2XIKA

Structure of human ysk1 (yeast sps1-ste20-related kinase 1)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
290
structure length
288
Chain Sequence
HLRGFANQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEEIEDIQQEITVLSQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNSPPTLEGQHSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSFLTELIDRYKRWKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE PROTEIN KINASE 25
publication title Structure of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1)
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 288
sequence length 290
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2xikA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xikA01
3ZS5A 4QMTA 3VS0A 4FSNA 3QTZA 3VS6A 4C62A 2PMIA 1UVRA 4IVCA 5TF9A 3ZFYA 4TYHB 3ORIA 5DEWA 4AU8A 5BMSA 5KZIA 4U5JA 4D2PA 3I81A 1H1RA 1LUFA 3IQ7A 4FV4A 4NU1A 3DJ6A 1UU3A 4EHGA 4R3CA 5GNKA 3FLQA 2PZ5A 2F9GA 2WTIA 4P4CA 2QG7A 2VWWA 1F3MC 1YW2A 2OK1A 4M13A 4M69A 4L8MA 4IIRA 3AT4A 5AP6A 4QD6A 3ZTXA 2IZTA 4X2FA 2CKQA 2Y6MA 1CM8A 1ZXEA 3HMPA 3D15A 4ASZA 1MP8A 5FXQA 5HNBA 2JEDA 1H07A 3P4KA 3Q2JA 3OT8A 3CCNA 2QOQA 3N4UA 3OUNB 4FT0A 3UOJA 4CXAA 2BHHA 2BRMA 4RX8A 4O0UA 2F2UA 4YZCA 3FY0A 4EQCA 4FVRA 3PPJA 3CQUA 3D94A 3FMLA 4FVQA 4BIEA 4AT5A 1J1BA 3CKXA 5DR6A 5FP6A 3QXPA 3ET7A 3TV7A 3BHUA 4TPTA 2CKOA 3BGPA 3TTJA 3N4VA 3NCZA 3EWHA 4XLVA 5E7RA 4PL3A 1GAGA 3THBA 3EZVA 5HZNA 1H1PA 4WA9A 2IVVA 4ZSJA 2XNBA 5M06A 2OH0E 4OTRA 3FZTA 2C3KA 3QGWA 2JDOA 4BGQA 1H1QA 5ETFA 1Y57A 3UYSA 4AZEA 3PXYA 5IH4A 1KSWA 4EH6A 4U80A 3F82A 3ROYA 2WOTA 2JAVA 3SGCA 1V1KA 2VGPA 4CYJA 4BI2A 3ZM9A 4DFUA 4EOLA 4CCBA 5A14A 3WYYA 3KC3A 4W9WA 4ZS4A 1NW1A 4O7VA 1JBPE 3DBDA 4O38A 5BUIA 2R0IA 4ZOGA 3TKIA 5B2MA 2YAKA 4AGDA 3VVHA 4D55A 3MDYA 5C26A 2Y6OA 4HGSA 2R3GA 4ONAA 4G6OA 2C5OA 1ZAOA 2RFNA 2B7AA 5KMNA 4EUUA 1JKTA 4D4SA 4YTFA 4GUEA 4BR3A 4O7ZA 3QLGA 4WHZA 3PXRA 2GCDA 1NVRA 3Q9XA 3FL4A 3I0QA 3QKLA 4NZWB 5LVOA 5DG5A 3ALNA 4O81A 2CMWA 1NXKA 3AG9A 4C38A 3AMYA 3NWWA 3JY0A 3CR0A 4TNBA 3RAHA 1YDRE 5HOAA 4CZTA 4DT9A 2ONLC 3VBQA 3MV5A 4PTGA 4OTWA 4UXQA 4AA0A 5ANIA 4Z7GA 3Q9WA 4O0WA 5F95A 4E5WA 5E8SA 4AS0A 4F7NA 4S32A 1NVSA 5K0XA 1Q8ZA 4IZ7A 3F3UA 3TN8A 3C4CA 3LFCA 3ORXA 4MBJA 3TV4A 4BB4A 5BYYA 4W4VA 4P7EA 2CGWA 4U9AA 4BCGA 4R7HA 5BPYA 3QTIA 3QKMA 3DFCB 4FL2A 4YPDA 4C8BA 2BAKA 2B53A 5F20A 3OC1A 4U6RA 2YM8A 3AC5A 4IB1A 4BCQA 3WIKA 5CNNA 3R30A 3MFRA 1LR4A 3T3VA 4XP2A 3C50A 4Y46A 4NTTA 1BMKA 3MSSA 5HKMA 3WZDA 2UW8A 5F4NA 4IH8A 2XUUA 3PSDA 1MRVA 3QQKA 4F4PA 4CKIA 4L3LA 3EQGA 2X8IA 3KXNA 4MF1A 5E8TA 4ZZOA 5HORA 5BUJA 3S0OA 4PMPA 3FL5A 3RZBA 3O7LD 4BZDA 5HLNA 3V8TA 2G15A 2WQMA 3QL8A 4IAKA 5HCYA 3ZUVA 4K11A 5G6VA 5IISA 2A0CX 1OMWA 1AGWA 4IQ6A 2XCHA 4GG7A 4I6QA 4PP7A 4K18A 4BKYA 2XNNA 4B0GA 4LI5A 1QPJA 4EOQA 4FV6A 3DLZA 1GZNA 5KBQA 4AUAA 4IWPA 3RAIA 3QXOA 1WBTA 4EYJA 3KULB 3FEGA 3E7VA 3PG3A 4JR3A 5IG1A 3CD8A 4N0SA 5LWNA 2BAQA 3FI3A 3W33A 3PSBA 4E6AA 2EXCX 5JFSA 4L42A 3TI1A 4HVDA 4FK6A 5J1WA 3QFVA 3BBWA 1JQHA 2WHBA 3NNXA 5J8IA 4QYEA 4DG0E 3REPA 1BL6A 4BY9E 3B8RA 2XEYA 2XEZA 2R3PA 3ACKA 3BE2A 4TYEA 5AR3A 3V5WA 5A46A 4MEDA 3FLYA 3F3ZA 4FG7A 4IZAA 2CGXA 3DZQA 2WMRA 4ERKA 5JT2A 2RGPA 4KIKA 4EWQA 5HO7A 4DFNA 2UW7A 5HU9A 1PMNA 3P1AA 2B9IA 1JVPP 5CXZA 1UU8A 3SX9A 2BR1A 1H25A 2O64A 4V0GB 1R3CA 4YBJA 1M14A 3I0OA 2R3FA 2F7XE 1V0PA 4EK6A 2GSFA 5IQFA 3EL7A 4ZEGA 5I9XA 3GC0A 3NCGA 4MQ1A 4KUJA 3UOKA 3LCKA 4GYGA 2YN8A 5EG3A 4BCMA 2G2IA 4RC2A 3U4UA 3IOPA 5I5ZA 5GINE 3FHIA 2CCIA 3IKAA 3O71A 1STCE 4IDTA 2PUPA 2YABA 4G3FA 4IX3A 4ZK5A 4G3GA 3H9RA 4DCEA 4G6LA 1W84A 4QPMA 3MWUA 5EFQA 3S95A 4QYYA 2Y8OA 4IXPA 4RIOA 3BEGA 1FPUA 3CJFA 4ZSGA 4U40A 1YQJA 4MAOA 4D4YA 4PV0A 1Y91A 2OJGA 5IDPA 3U54A 1FINA 3FMJA 1Q8UA 4WOVA 2C0IA 1O6YA 4WO5A 2VN9A 1Q3DA 5IH6A 3GGFA 3ZRKA 1YHSA 4DYMA 2HCKA 5CT7A 5FTQA 4O21A 2QU6A 3FKLA 3H4JA 5J9YA 4S31A 1Z5MA 2FUMA 3E8EA 3R9DA 4ASEA 2H9VA 3VUDA 2IZRA 3EQHA 5DT3A 3KVWA 3Q5IA 4F9BA 3R00A 4FKLA 4F1OA 5JKGA 5DPVA 4NYEA 2X9FA 4DLIA 2W5BA 2OJJA 2BZIB 2VD5A 4TXCA 3SQQA 3MH3A 4IFCA 4FIJA 5DT4A 3AC3A 1GNGA 3TNWA 3HUCA 2QLUA 3ETAA 3PP0A 3OCSA 5EKNA 3KGAA 4GW8A 4Z3VA 2X6DA 2G01A 4BDCA 3F7WA 3AC8A 3D4QA 5BUEA 5ICPA 4E20A 1XR1A 5HNGA 2X2MA 5H9BA 3OXZA 3QQUA 1U5QA 5C9CA 2C5NA 4H1JA 3E8NA 5A4QA 3MIYA 1YWNA 3QGYA 2QOHA 1NVQA 4UZDA 3ZH8A 1J3HA 4V04A 1BX6A 3B2WA 5CWZA 4FNYA 5T3QA 4JG7A 3VWAA 4L3JA 3O17A 3VJOA 3G5DA 2ZMDA 3TDWA 3GQIA 3TNPC 4AF3A 4NM0A 2GNGA 2QO7A 3QTWA 4X2JA 3UNZA 4DFYA 4DH7A 4XS2A 3ZLYA 5LVPA 4BI0A 4CNHA 5DRDA 3MBLA 3VS7A 4F6WA 2C3IB 4GG5A 4XV1A 4IVDA 4R78A 4L53A 5M44A 4A9UA 1Y6AA 1Y8GA 2IZSA 2R3NA 4XHKB 3ROCA 1L3RE 4YLKA 5A54A 2I7QA 3FBVA 4MXAA 4B8LA 4CFVA 4PPBA 5EYKA 3CXWA 1GZKA 3ZRLA 4M84A 4AW2A 2C5YA 4DCAA 2B55A 2YLFA 5GJFA 1KE6A 4OTQA 5HLWA 5HLPA 2C1AA 4EBWA 3LLAA 3POZA 2PE2A 4KRDA 5BVFA 3Q96A 5CSPA 4PTCA 5AR8A 3VUHA 4ZY6A 4AOIA 1XWSA 3FKOA 3OG7A 4G3CA 4S2ZA 3AQVA 4EK5A 2WTVA 3PUPA 3KXZA 4I22A 2JLDA 3DBCA 2XKDA 1L8TA 4RQVA 5CENA 4AA4A 3WBLA 2WMTA 3MPMA 1OUKA 4II5A 5TE0A 1MQ4A 3BBTB 1QPDA 3LMHA 1XQZA 5IA2A 