA 3J7AO 1TLHB 3CUQA 2QBYA 3RYPA 2D1HA 2LNBA 3OOPA 4M6YA 1YO5C 3WODF 1IN4A 4A12A 5FLXK 3K69A 1RI7A 4U0VA 4Q47A 2RQPA 4G9YA 2JPBA 2DU9A 2E7WA 3P7NA 3TOBA 1FP1D 4ZZDA 5FLXZ 2FMLA 1P4XA 2YPRA 1LNWA 5J8CA 2IP2A 2PBIA 1EH6A 3WTWC 1HXDA 1DP7P 4O6JA 4HQMA 1R1VA 1TW2A 1IN7A 5FFZA 4XSZF 3F8NA 4G94A 3PQJA 4BQAA 5CVUA 1FSHA 2PI0A 3R4KA 5KVRA 2L54A 2JT1A 5ILSA 3KP2A 3ECHA 1BM9A 2MC3A 3RKXA 3CUQC 3I53A 3SHFA 2RDPA 5CLSA 1R7JA 3ULQB 1UCRA 3GW2A 2CFXA 3T0YA 4P96A 3RKYA 4A5NA 1FOKA 1HSJA 3HRMA 1F5TA 4HX7A 3HSFA 1B59A 4R1HA 2DPDA 2M87A 2KIUA 1XSDA 4KNYA 4WK8F 4EM2A 2P8TA 3F22A 1E2XA 3K1NA 3L9FA 1I1GA 1G3TA 4L0ZB 2EFOA 2JTVA 1P92A 1YG2A 2BBYA 2O03A 2HQNA 2VN2A 4ZYDA 3V7SA 3K0LA 3FX3A 2ZBKA 4ETSA 4YIIA 1QPMA 5CVIA 4JQFA 1ODDA 3MAJA 3L7WA 3SQNA 3IRRA 3DV8A 2A07F 2STTA 4PZJA 4A6EA 1YS7A 4OIPF 1ZAOA 2NNYA 1V3FA 5D5UB 1TQPA 2BV6A 1SD6A 3GWZA 1MD0A 1UB9A 3BJAA 3T5XA 1TBXA 3ZQ7A 5H6RA 5D4RA 5JFRA 4BH9A 1FBQA 2DK8A 3E6CC 1B9NA 1HW5A 1PDNC 1WWXA 1JHFA 1IRFA 1RUNA 2R3SA 4R79A 1IXSB 2IA2A 1B9MA 3ZMSA 2H6BA 5CVRA 4DNCA 4I2OA 3QRFF 2Q2EA 1CGPA 1YYVA 1BC7C 2ACJA 1HSTA 3GFJA 2OA4A 4BHCA 5HLGA 4HDVA 4A6DA 1O3TA 1ZN2A 2Z99A 2RGVA 3HYIA 4L18B 2CYYA 4WXHA 1I27A 3I64A 2FBKA 4HA8A 5ILUA 4O5VA 2HEOA 2QLZA 1R23A 2XAFA 2JRTA 2FOKA 3HRSA 4GXOA 3ZMVA 4YFNF 1FX7A 4WF2A 4HV5A 1R36A 2PQ8A 2XGXA 1FPQA 2VC1A 4U7DA 3BY6A 4M71A 4XRFA 3JTGA 1IXCA 1JHHA 3MQ0A 3MZYA 3DXJF 2FA5A 2STWA 3LWFA 3E5XA 2XAJA 4A0YA 2YR2A 3M8FA 2LKPA 1U78A 1LVAA 4WX9A 2GA2A 6PAXA 4A0XA 1SD7A 4U7BA 1QQIA 1G3YA 3RPUA 5LHGA 4IRIA 1XGSA 2W25A 2Q0OA 3LQRA 2FBIA 2FSWA 3GX4X 4AIKA 2W84A 1XMKA 5AIQA 4ENKA 4LG0B 1FLIA 2EA4A 3JAMK 4KT5C 1DUXC 3DKWA 3KLNA 3RYRA 3DQVC 5FB2A 5F64A 1P2FA 1SD4A 1SMTA 3ZMZA 2R7FA 3HSRA 5LEJA 3VEPA 2H94A 1ZGJA 1J7KA 1G6NA 5HS8A 2XKPA 4GYGA 4GYIA 4IXAA 3QAHA 2ZNYA 1LDJA 2IRFG 2MA3A 1D5VA 2XKOA 4LLLA 1W7PB 2PFBA 3V8KA 2K4JA 1Z6TA 5D6FA 1R58A 2A6EF 2YSRA 3RTRA 5DD8A 1ULYA 1K79A 3GZ5A 5LEKA 1HQCA 4E70A 4YFKF 1ZLKA 1FY7A 4PCQA 1DDNA 5HOOA 5L3BA 4UV8A 4AVPA 4P9UA 3DPTA 1IN6A 3RIRA 3ZN1A 3K2ZA 1I5ZA 3ISPA 2DPUA 3S2WA 3QP6A 2EV0A 2FU4A 1IUYA 1OR7A 4LB5A 3D5LA 1JXSA 3HRUA 1PP7U 4R8HA 4OIRF 4WCGA 4LMYA 4MTDA 4HF2A 2VT2A 3L09A 3P9CA 1H9GA 2FQ3A 1ZYRF 4IF4A 3IWZA 4OMZA 2FF4A 4KIFA 2E1NA 2P4WA 2VBZA 2OBPA 1FC3A 2VE8A 2GXBA 2L01A 1BN5A 4P9FA 4YG2F 3H92A 3FMSA 3FF5A 1KU3A 5HLIA 3B02A 1QBJA 2ESHA 4MTEA 3I58A 1W7PA 4LK1F 3TDUC 2NS0A 3TQNA 3HSEA 2WTEA 5ILVA 2RC4A 4L9JA 2PN6A 2XVCA 2HOEA 4KN4X 3WGHA 1FYKA 4BNCA 5D5VB 3TOAA 5DCFA 3CLOA 4G7ZF 4HLXA 1OPCA 4HX8A 4IRHA 3E6MA 3CO7C 4OU0A 5A2QZ 1XCBA 2HKOA 3SXYA 3F8CA 4UUVA 4I7HA 1QZYA 1KU7A 4MQVA 2OZ6A 1R1TA 4EJTA 4PGHA 2VBWA 2JPCA 4RB1A 4AIJA 3PFIA 1ZRCA 3U1DA 4HQEA 5LHHA 2XUBA 3WG9A 1BIBA 4P5OA 3PQKA 4I01A 4OINF 2M5WA 4ZYHA 3SFZA 3V8JA 3KEOA 2HYFA 5FFXA 3TO7A 1GXPA 4MNUA 4L9TA 4S05A 1HKQA 2RVCA 2D1VA 2KJBA 2A6HF 4LLGF 4HW0A 4EV0A 1S7AA 5DD4A 3BOQA 1V4RA 3CO6C 3WE3A 4LJZF 5E1ZB 4A5MA 1CF7A 1O57A 4Q4ZF 4KFCA 3R60A 5D6EA 2QQAA 4HDUA 1H9TA 3I5UA 2E7XA 2A68F 1FZPB 2LDUA 4JBAA 4D0PA 3HOSA 3ROUA 3WE2A 3FM5A 2EFQA 1YW7A 5TJJA 1OKRA 2HQRA 1S3JA 2JZYA 3EETA 1SFXA 3LA3A 1XMAA 2BE5F 3N4MA 5IT9K 4EVIA 4L0YB 1XDSA 2VXZA 2D45A 4RB2C 3JSPA 1FP2A 1BJAA 3RPQA 1BIAA 2AXLA 5HDNA 4ON0A 4L5JA 1XGOA 4KUMA 2QWWA 2OU2A 1ZGAA 2VBXA 4HOBA 2ESNA 2R7DA 1HW1A 5K5OA 3F23A 4NHJA 1T0FA 2X0LA 5L3EA 3VOEA 1D3YA 4MEYF 1H0MA 4JK1X 3Q5FA 2VT3A 1J2XA 2UWMA 3GO5A 2GQQA 2V79A 2DTRA 4DQ2A 1S7OA 5E18F 2CW0F 5ICGA 1T98A 2YX4A 3IRQA 4ESBA 4RB3C 4ESJA 3ABTA 4BAYA 3E97A 2HZTA 1T39A 2KRFA 3F6OA 5LHIA 5LRRA 2X4HA 2EB7A 4U0WA 3WTZA 4G6QA 4L5IA 1L3LA 2O0YA 4CYDA 3MCZA 3K9TA 1S29A 4KICA 5H6QA 3BJ6A 1LDKB 4QWQA 3WTSC 3QU6A 2F5CA 5DUIA 5JVTA 3BPVA 3VB2A 3WTTC 3FM3A 3FMQA 3FXRA 2L3DA 2XHKA 3BDDA 1MZBA 1PUEE 4QLCU 2ZNZA 4MGRA 4PGGA 2KJCA 2IPQX 1XB4A 1BC8C 5LBQA 3I54A 2G7UA 2WWYA 4UV9A 3KFWX 3ECOA 2ISZA 3KP3A 4Q5SF 1KU9A 2P5KA 2KIFA 1KQ8A 2K02A 3M8EA 1LJ9A 1TQIA 3RJPA 2PEXA 1HBXG 3I59A 2H09A 3COAC 1AOYA 2HFHA 2HS5A 2V1XA 5IT3A 2DQRA 1MJ9A 5HS7A 4ASNA 4MEXF 3CTAA 1IRGA 1FNNA 1J75A 2LF8A 3KP4A 5BQTA 3F8FA 1IAWA 3GFIA 1QO0D 3E6DA 3GVAA 1ZHFA 1TQMA 2AS5F 2MBFA 1BI1A 3QPTA 4RAYA 4RB0A 2ADUA 3Q9SA 5E20A 1SFUA 3WTUC 2QBYB 1IN5A 3CJNA 5FO5A 3T1BA 1FBUA 4CICA 1YTYA 1C0WA 3J81K 3O2PE 1STZA 2XIGA 2W57A 2FNPA 1W5SA 1K78A 2YX7A 2O6GE 5BS6A 3REOA 3E5UA 1WSUA 2DT5A 2ZMEA 5HDKA 4LFUA 4ZZLA 2ZKZA 2BEOA 1IF1A 1ZLJA 1KYZA 3E3VA 5JR3A 3DEUA 4IVNA 4GGGA 1K6OA 4RGXA 1F1ZA 2VC0A 1NHAA 4BHBA 1REPC 1Z91A 2VONA 4NQWA 1T38A 1ZG1A 1SAXA 4B09A 2P7CB 2W85A 3LAJA 4RAZA 5D5WB 3GZ6A 4O3MA 1MDMA 2EA2A 4I0BA 4Q48A 2KIMA 2XAQA 1Z7UA 3KETA 1BI3A 2LF7A 2HR3A 1BI0A 3BJOA 4KA4A 1G3SA 2QQBA 2PJPA 2O8XA 3M9AA 2ZCWA 1MKMA 3IHUA 4XSXF 1P6RA 2DAOA 3F21A 2V1UA 2QQ9A 4IPAA 1O7LA 4ZYGA 2HKXA 3QOPA 3VFZA 4OMYA 4UNOA 3AAFA 5J8FA 1U5TA 2IJLA 3TGNA 4EGYA 2MD5A 1I6XA 1GHCA 2ISYA 