2XIKA

Structure of human ysk1 (yeast sps1-ste20-related kinase 1)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
290
structure length
288
Chain Sequence
HLRGFANQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEEIEDIQQEITVLSQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNSPPTLEGQHSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSFLTELIDRYKRWKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE PROTEIN KINASE 25
publication title Structure of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1)
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 288
sequence length 290
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2xikA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xikA01
4UWCA 5GZ8A 1TQIA 2QOBA 2X8IA 3LCDA 2JC6A 4BBMA 3QALE 3H0ZA 4R1VA 4F7SA 2V22A 3UVQA 3VF8A 4E4LA 5JMSA 5IQFA 1FQ1B 3GNIB 4J97A 5ETCA 3POOA 1JSTA 4PUZA 1XBCA 1FVRA 3DJ7A 2YAKA 3FZ1A 1V1KA 4EI4A 3TUDA 3Q5ZA 3CR0A 2XCHA 2PVLA 5CSHA 5CSVA 3R1NA 4TPTA 3AC5A 4NFNA 4EKKA 2G2IA 3DZQA 3H3CA 4M12A 3TZ7A 4U81A 4DBNA 3LFNA 3QKMA 2BUJA 2OBJA 4PTGA 2Y6OA 3LXPA 2J7TA 2HY0A 2VGPA 4IZ7A 5H8GA 3VUDA 1NVSA 3KRJA 4YO4A 4IFGA 5KMJA 3CBLA 4JS8A 4BHZA 5L2SA 5CLPA 5HZNA 1NT2A 4I93A 4BDBA 4EOJA 3EQPA 4HJOA 4ENYA 4BRXA 2W1ZA 3ZUTA 3BLHA 3MIYA 1P4OA 4HZSA 3U4WA 1NA7A 2QO7A 3WILA 5IQHA 3UGCA 2BROA 5HLWA 1SYKA 3HMPA 4DH5A 2G15A 4PPBA 5EH0A 1XR1A 2BKKA 3QD2B 4CKRA 4XG9A 2R3LA 3G9NA 3ZFMA 1P2AA 2OK1A 2QNJA 4XBUA 2QQ7A 5M4CA 4G1WA 4OR5A 3HRBA 3N4TA 1MRYA 2GFSA 3O50A 4HCVA 4DEGA 1G8SA 5EQPA 3ZXTA 2RGPA 5D1JA 2B4SB 2CGXA 2WKMA 3HDMA 1XH6A 3DDQA 3LFCA 2JDTA 4YHTA 4I23A 4UYNA 3B2WA 5HBEA 3ZEPA 3G5DA 1E1VA 2A2AA 3QQGA 4O81A 1UA2A 4BCPA 2WPAA 2GQGA 3EQDA 2ITXA 4U43A 1PMEA 1Q41A 3MV5A 4B6LA 3PJCA 4EH2A 2LGCA 3POZA 5CEMA 3KXMA 3KC3A 5M4IA 4HVDA 3BHUA 3VJOA 4FKJA 4TT7A 3SQQA 5L8KA 2F7EE 2QOCA 4RIXB 4BWPA 5KMLA 4AS0A 3L9PA 3IGOA 5E8TA 4PMMA 3UQGA 3G9LX 5EDQA 3DBFA 4R1YA 2DYLA 3R7UA 2VRXA 4NZWB 4EJNA 3FC2A 4OAUC 4FKPA 3MVJA 4ORKA 4DFUA 4ASXA 