3CBLA 4LRKA 4NW5A 5EHLA 2DS1A 4C37A 3RPYA 3RCJA 2R0UA 2C6EA 5CU3A 4LG4A 5HEZA 3CSVA 4QP4A 3JUHA 4OTDA 2YJSA 4DGGA 2WTWA 5FD2A 3A2CA 3NUAA 4ENXA 5LCKA 3HYHA 4IACA 2OG8A 2P33A 4CV8A 4D2TA 1J7UA 2A19B 4PL4A 4DC2A 3RP9A 3VBXA 4AN3A 2JD5A 4D2VA 5IU2A 1VYWA 1UKIA 4QP3A 4O22A 2VTIA 2R3RA 3C7QA 3CEKA 1I44A 1QL6A 2YM5A 3H30A 3QBNA 3RWQA 5CU2A 3UIUA 2VTLA 3VUKA 3ZUTA 5AAGA 5EQEA 1U54A 5AUZA 3HDNA 3DXPA 4IEBA 3LIJA 3BWFA 4CQGA 2R3KA 5HD4A 3D0EA 3Q32A 4ZTSA 5M55A 4I6BA 2W5HA 3KXHA 1F5QA 1OKZA 4NKAA 4U97A 1WVYA 4BDJA 3Q6WA 5B2LA 1WMKA 2UZTA 2R3OA 3A62A 3RM7A 4C4JA 3HNGA 5HG5A 4BTFA 3IDBA 2J50A 1P4OA 1GIHA 2PTKA 2W5AA 4J97A 4IWDA 5BVOA 3UZPA 4AN9A 1ND4A 1OITA 5DE2A 3ZDIA 4EC8A 3QQHA 4NTSA 5CXHA 2C3LA 5HVJA 4DN5A 4EEVA 3ZC6A 4JT3A 3PA4A 3ZHPC 2RSVA 3WYXA 3D5XA 3NVMB 4IZ5A 3R73A 1A48A 4BDFA 4QYHA 2B0QA 3DLSA 4G1WA 5CEMA 4FKOA 1DI9A 1Y8YA 3NS9A 3ZYAA 1DS5A 3EQCA 3ALOA 4XP0A 2UZBA 4I6HA 4V05A 4ZJVA 2Q83A 5LWMA 1RQQA 3HV4A 3NUUA 3W18A 4HVHA 4TYIA 2VX0A 5DN3A 2BKKA 4C0TA 2J2IB 3ZO2A 4D5HA 5M4IA 4H3QA 3L1SA 5AP2A 4TWCA 2ITPA 3AXWA 3EB0A 2JBPA 3OBJA 4GFMA 4PWNA 2J0IA 2XRWA 3HRCA 3Q5ZA 3O0GA 2CGVA 3RK9A 3RBWA 5EQYA 4X3JA 2QOCA 4BDHA 4FX3A 3S3IA 4CVAA 4G6NA 5CSHA 4F99A 5A4LA 4FEUA 3S00A 3GCPA 4F0IA 2EWAA 3VUTA 4ZTQA 2YCSA 4CMOA 3PY0A 2XJ0A 3R8VA 3UZRA 4RT7A 4IW0A 4JI9A 5L4QA 1OIYA 2WMQA 3GFWA 5HX8A 5KE0A 2ZB0A 4FSUA 5D9HA 3WILA 4YHFA 5J1VA 3JYAA 2UW5A 3HUBA 5AV1A 4M3QA 4C58A 4CD0A 5JFVA 2W7XA 4TYHA 1W83A 5M4CA 4CLIA 3R1SA 1T45A 3PRIA 4L01A 3GVUA 5EHOA 4JIKA 3QZFA 5E8WA 5FP5A 3WF6A 4YR8A 5CASA 3GI3A 3ZBXA 2PZYA 5JQ8A 4KABA 2C3JA 2YISA 2GTMA 3E64A 3PY1A 4K0YA 3FPQA 4O7NA 4TW9A 2Z7LA 2UZUE 1PHKA 1H0WA 3P86A 5CF6A 2ZVAA 5L6OA 3FMDA 2F4JA 2J6MA 3C0HA 2P4IA 1YXUA 4HYSA 2R9SA 4KAOA 3QCQA 4BCFA 3KVXA 3RGFA 3E62A 1IA9A 2PYWA 3PPKA 2F2CB 3HP2A 5FM3A 1KE7A 2IZUA 4CTBA 4FYNA 3VS1A 3E3BX 3BQCA 3C13A 4DEGA 5F94A 1RDQE 5JGAA 5IQGA 4I1ZA 3LXKA 4E5AX 2DQ7X 3W8LA 3DJ5A 4RLKA 3ZEPA 5F1ZA 3ATTA 3IOKA 2VNYA 4V01A 2Y4PA 4LUEA 4BBFA 4OUCA 3KL8A 4W8EA 4RVTA 1OKVA 2B9HA 2RF9A 3ODYX 4JBOA 5KMIA 5AP7A 3DK7A 2B9FA 4FSQA 3NEWA 1YI3A 2NO3A 4FKSA 3OWLA 4AGCA 1JKLA 3Q9ZA 4CYIA 3QHRA 3PPZA 3QTRA 1KE8A 1PJKA 2VRXA 4FV5A 4IFGA 3W2OA 4GSBA 3PFQA 3OZ6A 3D5UA 3W16A 4DH5A 3KF4A 4K6ZA 5IDNA 3KMMA 1ZMUA 4GIIA 4UWCA 5FBNC 3R7IA 4WBBB 4KA3A 3FZ1A 3FI8A 3ZONA 3V01A 3ANRA 4XV2A 4DG2E 3DA6A 3HV6A 4E6QA 3AC2A 4TWNA 2ZMCA 4LQMA 2ZV2A 2ZYBA 3B8QA 3ZSGA 4XEYA 3ZXZA 5JGBA 3RVGA 4BGGA 4F63A 3ORPA 2PHKA 2NP8A 3EH9A 4IB0A 4DEHA 5HI2A 4EH4A 4B8MA 5AIKA 5FXSA 3PP1A 2ITOA 5AR5A 4HCUA 3GU6A 4ACDA 4F08A 2JIIA 3UPZA 3RPRA 2Z02A 3FMKA 4ANNA 5JFWA 3VBWA 1LEZA 3FC2A 4IZYA 4J53A 3QYWA 5DI1A 3GU8A 3O7LB 2C6IA 4IAFA 4LGGA 2YDKA 4FEQA 4DFXE 3CTJA 1E9HA 5CSVA 4E4XA 5M4FA 4CSVA 1T46A 3CS9A 4H39A 2LGCA 3DDQA 4N70A 4GJ2A 1IEPA 1MRYA 4RSSA 3ULZA 5JZJA 4L67A 4EH7A 4LL0A 1VR2A 3SHEA 3QZHA 5CF8A 4USFA 4QMUA 4ZJJA 3P7CA 2ZV8A 2AUHA 2ZV9A 3R22A 4S30A 4TKSA 4YZBA 5DWRA 3RK7A 3U9CA 1WVXA 4FIFA 4ZS0A 3U51A 3H10A 5J7HA 5EI8A 4YNOA 4PP9A 4O0TA 5EM6A 3QCXA 1UV5A 5HNIX 2BDWA 4AG8A 4EKLA 3FV8A 5AR2A 4K2RA 3PJCA 4MHAA 2EXEA 4CT2A 3IK3A 4I21A 4W4WA 3IW7A 4U8ZA 5T68A 4PX6A 2ONLA 3D83A 2FB8A 2HWPA 3EMGA 1XO2B 4RMZA 5IF1A 3B2TA 5CALA 5AP4A 4ACMA 3ZSIA 3FXXA 4XNEA 3TEIA 2UV2A 2X4ZA 3T3UA 2RG5A 3RKBA 5L2IA 5BYLA 2P0CA 3GT8A 3EQRA 5H3QA 4CFNA 3TKHA 1OL7A 2OIDA 2C0OA 5I0BA 1CSNA 3VS2A 3KRXA 3NIEA 2NRUA 5M57A 1PXMA 3DOGA 2HK5A 2WEVA 3TZ8A 5CU6A 2XNEA 1OVEA 4O7YA 3FWQA 3QRKA 1OECA 5AR4A 4QYGA 3FHRA 3AD6A 3CY3A 3BQRA 3HVCA 4EHVA 1J91A 3CGFA 4RQKA 4XH6A 4AGUA 4BCOA 4I93A 4E6DA 5L8KA 2LAVA 2YM6A 1O6KA 3LFAA 4BC6A 2O63A 1M2PA 4Y83A 4YC6A 4M15A 3IGGA 3DKCA 3EN4A 4KKHA 1J1CA 4YU2A 5B0XA 3KMUA 5CI7A 1H1WA 5JSMA 4MWIA 4BBMA 4K8AA 4FL1A 4DE4A 3KULA 2VO6A 3D7TB 3DT1A 4MXXA 5E90A 4EORA 2FO0A 3TG1A 4FV7A 3RAKA 3V8WA 3MA3A 5GZ9A 4C7TA 2H8HA 2UZLA 4TZRA 3F66A 2J90A 3IG7A 1SNXA 4Y5QA 3ZBFA 5HVKA 3HGKA 4E1ZA 4UMRA 4O91A 2JC6A 4UWBA 5C4KA 3QU0A 1PKGA 4CFUA 3KRJA 5EYCA 5L2TA 4OT5A 3Q04A 4JDHA 4DGNA 2EVAA 3LFNA 4QP7A 4EH3A 2HZIA 3FZRA 2DYLA 3MIAA 1E1XA 1PMUA 2IN6A 3NAYA 3OCGA 3ZU7A 3LCTA 4RX7A 3ENHA 5DMZA 3FY2A 2BDFA 3QRTA 4BDAA 3LM5A 3BGQA 3DBFA 3MVMA 3F6XA 4V0GA 5DHJA 4QMXA 1NA7A 3G0EA 2WTCA 5TO8A 3R7VA 4NJDA 1APME 4CG8A 3TL8A 5FBOA 4Q2AA 4K33A 2QOOA 4I41A 5HCXA 1UA2A 2IPXA 4CG9A 5C8MA 4IC7A 3TXOA 3VS5A 4A07A 3UMXA 5FM2A 4AW0A 2Z7RA 4FF8A 5LCJA 3C1XA 3MY1A 5DLSA 5FTGA 2UW0A 3AOXA 2VTHA 3OUKA 4RWLA 3NW7A 1PKDA 2ITYA 4KS7A 4TY1A 2G2FA 2FGIA 3C0GA 4KSPA 4PL5A 3ZLWA 3II5A 4BZNA 3EQFA 4BDGA 5M09A 3MB6A 3NPCA 4I0SA 2GDOA 3FLSA 3WF9A 3ORZA 1AD5A 4HYIA 2BZHB 4IJPA 4XG3A 1PMVA 4NIFB 5C03A 1DI8A 3BYMA 3IS5A 4L46A 5C4LA 3ACJA 5CLPA 3P9JA 4M7IA 4FNZA 4D5KA 5KMMA 3V5TA 4DT8A 2W17A 4QP8A 5FUTA 2CJMA 2I40A 2XKEA 2BTRA 3DB8A 4KS8A 4RWKA 5CT0A 5EKOA 5JMSA 3EYHA 4ZTRA 4LOOA 5A4TA 2C4GA 3EQBA 5ANOA 4BTMA 2V55A 5LJJA 4OTFA 4U45A 3EN9A 3NLBA 3Q6UA 1W8CA 4OBPA 4AA5A 2JAMA 1DAWA 5EK7A 4G3DA 4CMTA 4UMTA 4O7RA 4QRCA 5K4JA 2XZSA 4D9UA 3IGOA 4KBAA 3DKOA 3ZLSA 1ZMWA 4JIAA 4ALWA 4MXOA 3BHYA 1P4FA 1YDTE 3MFUA 2XIKA 