3QPHA 2H27A 1EH8A 2PMHA 3G73A 1JGSA 2NNNA 1ON2A 5D8LB 2E1CA 4UVAA 1P4AA 2RKHA 3BROA 1ZG5A 3O6BB 2WC2A 2BYVE 3EUHA 3KLOA 2O61A 2HTSA 3FHZA 2A5YB 3CDHA 5ICCA 3LA2A 1PP8F 3I0TA 3C1DA 2PLYA 4MQ9F 1UHMA 5HDGA 3R6SA 5ERIA 5H20A 3M1EA 2ZXJA 2M45A 1J0RA 3GYHX 3WTVC 1LQ1A 2Z3YA 1XCVA 3BPXA 3H3UA 3L2CA 5F1RA 1USTA 3W6JB 1X3UA 1JE8A 3RI4A 3DPLC 1GXQA 3SZTA 2EFWA 3J81Z 3DP7A 4LK0F 1G3WA 2COMA 5DV5A 4HAMA 2CO5A 5BPIA 2ZMEB 4FX4A 2IW5A 2LSOA 2HWVA 1XN7A 5D4SA 2XROA 1R22A 3GFLA 1T2KA 1OYWA 2P6SA 2XRNA 4HV6A 3FXUA 1FBSA 4BHPA 1YIOA 1FYLA 4KMUX 3OV8A 2BGCA 1Z6RA 1KQ0A 1Z9CA 5E1XA 2GIVA 3JAMZ 3F6VA 3R0AA 1FT9A 1SD5A 4MHGA 2IVMA 3F8MA 1YFHA 5CVVA 5CYVA 2F2EA 5KK1A 3MZHA 4GCVA 1HW2A 3ZMTA 4HF1A 2VBYA 1U5TC 2OZUA 2NRAC 3LA7A 5BMZA 2Y48A 5DEQA 1ZARA 5HS9A 1ON1A 2HGCA 3HRTA 2QM3A 1YS6A 1XSXA 2CG4A 2FXAA 2IA1A 1B4AA 3KCCA 4EM1A 1USSA 3U9GA 2ETHA 5DCMB 2DK5A 3KEQA 3HUGA 2CGPA 1RIOH 4IHSA 4YFXF 1OYYA 3KZZA 2VOPA 2H6CA 3KE2A 4PDKA 1EH7A 5CVJA 3L00A 4EJVA 4EGZA 4U88A 5DUKA 2NYXA 5D8KB 3J80K 4KIBA 5ED4A 2A61A 2IT0A 4HF0A 1LB2A 4UHTA 2XV4S 1AWCA 2QUFA 2F5DA 5ICFA 1F9NA 1OMIA 2K27A 5TRDA 3GLXA 1XSVA 2DFIA 1LEAA 2J5PA 3ZN0A 3QU3A 3HHGA 2EV6A 3EQLF 4I0AA 4LG0A 4EJUA 2OAZA 1L0OC 2W24A 3WU1B 3CUOA 3F3XA 3ELKA 3GF2A 3ZP5A 4Z2YA 5E8GA 1UFMA 5FD6A 3FWEA 4M74A 4TV7A 1Q1HA 3HHHA 2PG4A 5DDGA 4Y17A 5A2QK 1ZRFA 1HKTA 1Z05A 2TDXA 1MGTA 2GZWA 2K86A 2HDCA 5L3FA 5FGMA 4IRGA 4RGUA 1U6GA 1IZ1A 1A04A 3MFKA 1P4WA 3HIFA 4N9HA 2D2WA 2M30A 4M73A 5AONA 4G7OF 4AD9A 4OOIA 4BXUA 2QZ8A 1XDUA 4K2EA 1IW7F 4EQQA 3V4GA 2O3FA 5E8IA 3MWMA 2FBHA 4FX0A 1XGNA 1XGMA 3C7JA 4I98B 1BI2A 1O3SA 4B8XA 4RGSA 4FHTA 4CDGA 1U5TB 3R0JA 3HTSB 4ZYEA 2HTJA 2ELHA 3EYIA 2XASA 3ERED 1EV7A 1YW9A 1I1SA 4U0YA 3WTYC 1DPUA 1BBYA 1HKSA 3O3KA 2VE9A 5LGNA 4RS8A 1WQ2A 4Y13A 2DI3A 1DPRA 2MLGA 5EEHA 1ZG3A 3P9IA 4I09A 2Z33A 4FT8A 2L4AA 3E5QA 3FXQA 3LFKA 2CQKA 1RUOA 3I71A 4I02A 1YLFA 1CF7B 3HOTA 2DO7A 1VTNC 4Y15A 3GFMA 4HBLA 1QGPA 4L9VA 3IKVA 4UVBA 2P7VB 2FMYA 1KU2A 4CHUA 1XD7A 3TDZC 3WGIA 2OQGA 4EJWA 2V6CA 4ESFA 4CZZA 3LAPA 1J9IA 4A0ZA 1R1UA 2ZFWA 3BP8A 4HLYA 1QNTA 3Q9VA 3EDPA 1TNSA 3R61A 1MDMB 2MLKA 4RGRA 3ZMUA 1U3EM 2K4BA 4OIQF 1SFEA 4G6DA 3CUQB 3C18A 5LRSA 1KA8A 1Y0UA 2OD5A 4HYEA 4A2UA 3RKWA 5L3DA 3MEXA 2MH9A 1G4DA 2RV8A 5K5QA 5D5XB 3K1MA 3J80Z 2XAGA 4EJOA 2EV5A 4UVCA 1K78B 2EFPA 1FSEA 4ENJA 3FZVA 2KKOA 2VODA 3N97A 4AWXB 3ZPLA 1B1BA 3IL2A 4M9ZA 4WWCA 2UXNA 3T8TA 2L4MA 1D8JA 2P6TA 2VOOA 2M8EA 3WU0A 3IWFA 1MJBA 2DW4A 2QYOA 4NB5A 3H3ZA 5E1WA 3T8RA 1F4KA 4YIFA 3QP5A 4ENMA 5JI6A 2Y75A 3KP5A 3I59B 2PMUA 1D8KA 3BZ6A 3NRVA 3I4PA 1TW3A 1WKMA 2P5VA 2QENA 1E17A 5EEGA 1U2WA 1ZRDA 1B6AA 2DLLA 2DQLA 1SMYF 2M1BA 5FD5A 2A3SA 4KIGA 3F8BA 2HYGD 2DBBA 2XAHA 5K5RA 2GXGA 5DYMA 1RZ4A 3TO9A 3LSTA 2NAZA 3WTXC 5J6XA 1K7AA 2JSCA 3DFGA 2FNAA 2A69F 3G3ZA 1BOAA 3V7RA 1W7PD 4M6XA 1IN8A 3V7CA 3KZYA 2GWRA 1OYIA 1ONVA 5E17F
chains in the Genus database with same CATH superfamily
3SZGA 2VPSA 3PUBA 2WBMA 4BY1J 1SFOA 2K3PA 2FE3A 2K7LA 4FQGA 5DG8A 1FKAH 1WRJA 1KJ9A 4CCMA 4UCVA 2XC9A 1SYXB 2V59A 1AN7A 4DV5H 3B73A 2L9VA 3RBDA 2EFNA 3BA9A 3N41B 5CA1F 4CSWA 2BOLA 2VQFH 4OX9H 5GPCA 2HU9A 4PWQA 1JKJB 3HG9A 5KFEA 2XGDA 4QWAA 3RTXA 4BE0A 3A02A 5KT6A 1R9TA 3ESWB 2M0CA 4IKFA 2XGQA 3W6KB 5HVQC 1AKHA 1NG7A 1KGSA 3MJFA 2ZMEC 1KQ9A 1AA7A 2RNJA 2L5QA 2AU0A 4A3DG 2OV7A 5ICEA 3TIIA 4JI5H 3DCFA 4Y33A 4L9NA 2EK5A 2V1DA 3JTHA 3GEZA 1FWZA 4P55A 5LGTA 2VB6A 3LMMA 4IHVA 4N9IA 5IT9Z 3KALA 2FLLA 3D1NI 2W7NA 1TWCJ 2ZJ2A 4BEHA 1VFCA 3K4NA 3ERMA 2JA6G 1XNRH 4N0BA 4G7HF 1M0TA 2IA0A 4CUGA 3KP7A 3NQOA 3S2HJ 2RDJA 1QZEA 2JEIA 3E5NA 4HX4A 3TO6A 4DR5H 2LREA 1VBGA 1S03G 3GIQA 2LKSA 5HLHA 2ASJA 1LEBA 1Z0XA 3G6VA 1B72A 4IOAF 4GLXA 5JHUA 2AGPA 3CMAI 3EPGA 4HSRA 2IBKA 3MVPA 1YQAA 2Y31A 1QZZA 2O7OA 3GBGA 2F5EA 3DBLB 1W5TA 3PUFA 2L02A 4OIOF 1TWCA 4DW6A 2G9WA 1S0OA 4M72A 1R5GA 2WA0A 2R92J 1BGWA 3KHGA 3E1SA 4EM0B 3ZMDA 1I94H 4KITB 5KFQA 1VQMI 4QIWN 2BY3A 4H0EA 3RB0A 4CGZA 1QVTA 2K85A 3I4NG 3VODA 4GO1A 2Y69H 4LD5A 1K1QA 2XPVA 2CWEA 5KAIC 4AC0A 1IXRC 2HVQA 3F72A 5L3GA 2FEZA 5CJ9A 1R5HA 3L1PA 3X2QH 3TQTA 3IC7A 2E5ZA 1FJLA 1TTYA 4AIDA 2ZFUA 4KISA 2VXDA 4DGWB 4KYWA 2CQXA 4LSXA 5DQHA 2LYCA 3RAQA 5CQEA 3DF7A 3IUOA 1M1EB 2Z9OA 3AFHA 3PL8A 1S8NA 4ECZA 2PJRB 2Y0MA 3ML6A 1PX2A 2YU3A 4AIHA 3KP6A 2OPTA 1ZH5A 4JX5A 4ZH4F 2UZKA 4EFEA 2UXXA 5L3CA 1EKEA 2VKVA 2R92G 2E1OA 5LLQA 2R86A 3PIPF 2EPFA 2W82A 3JZIA 2RN7A 2QSHX 4BE1A 1YW8A 4RAGA 1S9FA 1JJ8C 1J5YA 4KMFA 5FRMA 3V8LA 4JYAH 5DCMA 4CO8A 1W0TA 1GSAA 4F7ZA 2XGPA 2QF7A 3M07A 3D0SA 2DOAA 2B0LA 3MR5A 2DTZA 3HOYG 3G6EI 2ECBA 4HSTA 4LB6B 2R7TA 4LGWA 3NEUA 3OS2A 1FYMA 4LF5H 2K9QA 3V4SA 4M7EA 2JA6J 1MJAA 3NARA 2LBFA 4XBFA 1N33H 4G8XA 4HZFA 4CXFA 5B1BH 3H4DA 1O3RA 2V7FA 4M9XA 4V2FA 2WAQN 3K1PA 2F5FA 3RAXA 1UG2A 5H80A 2XF5A 1VAJA 5JH7F 1U8RA 5K1YA 2C6YA 1NK3P 2DFEA 2M7BA 1WSCA 2GA1A 5BPDA 