2B54A 3CY3A 3HMNA 4C62A 3V6RA 3GCVA 5E90A 4WSYA 3NGAA 4DGNA 4JDHA 3TNQB 4F08A 2X9FA 3FUPA 2HWOA 3GBZA 4MBIA 4N70A 5BYLA 2WQNA 2FB8A 2NP8A 2QURA 4K0YA 3PSBA 3D5WA 5J7HA 1RQQA 2EB3A 3KGAA 3BBTB 3PVBA 4FIJA 3FLNC 4ZTSA 3SW4A 5L2QA 4DT9A 4LGDA 3VS5A 4J53A 2C68A 3LPBA 4E73A 4EC9A 4DFYA 4CVAA 3QFVA 2YDKA 4JJRA 4ZS4A 5CANA 3Q52A 2CGUA 4QMWA 4M0YA 4ACMA 5JSMA 3TDWA 5HBHA 4ITIA 4C4FA 4U3YA 1Y91A 2R9SA 4S34A 1H1QA 1BLXA 1MQ4A 5JT2A 1PMUA 3C50A 4S31A 3RALA 3AT2A 3BGQA 4FICA 5CNNA 4UN0C 5I9XA 3QX2A 3RM6A 2VU3A 3E8NA 4TYJA 4CSVA 1Y8YA 4AOIA 3QKLA 3KL8A 3OG7A 4F70A 5KMNA 2R3QA 2RSVA 4LGHA 1M52A 3SXRA 4I1ZA 4BDGA 2CCHA 4TZRA 5CS6A 4FT3A 4PTEA 3CTHA 3LCTA 3FZRA 4KBKA 2BFXA 2V0DA 3IOKA 3KU2A 4G3DA 4KRCA 4EK8A 4PL3A 2H34A 2P33A 1PXMA 1W82A 1YDRE 2PK9A 3UP7A 3IQ7A 3D4QA 4FK3A 4U79A 4CMUA 5BVDA 3Q2MA 4BDEA 4KB8A 2XRUA 3NLBA 4YSJA 4I20A 3IECA 3TTIA 2W1IA 2NRYA 3EL7A 4IWPA 3P4KA 5J9ZA 3OTUA 1JKSA 2BZKB 2PE1A 3EQRA 5J9LA 3COIA 3HECA 4TYHA 4CCBA 3PVUA 3UYSA 1YXXA 5KMIA 3TKUA 4XNEA 3QA0A 4IDVA 5TT7A 4D5HA 5A4EA 3QQKA 3BIZA 4FEQA 4LYNA 3P7CA 3T8OA 3BLQA 3QRJA 2EVAA 4RJ3A 4CKIA 4E6AA 3W10A 5IQBA 5EOLA 3OOMA 4XS2A 4JR3A 3ETAA 3U6IA 4Y8DA 2HZIA 3OT3A 3N9XA 5ANDA 1R0EA 3DLSA 3JS2A 3QZIA 2E9NA 2BAJA 3FL4A 2ZB0A 4IZYA 4APCA 3BYOA 4UXQA 3RJCA 1EH4A 3RAHA 4IAIA 3W8LA 5FDPA 3GQIA 5CF5A 3EN6A 3SLSA 5JRQA 3ZFXA 2C5YA 2UW7A 3A4OX 5CSXA 4CT1A 4TY1A 3B2TA 3MFUA 4ASDA 4FG7A 4FZFB 4UWBA 5IPJA 3VBWA 4GT5A 5LMKA 4G16A 4BCKA 2FSMX 3HLLA 1BKXA 3IW7A 5EI6A 3AC2A 4MWIA 5AUYA 4GKIA 1IR3A 4IM3A 5HEZA 1KE7A 4MNEB 4MX9A 4FZ7A 4EHEA 3RPOA 4N57A 2JKMA 1B39A 3F3TA 4IC8A 3ZM4A 3AD4A 5CI7A 4M66A 4MNEA 3BLRA 3F5UA 5EFQA 3KRLA 3S3IA 2PMIA 3WF7A 4FV2A 1BL7A 1OPJA 3FWQA 3R7EA 2CNVA 2CLQA 3R02A 2JBPA 5HNGA 3QUEA 5BVNA 5IA4A 1OGUA 4K6ZA 4P5ZA 2G2HA 1WBNA 3MB7A 4J98A 4MWHA 4R3CA 4ALVA 5DR6A 4CV8A 2YCSA 5LJJA 5DR2A 4HVIA 4CMTA 5HO6A 4QTEA 3R22A 5CEOA 4WA9A 5CENA 4JXFA 2Z7QA 3QWKA 5A4LA 3AGLA 5A14A 4D0WA 2NNWB 4BB4A 3I79A 3VBYA 4BZDA 1PXNA 2QLQA 2X81A 3ZO3A 3QRTA 4MQ2A 