3GCVA 4C3FA 3RZFA 3R2BA 3PJ2A 3MYGA 3C5IA 4DEEA 4PNIA 3G0FA 4EHZA 3R8MA 3UIXA 4FT9A 2Z60A 1PMEA 4QP9A 2WU6A 4KRCA 4BHZA 3NR9A 4DGMA 2XNMA 3P23A 1TQMA 3BU5A 3K54A 5EM8A 2HOGA 2PY3A 2KULA 4WNOA 3U8WA 3LM0A 4EH5A 3GBZA 5ETCA 2GNFA 4I0RA 3VS3A 4BKZA 5LOHA 2YZAA 3HRBA 1QCFA 1YRPA 4BDIA 4X6RA 2OF2A 5H8BA 3GUBA 4BYIA 2YERA 4ZTHA 4ALUA 2WMUA 3WF7A 3FMNA 2QHNA 4LOPA 5HVYA 2O5KA 4D2RA 4EOOA 2PULA 3SXRA 4QQJA 4LM5A 2ERKA 4F0GA 3HV3A 4IB3A 4NK9A 3BV3A 3MFTA 4WNPA 2JKKA 5H8GA 3NMUF 3NGAA 3ZFMA 4BCHA 3Q52A 4UXLA 1SMHA 3VHKA 3RM6A 1W98A 1FMKA 2OFUA 5KCVA 2YWVA 5ANJA 3PZEA 4LRMA 2BZKB 4GRBA 4YJNA 3UC4A 2YCRA 3VS4A 4YJTA 1XKKA 2Z2WA 4EONA 5GIPE 3GU5A 1Q61A 2PVRA 2X39A 4DA5A 2CNUA 3HMOA 5DOSA 4F1TA 1XHAA 2VWUA 3PVBA 4EHEA 1LPUA 2PVJA 1AQ1A 2ITQA 3DJ7A 3EYGA 5TR6A 4D2WA 3UVPA 1PRYA 4O7WA 5AUWA 2VO0A 3QUPA 1F0QA 5L2WA 4A9RA 3V6RA 5K0KA 5LMKC 2Y7JA 1LEWA 3DBEA 2OFVA 1YXXA 4IJ9A 2A27A 5AP1A 3W55A 2YJRA 4J95A 3MPAA 4A9TA 3MW1A 3V8SA 3ZDUA 1WFCA 3GFEA 3KK8A 3LAUA 3HA8A 4AW5A 5CVFA 4KINA 3UVRA 1OPLA 1ZYLA 4FEWA 3ENMA 3FLZA 2O2UA 3Q9YA 3IW4A 2YM3A 2OF4A 3G51A 2WFYA 4FZ6A 4W4YA 4CFFA 3DPKA 4XUFA 4F9YA 2BALA 3T8OA 3U6HA 4PMSA 3QD2B 3QD0A 3FJQE 4ZIMA 2OO8X 5HX6A 3F3VA 2VTQA 2FH9A 2QOIA 3F5XA 5FRIA 1QPCA 3OD6X 2I0VA 4H58A 4J1RA 3KB7A 3UBDA 4JQ8A 4UN0C 5K5NA 2BRNA 4CKRA 3A60A 3HLLA 2YFXA 2B54A 2ZM3A 3CPCA 4USEA 4OTPA 4JVGA 4O2ZA 5JN2A 2ZDUA 3PY3A 4R8QA 5EOLA 2GHGA 3PVGA 4QT1A 2BTSA 3A7JA 1GZOA 4E93A 2OXYA 5CQUA 3QX2A 1LP4A 5L2SA 3KXXA 3FZPA 2X8EA 2WOUA 4Y8DA 2HW6A 2PVYA 1WAKA 5DA3A 2KTYA 3CD3A 1B38A 3OHTA 1G8AA 5K5XA 3V04A 2PMLX 2O65A 3NDMA 2BAJA 1KOBA 4FEXA 1MRUA 2B4SB 2YAAA 2YIWA 3SV0A 5HIEA 3HL7A 3GC8A 3GC9A 3FLNC 2X6EA 1XH6A 2QODA 3C4FA 3KCFA 3OROA 3QRUA 4FV0A 4YP8A 1XH4A 4CFWA 4O7LA 2VTTA 3Q4ZA 2NRYA 4U43A 5K3YA 3MH1A 5JQ5A 3KXMA 2H6DA 2OBJA 4WIHA 3W10A 5KHXA 1Q8TA 4FSMA 4IB5A 4FKRA 4GCJA 4ANOA 3C4WA 5H2UA 1OPJA 4F0FA 5IEVA 4XP3A 4CGAA 3LJ0A 5A4EA 3FI2A 2W06A 4FICA 1IAHA 3DU8A 2IW9A 4XX9A 4DBXA 1O6LA 4MBLA 3PRFA 2VTNA 3W32A 3TNHA 3PLSA 2XBAA 2ERZE 1Q3WA 2UZVA 2RIOA 3BZ3A 5KNJA 3KF7A 3W8QA 3LFSA 3NRMA 2B9JA 4RPVA 5J79A 5LARA 3QQFA 1IAJA 3VBTA 4NT4A 5HBJA 4RVMA 4HNFA 2I0YA 3HV5A 3R9OA 3G6HA 2OH4A 2VWIA 3I5ZA 3BLHA 4JBPA 4MWHA 4XV9A 4CCUA 4ZTMA 3TUDA 1GY3A 2WMXA 1A06A 3EN7A 5KMLA 4FTUA 4RWIA 1SVEA 2GQGA 3OY3A 4LOQA 3HZTA 3T9IA 4AZSA 2RFDA 3DKGA 2OJFE 3OBGA 5CZHA 5J87A 4ANLA 3QUEA 4UALA 2F7EE 2YCFA 3G2FA 5I9WA 1ZARA 3ERKA 4G2FA 4IVAA 2QO2A 4Z16A 2FYSA 5ITAA 4KSQA 2RKUA 1ZLTA 4YMJA 5J7BA 1PXIA 3DBQA 1PF8A 2WMSA 4R1YA 4YSMA 1H4LA 1PYEA 1VYZA 3H3CA 4YLJA 4FTCA 3EJ1A 2QR8A 4ZSAA 4MX9A 2ITVA 5HQ0A 3PWYA 5DT0A 4FNXA 5DBXA 4ZY4A 3DNEA 4BRXA 5M56A 3OXIA 4USDA 4Y5HA 3HDMA 4FOBA 4JDJA 5AWMA 5FEEA 4MD9E 4XCUA 5L3AA 2HZNA 3ORKA 1KE5A 4C34A 4NJ3A 4BCNA 2QONA 1JPAA 3FQSA 5LQFA 5M07A 3G33A 5GJGA 4F65A 4NWMA 4R3PA 1G5SA 4B9DA 2XF0A 3L8VA 4FZFB 1YWRA 2QQ7A 4FV9A 2VTSA 5IH5A 3KEXA 3SW7A 4QMOA 4JQEA 4E7WA 1U5RA 5CF5A 5DIAA 3DKFA 2AC3A 2XIRA 2BFYA 3MI9A 4TYJA 4QMZA 3V5QA 2YLEA 2VTJA 2VWBA 3OCTA 3E3PA 1BI7A 2YDIA 5C8NA 1BUHA 3O50A 2V22A 3KMWA 4L7FA 3TIZA 4YHJA 5EDQA 4RJ3A 4G9CA 5AP0A 3OXTA 2O8YA 1WBNA 4JLCA 3BU6A 3VW6A 4WT6A 1RE8A 4MXYA 2GTNA 3CGOA 1XH7A 4QQTA 4GK2A 3DAJA 2UZDA 3LFDA 3Q4UA 2QD9A 4PMMA 4PQNA 3ZZWA 4D4VA 2BCJA 2JDVA 3V6SA 3DV3A 1UWHA 4YJVA 5IQEA 3KQ7A 1IR3A 3QRJA 2ZM4A 3BLRA 2VNWA 5IUIA 5IPJA 4JRNA 3L9NA 4L6QA 3FI4A 3LW0A 4NSTA 1EH4A 2O3PA 4APPA 2ITUA 3FZSA 1YXSA 3FMEA 4YNEA 4R77A 3UQGA 4AZFA 2WMVA 4KIOA 5BVKA 2JITA 4C4EA 4F7JA 4EQMA 2XIXA 4I5PA 3A61A 3VNTA 3O2MA 3UIBA 2J0LA 1CDKA 5ANKA 3V5PA 4MBIA 5A6NA 4N6ZA 3TUBA 4UEUA 3EQPA 1PXNA 1OL5A 3FMHA 3OOGA 2OIBA 4QMSA 3NW5A 4HGLA 4RFYA 4MNEB 2WQBA 3BU3A 3RPSA 2PVLA 3G9NA 2PVHA 4L00A 4CRLA 4XBRA 4QMPA 2EB3A 3ANQA 3Q4TA 3MB7A 5CAVA 2XK9A 1G3NA 1TQIA 4LV5A 4D1ZA 4DITA 4TL0A 3R63A 1Q8YA 4JS8A 4R7IA 1W7HA 4FBXA 5HG7A 5C8KA 3BEAA 3K5VA 4YUQA 3OF0A 1H1SA 3LXPA 4QMYA 5EOBA 5M08A 3DB6A 3NYXA 4O86A 3K3IA 4J52A 4WUNA 3SC1A 3NAXA 5BVWA 1FBNA 5AAFA 1OM1A 1OPKA 2WTKC 3UQCA 3NNWA 3P7AA 2QI8A 3EN5A 3E8CA 2XA4A 1YKRA 2DUVA 2G9XA 4PF4A 4NH1A 4FZAB 4AWIA 4PDPA 3VQUA 3D5VA 4FKJA 3EKKA 3VUMA 5IA4A 3GCUA 3AD5A 5K9IA 4FTTA 4RX5A 5IQHA 4TYGA 3FSKA 3BLQA 4FTNA 5ETAA 4A4LA 5C01A 4EZ3A 5CF4A 2PWLA 2WQNA 3QX4A 4HNIA 1HCKA 3WARA 3SAYA 4UMPA 2OICA 4U3YA 3LMIA 4ZAUA 4ITIA 4KIPA 3EIDA 3DFAA 3PXZA 3UO6A 4A06A 5DYJA 4JJRA 1K9AA 3ZO1A 2WTKB 5E8VA 3I7BA 4XG9A 2W4KA 3QD4A 2BIKB 3RCDA 5AAEA 5HIBA 4FIHA 3G9LX 5EW8A 1PYXA 3D7TA 2VWZA 1Y6BA 3TNQB 3TWJA 4AT3A 2ITTA 4Z7HA 1X8BA 2RFEA 3PSCA 4X3FC 3QTSA 3FPMA 1KUTA 3C4ZA 1UNGA 3DNDA 4LMUA 1M52A 2R7BA 1Z57A 5CQWA 2GS6A 3GENA 3PJ3A 4PY1A 4E4LA 3ORMA 2J0MB 4FVPA 2PMNX 1BKXA 4HJOA 4QMWA 4RJ7A 5CVHA 3ZEWA 2E9NA 4I5CA 2WZJA 4IM3A 4YTHA 2WD1A 4RIYB 3E92A 3ATSA 2OSCA 5IMEA 2OU7A 4UWYA 3W2SA 4K77A 4IBMA 2BHEA 2OXXA 4YO6A 3VRYA 5L2QA 3AD4A 1BLXA 1R1WA 3A4PA 2A1AB 3EQIA 3ODZX 4ID7A 1H26A 2W1GA 3JXWA 3MY0A 4QYFA 4X3FB 4M8TA 1YWVA 3UYTA 3H0ZA 4OGRA 4YC8A 2E9VA 3ZSHA 3LKMA 2CPKE 4G34A 3FQHA 1ATPE 3FZOA 2I6LA 4DTKA 3C0IA 4MCVA 4GU6A 3TT0A 1U46A 4O7SA 