1FMWA 3C3WA 3GUDA 3TKYA 2J6SA 3RB6A 2KLOA 3JSOA 5DG7A 3OYIA 3M7GA 4KDPA 2QGUA 3HOVG 2V26A 1WI9A 1KYWA 1S6LA 3PZPA 1T6SA 4XLNF 1GYFA 2EJRA 4ENNA 4WXCA 4KN7X 2QVOA 4LLNA 3BR5A 4DBQA 1R00A 2P5LC 5BOXA 1APLC 2BQUA 1EUDB 4MV4A 2V5AA 3I9V2 2EWNA 4R8UB 1GVJA 3FBNB 2ZO4A 1X1CA 4BYYA 4ZTJA 2O8KA 2KT0A 2G7HA 4IWYA 3KAKA 3FMRA 1Y1WA 4EMSA 2MH2A 5FKLA 3OUZA 1J59A 4DV7H 3P9KA 4IHTA 2W9AA 4I55F 1IV8A 4FTHA 4A3LJ 4O2BF 2NU9B 1W4MA 2WB1E 2KMUA 5LYJF 4XKWA 2CSOA 4CCJA 1TNTA 3OL4A 3IKTA 2HXOA 1RNLA 1J09A 2ZB9A 3M3YJ 4BDYA 4M9SA 5KFMA 1GV2A 3FXLA 3BWGA 1XS9A 4HG2A 4UXNA 1ZTRA 5F0FA 3HTUA 2R82A 1Z1DA 2RQQA 2W8LA 2W00A 2FUG2 2JVHA 1P8LA 4WXDA 1X1AA 3GXOA 1B8IA 1UHWA 1DU0A 5KT3A 3MR2A 1O7FA 2DA7A 2OQRA 5DTDA 3U2RA 3WGGA 4Y52J 1PK8A 5EF6A 2V9VA 4B3AA 1VQOI 3TBIA 4UUSB 1ZREA 1T33A 2Q8KA 2GAUA 2J5OA 3JW4A 4XLPF 2R7SA 3E6BA 1UNNC 2XD4A 4LF6H 5F6FA 5KFFA 3ABUA 1O3QA 2Z5UA 3RCOA 3I56I 4PJNA 3BCAA 3U21A 3RDIA 4IJAA 4S04A 4YHHH 3GIKA 4BUPA 2W7PA 5LGUA 4B3SH 3SZPA 3HPHA 3BG7A 3HOWG 1LDDA 2FRHA 3EYYA 5J1YA 1EJ9A 2WV0A 4XN0A 2FK2A 5D1PA 2VKDA 1V55H 3DF8A 3LQQA 4II2A 2BY1A 2R5YA 5C3EG 5AIPA 2C2EA 2LK2A 3J7AO 4ECQA 1TLHB 2VASA 3CUQA 1E4EA 4CZCA 2I80A 2QBYA 3RYPA 3OIPA 2JMWA 2D1HA 2KISA 2K9NA 2LNBA 4A3JG 5DGAA 1MMDA 4NNJA 4BACA 3OOPA 4M3BA 4M6YA 2IS6A 4F4XA 1YO5C 3DKYA 4A3BJ 1DP3A 4A2BA 3WODF 5KFNA 5KFWA 4B44A 2B9SA 1EF4A 1IN4A 2ZDHA 1G8XA 2KRCA 4A12A 1B33N 5FLXK 3K69A 4PFPA 3TW7A 1RI7A 4U0VA 4Q47A 2RQPA 3DU6A 1B72B 4MAMA 4G9YA 1EZ1A 4D7MA 2JPBA 2DU9A 1KEEA 2E7WA 3P7NA 4ECVA 2YS9A 3TOBA 1FP1D 4RMNA 4ZZDA 2FMLA 3VYTB 5FLXZ 1P4XA 1S7EA 1JDEA 3OUUA 2YPRA 2R7KA 1T3NA 1LNWA 1B6SA 5J8CA 1PUFB 5LMNH 5KFGA 4IX7A 3CMMA 2FJ1A 3PJRA 1IDYA 1NK2P 2PBIA 2IP2A 1PJRA 1EH6A 1HXDA 3WTWC 1DP7P 3K70C 5CPRB 4O6JA 4HQMA 1R1VA 1YX5A 2XGEA 4JYKA 1TW2A 2BXZA 2DJIA 1IN7A 3PFYA 4A93J 2PVPA 3SFIA 2W9BB 5FFZA 4XSZF 4DL4A 3J7YJ 3C2GA 3F8NA 1SFOJ 1AUXA 4LITA 4G94A 2DCEA 5DM7F 4IOCF 1GSHA 3PQJA 1JUSA 4BQAA 5CVUA 2OH2A 1FSHA 2PI0A 4B4CA 3R4KA 3A2KA 5KVRA 2L54A 1FOYA 3VSKA 2JT1A 5ILSA 4AM3A 5I47A 3KP2A 3HXLA 1QRYA 3ECHA 1JLLB 4IZOA 2M3AA 4HRIA 5CKTA 2DWCA 3SYTA 1BM9A 3MMYB 1TWFJ 3GTPJ 4YAKB 1K4SA 4QW9A 2MC3A 3RKXA 4CYCB 4BL0B 2WE6A 2VKEA 3CUQC 5KFKA 5EOYA 1UELB 3K6GA 4NC8A 3I53A 3SHFA 1UHSA 3DLLF 4A3LG 3J80W 2EQRA 3K2AA 5EG0A 2RDPA 3MFIA 2Z1DA 4QSHA 1H88C 5CLSA 1R7JA 1MMSA 4X64H 2NU6B 5M5XJ 1W0UA 3ULQB 1ACIA 1UCRA 3FXKA 3GW2A 4DV2H 5HLTA 2BQRA 3LOCA 5IWAH 2CFXA 3T0YA 1BW5A 2AO9A 4P96A 4X0GA 4C3IJ 1GT0C 3RKYA 2DA3A 4XONA 2RF4A 3RIZA 3CESA 4Q45A 4NLGA 1Z2NX 1TWAJ 4CCNA 2JWTA 4A5NA 1FOKA 1HSJA 3HRMA 3KHLA 2JA5G 5L9XA 2H1LA 3IP4B 1SFKA 1F5TA 1IC8A 3PW5A 4HX7A 4PFOA 3HSFA 2DZDA 3PW0A 2A6TA 1B59A 4R1HA 3JR9A 3OOUA 4ZJZA 2DPDA 1IG7A 2M87A 2KIUA 4I99C 3QYBA 1XSDA 4KNYA 4DV4H 4WK8F 1TT5B 5FKOA 3OYKA 2VQEH 4EM2A 2P8TA 2VI6A 3F22A 4M6VA 5C4XJ 1E2XA 2X51A 3K1NA 3L9FA 2IS2A 4F3QA 3G6XA 1I1GA 2AQFA 3H5AA 1G3TA 4L0ZB 4EFBA 1XMXA 4HYKA 1AKHB 1T95A 2EFOA 2NU8B 5KX5F 2JEGA 2JTVA 1P92A 3RQIA 4Q8FA 1YG2A 3GILA 4E7HA 2BBYA 2O03A 1ORKA 2HQNA 1RR7A 2VN2A 3Q0WA 4HEA2 4ZYDA 1JTYA 2A05A 3KTMA 3V7SA 4IHWA 2R8HA 3K0LA 3FX3A 4UCSA 2YZNA 1XC5A 3B6CA 1JKOC 3PO2J 1D0YA 3CCRI 1YJ9I 4YAJB 2ZBKA 4JI2H 4ETSA 1SC7A 1B8IB 1RJQA 4YIIA 2HGSA 1QPMA 3OR2C 4EG0A 2OJED 5CVIA 5GPAA 4IR9A 4JQFA 1ODDA 3MAJA 1MSEC 3L7WA 3S1NJ 5KFUA 4C2TA 3SQNA 3IRRA 3CDIA 1SVLA 2LOOA 2H8WA 3DV8A 2A07F 2STTA 1P7IA 4PZJA 4DIQA 4ED1A 4A6EA 2UU9H 3OMYA 1YS7A 4OIPF 3TEDA 1ZAOA 3ZOBA 2NNYA 2JJ7A 1V3FA 1Y8QB 1R4NB 3H4BA 5D5UB 2GM4A 1TQPA 2BV6A 4RLQA 1M0WA 1SD6A 3GWZA 4FE7A 1WJBA 1MD0A 1FMVA 1UB9A 4A69C 2VR1A 3GIDA 4K0KH 3BJAA 2R93A 3GMEA 2X85A 4BXFA 3T5XA 1TBXA 3ZQ7A 3T5LA 5H6RA 2X9DA 2ZJQF 5D4RA 2UUBH 5M3MJ 2CMPA 5JFRA 2XB0X 4BH9A 1FBQA 2V9WA 3Q3SA 2DK8A 3E6CC 1B9NA 2E35A 2ALZA 4MV8A 1HW5A 2CUFA 3UKGA 3IAM2 3L4KA 1PDNC 2FLNA 4UUSA 1WWXA 1JHFA 4RDUA 2QA4I 1IRFA 1RUNA 2R3SA 4R79A 1D1CA 4EGQA 1IXSB 4MFEA 3VWBA 5KG3A 2L0KA 3H9GA 1T0FC 2IA2A 2BR0A 3ONQA 1B9MA 5GAHJ 4J9PA 3ZMSA 3EUHC 3A01A 3L2VA 1BR1A 2H6BA 4A3DJ 1HNXH 4DZPA 5CVRA 3BR0A 4DNCA 2Q1ZB 3E7LA 4JI3H 5LP6F 2NVXJ 4I2OA 3PO2G 3QRFF 2Q2EA 2L2OA 3PM1A 2XSDC 1CGPA 3L2RA 1GLNA 1YYVA 1BC7C 5KG6A 1X9NA 2ACJA 1HSTA 3GFJA 4C2MA 2R7ZA 2OA4A 1DV2A 4BHCA 2DFHA 4ECTA 2IGKA 2LY9A 3WHBA 5HLGA 3CCSI 4HDVA 2R8IA 2R87A 4A6DA 3SJMA 1RRJA 4RUAA 3CCVI 3OYHA 2LH9A 1O3TA 1ZN2A 1WJCA 3JSNA 2Z99A 2X1DA 4IRCA 2IAIA 4IO9F 4GKJH 2RGVA 3HYIA 5GTHC 4A3MJ 4L18B 5FRNA 2CYYA 1WCMA 3ZRGA 4CC6A 4WXHA 1I27A 1KONA 2NOJB 1VQ9I 3I64A 2Y2ZA 4CA0A 2W6OA 2BY0A 3BTCA 2FBKA 4XL9A 4HA8A 5ILUA 2XCPA 2E34A 1XDNA 4O5VA 2ID3A 5F9LA 5KG2A 2HEOA 3PR5B 2QLZA 2R84A 1R23A 1E3HA 5IT9W 2XAFA 2JRTA 3DU5A 2ZM6H 3WHCA 5JQWA 2FOKA 3HRSA 4GXOA 5GAEJ 1OCTC 2KDZA 4CCOA 5IYZF 3A0HC 3ZMVA 4YFNF 1ZQ7A 1RYRA 4IZZA 3OYLA 2R6FA 4LFAH 1FX7A 4WF2A 4HV5A 1R36A 2PQ8A 1RYSA 2XGXA 5IP6A 1FPQA 4D7NA 