2XP2A 2X39A 1PKDA 3OCGA 3Q6UA 3DBCA 4ZY6A 4A9TA 3GXLA 4XP0A 3UNZA 1IEPA 4KBCA 4FSWA 1MQBA 2VWWA 2ITQA 3DXPA 3CD8A 4NH1A 4IX6A 3WZEA 4U6RA 4YSMA 4ACCA 3GVUA 4EOPA 4G6NA 3MH3A 2PVFA 1ZMWA 2WMTA 3O8UA 2ONLC 5CEIA 5AFVA 1CDKA 4XYFA 1P5EA 4EJ7A 1PXKA 4C36A 5EQEA 2ETMA 5FGKA 4M8TA 5I9UA 4AQCA 2JFLA 4D58A 4YNOA 5D10A 3MB6A 2V5QA 5I0BA 4QQTA 4R3RA 4QOXA 5K0KA 2VX3A 4RRVA 5ANJA 2ZOQA 3MY0A 3QF9A 2CGVA 4DEAA 4KKHA 4R7BA 3Q9XA 3ALOA 3OP5A 4EOOA 1Q62A 4J99A 3KK8A 3PRIA 2PVRA 4X2KA 3OW3A 3VN9A 4I6QA 4QTAA 1F3MC 2HAKA 1PHKA 4WG5A 3OY1A 5HVYA 3ROCA 4GUBA 5IUGA 4DA5A 3HP5A 5IA1A 3SA0A 3FXXA 3PZEA 4TRLA 3W2QA 2QR8A 4I0TA 3TL8A 2EWAA 1GIJA 2WMWA 3QTWA 2PVHA 3ERKA 4MH7A 2X4ZA 4BCHA 4AZFA 4DLJA 2W1GA 2YEXA 3QTRA 2X7FA 3BELA 4KAOA 2IVTA 3RPSA 5I4NA 3QKKA 2PUPA 2UZNA 4JT3A 5EOBA 3CJFA 5KMOA 3E8EA 4JQ8A 4QQ5A 5GJGA 4BCMA 3CSVA 3V5TA 4I6FA 2QO2A 4K2RA 2VWYA 4TYEA 3ZZWA 1FGKA 3LFEA 4EQCA 3P5KA 5L6PA 2CHLA 5E9EA 4MD9E 5IH5A 4IB0A 4B8LA 4O96A 2AUHA 2VTNA 4NKAA 5TF9A 3PUPA 4TW9A 1OBDA 2CJMA 5HD4A 4Q9ZA 4IMYA 1MRVA 2W5HA 3EQCA 4HGTA 4II5A 1XH9A 1XJDA 5A6NA 3WYXA 4QO9A 1OKZA 4QMSA 5CEKA 4PX6A 3GC9A 3MFTA 5FD2A 3UDBA 2VUWA 4Y46A 4H3BA 4OTWA 4I4FA 2KULA 4FTCA 4RJ7A 4C3PA 5IISA 4HCTA 4GG7A 4L9IA 2ZJWA 4U40A 4ZTRA 3BQRA 4BTMA 2QC6A 3JY0A 3IONA 4N6YA 4ANNA 5HU3A 4DE4A 2OIDA 2YJSA 3FDNA 2QG5A 4R6VA 4AA4A 4F9YA 3NUSA 4IJ9A 2QI8A 3OROA 5CVFA 3GQLA 3TCPA 3V51A 1GIHA 4ITJA 1SM2A 2QKRA 2ZV2A 4H3PA 5DT3A 3PJ2A 2YA9A 3RKBA 4FV8A 4TWCA 2R3KA 5AUVA 1P4FA 2VTJA 3CP9A 4IAZA 3PSCA 3PY1A 4V0GB 3ZBFA 4F4PA 3QA8A 3QQLA 4ONAA 2F49A 3V8SA 3NCGA 5FDXA 2JKKA 2OSCA 4D1SA 5ITAA 3P7AA 3MIAA 3W16A 4ZY5A 4HPUE 4FF8A 4N0SA 3PIYA 4C58A 4USEA 4NT4A 1QPJA 5HORA 1H1PA 3TIZA 1XH4A 3ZTXA 3LCSA 5EHLA 4DG0E 1DAYA 3HV7A 4DEHA 4FVPA 2XKDA 4Y5QA 4IFCA 3C0HA 4KUJA 3BGPA 5C9CA 4AF3A 3E7OA 1U5QA 2HYYA 3PPKA 1YVJA 4QP4A 4H05A 1U59A 4EBWA 2QO9A 2UZDA 3R63A 4OTGA 3TNHA 3ZO1A 3HUCA 3D7TA 2O0UA 5L8LA 3KA0A 1KOAA 5E8UA 5EW9A 3RK9A 4RT7A 3OBJA 3U54A 2QR7A 4E6CA 4QMMA 3ZLSA 4JAJA 2REIA 