1PW2A 2IG7A 5DR2A 3FMMA 1Q62A 5KUPA 3R6XA 2YM7A 4AQCA 2DWBA 3ELJA 3LFQA 3ORTA 1VEBA 2UUEA 4FKIA 4DINA 5AFVA 3AMAA 3RALA 5AR7A 4JOAA 4R6VA 4DEDA 1FVTA 5KX8A 2NNWB 3P0MA 3WI6A 3H9FA 2OKRA 1SYKA 4TWOA 4E8AA 2W1DA 3RHKA 4UYNA 4ERWA 3VJNA 4XMOA 4GK3A 2PE0A 1DM2A 1WBPA 4H3BA 3VAPA 4JR7A 4U44A 3IDPA 2XH5A 3ZCLA 5M53A 4O6EA 2YIQA 4D1XA 1P2AA 2WIPA 4NIFA 3CIKA 1IASA 2I1MA 1UNHA 2O0UA 5A6OA 3I6WA 4OR5A 1FOTA 4QMVA 4FV1A 3R83A 4AXAA 3CQWA 5BVEA 1P14A 4M12A 4GYIA 3R9RA 4DH3A 2VTMA 1R0PA 2WQOA 3SRVB 2XM8A 3ZFXA 5EHYA 5JRQA 4N57A 2PZRA 4UB7A 1HOWA 4FG9A 2GS7A 4GUBA 4U0IA 3KRWA 1OI9A 2BRBA 4PNKA 3E93A 3UG2A 3MY5A 5K4IA 3MVJA 3BCEA 2ZDTA 2XM9A 2SRCA 4MF0A 2FSTX 4BI1A 4FGRA 5CSWA 5FDXA 4DEIA 5CS6A 4C3PA 2UZEA 5CEQA 3D2KA 4O0YA 2RFSA 3ORLA 3HMIA 3PTGA 4EOSA 3KA0A 3F61A 5BQ0A 3AT2A 3QALE 4FT3A 3F3TA 5KKRC 2C6MA 3FE3A 4EJ7A 3MPTA 4I5HA 5L8LA 2QR7A 3D7ZA 3OVVA 3Q60A 2BRGA 4ANBA 5HO8A 4WSYA 3F2NA 3IW6A 4WG4A 4DH8A 4O82A 5HCZA 1YOLA 4P5QA 5LVNA 2IJMA 2X7OA 2I0HA 1JNKA 3A7HA 4EUTA 2ZJWA 4YO4A 4FK3A 2XIZA 2YM4A 1B6CB 4G17A 2JIVA 2XIYA 4RG0A 4WUAA 3PYYA 3BELA 1TKIA 4W4XA 3R28A 3KREA 4C61A 4MD7E 4UMQA 2C5VA 3EFKA 2X4FA 3GOKA 3BIZA 5KKRB 3D2IA 3NW6A 3Q4CA 4HGEA 4UV0A 2E9PA 2GHLA 3R1NA 2BIYA 3GU7A 3RWPA 2R3MA 3PXFA 4NFNA 4AZWA 4WD5A 3QUDA 3KK9A 3COHA 3L9LA 1OBGA 4DHFA 2IW8A 4I6FA 3TZMA 5CEOA 2QG5A 4NL0A 4EL9A 5DNRA 3TJCA 2WGJA 3ZOSA 4H36A 4LGHA 4Z55A 2R3HA 4IVBA 4A4XA 3UGCA 1SZMA 4RLLA 3PVUA 4QTDA 4XG2A 1OIUA 3FYJX 2PZIA 3M2WA 4HGTA 4YJSA 3U9NA 3K2LA 2QHMA 3JS2A 2WTDA 4PUZA 2WNTA 3OT3A 4FTKA 2XYNA 4G5JA 3MS9A 5BVNA 4ZMEA 4DAWA 4N6YA 5CI6A 3TKUA 4JDIA 4M0YA 4L44A 2UVZA 5HIDA 4EH2A 3DQWA 2XNOA 2HXLA 2VO7A 3UOLA 3NIZA 4GVAA 1I09A 1MQBA 3C4XA 4DGLC 4QTCA 5IEYA 2REIA 4IMYA 4WBOA 1Q24A 4RJ8A 5CNOA 3TCPA 4J8NA 4JG6A 4FGBA 1JOWB 2R64A 3O8UA 4IAAA 5CAOA 3SVVA 3Q2MA 1ZYDA 2VWYA 4FTQA 2VAGA 2YHVA 1XH8A 5D7AA 2WMAA 4XRJA 1Q5KA 3DXNA 4IE9A 4IAYA 4Y73A 1TVOA 4NEUA 1HCLA 4FR4A 3QQLA 4RIXB 4O0XA 4HYUA 4O6LA 4F1MA 2PE1A 4HOKA 1H28A 5CAPA 3SG9A 3NNUA 3QC9A 3VULA 4FTJA 3OEFX 4D0WA 3GC7A 5HTIA 5LMKA 4KD1A 4Q9SA 3LMGA 4UZHA 1ZYSA 3VW8A 3UPXA 3DXQA 3CP9A 2UZNA 4IX4A 1OKYA 2J51A 1E1VA 3PE1A 1QMZA 3R8UA 3PJ8A 1OGUA 3QTXA 2A2AA 2XRUA 2ZM1A 2Q0NA 3BE9A 5GJDA 2XMYA 3PIYA 5DFPA 3S2PA 4B99A 3G15A 5TKDA 3PLAE 2VV9A 2P2HA 2CN8A 4JRVA 3PJ1A 4PRJA 3FAAA 1YVJA 2BVAA 3Q3BA 3O23A 5HESA 4G31A 2CNQA 4OLIA 4RZVA 3VRZA 4BTJA 1GJOA 1JLUE 2JIUA 4JXFA 4M97A 2W05A 3OMVA 4O27B 3SA0A 5JRSA 4IX6A 4KWPA 5ANDA 2OXDA 3L8XA 5AJQA 5AP5A 5GHVA 4FUXA 2X7FA 4YHTA 4PDOA 2UW9A 5FTOA 3JY9A 3FUPA 4FKTA 2WAJA 4U81A 5IMXA 2PL0A 4QNAA 2JGZA 4WRSA 2C6KA 2W1EA 4BCJA 2YEXA 3HV7A 1JWHA 3N9XA 2GHMA 4NW6A 4X21A 4CFXA 4GKIA 2NPQA 3GCQA 4X0MA 5HTCA 4P2KA 4ALVA 4GJ3A 5FDPA 4LRJA 2OGVA 1SVHA 2C5XA 2HAKA 2OZOA 4K9YA 3UDBA 3M42A 4AE9A 5E8YA 3EN6A 2IO6A 3HEGA 1WBWA 1UU7A 4NUSA 4ZLYA 2VU3A 3DTCA 2HY81 4OBOA 4P5ZA 3U87A 3TJDA 5HU3A 4EQUA 4C33A 3R01A 3COIA 4OW8A 5HO6A 2B52A 2GU8A 3NUNA 5AM7A 4BKJA 3UZTA 2QKWB 3TV6A 2H34A 4QO9A 3IONA 2GNLA 1YDSE 5EI2A 4BGHA 5ANGA 4CFMA 3L9PA 1FVVA 2UW6A 5E8XA 5KO1A 4C36A 4F64A 2XJ2A 4J71A 1JAMA 2VWVA 4GT4A 4YZ9A 4YZNA 5CSXA 1O9UA 3DQXA 4PPCA 4D2SA 2EB2A 4FL3A 5HGIA 4IM2A 4DG3E 2W1FA 4O0RA 4FT5A 2QC6A 4H3PA 2WEIA 2UZOA 2C6LA 2QU5A 4FSZA 2Y0AA 4L43A 3SG8A 4K1BA 3LFEA 3MGYA 1XBBA 3FKNA 2J0JA 4X2KA 1KE9A 2W9FB 2GNIA 3LXLA 3MA6A 1OL1A 4UYAA 3VUGA 4GS6A 1M7QA 3MVLA 4JL9A 4LFIA 3QQJA 3SOAA 5A3XA 2FSMX 3FQEA 5JGDA 2UVXA 2JFMA 3A8WA 3H0YA 5CTPA 1ZY4A 1GOLA 2ITXA 2XKFA 3RAWA 4UMUA 3LQ3A 5M51A 4FT7A 4O1OA 2XKCA 4AE6A 4DH1A 2CKPA 3IW8A 4R5SA 4FKQA 3NSZA 2XK3A 3S1HA 3TZ7A 4QP6A 2WKMA 4XRLA 5EYDA 3VIDA 4ACCA 3L9MA 2H96A 4D28A 3W2RA 5G1XA 3BPRA 2VZ6A 5AEPA 4FKVA 3LOKA 5JK3A 4HVGA 3FC1X 5I9VA 3AT3A 3LFFA 2ZAZA 2PU8A 3QKKA 2HYYA 4FG8A 1CKIA 2V5QA 3GCSA 2WELA 3GXLA 3QAME 4C59A 5FQDC 3HMMA 3P78A 2OZAB 4IADA 4QMNA 4MD8E 4Y72A 4RWJA 4OAUC 2QURA 4JX7A 4TWPA 1PXKA 1OIRA 2IW6A 3R8LA 5DH3A 2YIYA 5TT7A 4EI4A 2WB8A 4M0ZA 4I20A 2UW4A 5AUTA 4JX3A 1Q41A 4RIWB 5AMNA 5GZAA 3R04A 3P5KA 5E8UA 2WXVA 3G6GA 3RK5A 1YI6A 4FI1A 3RPVA 5HBEA 4ANMA 1OIQA 3CTHA 4FKUA 4FTRA 3OTVA 4EC9A 3TUCA 4FV3A 3KN6A 4WKQA 5EW9A 4IDVA 4DF3A 2VX1A 5GIOE 3BYOA 3C9WA 1YXTA 3L8PA 2VGOA 1OB3A 2R7IA 5IA3A 5EM5A 1TQPA 2BKZA 2VTPA 2ESMA 3D5WA 3O8TA 1XJDA 3PZHA 3K3JA 1H08A 3EZRA 1A9UA 4E5BA 4DTAA 3CJGA 3K5UA 4XOZA 3KCKA 4CRSA 3RNYA 4FKWA 4BFMA 4M67A 2X2LA 2I0EA 4C57A 4J98A 3GU4A 5D11A 1QPEA 4FODA 2G2HA 4KB8A 4XG8A 5DEYA 5HICA 4DFZE 1GIIA 2FSLX 2JDRA 3OWKA 2QOLA 4DFLA 1BL7A 3AC1A 2HW7A 2W1HA 4WSQA 4BDEA 3JR1A 4ZLZA 2XS0A 3R7OA 2J4ZA 4EOJA 4F9CA 3R1YA 4LV8A 2V62A 4G16A 4WG3A 4MK0A 1GIJA 4HPUE 4C4IA 4H05A 2C6OA 4XOYA 4NCTC 3RJCA 3UG1A 3GQLA 2VTAA 2PVFA 3LQ5A 4RJ5A 4BHNA 1Q4LA 4QQ5A 5E9EA 1S9IA 4MNEA 3R21A 3TIYA 1RJBA 2VTOA 4S33A 3I60A 5CU0A 4FIEA 4RFMA 5E1SA 4PDSA 2QLQA 2F57A 3HAMA 3MTLA 1ZOGA 3QD3A 3TACA 4BN1A 2PVMA 5IEXA 3GP0A 4C4HA 2W9ZB 1IA8A 4L45A 5FLFA 5IKWA 3BHVA 4AOJA 3IECA 1UNLA 3LJ2A 3NUSA 3PA5A 4QPSA 3DAEA 3ORNA 1H01A 4D9TA 2Q0BA 5L8JA 2JBOA 5CX9A 3R7EA 3JVRA 4FOCA 5D12A 3R7UA 