2VC1A 4U7DA 1I7LA 4NQWB 3BY6A 4M71A 3H0GA 4XRFA 1M7JA 3JTGA 1IXCA 3ZQLA 4J9RA 3ZQFA 4N4OB 1JHHA 3GIJA 4F50A 1OCOH 1YX3A 3MQ0A 3MR3A 3MZYA 3DXJF 2FA5A 3CJRB 5F04A 2STWA 3LWFA 4ECRA 2XPUA 4YP3A 3JRAA 2PBZA 3LSMA 1WCMG 3VPCA 1RESA 3D5SC 3E5XA 1YRNB 2OTJI 2XAJA 1TWFA 1JKQC 4A0YA 4DR2H 2YR2A 3M8FA 4M3GA 4E4TA 4J9OA 2LKPA 1F36A 1MBJA 1R4MB 1K4TA 3M9MB 5HV6A 1U78A 5J40A 4F4YA 2NXNB 3HPGA 1LVAA 4B47A 4WX9A 2R7WA 1TWHA 2GA2A 6PAXA 3OIOA 3T5JA 2CZGA 3C2HA 4A0XA 1SD7A 5JVLA 4U7BA 5KNLA 1NTCA 1G3YA 1QQIA 3RPUA 4ZHQF 5LHGA 5EWGA 4YR2A 3FDYA 1KJ8A 4IRIA 1XGSA 2W25A 2XCLA 2Q0OA 3LQRA 2FPGB 1JX4A 2WAFA 1BJTA 4N4NB 1YI2I 2LVSA 4JX6A 5BPHA 4AUXA 2FBIA 2FSWA 3GX4X 4A3FG 4J19A 4AIKA 3GTMA 2W84A 4BEHB 3I4MG 1XMKA 3HOXG 3OS1A 5AIQA 4ENKA 3CDLA 3CCUI 4LG0B 1FLIA 1N77A 4APMA 3BT9A 3DBHB 3Q8QB 4A3CG 2EA4A 2KQRA 4BDZA 3CC7I 3BABA 1X2MA 3JAMK 1SANA 5IPAA 1D1BA 4KT5C 1DUXC 2F4VH 1VQ8I 3DKWA 3KLNA 3OHBA 3BJYA 3RYRA 2V4JC 3DQVC 5FB2A 5F64A 3L2QA 4O4HF 5BMVF 2CQQA 2X1EA 2DA1A 2F5VA 1KJIA 1P2FA 3LP8A 1SD4A 2DYRH 1SMTA 3ZQHA 2R92A 4E4HA 4BBRJ 3ZMZA 2R7FA 2WTFA 3HSRA 2RREA 1UJ8A 5LEJA 4GDFA 4C5CA 4A3JJ 3VEPA 2H94A 5L1LA 1ZGJA 4DZJA 2W6QA 3QYFA 2K5CA 1XMQH 2KP6A 1J7KA 4Y7NJ 1G6NA 2CU7A 5HS8A 1LFUP 2XKPA 4GYGA 3UNGC 2B63J 5KG1A 3ASOH 2NOGA 2UUZA 4GYIA 4IXAA 2J6UA 3DPUA 3QAHA 2I8DA 2ZNYA 5FROA 4E7LA 2FP4B 1LDJA 2Y9YA 2IRFG 3Q1KA 3H9JA 3NWSA 4XLHA 4O2AF 2MA3A 4UCTA 1D5VA 5KFBA 2XKOA 4LLLA 3GIPA 2X1CA 1W7PB 2PFBA 3V8KA 2K4JA 1Z6TA 3M8JA 2IS4A 5D6FA 1HCRA 1IGNA 2FB9A 1R58A 4MV7A 2A6EF 1T94A 4Q43A 1JTXA 2YSRA 3GTMJ 3RTRA 2LLKA 4PJLA 5DD8A 1ULYA 5HNHA 1QA6A 1K79A 3JAMW 3GZ5A 2BY2A 1MNEA 1JT0A 2WAQE 2M0MA 3RV3A 5LEKA 2YCHA 1HQCA 4E70A 4YFKF 1ZLKA 1Y1WG 3GIIA 1FY7A 4PCQA 2UUAH 2L9RA 1DDNA 1R5ID 3LMLA 2V9KA 5HOOA 5L3BA 3JRFA 4UV8A 1Y0NA 1W36C 4AVPA 4P9UA 4DR7H 5LL6b 1HDPA 2UXBH 2JK3A 2H8RA 3DPTA 1IN6A 3HUGB 3RIRA 2ME6A 3ZN1A 3K2ZA 4QPOA 1I5ZA 1Z2OX 3ISPA 3VPDA 2G0EA 2FPIB 2W6NA 2DPUA 3S2WA 1ETQA 2YZMA 4ED6A 2C2DA 3QP6A 2EV0A 2FU4A 3ZQCA 4BBSJ 1OR7A 2XC7A 1IUYA 4LB5A 4DBRA 4A3GJ 4EYIB 3D5LA 1JXSA 2QEXI 3G8CA 3HRUA 1G59A 1YJWI 1PP7U 4R8HA 4OIRF 5B66C 1FIPA 4WCGA 4LMYA 4QIWE 2ELKA 4MTDA 2BVLA 4HF2A 3JSLA 2R8KA 2VT2A 2ICWG 3L09A 5EZGA 3P9CA 3MWEA 5L1IA 1H9GA 2FQ3A 2JA5A 1ZYRF 1A35A 2M4GA 2OCEA 4IF4A 3IWZA 4OMZA 4YJ3F 1LKXA 2FF4A 1Y8RB 4KIFA 5FKKA 1V5GA 3JCUC 2E1NA 1TL8A 2JA7G 3LSJA 3W6VA 2P4WA 1RK5A 2E5LH 1A6QA 4JI0H 2VBZA 3KYDB 2OBPA 2HYJA 3BR1A 4UCOA 1VNDA 4S0HB 1CQJB 1FC3A 2I87A 1P9QC 1MBEA 2OUMA 2VE8A 2GXBA 4DV1H 3HOUJ 2L01A 2DMTA 1I6HJ 1BN5A 3BTIA 2P0AA 4TUYF 4P9FA 5KAFC 4YG2F 2EZHA 3LWBA 3H92A 3FMSA 2R5YB 3AYHB 3FF5A 5IP7J 3BQ2A 1KU3A 4A3KJ 4XMYA 1ZK8A 4IWXA 3HOYJ 5HLIA 1IO2A 1W1WE 3B02A 2ESHA 4MTEA 1QBJA 2HVRA 4X65H 4J0MA 4PJJA 4JI7H 3V4ZA 1GDTA 1WHUA 2RAEA 3I58A 1LE8A 1W7PA 3OSFA 2DDBA 1X3WB 1V5FA 1TAEA 4XZ3B 5KCMA 4LK1F 2NVQJ 3TDUC 3CCEI 2NS0A 1EUCB 3TQNA 3KHHA 2ZDGA 3V6HA 3HSEA 2WTEA 5ILVA 3J81W 3LSPA 1ZR2A 3QZ7A 2RC4A 4L9JA 3N8DA 2PN6A 2XVCA 2HOEA 2R7QA 2X6YA 5FPOA 1ETOA 4KN4X 3WGHA 1FYKA 4BNCA 1Y1VA 4B43A 2FOWA 4J9KA 2VPRA 2JA7J 5D5VB 2DOEA 3H0GJ 2WAEA 4IQ4A 4PJMA 3TOAA 5DCFA 3ZQQA 3CLOA 2YL2A 4OAZA 5J47A 2DXIA 2I8CA 2W48A 1S68A 4G7ZF 3LL7A 4HLXA 1OPCA 1MMGA 4HX8A 4IRHA 3BQ1A 3E6MA 3CO7C 4OU0A 4ZYAA 5A2QZ 1XCBA 1VF9A 3K7AJ 2PX9A 4NBQA 2IS1A 5KFVA 1BW6A 2CUJA 2HKOA 2JRMA 3SXYA 4BQOA 1H8AC 1V51A 3Q8RB 1K61A 4F4WA 4LF7H 3FKIG 2UXDH 1SCUB 3F8CA 4UUVA 4I7HA 1W96A 1X3ZB 1Y14B 4MV3A 3PR4A 1NG6A 2ATLA 1QZYA 2NUAB 1KU7A 2VIXA 4MQVA 3HOZG 5C4XG 2OZ6A 1R1TA 3PO3G 4PGHA 4EJTA 2VBWA 5CQGA 1KJJA 5FLMG 5CAEB 1MMAA 3DTEA 1X4PA 5J4VA 2JPCA 2CV1A 5IP9J 3SEZA 4UCUA 4RB1A 4AIJA 3H40A 1FJGH 2E60A 3PFIA 1ZRCA 3OYFA 2O5RA 3TW6A 4TV8F 2W71A 3U1DA 2K9SA 5J3LA 2XDVA 4HQEA 3H35A 3BLYA 3AKZA 5LHHA 2XUBA 3WG9A 5FJ8G 2UVWA 4IEJA 1BIBA 2GPSA 5EJCA 2EIKH 3A1YA 4P5OA 1VQ5I 1WJ5A 1MNMC 1E3PA 1BXRA 2ZJTA 3PQKA 4I01A 5DG9A 4OINF 4C5AA 2M5WA 1GVDA 4C2MJ 2R0QC 3KZIC 5M3FJ 4ZYHA 3SFZA 3V8JA 3HB9A 1TZLA 2HYFA 3KEOA 3LSRA 3PSFA 2LMDA 2M9HA 5FFXA 3TO7A 2Q2UA 1GXPA 4MNUA 1ZETA 2K9MA 2VUMA 4Y4RA 3K4MA 4JI6H 4L9TA 4S05A 1HKQA 3HM5A 2R7NA 1QPIA 3FK7A 2RVCA 4QW8A 4HNTA 3G1OA 2D1VA 2KJBA 2R85A 1DQUA 1OWTA 3GIMA 2A6HF 4LLGF 4HW0A 4UB8C 2TRTA 1HF0A 4EV0A 1K83J 2JEFA 1VKZA 5LOVF 2BVMA 4XIDA 1S7AA 1W36D 1KC7A 5DD4A 3BOQA 1V4RA 3CO6C 3WE3A 2R7OA 3K4LA 4LJZF 5E1ZB 2JQ7A 4A5MA 1CF7A 1N34H 5D1OB 5KT4A 3IH2A 1O57A 3NWTA 2Z2SB 3OYNA 4Q4ZF 3BG5A 4KFCA 5H2FC 3TIGA 2VJ5A 3R60A 1S72I 4XOTA 2QQAA 5D6EA 4HDUA 1H9TA 3I5UA 3HL2A 2E7XA 3H36A 3QWLA 3UQ8A 4YELA 2A68F 2F6CA 1R49A 1M6VA 4LIUA 1UC8A 2R93G 1FZPB 5GONF 2AGOA 2LDUA 1XNQH 3DEEA 4JBAA 4D0PA 3HOSA 2B63A 2MD0A 2ME0A 3ROUA 2VUGA 3WE2A 2HDDA 3J7AY 3ETHA 3FM5A 2EFQA 1T56A 1YW7A 3ABMH 5TJJA 1VQKI 2EZIA 4J9SA 1IJWC 1G2HA 2MFZA 2M7AA 1OKRA 2HQRA 2E19A 1S3JA 4FISA 3EETA 2JZYA 2VQLA 1MBGA 3LSKA 3QQAA 3N42B 2DPJA 1SFXA 3OTOH 3LA3A 2E71A 1XMAA 4DR1H 2Q2EB 3HBLA 3GLLA 2MW8A 2D5VA 1WVRA 1D0XA 2BE5F 2BHYA 1ETVA 3EPIA 3N4MA 1E4FT 4YR0A 5D8DA 5TISC 2L9SA 5IT9K 4DUYH 4EVIA 5JLWA 1YE9A 4L0YB 2DYSH 2PJRA 4U7CA 2VOBA 1XDSA 3T5KA 2VXZA 2D45A 1EYZA 5K2MA 4XLCA 4RB2C 3JSPA 1FOWA 1WCMJ 2RNGA 3N6XA 4DUZH 1FP2A 1BJAA 3RPQA 1BIAA 4XR6A 2HQAA 2AXLA 5E3LA 4YQWA 2EZKA 5HDNA 4IHYA 4I4TF 2MC4A 3OL3A 4ON0A 5EWEA 5KFLA 1S5LC 3W2WA 2KSWA 4L5JA 3JRCA 4YBZB 3H5NA 3CLQA 1XGOA 4Z6YA 3F0CA 4KUMA 1YIJI 2QWWA 4BE2A 2LR8A 2M2EA 2X6XA 3CJQB 3JRIA 2OU2A 1ZGAA 1FVIA 2VBXA 3Q0VA 4HOBA 2ESNA 2R7DA 1HW1A 5K5OA 4UUTA 3F23A 1X4OA 1LFPA 4NHJA 4ED2A 1T0FA 4DYQA 1UC9A 2AQ4A 2X0LA 2R7ZG 3MKLA 5L3EA 3VOEA 2FQ4A 5LFAA 5FJ8J 1D3YA 4AYBN 2XF6A 4BJ5C 5K7FA 4MEYF 1WH5A 3H20A 3TL4X 2R7VA 2R5ZA 4YR3A 4BQNA 2KZGA 4GRIA 3CMEI 1H0MA 3IH4A 1BA5A 2R7LA 4RBOA 5KG5A 4JK1X 3Q5FA 3GTOJ 1T36A 2VT3A 1J2XA 3B6AA 2W9BA 2UWMA 3GO5A 2GQQA 4A3IG 1I6UA 2V79A 2WB1A 1PYVA 4ABZA 3VPBA 4B3MH 2DTRA 4DQ2A 1S0NA 4MFDA 1S7OA 5KT2A 5E18F 2CW0F 3RJ0A 5ICGA 3HDDA 1X19A 5JUMA 5IYBG 1T98A 2YX4A 2LKXA 3IRQA 4ESBA 2YU9J 4RB3C 4EBEA 4ESJA 3K3PA 3JRHA 3GTJA 1WH7A 5BR8H 3ABTA 3ZCOA 5FLXW 4BAYA 3E97A 2HZTA 1T39A 4QWCA 2KRFA 3F6OA 4JV5H 3CCJI 5LHIA 2GLOA 4IRKA 4W1UA 5LRRA 1ULZA 2X4HA 1BR4A 2EB7A 4BWSC 3S3NA 4JP0A 3PW7A 2MG4A 1GGOA 2YS7A 2KZVA 5K7ZA 4U0WA 3GV7B 2EILH 3WTZA 4IL6C 3HOVJ 4G6QA 2Y30A 4L5IA 1DIKA 3KPHA 3KHRA 5DLGA 2M4KA 1S9HA 1L3LA 2O0YA 3A03A 2VQCA 3JRDA 4CYDA 3MCZA 3K9TA 2AGQA 4B3XA 2VL8A 3OS0A 1S29A 4XRSA 4KICA 5H6QA 1RK6A 3BJ6A 4NC6A 4C30A 1LDKB 4QWQA 4X1EA 3WTSC 2N8GA 3QU6A 3FXJA 2HVSA 4BS9A 4V19K 1I3QJ 3DTIA 2F5CA 5DUIA 1MW7A 1VZ0A 5JVTA 3BPVA 2DIKA 3T1HH 3VB2A 4O4LF 2DODA 3WTTC 3FM3A 3FMQA 3IG0A 3FXRA 3OR1C 2L3DA 2XHKA 2HJWA 1RKWA 1WPKA 3HOUG 1HDDC 3BDDA 1IOWA 4PK4A 5FKMA 5EDWA 3CCQI 5E3MA 3RSNA 3KYLA 4PSXA 1MZBA 1VQPI 4QLCU 1PUEE 2ZNZA 2VJIA 4MGRA 2WV1A 3AG3H 2KJCA 4PGGA 2IPQX 3V6JA 2P81A 4J9LA 1XB4A 1OCRH 4HNVA 1NH3A 4EEYA 3OWTA 1BC8C 3N44B 5KFHA 1HR0H 5LBQA 2DJNA 1JJ6C 3TP3A 4U6PA 5L1JA 1FEXA 2YRXA 2K40A 3I54A 5TGTA 3SDBA 2GPWA 2G7UA 2WWYA 4UV9A 3GQCA 1VQ4I 3KFWX 2M34A 3S1QJ 3ECOA 3V42A 2UVUA 2E5NA 2W1OA 2JEJA 3AG1H 2ISZA 3L2PA 4EBCA 3VSLA 1IUFA 5CA0F 1GSOA 5LA6F 1E4GT 3KP3A 4Q5SF 3N40P 2JSPA 1KU9A 4ZC3A 2W9CA 1N25A 2P5KA 4E7JA 2KIFA 3KIOA 2JA2A 3UR3C 1PVEA 1KQ8A 3DLAA 3GTLA 2W70A 2K02A 3M8EA 1LJ9A 1TQIA 4A3KG 5IP7G 3RJPA 2PEXA 3DWLE 4XKCA 1HBXG 3I59A 2H09A 3COAC 3KEYA 3U1KA 1RC9A 2FMAA 1AOYA 2HFHA 3S17J 1OISA 2WDTA 4UCRA 1WJDA 2HS5A 2V1XA 5IT3A 3K4KA 3OSGA 1JKRC 4MA5A 3GTGJ 3TQ1A 4DYCA 2OTLI 2DQRA 1MJ9A 4LF8H 5HS7A 4ASNA 2HOTA 2UV1A 4MEXF 5F0HA 1MSFC 3CTAA 3S14J 5J2TF 1IRGA 4KT6A 1FNNA 2HZDA 1J75A 1CQIB 1ETXA 1Z7LA 2LF8A 4ZDOA 3KP4A 1O4XA 5BQTA 3F8FA 2LC2A 2FX0A 4M3DA 1IAWA 4EYHB 3GFIA 2QCOA 1QO0D 3RZDJ 3E6DA 3GVAA 4YEJA 1ZHFA 3S1MJ 1K6YA 1TQMA 3CP2A 4LSAA 2OLSA 1ETWA 3L2UA 5EZYF 4C9YA 2AS5F 2IMWP 1PUFA 5KFCA 2MBFA 1FTTA 3CQZA 1BI1A 1XX5A 3QOEA 3QPTA 4RAYA 3A01B 4FBUA 4RB0A 4BY1G 5JVGF 3FKJA 2ADUA 1QHGA 5IYBJ 5M5YJ 1TP4A 1KBLA 3IN5A 3Q9SA 5E20A 1SFUA 4BXXG 1RJRA 3WTUC 2W6MA 1OR7C 3TINA 2QBYB 3MN2A 2BXYA 3I3LA 3QPLA 1IN5A 2FK1A 3CJNA 4Y8VB 3Q8PB 5FO5A 2E36A 3T1BA 1VI0A 4A2AA 4CC5A 1FBUA 4CICA 3WG7H 4H4KC 4MO7A 1YTYA 1C0WA 3CVZA 3FBIB 4ZQIA 3J81K 3LSGA 3O2PE 2WADA 1AHDP 2QK4A 1STZA 4EGJA 1J5EH 2XIGA 2W57A 4QWDA 1VBHA 2FNPA 1W5SA 5GAGJ 2FK3A 3Q2OA 1K78A 1OCCH 2YX7A 1WZ2A 2O6GE 5BS6A 9ANTA 2PN1A 4FE4A 3REOA 4ME6A 3E5UA 2ZSHB 1WSUA 1VQNI 2DT5A 3VDXA 4NDLA 2ZMEA 3S16J 4B3TH 5HDKA 4C2UA 4W97A 4GC6A 1U8BA 1MBFA 1YOVB 4LFUA 4ZZLA 3C2BA 3S3OA 2ZKZA 3HKZN 2BQ3A 2BEOA 3IH3A 2CJJA 5F27A 2IP4A 1IF1A 2R5ZB 1ZLJA 3AG4H 1KYZA 4B1RA 2EIJH 3E3VA 4F92B 5JR3A 5KFZA 1CQTA 3KYCB 2CUZA 3U9SA 1HNZH 3DEUA 3E0JB 4IVNA 4GGGA 3M9NB 1K6OA 3WO1A 4RGXA 1F1ZA 5KG0A 2VC0A 4JOMA 1NHAA 4BHBA 3G71I 1REPC 1Z91A 2VONA 3FHNA 3GV5B 4NQWA 2UUCH 2NS8A 4XLAA 1T38A 3S3MA 1Q1VA 4A3BG 1ZG1A 1SAXA 4CCLA 4B09A 2HPMA 4M9UA 2P7CB 2W85A 3LAJA 2O9LA 3WU2C 4E7ZA 1LE8B 4RAZA 1TWGJ 5D5WB 4F52A 3S15J 3GZ6A 4DL2A 4O3MA 5JHFA 1Z67A 4FETA 3MKZA 1MDMA 3K5IA 4DV6H 2EA2A 4I0BA 4Q48A 4A3CJ 4MA0A 2KIMA 2VUMG 1V54H 2XAQA 1Z7UA 3KETA 2Y9ZA 3HOXJ 4ITVA 3EUAA 1BI3A 2IXSA 2LF7A 1OCPA 2NS7A 1DGSA 3LSHA 4A3FJ 2CH0A 2R93J 2K9LA 4L5EA 2HR3A 4G6TB 1BI0A 1X58A 2JA6A 3BJOA 4KA4A 1G3SA 4E7IA 1D5YA 3KAJA 5KFXA 5EWFA 4O3NA 5KFJA 2QQBA 2PJPA 2DN0A 2CW8A 2O8XA 3M9AA 2CFOA 1UAAA 2ZCWA 4II3A 1JKPC 1MKMA 3S2DJ 2R8GA 3IHUA 4LFBH 4XSXF 2R7MA 3O8GA 1P6RA 3K4BA 1ITYA 2CQ7A 2DAOA 1AU7A 4RM3A 2IGOA 1YHQI 2GOMA 4ECUA 3F21A 5E3OA 3CCLI 2V1UA 4ECYA 2JUGA 2QQ9A 4IPAA 3VYSB 4A3MG 1O7LA 4ZYGA 1O75A 2Z16A 4D9JA 4DLKA 3SEQA 2HKXA 3W3CA 5M5WJ 1QVUA 1JDBB 4U87A 1V4YA 5C1OA 3QOPA 3VFZA 2ZJRF 5LXTF 4OMYA 4A3EJ 4UNOA 1I50J 1WFXA 3AAFA 2DPIA 3JRWA 3U9TA 5J8FA 1U5TA 3WO0A 5KFDA 2IJLA 3TGNA 2DMQA 