4U79A 3DDPA 2RL5A 5AA8A 3FYKX 5GZ8A 4F9AA 4YBKA 3JPVA 3VUIA 5HHWA 4LGDA 4RC4A 4RJ4A 3ULIA 3I5NA 4A9SA 5HBHA 4A9YA 4CZUA 4R5YA 4RJ6A 4ZY5A 3FDNA 5IQBA 4QP1A 3SOCA 2ITWA 4AFEA 4QMMA 3ID6C 4L68A 2CN5A 4D4RA 2OJIA 1CTPE 2W99B 1WVWA 3QYZA 2C6TA 1ZYJA 3FLWA 2YACA 3GNIB 4DLJA 4APCA 4I4EA 3KFAA 4OTGA 5IQCA 3QWKA 4BZOA 4FKGA 4MTAA 3LE6A 4JAJA 2GQSA 1H24A 2WMWA 4IHPA 1R78A 4RC3A 3RI1A 3HAVA 3CE3A 4QPAA 5AIRA 4W9XA 5IA1A 3PE2A 2IVTA 2W0JA 4CKJA 3FXZA 1OUYA 2FVDA 3A7GA 5FXRA 4FTLA 4GV1A 3PA3A 3OFMA 3HKOA 3R8PA 3F5GA 3O8PA 4JQ7A 4MXCA 2BRHA 3MH0A 3LCSA 5DVRA 5I3OA 2WIHA 1UWJA 2J9MA 2PK9A 2EU9A 2X7GA 2GNJA 2W4OA 3EQDA 5ACBC 1DAYA 5EH0A 2XBJA 4RIYA 3ZLXA 4J99A 1XBCA 1WCCA 1ZY5A 4EK8A 4RBLA 3VBYA 4EOMA 3LPBA 4PDYA 5FEQA 4NKSA 2AYPA 4X2GA 4GEOA 2XB7A 4G5PA 3HP5A 4X3FA 1XBAA 1REKA 2V0DA 3OS3A 3QCYA 4JG8A 3UP7A 4F7SA 1FGIA 2HWOA 3F5UA 3E87A 5E1EA 4TRLA 5L6WL 4J96A 3LQ8A 3N4TA 4E73A 3HA6A 2GNHA 4NM5A 2UW3A 1FMOE 4OT6A 4F09A 2WU7A 2BPMA 2HELA 3WZKA 3H9OA 4LUDA 3VF9A 4XBUA 2ETRA 4EOPA 1H27A 5CYIA 4ZXTA 1CKPA 4TN6A 3DTWA 2X2KA 4HZRA 4ZLOA 2GFCA 3CPBA 4ORKA 4C2WA 5IQDA 2BZJA 2QOKA 5AUVA 1Z9XA 4W8DA 3AC4A 4M68A 4F6UA 3BX5A 3KY2A 3RMFA 5T6KA 2Z7SA 4M69B 3ZZEA 3NNVA 4MYGA 4F6SA 2C69A 5I9YA 2HIWA 3QA0A 4RX9A 4G3EA 3COKA 3SXSA 4CQEA 4DGOA 3WZJA 3W2CA 4S34A 4DEBA 4FKPA 2QOBA 2VWXA 4ITHA 4MH7A 4A4OA 4BCPA 4E4NA 4EWHA 3SKCA 4C2VA 4DEAA 2W1IA 4IWOA 3NYNA 3ZMMA 5EDRA 3KRLA 5AX9A 3SRVA 4EOIA 1OBDA 4X2NA 4QMQA 5LXMA 4FC0A 4BVUA 4PTEA 2WO6A 5KHWA 3SXFA 4R3RA 3IDCA 3UP2A 4QMLA 4AZVA 4ANSA 4C02A 4YGAA 1SVGA 3WZUA 1YHWA 5IA5A 5AV4A 4GFGA 2B1PA 4ACHA 4MNFA 2YIRA 5CVGA 4EK3A 3A99A 3U6JA 2P2IA 2PSQA 4OAVB 3R2YA 5BYZA 3WF5A 2ZV7A 1Q8WA 2XJ1A 3ZO4A 2CHLA 3QHWA 2X9EA 3L8SA 3QZIA 4XG6A 3I4BA 5AUYA 1JSTA 4U7ZA 2Z8CA 3DZOA 4E6CA 2P55A 4X6QC 3MVHA 4GH2A 1RW8A 4HCVA 1KWPA 2CLQA 2YCQA 4TT7A 3C4EA 3OOMA 4HCTA 2YA9A 4YC3A 3BYUA 4WNKA 1VJYA 4YURA 3W2PA 2QO9A 4FE2A 4CEGA 4ITJA 4GMYA 1URWA 1XH5A 1M17A 1UU9A 4FSYA 2QVSE 2CSNA 3DK3A 2Y9QA 3POOA 3OWJA 1REJA 5L6PA 3FXWA 2JDSA 3PXKA 1K2PA 2E9UA 3OCBA 4GVJA 2YIXA 4PMTA 3EHAA 3BGZA 2PVKA 5EM7A 3F3WA 4BICA 5CAQA 2W1CA 3V5JA 1OL6A 3UNJA 2ETKA 2JFLA 3LHJA 3NX8A 5CU4A 3AGLA 3WOWA 4EJNA 4ZSEA 3OY1A 3EFJA 4QTEA 5ETIA 3VBVA 4O2PA 1PXPA 1WBSA 3D14A 3MJ1A 4YLLA 4I5MA 2VX3A 3F7ZA 2J5EA 4CLJA 2VO3A 3PG1A 4JBVA 4AACA 5CEIA 3GB2A 3R0TA 5HE3A 4I94A 3LXNA 3UODA 1OKWA 4P90A 1JKSA 5BX0A 3UQFA 3EL8A 4IAIA 3V5LA 4YSJA 4PPAA 1SM2A 2W96B 2PMOX 4QP2A 4RGJA 3RINA 4MXZA 4ZTNA 5E91A 4ENYA 4L9IA 4FNWA 4E4MA 2GS2A 3CC6A 4BIBA 1FQ1B 3EOCA 4RFZA 4RVLA 2BFXA 2FSOX 3LZBA 4IANA 3PXQA 3SDJA 2VUWA 4GU9A 4U3ZA 2FA2A 3UO5A 3WIGA 4QNYA 5J9LA 5KZ0A 1W0XC 3IPHA 2ETMA 5KMKA 3NZ0A 1Q99A 4FTAA 1JSUA 4JNWA 4WRGA 4AP7A 3OTUA 4QOXA 4BCIA 3ITZA 2UZWE 3FSFA 2WTJA 3AGMA 3TZ9A 5IQAA 1H0VA 2VTRA 3O51A 1PXOA 4XG4A 5HE2A 3MTFA 4RIXA 2JKOA 3P7BA 4J8MA 3R9HA 3QTQA 3ZM4A 2ZB1A 3IW5A 3KN5A 3OW4A 3CLYA 4ACGA 3R9NA 4C35A 4FZ7A 4I4FA 4A7CA 4L3PA 2R3IA 2YDJA 3HMNA 3D9VA 4CMUA 3SW4A 4G9RA 2A4LA 2GFSA 4I0TA 2C47A 1P5EA 3VHEA 4D58A 3EFLA 4EOKA 4LYNA 4BWKA 3LCOA 1SNUA 2HY0A 5AX3A 4MQ2A 2G1TA 1BYGA 4L52A 3ZXTA 4FYOA 4GK4A 5BVDA 4FTIA 1M7NA 3S4QA 4RVKA 3U6IA 2BILB 3UIMA 4AOTA 4ASXA 5A9UA 4LL5A 2E2BA 4FV2A 4KBKA 3WE8A 3WF8A 5EDPA 1XH9A 4ARKA 4HPTE 5F9EA 3E88A 3R02A 4RZWA 2XVDA 5AV0A 4AZTA 2CNVA 5I4NA 1BI8A 1UKHA 3F9NA 2EXMA 3QF9A 2GPHA 4ZJIA 1OL2A 4YJQA 5AUUA 2F7ZE 3C5UA 4EYMA 3RNIA 1WBVA 3PIZA 4KIKB 4FA2A 3IO7A 4D1SA 3SLSA 4O83A 2OW3A 3F5PA 2J0KA 1JKKA 4XYFA 3QRIA 2ZOQA 1H8FA 4B7TA 3F69A 5FG8A 1FGKA 4FTMA 2XNGA 4JAIA 5LMAA 5M4UA 3LFBA 4C3RA 3KU2A 1B39A 3BRBA 2R5TA 3LJ1A 1V0BA 4MVFA 3MJ2A 4BL1A 1KOAA 2PVNA 2Y4IC 1H00A 3QWJA 5AA9A 4L7SA 1J7LA 2XCKA 4O7TA 4CTCA 2OWBA 4F9WA 5CAUA 2XNPA 4JDKA 1YXVA 2CGUA 4QTBA 4C4GA 3BV2A 3E63A 4GT3A 4I92A 3GOPA 3ZC5A 2X81A 3F2RA 1IG1A 3I79A 1WZYA 1ZOHA 3A7IA 2OI4X 5AV2A 4GFOA 2Z7QA 4H1MA 3VN9A 4F7LA 4GIHA 5JZNA 2C30A 2PPQA 2R3QA 4J7BA 1YOMA 4FZDB 4OTHA 2YITA 4FIGA 5D1JA 3ZUUA 3SD0A 1M2RA 3A8XA 4GKHA 4GT5A 5HG9A 2XK8A 2Y4IB 1CMKE 4IC8A 4YJUA 4AN2A 4HW7A 4M66A 3BKBA 4WNMA 4EKKA 4DTBA 3UC3A 3QZGA 4LMNA 3QCSA 3UTOA 4I23A 3U4WA 5E92A 1U59A 4I24A 3T9TA 5A4CA 4BDBA 4U42A 3EFWA 2RG6A 3LCDA 1PXLA 4B6LA 5AV3A 4NM3A 4ZTLA 1JSVA 2HZ4A 3TNIA 2XK6A 2ITZA 3BHHA 3BHTA 3BWJA 3HECA 3LLTA 5HE0A 4FTOA 4EH9A 3KRRA 3KKVA 3BYSA 4BDKA 3M1SA 1S9JA 4HVIA 2BMCA 2V7AA 3E5AA 3OWPA 4XJ0A 1R39A 4KNBA 2EUFB 1K3AA 4OTIA 2R3LA 3E8DA 4IM0A 2OZAA 1KV2A 5FWKK 4YJOA 5JH6A 5DGZA 2E9OA 2QKRA 4BCKA 4NM7A 5CEPA 3PIXA 2BDJA 2R3JA 3HRFA 5ACKA 5E4HA 1FVRA 5FGKA 3RTPA 3UO4A 3UJGA 4BTKA 3WZEA 2XK7A 4TTHB 5HG8A 3P79A 3TTIA 3UOHA 4RIWA 2OJ9A 4DFBA 5E8ZA 3M11A 2CKEA 3R8ZA 3W1FA 4FV8A 4XG7A 2J5FA 4IAZA 2F49A 3A7FA 4NFMA 1ZZLA 4KKEA 1M2QA 2IWIA 2QCSA 3R71A 4AX8A 4YTCA 2GQRA 4O84A 3MFSA 2V7OA 4M14A 4KBCA 4CV9A 4YZMA 2X1NA 4O0VA 5IA0A 2C6DA 4RA5A 4FSWA 1GZ8A 4I3ZA 2QNJA 4DBNA 2AC5A 2IVUA 4AGWA 5CZIA 5EI6A 5B2KA 3VF8A 4AFJA 5AUXA 1ZRZA 5BMMA 5J5SA 4AAAA 4BDDA 1G8SA 5I3RA 4ZP5A 3N51A 4YJPA 2ITNA 2XK4A 4N4SA 5EYMA 1U4DA 1YOJA 3VC4A 2IVSA 4KKGA 3E7OA 3F2AA 