5C44J 3AG2H 2MD5A 3MD2A 4MIMA 1I6XA 1XG1A 4QPQA 3OYBA 4EGYA 2YW2A 4J9QA 4KHPH 1GHCA 4XK4A 1EA3A 3S93A 2ISYA 3QPHA 2H27A 3BG9A 5D1OA 3RUPA 1EH8A 1WJEA 3F9KA 3P5JA 1A36A 2R8JA 2IGMA 2L7FP 1ERDA 2PMHA 3K3VA 3S8PA 4JV0A 2R7RA 1GUUA 3G73A 1N78A 1JGSA 3MFHA 2NNNA 2JA8G 1ON2A 3BA8A 3QFFA 3QYEA 3VPRA 5D8LB 2E1CA 1MBHA 2AHQA 5KFTA 1P7JA 2X6OA 1V9PA 4UVAA 1Y1VJ 1P4AA 2RKHA 3BROA 4NUBA 2LG4A 2ASDA 3FIWA 1ZG5A 4ED8A 3J7AK 1JUMA 3W2AA 3O6BB 2WC2A 4DOZA 2BYVE 2QKLB 2C00A 4RU9A 3EUHA 3KLOA 2VQDA 4LF4H 4DV0H 4ECSA 3RZOJ 2O61A 1HA8A 5FKNA 2HTSA 3FHZA 3OYMA 2X0SA 4J9MA 2A5YB 3CDHA 1TC3C 1IRXA 2IA6A 5ICCA 3LA2A 1PP8F 1LPQA 3I0TA 4JUZA 3C1DA 2PLYA 5FLMJ 4RZQA 4MQ9F 1UHMA 3KX2A 5HDGA 1TWAA 1I50A 3R5XA 3R6SA 5ERIA 5H20A 4RNNA 3PIOF 3M1EA 2ZXJA 2M45A 4LH7A 2QYZA 4RUCA 1J0RA 3GYHX 3WTVC 1F43A 4XYLB 2W6PA 1LQ1A 1Z3XA 3RB4A 2Z3YA 4RA2A 2YU9A 1XCVA 2C22A 3BPXA 2F48A 3H3UA 1WGXA 5GTIC 3L2CA 1HLVA 4Y3OA 1OJLA 3VYUB 5F1RA 3HGYA 1MIJA 1I39A 4XORA 4B48A 1MBKA 4WD3A 1USTA 2E1MB 3W6JB 1X3UA 3PN1A 4PJ0C 2ID6A 5KFAA 2DLNA 2CS3A 1JE8A 1R9TJ 3RI4A 5F0CA 3H0GG 1L2ZA 5EDNA 4PSWA 3OYDA 3N43B 1N32H 4AU7A 3DPLC 3WNZA 3HC7A 1GXQA 3SZTA 2EFWA 3J81Z 1UMQA 1H89C 3DP7A 4LK0F 3S1RJ 2HHHH 2MCTA 2FD5A 1G3WA 5LMUH 2COMA 5DV5A 1A0IA 1RETA 4HAMA 3I4NJ 2CO5A 5BPIA 2ZMEB 4FX4A 1TWHJ 4IQJA 2IW5A 1ZGWA 2LSOA 4E7SA 1K83A 2HWVA 1XN7A 5D4SA 2XROA 1R22A 3GFLA 1T2KA 3OSPA 3H5RA 1OYWA 4I50F 2P6SA 3BCBA 5KFIA 2GLTA 2XRNA 4HV6A 3FXUA 4NXMH 2DOFA 3RPUD 4G12A 1FBSA 3FKIA 2L7KA 4BHPA 1YIOA 3K4JA 3BG6A 4ED7A 1FYLA 4MLOA 4KMUX 1BOBA 3OV8A 2BGCA 1Z6RA 1XPXA 1KQ0A 3HKZE 1Z9CA 1GO3E 2LY1A 3DBRB 2NU7B 4TQRA 3LSIA 3RGXA 3ZR8X 5E1XA 2GIVA 4FM9A 2ZC2A 5KFPA 3JAMZ 4C5BA 1SAUA 3A0BC 2NVYA 3GTKA 2RDIA 4DL5A 3F6VA 2EBIA 1FT9A 3R0AA 5EGOA 2JA5J 2JVGA 4OWRB 1Y1VG 1SD5A 3RQ4A 4MHGA 2IVMA 3F8MA 3M4IA 3FISA 1YFHA 3S32A 3T1YH 5CVVA 5EG0B 4DR4H 2JA8J 2F4MB 5CB4F 2ELJA 3HZJA 5CYVA 3K70D 2F2EA 5KK1A 1I3AA 3VYRB 3MZHA 3PW2A 2UXCH 2ZXWH 4GCVA 1HW2A 3ETJA 5HBRB 3UFXB 1A31A 3MR6A 2V6EA 1LVKA 3ZMTA 4RM2A 1A9XA 4HF1A 2VBYA 3IAS2 5JVDF 3BQYA 1U5TC 2OZUA 2CW7A 3CC4I 4JI8H 4A3GG 2NRAC 2DA5A 3LA7A 4MV6A 5BPFA 3HJEA 4F55A 4J00A 5BMZA 1JI8A 2Y48A 3RF2A 1C3OA 5DEQA 1ZARA 4LIVA 3VMMA 2QSGX 5HS9A 1ON1A 2HGCA 3HRTA 2QM3A 2FLPA 1YS6A 2IEKA 5DLFA 1R6RA 5IYCJ 2AQEA 1XSXA 1ZHSA 2CG4A 2FXAA 4QJFA 5IYDJ 4LG3A 4RNOA 3MZ8A 3BC8A 4DJAA 2IA1A 1A5JA 3RFCA 3CZ6A 1RKTA 1B4AA 4KJZA 3KCCA 4XN3A 4EM1A 1USSA 3U9GA 3H0DA 1JIHA 2JA7A 2V1NA 2QQ8A 1SVOA 3RV4A 2RGRA 2ETHA 1ZHQA 5DCMB 1S97A 1EHIA 2YRWA 3BQZA 2DK5A 2E2JJ 2MSYA 1U9NA 5C1PA 3EPZA 3FXOA 4ED3A 1DU6A 3KEQA 3HUGA 1S0MA 3KXYT 2CGPA 4EATA 3FMAA 4P1WA 1RIOH 4IHSA 1JT6A 3CP8A 4PUSA 4E6KG 4YFXF 2R7UA 4ED0A 1OYYA 3KZZA 2VOPA 1ENHA 2VUMJ 3CD6I 4QTRA 2H6CA 5E79C 3PNYA 4XNFA 4DR6H 1MNDA 2KRHA 3KE2A 4BKXA 4PDKA 1EH7A 5CVJA 5GP9A 2KDOA 4E7KA 2B63G 2Y0SE 2XB5A 1T8IA 4ECWA 5J4YA 4DL3A 3L00A 4EJVA 1X1DA 1BJZA 4GKKH 2IBDA 1JUPA 4YY3H 4LFCH 2KPMA 4O3SA 4EGZA 3M1CA 3GTJJ 2XF7A 4I76A 4U88A 5C44G 4BBRG 4M3EA 2DMNA 5DUKA 2XCAA 2NYXA 3QPSA 5D8KB 1N36H 4XLEA 5LD2C 5J2UF 4A3EG 3LNQA 2JUCA 3Q0UA 3M9OB 3J80K 1Z2PX 4XOPA 2WYOA 2V4QA 1OCZH 5GADJ 3FXMA 3N05A 4KIBA 5F1JA 5ED4A 1DGWY 3GTLJ 2A61A 3OIQA 2CV0A 2IT0A 3R5HA 4CH7A 1HOMA 4HF0A 3ABLH 1LB2A 1LFBA 3HOWJ 4UHTA 1ZQ3P 2IGNA 3HKZA 5JLXA 1QHHD 2XPWA 2XV4S 1AWCA 2GBYA 3I4MJ 4FS2A 2QUFA 1IBMH 3H3VH 4BU2A 2F5DA 5ICFA 2E2HA 4J01A 1F9NA 1OMIA 2QKMB 3ASNH 2VLAA 3G6YA 4IRDA 2VKHA 2K27A 4IHXA 1X2NA 4ZDPA 5TRDA 2XSJC 2HNHA 3GLXA 1XSVA 2NVTJ 2DFIA 4O4IF 1LEAA 3G4SI 3GTQJ 5T14A 2J5PA 2OC6A 3ZN0A 3QZ8A 3QU3A 3BG3A 3HHGA 1VQ7I 2EV6A 3EQLF 2W8KA 1GV5A 2LP0A 5C4JJ 4I0AA 4AYBE 2DT7B 3BTJA 4LG0A 4EJUA 3SE7A 4YRVA 3H3VK 4QWEA 2OAZA 3ZQGA 1L0OC 2W24A 3WU1B 4YJ2F 2ZXIA 3CUOA 3F3XA 3ELKA 3GF2A 4NXNH 4O3RA 3ZXSA 3MKYB 2YS6A 4ZI7F 3ZP5A 4Z2YA 5E8GA 1UFMA 1JGGA 4XLFA 3NGDA 4JI4H 3FDSA 5FD6A 1ZKGA 3FWEA 3MKWB 1Y39A 3H1CA 4M74A 2XRLA 1I7NA 4MV9A 4EBDA 2WY8Q 1Q1HA 3HHHA 1D0ZA 1U9OA 4TV7A 2YYAA 2PG4A 2X48A 3CCMI 5DDGA 4RAFA 2L7ZA 4Y17A 3M4OJ 5A2QK 2R7XA 2AXTC 3OYEA 2COBA 2V9PA 2E1MC 3RB3A 3OYCA 2M8GX 5KHDA 5EYRA 1ZRFA 5C3EJ 4XICA 4DYRA 3IV5A 1HKTA 1HNWH 1Z05A 2TDXA 1MGTA 2GZWA 1B6RA 2ZDQA 1V5EA 2P0WA 4ZTFA 2V58A 4BGDA 1LUJB 3ORRA 4MV1A 2FPPB 2OWOA 2K86A 2DA6A 3V6KA 2HDCA 1RJPA 5B3SH 4L1KA 5L3FA 3J7ZI 2JN6A 4R7RA 5FGMA 2XGCA 4IRGA 4RGUA 1U6GA 3GLKA 1IZ1A 1A04A 3R23A 2EINH 2L7MP 4BJ6C 4HR7A 3OSNA 3MFKA 4FS1A 3C0FB 1P4WA 2F4OB 3HIFA 4N9HA 1Z77A 2KFDA 3GTPA 2B7EA 2D2WA 4NC7A 4XKBA 1HC8A 3RBEA 2DDAA 2X6WA 2M30A 1N56A 4M73A 4ZDLA 2ASLA 2WY7Q 5AONA 4G7OF 4ECXA 5K7HA 1N48A 4AD9A 1D1AA 4CCKA 5IP9G 3PNVA 5KT5A 4OOIA 3D5RC 3I12A 4BXUA 2QZ8A 4YIRX 1BR2A 2Y0SN 1XDUA 4K2EA 1VQ6I 3QODA 1IW7F 2CRGA 4XRSG 4D5CA 3G2BA 2MYSA 4EQQA 1BL0A 3GTKJ 2NVXA 3V4GA 5KG4A 2I5UA 2O3FA 5E8IA 4LF9H 1FTZA 3FKIJ 2CKZB 1B04A 3MWMA 2BZTA 2FBHA 3HEFA 