1YHVA 3LVPA 2X8DA 1OZ1A 3COMA 4YZDA 4FSTA 3NUXA 4OBQA 1YI4A 3CQEA 5J95A 4X7QA 5EW3A 4KIQA 4BBEA 3AMBA 2W4JA 3P08A 4ASDA 4CZYB 2YZLA 3CTQA 3V3VA 2BROA 4E26A 4UBAA 2PUUA 3OEZA 3RPOA 3NVKI 4BWXA 4RRVA 4ZSLA 3NUPA 5DRBA 2WQEA 4HZSA 3DGKA 3F88A 3I6UA 4TNDA 3QA8A 4C4FA 4O0SA 5IQIA 5HTBA 2R4BA 2XP2A 3GEQA 4ZZMA 2OLCA 5ANEA 3DCVA 3R7GA 4BWPA 3V51A 1MUOA 4ZZNA 2JKMA 1KV1A 3QLFA 2W1ZA 4EK4A 5I9ZA 5AM6A 2C1BA 3NUYA 4FSRA 5HD7A 2OIQA 4R7BA 4BIDA 5D10A 4QTAA 1U54B 3UMWA 5AADA 2HZ0A 3DAKA 3DK6A 4NCTA 3WE4A 4F70A 3EKNA 2QOFA 4FIIA 2JKQA 2P3GX 3ZRMA 5JFXA 4FMQA 3TDVA 3O96A 4AW1A 3QC4A 4EBVA 1CKJA 3G90X 4HYHA 5H8EA 5LVMA 5FEDA 2C0TA 4AT4A 2PUIA 4Y95A 5EQPA 1ZOEA 4RA4A 1ERKA 3U55A 2HXQA 4JBQA 1ZWSA 3CY2A 5IUHA 5JEBA 4HVSA 1PXJA 5KMOA 2CDZA 4UX9A 1VZOA 2YWPA 2R2PA 3MESA 4BYJA 3R1QA 4D0XA 3A4OX 2J7TA 3QQGA 3W2QA 3UVQA 3JVSA 2WMBA 3CKWA 4BF2A 2GMXA 4QQCA 3TM0A 4B4LA 5D7VA 5DR9A 5AP3A 2WPAA 2ACXA 2BUJA 4GL9A 4R1VA 4EZ5A 3I7CA 4YTIA 3UNKA 1W82A 3QTUA 2HENA 2XYUA 4ANQA 4XV3A 4EZ7A 2C68A 3I1AA 4CT1A 1WBOA 3C51A 2CLXA 2CCHA 5B7VA 4IX5A 5HE1A 4WG5A 5C27A 4XLIA 2PZPA 3PVWA 4MKCA 1NY3A 4O96A 1PY5A 3ZO3A 5CANA 2PUNA 3DY7A 3NYOA 4UY9A 3PDTA 2JDTA 4FUYA 4Q5EA 4Q5HA 5IZFA 3BI6A 5KMJA 1ZZ2A 3KXGA 3DS6A 5I9UA 5J9ZA 4EH8A 5C1QB 1V0OA 2UVYA 1ZMVA 5LVLA 3R7YA 1ZYCA 4O1PA 4YPSA 4IWQA 4Z9LA 3NYVA 4Q9ZA 5BNJA 1Q97A 3HX4A 3BYVA 3MH2A 3RHXA 4U41A 3PWDA 5IUGA 4Y85A 1J7IA 5KBRA 3MN3A 1IRKA 5LMBA 1R0EA 4FEVA 1URCA 4E3CA 4ZMFA 4YJRA 5CY3A 2X0GA 5TOZA 3VO3A 3OP5A 3UE4A 5J5TA 3OW3A 5CEKA 1NT2A 3VQHA 5D41A 3Q53A
chains in the Genus database with same CATH superfamily
3ZS5A 4QMTA 3VS0A 4FSNA 3QTZA 3VS6A 4C62A 2PMIA 1UVRA 4IVCA 5TF9A 3ZFYA 4TYHB 3ORIA 5DEWA 4AU8A 5BMSA 5KZIA 4U5JA 4D2PA 3I81A 1H1RA 1LUFA 3IQ7A 4FV4A 4NU1A 3DJ6A 1UU3A 4EHGA 4R3CA 5GNKA 3FLQA 2PZ5A 2F9GA 2WTIA 4P4CA 2QG7A 2VWWA 1F3MC 1YW2A 2OK1A 4M13A 4M69A 4L8MA 4IIRA 3AT4A 5AP6A 4QD6A 3ZTXA 2IZTA 4X2FA 2CKQA 2Y6MA 1CM8A 1ZXEA 3HMPA 3D15A 4ASZA 1MP8A 5FXQA 5HNBA 2JEDA 1H07A 3P4KA 3Q2JA 3OT8A 3CCNA 2QOQA 3N4UA 3OUNB 4FT0A 3UOJA 4CXAA 2BHHA 2BRMA 4RX8A 4O0UA 2F2UA 4YZCA 3FY0A 4EQCA 4FVRA 3PPJA 3CQUA 3D94A 3FMLA 4FVQA 4BIEA 4AT5A 1J1BA 3CKXA 5DR6A 5FP6A 3QXPA 3ET7A 3TV7A 3BHUA 4TPTA 2CKOA 3BGPA 3TTJA 3N4VA 3NCZA 3EWHA 4XLVA 5E7RA 4PL3A 1GAGA 3THBA 3EZVA 5HZNA 1H1PA 4WA9A 2IVVA 4ZSJA 2XNBA 5M06A 2OH0E 4OTRA 3FZTA 2C3KA 3QGWA 2JDOA 4BGQA 1H1QA 5ETFA 1Y57A 3UYSA 4AZEA 3PXYA 5IH4A 1KSWA 4EH6A 4U80A 3F82A 3ROYA 2WOTA 2JAVA 3SGCA 1V1KA 2VGPA 4CYJA 4BI2A 3ZM9A 4DFUA 4EOLA 4CCBA 5A14A 3WYYA 3KC3A 4W9WA 4ZS4A 1NW1A 4O7VA 1JBPE 3DBDA 4O38A 5BUIA 2R0IA 1ST0A 4ZOGA 3TKIA 5B2MA 2YAKA 4AGDA 3VVHA 4D55A 3MDYA 5C26A 2Y6OA 4HGSA 2R3GA 4ONAA 4G6OA 2C5OA 1ZAOA 2RFNA 2B7AA 5KMNA 4EUUA 1JKTA 4D4SA 4YTFA 4GUEA 4BR3A 4O7ZA 3QLGA 4WHZA 3PXRA 2GCDA 1NVRA 3Q9XA 3FL4A 3I0QA 3QKLA 4NZWB 5LVOA 5DG5A 3ALNA 4O81A 2CMWA 1NXKA 3AG9A 4C38A 3AMYA 3NWWA 3JY0A 3CR0A 4TNBA 3RAHA 1YDRE 5HOAA 4CZTA 4DT9A 2ONLC 3VBQA 3MV5A 4PTGA 4OTWA 4UXQA 4AA0A 5ANIA 4Z7GA 3Q9WA 4O0WA 5F95A 4E5WA 5E8SA 4AS0A 4F7NA 4S32A 1NVSA 5K0XA 1Q8ZA 4IZ7A 3F3UA 3TN8A 3C4CA 3LFCA 3ORXA 4MBJA 3TV4A 4BB4A 5BYYA 4W4VA 4P7EA 2CGWA 1VLRA 4U9AA 4BCGA 4R7HA 5BPYA 3QTIA 3QKMA 3DFCB 4FL2A 4YPDA 4C8BA 2BAKA 2B53A 5F20A 3OC1A 4U6RA 2YM8A 3AC5A 4IB1A 4BCQA 3WIKA 5CNNA 3R30A 3MFRA 1LR4A 3T3VA 4XP2A 3C50A 4Y46A 4NTTA 1BMKA 3MSSA 5HKMA 3WZDA 2UW8A 5F4NA 4IH8A 2XUUA 3PSDA 1MRVA 3QQKA 4F4PA 4CKIA 4L3LA 1XMMA 3EQGA 2X8IA 3KXNA 4MF1A 5E8TA 4ZZOA 5HORA 5BUJA 3S0OA 4PMPA 3FL5A 3RZBA 3O7LD 4BZDA 5HLNA 3V8TA 2G15A 2WQMA 3QL8A 4IAKA 5HCYA 3ZUVA 4K11A 5G6VA 5IISA 2A0CX 1OMWA 1AGWA 4IQ6A 2XCHA 4GG7A 4I6QA 4PP7A 4K18A 4BKYA 2XNNA 4B0GA 4LI5A 1QPJA 4EOQA 4FV6A 3DLZA 1GZNA 5KBQA 4AUAA 4IWPA 3RAIA 3QXOA 1WBTA 4EYJA 3KULB 3FEGA 3E7VA 3PG3A 4JR3A 5IG1A 3CD8A 4N0SA 5LWNA 2BAQA 3FI3A 3W33A 3PSBA 4E6AA 2EXCX 5JFSA 4L42A 3TI1A 4HVDA 4FK6A 5J1WA 3UDTA 3QFVA 3BBWA 1JQHA 2WHBA 3NNXA 5J8IA 4QYEA 4DG0E 3REPA 1BL6A 4BY9E 3B8RA 2XEYA 2XEZA 2R3PA 3ACKA 3BE2A 4TYEA 5AR3A 3V5WA 5A46A 4MEDA 3FLYA 3F3ZA 4FG7A 4IZAA 2CGXA 3DZQA 2WMRA 4ERKA 5JT2A 2RGPA 4KIKA 4EWQA 5HO7A 4DFNA 2UW7A 5HU9A 1PMNA 3P1AA 2B9IA 1JVPP 5CXZA 1UU8A 3SX9A 2BR1A 1H25A 2O64A 4V0GB 1R3CA 4YBJA 1M14A 3I0OA 2R3FA 2F7XE 1V0PA 4EK6A 2GSFA 5IQFA 3EL7A 4ZEGA 5I9XA 3GC0A 3NCGA 4MQ1A 4KUJA 3UOKA 3LCKA 4GYGA 2YN8A 5EG3A 4O4EA 4BCMA 2G2IA 4RC2A 3U4UA 3IOPA 5I5ZA 5GINE 3FHIA 2CCIA 3IKAA 3O71A 1STCE 4IDTA 2PUPA 2YABA 4G3FA 4IX3A 4ZK5A 4G3GA 3H9RA 4DCEA 4G6LA 1W84A 4QPMA 3MWUA 5EFQA 3S95A 4QYYA 2Y8OA 4IXPA 4RIOA 3BEGA 1FPUA 3CJFA 4ZSGA 4U40A 1YQJA 4MAOA 4D4YA 4PV0A 1Y91A 2OJGA 5IDPA 3U54A 1FINA 3FMJA 1Q8UA 4WOVA 2C0IA 1O6YA 4WO5A 2VN9A 1Q3DA 5IH6A 3GGFA 3ZRKA 1YHSA 4DYMA 2HCKA 5CT7A 5FTQA 4O21A 2QU6A 3FKLA 3H4JA 5J9YA 4S31A 1Z5MA 2FUMA 3E8EA 3R9DA 4ASEA 2H9VA 3VUDA 2IZRA 3EQHA 5DT3A 3KVWA 3Q5IA 4F9BA 3R00A 4FKLA 4F1OA 5JKGA 5DPVA 4NYEA 2X9FA 4DLIA 2W5BA 2OJJA 2BZIB 2VD5A 4TXCA 3SQQA 3MH3A 4IFCA 4FIJA 5DT4A 3AC3A 1GNGA 3TNWA 3HUCA 2QLUA 3ETAA 3PP0A 3OCSA 5EKNA 3KGAA 4GW8A 4Z3VA 2X6DA 2G01A 4BDCA 3F7WA 3AC8A 3D4QA 5BUEA 5ICPA 4E20A 1XR1A 5HNGA 2X2MA 5H9BA 3OXZA 3QQUA 1U5QA 5C9CA 2C5NA 4H1JA 3E8NA 5A4QA 3MIYA 1YWNA 3QGYA 4MUQA 2QOHA 1NVQA 4UZDA 3ZH8A 1J3HA 4V04A 1BX6A 3B2WA 5CWZA 4FNYA 5T3QA 4JG7A 3VWAA 4L3JA 3O17A 3VJOA 3G5DA 2ZMDA 3TDWA 3GQIA 3TNPC 3W0RA 4AF3A 4NM0A 2GNGA 2QO7A 3QTWA 4X2JA 3UNZA 4DFYA 4DH7A 4XS2A 3ZLYA 5LVPA 4BI0A 4CNHA 5DRDA 3MBLA 3VS7A 4F6WA 2C3IB 4GG5A 4XV1A 4IVDA 4R78A 4L53A 5M44A 4A9UA 1Y6AA 1Y8GA 2IZSA 2R3NA 4XHKB 3ROCA 1L3RE 4YLKA 5A54A 2I7QA 3FBVA 4MXAA 4B8LA 4CFVA 3BL7A 4PPBA 5EYKA 3CXWA 1GZKA 3ZRLA 4M84A 4AW2A 2C5YA 4DCAA 2XAOA 2B55A 2YLFA 5GJFA 1KE6A 4OTQA 5HLWA 5HLPA 2C1AA 4EBWA 3LLAA 3POZA 2PE2A 4KRDA 5BVFA 3Q96A 5CSPA 4PTCA 5AR8A 3VUHA 4ZY6A 4AOIA 1XWSA 3FKOA 3OG7A 4G3CA 4S2ZA 3AQVA 4EK5A 2WTVA 3PUPA 3KXZA 4I22A 2JLDA 3DBCA 2XKDA 1L8TA 4RQVA 5CENA 4AA4A 3WBLA 2WMTA 3MPMA 1OUKA 4O4BB 4II5A 5TE0A 1MQ4A 3BBTB 1QPDA 3LMHA 1XQZA 5IA2A 3CBLA 4LRKA 4NW5A 5EHLA 2DS1A 4C37A 3RPYA 3RCJA 2R0UA 3UDZA 2C6EA 5CU3A 4LG4A 5HEZA 3CSVA 4QP4A 3JUHA 4OTDA 2YJSA 4DGGA 2WTWA 5FD2A 3A2CA 3NUAA 4ENXA 5LCKA 3HYHA 4IACA 2OG8A 2P33A 4CV8A 4D2TA 1J7UA 2A19B 4PL4A 4DC2A 3RP9A 4DHZA 3VBXA 4AN3A 2JD5A 4D2VA 5IU2A 1VYWA 1UKIA 4QP3A 4O22A 2VTIA 3C7QA 2R3RA 3CEKA 1I44A 1QL6A 2YM5A 3H30A 3QBNA 3RWQA 5CU2A 3UIUA 2VTLA 3VUKA 3ZUTA 5AAGA 5EQEA 1U54A 5AUZA 3HDNA 3DXPA 4IEBA 3LIJA 3BWFA 4CQGA 2R3KA 5HD4A 3D0EA 3Q32A 4ZTSA 5M55A 4I6BA 2W5HA 3KXHA 1F5QA 1OKZA 4NKAA 4U97A 1WVYA 2X0PA 4BDJA 3Q6WA 5B2LA 1WMKA 2UZTA 2R3OA 3A62A 3RM7A 4C4JA 3HNGA 5HG5A 4BTFA 3IDBA 2J50A 1P4OA 1GIHA 2PTKA 2W5AA 4J97A 4IWDA 3P5JC 5BVOA 3UZPA 4AN9A 1ND4A 1OITA 5DE2A 3ZDIA 4EC8A 3QQHA 4NTSA 5CXHA 2C3LA 5HVJA 4DN5A 4EEVA 3ZC6A 4JT3A 3PA4A 3ZHPC 1XMLA 2RSVA 3WYXA 3D5XA 3NVMB 4IZ5A 3R73A 1A48A 4BDFA 4QYHA 2B0QA 3DLSA 4G1WA 5CEMA 4FKOA 1DI9A 1Y8YA 3NS9A 3ZYAA 1DS5A 3EQCA 3ALOA 4XP0A 2UZBA 4I6HA 4V05A 4ZJVA 2Q83A 5LWMA 1RQQA 3HV4A 3NUUA 3W18A 4HVHA 4TYIA 2VX0A 5DN3A 2BKKA 4C0TA 2J2IB 3ZO2A 4D5HA 5M4IA 4H3QA 3L1SA 5AP2A 4TWCA 2ITPA 3AXWA 3EB0A 2JBPA 3OBJA 4GFMA 4PWNA 2J0IA 2XRWA 3HRCA 3Q5ZA 3O0GA 2CGVA 3RK9A 3RBWA 5EQYA 4X3JA 2QOCA 4BDHA 4FX3A 3S3IA 4CVAA 4G6NA 5CSHA 4F99A 5A4LA 4FEUA 3S00A 4AXCA 3GCPA 4F0IA 2EWAA 3VUTA 4ZTQA 2YCSA 4CMOA 3PY0A 2XJ0A 3R8VA 3UZRA 4RT7A 4IW0A 4JI9A 5L4QA 1OIYA 2WMQA 3GFWA 5HX8A 5KE0A 2ZB0A 4FSUA 5D9HA 3WILA 4YHFA 5J1VA 3JYAA 2UW5A 3HUBA 5AV1A 4M3QA 4C58A 4CD0A 5JFVA 3W0NA 2XALA 2W7XA 4TYHA 1W83A 5M4CA 4CLIA 3R1SA 1T45A 3PRIA 4L01A 3GVUA 5EHOA 4JIKA 3QZFA 5E8WA 5FP5A 3WF6A 4YR8A 5CASA 3GI3A 3ZBXA 2PZYA 5JQ8A 4KABA 2C3JA 2YISA 2GTMA 3E64A 3PY1A 4K0YA 3FPQA 4O7NA 4TW9A 2Z7LA 2UZUE 1PHKA 1H0WA 3P86A 5CF6A 2NYAA 2ZVAA 5L6OA 3FMDA 2F4JA 2J6MA 3C0HA 2P4IA 1YXUA 4HYSA 2R9SA 4KAOA 3QCQA 4BCFA 3KVXA 3RGFA 3E62A 1IA9A 2PYWA 3PPKA 2F2CB 3HP2A 5FM3A 1KE7A 2IZUA 4CTBA 4FYNA 2IEWA 3VS1A 3E3BX 3BQCA 3C13A 4DEGA 5F94A 1RDQE 5JGAA 5IQGA 4I1ZA 3LXKA 4E5AX 2DQ7X 3W8LA 3DJ5A 4RLKA 3ZEPA 5F1ZA 3ATTA 3IOKA 2VNYA 4V01A 2Y4PA 4LUEA 4BBFA 4OUCA 3KL8A 4W8EA 4RVTA 1OKVA 2B9HA 2RF9A 3ODYX 4JBOA 5KMIA 5AP7A 3DK7A 2B9FA 4FSQA 3NEWA 1YI3A 2NO3A 4FKSA 3OWLA 4AGCA 1JKLA 3Q9ZA 4CYIA 3QHRA 3PPZA 3QTRA 1KE8A 1PJKA 2VRXA 4FV5A 4IFGA 3W2OA 4GSBA 3PFQA 3OZ6A 3D5UA 3W16A 4DH5A 3KF4A 4K6ZA 5IDNA 3KMMA 1ZMUA 4GIIA 4UWCA 5FBNC 3R7IA 4WBBB 4KA3A 3FZ1A 3FI8A 3ZONA 3V01A 3ANRA 4XV2A 4DG2E 3DA6A 4LV7A 3HV6A 4E6QA 3AC2A 4TWNA 2ZMCA 4LQMA 2ZV2A 2ZYBA 3B8QA 3ZSGA 4XEYA 3ZXZA 5JGBA 3RVGA 4BGGA 4F63A 3ORPA 2PHKA 2NP8A 3EH9A 4IB0A 4DEHA 5HI2A 4EH4A 4B8MA 5AIKA 5FXSA 3PP1A 2ITOA 5AR5A 4HCUA 3GU6A 4ACDA 4F08A 2JIIA 3UPZA 3RPRA 2Z02A 3FMKA 4ANNA 5JFWA 3VBWA 1LEZA 3FC2A 4IZYA 4J53A 3QYWA 5DI1A 3GU8A 3O7LB 2C6IA 4IAFA 4LGGA 2YDKA 4FEQA 4DFXE 3CTJA 1E9HA 5CSVA 4E4XA 5M4FA 4CSVA 1T46A 3CS9A 4H39A 2LGCA 3DDQA 4N70A 4GJ2A 1IEPA 1MRYA 4RSSA 3ULZA 5JZJA 4L67A 4EH7A 4LL0A 1VR2A 3SHEA 3QZHA 5CF8A 4USFA 4QMUA 4ZJJA 3P7CA 2ZV8A 2AUHA 2ZV9A 3R22A 4S30A 4TKSA 4YZBA 5DWRA 3RK7A 3U9CA 1WVXA 4FIFA 4ZS0A 3U51A 3H10A 5J7HA 5EI8A 4YNOA 4PP9A 4O0TA 5EM6A 3QCXA 1UV5A 5HNIX 2BDWA 4AG8A 4EKLA 3FV8A 5AR2A 4K2RA 3PJCA 4MHAA 2EXEA 4CT2A 3IK3A 4I21A 4W4WA 3IW7A 4U8ZA 5T68A 4PX6A 2ONLA 3D83A 2FB8A 2HWPA 3EMGA 1XO2B 4RMZA 5IF1A 3B2TA 5CALA 5AP4A 4ACMA 3ZSIA 3FXXA 4XNEA 3TEIA 2UV2A 2X4ZA 3T3UA 2RG5A 3RKBA 5L2IA 2XANA 5BYLA 2P0CA 3GT8A 3EQRA 5H3QA 4CFNA 3TKHA 2AEGA 1OL7A 2OIDA 2C0OA 5I0BA 1CSNA 3VS2A 3KRXA 3NIEA 2NRUA 5M57A 1PXMA 3DOGA 2HK5A 2WEVA 3TZ8A 5CU6A 2XNEA 1OVEA 4O7YA 3FWQA 3QRKA 1OECA 5AR4A 4QYGA 3FHRA 3AD6A 3CY3A 3BQRA 3HVCA 4EHVA 1J91A 3CGFA 4RQKA 4XH6A 4AGUA 4BCOA 4I93A 4E6DA 5L8KA 2LAVA 2YM6A 1O6KA 3LFAA 4BC6A 2O63A 1M2PA 4Y83A 4YC6A 4M15A 3IGGA 3DKCA 3EN4A 4KKHA 1J1CA 4YU2A 5B0XA 3KMUA 5CI7A 1H1WA 5JSMA 4MWIA 4BBMA 4K8AA 4FL1A 4DE4A 3KULA 2VO6A 3D7TB 3DT1A 4MXXA 5E90A 4EORA 2FO0A 3TG1A 4FV7A 3RAKA 3V8WA 3MA3A 5GZ9A 4C7TA 2H8HA 2UZLA 4TZRA 3F66A 2J90A 3IG7A 1SNXA 4Y5QA 3ZBFA 5HVKA 3HGKA 4E1ZA 4UMRA 4O91A 2JC6A 4UWBA 5C4KA 3QU0A 1PKGA 4O4CA 3KRJA 4CFUA 5EYCA 5L2TA 4OT5A 3Q04A 4JDHA 4DGNA 2EVAA 3LFNA 4QP7A 4EH3A 2HZIA 3FZRA 2DYLA 