4FX0A 3BR3A 1XGNA 1WR2A 2VJ4A 3JREA 1XGMA 3ZQIA 2UVVA 3GTOA 3C7JA 4I98B 1BI2A 4O3QA 2MABA 3LFUA 1TT0A 1VS0A 1IRZA 1O3SA 4B8XA 4RGSA 2V4RA 1ETYA 4FHTA 4CDGA 4BJTA 3CMYA 1Z21A 1U0JA 1WJAA 1U5TB 3K10A 3O8HA 3R0JA 4HPQA 4JV2A 3G1MA 2QSFX 4C3JJ 1IDZA 3HTSB 2CUEA 4ZYEA 5KFYA 2HTJA 2ELHA 4XM3A 2VPQA 2BW3A 3EYIA 2XASA 3ERED 1EV7A 1YW9A 4DL6A 1I1SA 4U0YA 5IOYA 2FJZA 3EUKL 3WTYC 1DPUA 1KJQA 1BBYA 1HKSA 3PNTA 4JI1H 3O3KA 5B1AH 2VE9A 2PMZN 5LGNA 4RS8A 2W7OA 3PW4A 1ZELA 1ETKA 1WQ2A 4UB6C 2CQYA 4M3FA 4Y13A 2DI3A 1DPRA 3JRXA 2PMZE 2MLGA 5EEHA 1ZG3A 5KFSA 1SEIA 5EGOB 4RNMA 4DL7A 1E0EA 3P9IA 2W9CB 4I09A 1CE8A 5A2QW 2LFBA 1XMOH 3L4JA 2Z33A 1Y56A 4IHJF 4FT8A 5KT7A 2L4AA 2E2HJ 4IAJA 3E5QA 4V2GA 4HNUA 1ZR4A 3SI8A 3FXQA 5C5JA 3OHAA 3LFKA 3ORQA 2CQKA 3W2VA 1RUOA 3I71A 3K4CA 5EEAA 3HGGA 3OYGA 1POGA 2UVRA 2KIQA 2J6TA 2KL4A 4I02A 1YLFA 1CF7B 4J9NA 4OAYA 3HOTA 1TA8A 1WJFA 2DO7A 1VTNC 2BHZA 4Y15A 3OYAA 3GFMA 4X62H 4B3RH 2GXAA 1W93A 2VQGA 4HBLA 1QGPA 4Q0YA 4L9VA 2LTPA 3IKVA 2EIMH 4UVBA 2K3FA 1UG0A 3CQZJ 2P7VB 4F4ZA 2FMYA 5F08A 1KU2A 4XKVA 4CHUA 4QIWA 1XD7A 3TDZC 1OQYA 3WGIA 4YB8B 3I55I 4AYBA 2OQGA 3CCYA 2KHMA 4EEQA 5J1UA 4BBSG 1BNCA 4EJWA 2V6CA 2CV2A 1MMNA 2L9NA 3GV8B 1RPWA 2PMZA 4DV3H 1SEUA 2WB1N 4ESFA 4CZZA 3LAPA 1DGRM 4A3IJ 3BAAA 1J9IA 4A0ZA 4X66H 1R1UA 2ZFWA 3BP8A 4HLYA 1QNTA 4TV9F 2VJJA 3Q9VA 2HPIA 2SCUB 3BR6A 3AL0B 4UFZA 3RGZA 3EDPA 1TNSA 4LH6A 4ZOLF 1C30A 3R61A 1MDMB 2FKLA 3BZKA 4FBTA 1Y1WJ 2HOSA 2MLKA 3ABKH 4RGRA 3TMOA 5DS9A 3ZMUA 4BY7J 5KFOA 5J1RA 1Z3YA 3SDGA 2K4BA 1U3EM 4OIQF 1E3OC 4FCYA 2DMPA 2DFFA 2M05A 1SFEA 1VQLI 1AUVA 3CC2I 3OYJA 3RKQA 4G6DA 5IY5H 1CS0A 1IBLH 4IR1A 3CUQB 2VQHA 3TP0A 3C18A 4XQFA 5LRSA 1KA8A 1Y0UA 2E2IA 2OD5A 4HYEA 4A2UA 2HI3A 1YJNI 2W4SA 2H1KA 3RKWA 5L3DA 3GTQA 2HDWA 2XAUA 2F4IA 3MEXA 1WH2A 2LD5A 4AQYH 1A6IA 2EH3A 2MH9A 3MWDA 3R5FA 3CF2A 1G4DA 2RV8A 5K5QA 5D5XB 1T08B 2ECCA 3K1MA 4I6ZA 3G1LA 3DKXA 3J80Z 2XAGA 3BR2A 2NVYJ 4AVZA 2I10A 2HQ5A 2Y0SA 4EJOA 2EV5A 2E2IJ 1IV6A 4UVCA 1RR8C 2EFPA 1K78B 2YZGA 1OLTA 1FSEA 4ENJA 2CQNA 3FZVA 5DQIA 3GZNB 2KKOA 4DR3H 2VODA 2VA3A 3N97A 1X1BA 4AWXB 2GOXB 3ZPLA 3BQ0A 4F93B 5E3NA 4LOCA 2DA2A 3AL0C 1B1BA 3IL2A 2DMUA 4M9ZA 4WWCA 1S10A 2UXNA 2BW3B 1TWGA 3T8TA 2L4MA 1D8JA 2LBFB 2R4GA 4XRMA 3PVXA 2P6TA 2WAQA 3JRGA 2VOOA 4Q8EA 2M8EA 4QWBA 1YRNA 4A93G 3WU0A 3CF5F 2R7ZJ 1IOVA 1OFCX 4FU0A 4JX4A 1KZHA 3IWFA 1MJBA 2GIZA 1I3QA 4PDBA 2DW4A 2QYOA 2TCTA 1SVMA 2OF7A 1UZCA 1R71A 4NB5A 4R8UA 4WBNF 3DTKA 3H3ZA 4CYCA 5E1WA 2C28A 5C8YF 3T8RA 3NAUA 3CJTB 2LY2A 3DEWA 4GFBA 1FOXA 4RZRA 2VA2A 2VPLA 2MGQA 1YITI 5DGBA 4D1QA 4UY8I 1F4KA 4YIFA 3QP5A 4ENMA 4ANJA 5JI6A 2Y75A 3KP5A 4D5FA 3I59B 1N75A 2PMUA 1JXLA 5EZHA 2EZLA 5IOZA 3FK6A 4C3HJ 4O3OA 1D8KA 3BZ6A 2HOAA 3NRVA 5L1KA 1MH4A 2ZJPF 1E4EB 3I4PA 1TW3A 1K1SA 1WKMA 3JRBA 4F91B 1XTAA 2P5VA 2QENA 1QU3A 1E17A 2J9GA 5EEGA 3T5HA 1WI3A 1U2WA 1ZRDA 4X6AJ 2DT6A 2HXIA 1B6AA 2DLLA 4G3IA 1Y6IA 2DQLA 3BZCA 5BNGA 4Q44A 1SMYF 2M1BA 5FD5A 3K5HA 2C35B 2C2RA 1MH3A 2A3SA 4KIGA 3F8BA 3H9QA 2HYGD 3Q8SB 2NVUB 2DBBA 2XAHA 2YUSA 4BQQA 5DQGA 1X1PA 3A4CA 5K5RA 4RLFA 2LRDA 5FLVA 2GXGA 5DYMA 5KG7A 3PSIA 1RZ4A 3TO9A 3LSTA 5HODA 4XX0B 4GC7A 2Q2TA 5B5EC 2NAZA 3WTXC 3ZGKA 4BY7G 5J6XA 5F9NA 4FASD 1K7AA 2JSCA 2OCCH 3DFGA 2FNAA 4HQ6A 2A69F 1DV1A 3G3ZA 1BOAA 3V7RA 2W6ZA 1W7PD 3BTLA 1W5CC 1IBKH 1FIAA 4M6XA 4JV1A 3L2WA 4TQSA 1IN8A 3V7CA 4XYMB 2ZSIB 5HNFA 5KKNB 3GCMA 5DM6F 3PO3J 5FPRA 3GTGA 2ZXHA 3KZYA 3HOZJ 4EEFG 2GWRA 2DA4A 1GLVA 4O3PA 5IYDG 5KFRA 4BXXJ 1OYIA 1ONVA 5IYCG 5E17F 2A5WA 3OY9A
chains in the Genus database with same CATH topology
2VPSA 2FE3A 2K7LA 1FKAH 1WRJA 4UCVA 1SYXB 1AN7A 4DV5H 3B73A 2EFNA 3BA9A 3N41B 2VQFH 4OX9H 3RTXA 3W6KB 5HVQC 1KGSA 1KQ9A 2RNJA 5ICEA 4JI5H 4L9NA 2EK5A 2V1DA 3JTHA 3GEZA 1FWZA 5LGTA 4P55A 4N9IA 5IT9Z 3KALA 2ZJ2A 1XNRH 4N0BA 4G7HF 1M0TA 2IA0A 3KP7A 3NQOA 4HX4A 3TO6A 4DR5H 1S03G 5HLHA 1LEBA 4GLXA 5JHUA 1YQAA 1QZZA 2F5EA 1W5TA 2L02A 4OIOF 2G9WA 4M72A 1R5GA 1BGWA 4EM0B 3ZMDA 1I94H 4H0EA 4CGZA 3VODA 4GO1A 4LD5A 2CWEA 1IXRC 3F72A 5L3GA 2HVQA 2FEZA 5CJ9A 1R5HA 3IC7A 1TTYA 4LSXA 4KYWA 3DF7A 2Z9OA 1S8NA 2Y0MA 3ML6A 2YU3A 4AIHA 3KP6A 1ZH5A 2UZKA 4ZH4F 4EFEA 2UXXA 5L3CA 5LLQA 2RN7A 1YW8A 1J5YA 4KMFA 4JYAH 3V8LA 5DCMA 4CO8A 4F7ZA 3D0SA 2B0LA 4LB6B 4LGWA 3NEUA 1FYMA 4LF5H 4M7EA 1MJAA 1N33H 4XBFA 4G8XA 4HZFA 4CXFA 1O3RA 4M9XA 3K1PA 2F5FA 1U8RA 5K1YA 2C6YA 2GA1A 5BPDA 3C3WA 3GUDA 3TKYA 3JSOA 3M7GA 4KDPA 1WI9A 1KYWA 1S6LA 1T6SA 4XLNF 1GYFA 2EJRA 4ENNA 4WXCA 4KN7X 2QVOA 4LLNA 1R00A 2P5LC 5BOXA 2EWNA 1GVJA 2ZO4A 4BYYA 2G7HA 3KAKA 3FMRA 4EMSA 2MH2A 1J59A 4DV7H 3P9KA 4IHTA 1W4MA 2CSOA 1TNTA 3IKTA 1RNLA 4M9SA 3BWGA 4UXNA 3HTUA 1Z1DA 1P8LA 4WXDA 3GXOA 1UHWA 1O7FA 2OQRA 3U2RA 3WGGA 2V9VA 1ZREA 2Q8KA 2GAUA 2J5OA 3JW4A 4XLPF 3E6BA 4LF6H 5F6FA 3ABUA 1O3QA 2Z5UA 3RDIA 4IJAA 4S04A 4YHHH 5LGUA 4B3SH 3SZPA 1LDDA 2FRHA 3EYYA 2WV0A 5D1PA 3DF8A 3LQQA 5AIPA 3J7AO 1TLHB 3CUQA 2QBYA 3RYPA 2D1HA 2LNBA 3OOPA 4M6YA 1YO5C 4A2BA 3WODF 1IN4A 4A12A 5FLXK 3K69A 1RI7A 4U0VA 4Q47A 2RQPA 4G9YA 2JPBA 2DU9A 2E7WA 3P7NA 3TOBA 1FP1D 4ZZDA 5FLXZ 2FMLA 1P4XA 2YPRA 1LNWA 5J8CA 5LMNH 2IP2A 2PBIA 1EH6A 3WTWC 1HXDA 1DP7P 4O6JA 4HQMA 1R1VA 1TW2A 1IN7A 5FFZA 4XSZF 3F8NA 4G94A 3PQJA 4BQAA 5CVUA 1FSHA 2PI0A 3R4KA 5KVRA 2L54A 2JT1A 5ILSA 3KP2A 3HXLA 3ECHA 1BM9A 2MC3A 3RKXA 2WE6A 3CUQC 5EOYA 3I53A 3SHFA 3J80W 2RDPA 5CLSA 1R7JA 4X64H 3ULQB 1UCRA 3GW2A 4DV2H 5IWAH 2CFXA 3T0YA 4P96A 3RKYA 3RIZA 1Z2NX 4A5NA 1FOKA 1HSJA 3HRMA 1F5TA 4HX7A 3HSFA 1B59A 4R1HA 2DPDA 2M87A 2KIUA 1XSDA 4KNYA 4DV4H 4WK8F 2VQEH 4EM2A 2P8TA 3F22A 1E2XA 3K1NA 3L9FA 1I1GA 1G3TA 4L0ZB 4EFBA 2EFOA 2JTVA 1P92A 1YG2A 2BBYA 2O03A 2HQNA 2VN2A 4ZYDA 3V7SA 3K0LA 3FX3A 4UCSA 4JI2H 2ZBKA 4ETSA 4YIIA 2HGSA 1QPMA 5CVIA 4JQFA 1ODDA 3MAJA 3L7WA 3SQNA 3IRRA 3DV8A 2A07F 2STTA 4PZJA 4A6EA 2UU9H 1YS7A 4OIPF 1ZAOA 2NNYA 1V3FA 5D5UB 1TQPA 2BV6A 1M0WA 1SD6A 3GWZA 1MD0A 1UB9A 4K0KH 3BJAA 3T5XA 1TBXA 3ZQ7A 5H6RA 5D4RA 2UUBH 5JFRA 4BH9A 1FBQA 2DK8A 3E6CC 1B9NA 1HW5A 3L4KA 1PDNC 1WWXA 1JHFA 1IRFA 1RUNA 2R3SA 4R79A 1IXSB 2IA2A 1B9MA 3ZMSA 2H6BA 1HNXH 5CVRA 4DNCA 4JI3H 4I2OA 3QRFF 2Q2EA 1CGPA 1YYVA 1BC7C 1X9NA 2ACJA 1HSTA 3GFJA 2OA4A 4BHCA 5HLGA 4HDVA 4A6DA 1O3TA 1ZN2A 3JSNA 2Z99A 4GKJH 2RGVA 3HYIA 4L18B 2CYYA 4CC6A 4WXHA 1I27A 3I64A 2FBKA 4HA8A 5ILUA 1XDNA 4O5VA 2HEOA 2QLZA 1R23A 5IT9W 2XAFA 2JRTA 2ZM6H 2FOKA 3HRSA 4GXOA 3ZMVA 4YFNF 4LFAH 1FX7A 4WF2A 4HV5A 1R36A 2PQ8A 2XGXA 1FPQA 2VC1A 4U7DA 3BY6A 4M71A 4XRFA 3JTGA 1IXCA 1JHHA 3MQ0A 3MZYA 3DXJF 2FA5A 2STWA 3LWFA 3E5XA 2XAJA 4A0YA 4DR2H 2YR2A 3M8FA 2LKPA 1U78A 1LVAA 4WX9A 2GA2A 6PAXA 4A0XA 1SD7A 4U7BA 1QQIA 1G3YA 3RPUA 5LHGA 4IRIA 1XGSA 2W25A 2Q0OA 3LQRA 1BJTA 2FBIA 2FSWA 3GX4X 4AIKA 2W84A 1XMKA 5AIQA 4ENKA 4LG0B 1FLIA 4APMA 2EA4A 3BABA 3JAMK 2F4VH 4KT5C 1DUXC 3DKWA 3KLNA 3RYRA 3DQVC 5FB2A 5F64A 1P2FA 1SD4A 1SMTA 3ZMZA 2R7FA 3HSRA 5LEJA 3VEPA 2H94A 1ZGJA 1XMQH 1J7KA 1G6NA 5HS8A 2XKPA 4GYGA 4GYIA 4IXAA 3QAHA 2ZNYA 1LDJA 2IRFG 2MA3A 4UCTA 1D5VA 2XKOA 4LLLA 1W7PB 2PFBA 3V8KA 2K4JA 1Z6TA 5D6FA 1R58A 4MV7A 2A6EF 2YSRA 3RTRA 5DD8A 1ULYA 1K79A 3JAMW 3GZ5A 5LEKA 2YCHA 1HQCA 4E70A 4YFKF 1ZLKA 1FY7A 4PCQA 2UUAH 1DDNA 3LMLA 5HOOA 5L3BA 4UV8A 4AVPA 4P9UA 4DR7H 5LL6b 2UXBH 3DPTA 1IN6A 3RIRA 3ZN1A 3K2ZA 1Z2OX 1I5ZA 3ISPA 2DPUA 3S2WA 3QP6A 2EV0A 2FU4A 1IUYA 1OR7A 4LB5A 3D5LA 1JXSA 3HRUA 1PP7U 4R8HA 4OIRF 4WCGA 4LMYA 4MTDA 4HF2A 3JSLA 2VT2A 3L09A 3P9CA 1H9GA 2FQ3A 1ZYRF 4IF4A 3IWZA 4OMZA 2FF4A 4KIFA 2E1NA 2P4WA 2E5LH 4JI0H 2VBZA 2OBPA 4UCOA 1FC3A 2VE8A 4DV1H 2GXBA 2L01A 1BN5A 4P9FA 4YG2F 3H92A 3FMSA 3FF5A 1KU3A 5HLIA 3B02A 1QBJA 2ESHA 4MTEA 2HVRA 4X65H 4J0MA 4JI7H 3I58A 1W7PA 1TAEA 4LK1F 3TDUC 2NS0A 3TQNA 3HSEA 2WTEA 5ILVA 3J81W 2RC4A 4L9JA 2PN6A 2XVCA 2HOEA 5FPOA 4KN4X 3WGHA 1FYKA 4BNCA 5D5VB 3TOAA 5DCFA 3CLOA 1S68A 4G7ZF 4HLXA 1OPCA 4HX8A 4IRHA 3E6MA 3CO7C 4OU0A 5A2QZ 1XCBA 2HKOA 3SXYA 4LF7H 2UXDH 3F8CA 4UUVA 4I7HA 1QZYA 1KU7A 4MQVA 2OZ6A 1R1TA 4EJTA 4PGHA 2VBWA 2JPCA 1FJGH 4UCUA 4RB1A 4AIJA 3PFIA 1ZRCA 3U1DA 4HQEA 5LHHA 2XUBA 3WG9A 1BIBA 4P5OA 2ZJTA 3PQKA 4I01A 4OINF 2M5WA 4ZYHA 3SFZA 3V8JA 3KEOA 2HYFA 5FFXA 3TO7A 2Q2UA 1GXPA 4MNUA 4JI6H 4L9TA 4S05A 1HKQA 2RVCA 2D1VA 2KJBA 2A6HF 4LLGF 4HW0A 4EV0A 1S7AA 5DD4A 3BOQA 1V4RA 3CO6C 3WE3A 4LJZF 5E1ZB 4A5MA 1CF7A 1N34H 5D1OB 1O57A 4Q4ZF 4KFCA 3R60A 5D6EA 2QQAA 4HDUA 1H9TA 3I5UA 2E7XA 3UQ8A 2A68F 1FZPB 1XNQH 2LDUA 4JBAA 4D0PA 3HOSA 3ROUA 2VUGA 3WE2A 3FM5A 2EFQA 1YW7A 5TJJA 1OKRA 2HQRA 1S3JA 2JZYA 3EETA 3N42B 1SFXA 3OTOH 3LA3A 4DR1H 1XMAA 2BE5F 3N4MA 1E4FT 5IT9K 4DUYH 4EVIA 4L0YB 2VOBA 1XDSA 2VXZA 2D45A 4RB2C 3JSPA 3N6XA 4DUZH 1FP2A 1BJAA 3RPQA 1BIAA 2AXLA 5HDNA 4ON0A 2KSWA 4L5JA 1XGOA 4KUMA 2QWWA 2OU2A 1ZGAA 1FVIA 2VBXA 4HOBA 2ESNA 2R7DA 1HW1A 5K5OA 3F23A 4NHJA 1T0FA 2X0LA 5L3EA 3VOEA 1D3YA 4MEYF 3H20A 1H0MA 4JK1X 3Q5FA 2VT3A 1J2XA 2UWMA 3GO5A 2GQQA 1I6UA 2V79A 4B3MH 2DTRA 4DQ2A 1S7OA 5E18F 2CW0F 3RJ0A 5ICGA 1T98A 2YX4A 3IRQA 4ESBA 4RB3C 4ESJA 5BR8H 3ABTA 5FLXW 4BAYA 3E97A 2HZTA 1T39A 2KRFA 3F6OA 4JV5H 5LHIA 5LRRA 2X4HA 2EB7A 4BWSC 4U0WA 3WTZA 4G6QA 4L5IA 1L3LA 2O0YA 4CYDA 3MCZA 3K9TA 1S29A 4KICA 5H6QA 3BJ6A 1LDKB 4QWQA 3WTSC 3QU6A 2HVSA 2F5CA 5DUIA 5JVTA 3BPVA 3T1HH 3VB2A 3WTTC 3FM3A 3FMQA 3IG0A 3FXRA 2L3DA 2XHKA 3BDDA 1MZBA 1PUEE 4QLCU 2ZNZA 4MGRA 4PGGA 2KJCA 2IPQX 1XB4A 1BC8C 3N44B 1HR0H 5LBQA 3I54A 2G7UA 2WWYA 4UV9A 3KFWX 3ECOA 2ISZA 3L2PA 1E4GT 3KP3A 4Q5SF 3N40P 1KU9A 2P5KA 2KIFA 1KQ8A 2K02A 3M8EA 1LJ9A 1TQIA 3RJPA 2PEXA 1HBXG 3I59A 2H09A 3COAC 1AOYA 2HFHA 2WDTA 4UCRA 2HS5A 2V1XA 5IT3A 2DQRA 1MJ9A 4LF8H 5HS7A 4ASNA 4MEXF 3CTAA 1IRGA 1FNNA 1J75A 2LF8A 3KP4A 5BQTA 3F8FA 1IAWA 3GFIA 1QO0D 3E6DA 3GVAA 1ZHFA 4LSAA 1TQMA 2AS5F 2MBFA 1BI1A 3QPTA 4RAYA 4RB0A 2ADUA 3Q9SA