3MIAA 1E1XA 1PMUA 2IN6A 3NAYA 3OCGA 3ZU7A 3LCTA 4RX7A 3ENHA 5DMZA 3FY2A 2BDFA 3QRTA 4BDAA 3LM5A 3BGQA 3DBFA 3MVMA 3F6XA 4V0GA 5DHJA 4QMXA 1NA7A 3G0EA 2WTCA 5TO8A 3R7VA 4NJDA 1APME 4CG8A 3TL8A 5FBOA 4Q2AA 4K33A 2QOOA 4I41A 5HCXA 1UA2A 2IPXA 4CG9A 5C8MA 4IC7A 3TXOA 3VS5A 4A07A 3UMXA 5FM2A 4AW0A 2Z7RA 4FF8A 5LCJA 3C1XA 3MY1A 5DLSA 5FTGA 2UW0A 3AOXA 2VTHA 3OUKA 4RWLA 3NW7A 1PKDA 2ITYA 4KS7A 4TY1A 2G2FA 2FGIA 3C0GA 4KSPA 4PL5A 3ZLWA 3II5A 4BZNA 3EQFA 4BDGA 5M09A 3MB6A 3NPCA 4I0SA 2GDOA 3FLSA 3WF9A 3ORZA 1AD5A 4HYIA 2BZHB 4IJPA 4XG3A 1PMVA 4NIFB 5C03A 1DI8A 3BYMA 3IS5A 4L46A 5C4LA 3ACJA 5CLPA 3P9JA 4M7IA 4FNZA 4D5KA 5KMMA 3V5TA 4DT8A 2W17A 4QP8A 5FUTA 2CJMA 2I40A 2XKEA 2BTRA 3DB8A 4KS8A 4RWKA 5CT0A 5EKOA 5JMSA 3EYHA 4ZTRA 4LOOA 5A4TA 2C4GA 3EQBA 5ANOA 4BTMA 2V55A 5LJJA 4OTFA 4U45A 3EN9A 3NLBA 3Q6UA 1W8CA 4OBPA 4AA5A 2JAMA 1DAWA 5EK7A 4G3DA 4CMTA 4UMTA 4O7RA 4QRCA 5K4JA 2XZSA 4D9UA 3IGOA 4KBAA 3DKOA 3ZLSA 1ZMWA 4JIAA 4ALWA 4MXOA 3BHYA 1P4FA 1YDTE 3MFUA 2XIKA 3GCVA 4C3FA 3RZFA 3R2BA 3PJ2A 3MYGA 2XAMA 3C5IA 4DEEA 4PNIA 3G0FA 4EHZA 3R8MA 3UIXA 4FT9A 2Z60A 1PMEA 4QP9A 2WU6A 4KRCA 4BHZA 3NR9A 4DGMA 2XNMA 3P23A 1TQMA 3BU5A 3K54A 5EM8A 4LDTA 2HOGA 2PY3A 2KULA 4WNOA 3U8WA 3LM0A 4EH5A 3GBZA 5ETCA 2GNFA 4I0RA 3VS3A 4BKZA 5LOHA 2YZAA 3HRBA 1QCFA 1YRPA 4BDIA 4X6RA 2OF2A 5H8BA 3GUBA 4BYIA 2YERA 4ZTHA 4ALUA 2WMUA 3WF7A 3FMNA 2QHNA 4LOPA 5HVYA 2O5KA 4D2RA 4EOOA 2PULA 3SXRA 4QQJA 4LM5A 2ERKA 4F0GA 3HV3A 4IB3A 4NK9A 3BV3A 3MFTA 4WNPA 2JKKA 5H8GA 3NMUF 3NGAA 3ZFMA 4BCHA 3Q52A 4UXLA 1SMHA 3VHKA 3TYKA 3RM6A 1W98A 1FMKA 2OFUA 5KCVA 2YWVA 5ANJA 3PZEA 4LRMA 2BZKB 4GRBA 4YJNA 3UC4A 2YCRA 3VS4A 4YJTA 1XKKA 2Z2WA 4EONA 5GIPE 3GU5A 1Q61A 2PVRA 2X39A 4DA5A 2CNUA 3HMOA 5DOSA 4F1TA 3AKLA 1XHAA 2VWUA 3PVBA 4EHEA 1LPUA 2PVJA 1AQ1A 2ITQA 3DJ7A 3EYGA 5TR6A 4D2WA 3UVPA 1PRYA 1ST4A 5AUWA 2VO0A 4O7WA 3QUPA 1F0QA 5L2WA 4A9RA 3V6RA 5K0KA 5LMKC 2Y7JA 1LEWA 3DBEA 2OFVA 1YXXA 4IJ9A 2A27A 5AP1A 3W55A 2YJRA 4J95A 3MPAA 4A9TA 3MW1A 3V8SA 3ZDUA 1WFCA 3GFEA 3KK8A 3LAUA 3HA8A 4AW5A 5CVFA 4KINA 3UVRA 1OPLA 1ZYLA 4FEWA 3PFYA 3ENMA 3FLZA 2O2UA 3Q9YA 3IW4A 2YM3A 2OF4A 3G51A 2WFYA 4FZ6A 4W4YA 4CFFA 3DPKA 4XUFA 4F9YA 2BALA 3T8OA 3U6HA 4PMSA 3QD2B 3QD0A 3FJQE 4ZIMA 2OO8X 5HX6A 3F3VA 2VTQA 2FH9A 2QOIA 3F5XA 5FRIA 3O5AA 1QPCA 3OD6X 2I0VA 4H58A 4J1RA 3KB7A 3UBDA 4JQ8A 4UN0C 5K5NA 2BRNA 4CKRA 3A60A 3HLLA 2YFXA 2B54A 2ZM3A 3CPCA 4USEA 4OTPA 4JVGA 4O2ZA 5JN2A 2ZDUA 3PY3A 4R8QA 5EOLA 2GHGA 3PVGA 4QT1A 2BTSA 3A7JA 1GZOA 4E93A 2OXYA 5CQUA 3QX2A 1LP4A 5L2SA 3KXXA 3FZPA 2X8EA 2WOUA 4Y8DA 2HW6A 2PVYA 1WAKA 5DA3A 2KTYA 3CD3A 1B38A 3OHTA 1G8AA 5K5XA 3V04A 2PMLX 2O65A 3NDMA 2BAJA 1KOBA 2X0QA 4FEXA 1MRUA 2B4SB 2YAAA 2YIWA 3SV0A 5HIEA 3HL7A 3GC8A 3GC9A 3FLNC 2X6EA 1XH6A 2QODA 3C4FA 3KCFA 3OROA 3QRUA 4FV0A 4YP8A 1XH4A 4CFWA 4O7LA 2VTTA 3Q4ZA 2NRYA 4U43A 5K3YA 3MH1A 5JQ5A 3KXMA 2H6DA 2OBJA 4WIHA 3W10A 5KHXA 1Q8TA 4FSMA 4IB5A 4FKRA 4GCJA 4ANOA 3C4WA 5H2UA 1OPJA 4F0FA 5IEVA 4XP3A 4CGAA 3LJ0A 5A4EA 3FI2A 2W06A 4FICA 1IAHA 3DU8A 2IW9A 4XX9A 4DBXA 1O6LA 4MBLA 3PRFA 2VTNA 3W32A 3TNHA 3PLSA 2XBAA 2ERZE 1Q3WA 2UZVA 2RIOA 3BZ3A 5KNJA 3KF7A 3W8QA 3LFSA 3NRMA 2B9JA 4RPVA 5J79A 5LARA 3QQFA 1IAJA 3VBTA 4NT4A 5HBJA 4RVMA 4HNFA 2I0YA 3HV5A 3R9OA 3G6HA 2OH4A 2VWIA 3I5ZA 3BLHA 4JBPA 4MWHA 4XV9A 4CCUA 4ZTMA 3TUDA 1GY3A 2WMXA 1A06A 3EN7A 5KMLA 4FTUA 4RWIA 1SVEA 2GQGA 3OY3A 4LOQA 3HZTA 3T9IA 4AZSA 2RFDA 3DKGA 2OJFE 3OBGA 5CZHA 5J87A 4ANLA 3QUEA 4UALA 2F7EE 2YCFA 3G2FA 5I9WA 1ZARA 3ERKA 4G2FA 4IVAA 2QO2A 4Z16A 2FYSA 3NFGB 5ITAA 4KSQA 2RKUA 1ZLTA 4YMJA 5J7BA 1PXIA 3DBQA 1PF8A 2WMSA 4R1YA 4YSMA 1H4LA 1PYEA 1VYZA 3H3CA 4YLJA 4FTCA 3EJ1A 2QR8A 4ZSAA 4MX9A 2ITVA 5HQ0A 3PWYA 5DT0A 4FNXA 5DBXA 4ZY4A 3DNEA 4BRXA 5M56A 3OXIA 4USDA 4Y5HA 3HDMA 4FOBA 4JDJA 5AWMA 5FEEA 4MD9E 4XCUA 5L3AA 2HZNA 3ORKA 1KE5A 4C34A 4NJ3A 4BCNA 2QONA 1JPAA 3FQSA 5LQFA 5M07A 3G33A 5GJGA 4F65A 4NWMA 4R3PA 1G5SA 4B9DA 2XF0A 3L8VA 4FZFB 1YWRA 2QQ7A 4FV9A 2VTSA 5IH5A 3KEXA 3SW7A 4AAYA 4QMOA 4JQEA 4E7WA 1U5RA 5CF5A 5DIAA 3DKFA 2AC3A 2XIRA 2BFYA 3MI9A 4TYJA 4QMZA 3V5QA 2YLEA 2VTJA 2VWBA 3OCTA 3E3PA 1BI7A 2YDIA 5C8NA 1BUHA 3O50A 2V22A 3KMWA 4L7FA 3TIZA 4YHJA 5EDQA 4RJ3A 4G9CA 5AP0A 3OXTA 2O8YA 1WBNA 4JLCA 3BU6A 3VW6A 4WT6A 1RE8A 4MXYA 4O4DA 2GTNA 3CGOA 1XH7A 4QQTA 4GK2A 3DAJA 2UZDA 3LFDA 3Q4UA 2QD9A 4PMMA 4PQNA 3ZZWA 4D4VA 2BCJA 2JDVA 3V6SA 3DV3A 1UWHA 4YJVA 5IQEA 3KQ7A 1IR3A 3QRJA 2ZM4A 3BLRA 2VNWA 5IUIA 5IPJA 3W0SA 4JRNA 3L9NA 4L6QA 3FI4A 3LW0A 4NSTA 1EH4A 2O3PA 4APPA 2ITUA 3FZSA 1YXSA 3FMEA 4YNEA 4R77A 3UQGA 4AZFA 2WMVA 4KIOA 5BVKA 2JITA 4C4EA 4F7JA 4EQMA 2XIXA 4I5PA 4O4FA 3A61A 3VNTA 3O2MA 3UIBA 2J0LA 1CDKA 5ANKA 3V5PA 4MBIA 5A6NA 4N6ZA 3TUBA 4UEUA 3EQPA 1PXNA 1OL5A 3FMHA 3OOGA 2OIBA 4QMSA 3NW5A 4HGLA 4RFYA 4MNEB 2WQBA 3BU3A 3RPSA 2PVLA 3G9NA 2PVHA 1TZDA 4L00A 4XBRA 4CRLA 4QMPA 2EB3A 3ANQA 3Q4TA 3MB7A 5CAVA 2XK9A 1G3NA 1TQIA 4LV5A 4D1ZA 4DITA 4TL0A 3R63A 1Q8YA 4JS8A 4R7IA 1W7HA 4FBXA 5HG7A 5C8KA 3BEAA 3K5VA 4YUQA 3OF0A 1H1SA 3LXPA 4QMYA 5EOBA 5M08A 3DB6A 3NYXA 4O86A 3K3IA 5BV3A 4J52A 4WUN