3QUDA 2WD1A 5EKOA 4ZEGA 3RWPA 5IQDA 2YITA 2GDOA 1YXSA 3P08A 4BHNA 5M08A 1ZARA 3R9OA 3D9VA 4NSTA 4I4EA 3RWQA 3F69A 4TKSA 3TT0A 4DFLA 3QTIA 3LMGA 5DN3A 3RCDA 3QUPA 5CAVA 3KCKA 4CFXA 5AAEA 3UBDA 5JFVA 4YUQA 3A7IA 2WTJA 4R8QA 1PKGA 2J90A 3UNJA 2BHEA 4FUXA 1S9IA 4KIOA 2W1EA 2WMAA 2X2LA 5J95A 5I9ZA 3DK3A 4FTMA 2LAVA 5EHOA 2IW9A 4FTIA 2DUVA 4E6DA 4W4YA 2HWPA 5KX8A 5AP4A 5LQFA 4OTRA 1H08A 3A2CA 3FAAA 4YURA 4UX9A 4FSNA 4EH8A 3ORIA 5BUIA 1J7LA 3FKOA 4DFZE 4F7JA 3CD3A 1UNLA 5HICA 1M7NA 2F57A 3E63A 1CTPE 4FE2A 2Q0NA 3NZ0A 4P2KA 3QTQA 1V0OA 2C3JA 1KE6A 3NNVA 3OUKA 1ZRZA 3CY2A 3OWKA 3MPAA 3PE2A 1BI8A 1ZYJA 5JK3A 4GVAA 2ZYBA 4OTQA 4E7WA 4GS6A 2GTNA 4G17A 3BEGA 4ZSEA 2OJGA 1R39A 1ZXEA 5CXHA 4YZDA 3OEFX 1UKIA 5AEPA 3F5XA 5DH3A 3HDNA 2ZMCA 1YDTE 4M69B 3LFFA 1LR4A 4D2SA 1JAMA 3PY3A 2ITTA 2ACXA 3KXHA 4KWPA 3AG9A 2XK4A 1B6CB 4JBVA 2OXYA 5GZAA 3NSZA 5ANKA 5HE0A 3C4XA 2YCQA 3P79A 5EM8A 3ZS5A 5I9YA 4RZWA 3AC4A 4I5PA 4E4MA 2OF2A 1R78A 4PY1A 2QU5A 4EC8A 4GKHA 4IE9A 3GC7A 1OZ1A 2WGJA 3A7FA 3OMVA 3BU3A 4QP9A 5KZIA 5L2TA 3UZRA 2C5NA 4WG3A 5BUJA 2HY81 5M07A 4DH7A 2YABA 5EQYA 2HXQA 2ITWA 4DYMA 3DNDA 1H00A 4EQUA 2ZV9A 4O83A 3MVHA 3PJ3A 3S95A 1FINA 2QHMA 5LWNA 4HOKA 4IX5A 2JGZA 4MXZA 4G9RA 4KIKB 2W1CA 4OTFA 1Z5MA 1PXJA 3ZRLA 5HCYA 3UQCA 3L1SA 3QC4A 4R78A 1CMKE 1F5QA 5CU2A 1V0BA 4KIKA 4NJ3A 4EOKA 3MY1A 1YHSA 4X3FA 4ASEA 4PWNA 2JDSA 5AV3A 3Q4ZA 5ANGA 3WF8A 4JX3A 5ETAA 1JVPP 3D0EA 2PVYA 3HRCA 2C0IA 3RAWA 5L4QA 3O8PA 3I1AA 1GZ8A 4EKLA 4F0FA 4JIKA 4K77A 1Q3DA 4YZBA 3VF9A 5J9YA 4XG4A 3VIDA 4BDCA 2RFDA 5IQIA 2UZUE 2WQOA 1ERKA 2WMRA 4AX8A 4JI9A 4IX3A 3DXNA 3RHKA 4FTNA 3R30A 4F9BA 5KBRA 4K18A 3ZH8A 2R64A 5E8VA 1ZWSA 3LJ0A 4OTDA 3W33A 4ALWA 4Z3VA 4QT1A 4C4HA 2C5OA 1UU7A 3TZMA 2W1HA 5JQ5A 2C6TA 5GJDA 3HMMA 4FTKA 2XEYA 3KEXA 2CPKE 4CEGA 2IZUA 1JSVA 2HK5A 2GFCA 4NM7A 3ZLXA 4ZLYA 2PUIA 1NVRA 3G2FA 2J5EA 4OTIA 3PP0A 2F7XE 3BV3A 3MVMA 4I5MA 4TWPA 2ITPA 3DAKA 2WFYA 3KF4A 4LV8A 3PP1A 4QPMA 4XCUA 4XX9A 3I7CA 2E2BA 1FGIA 4FV0A 1YOJA 2XZSA 5LMAA 4PMTA 1OBGA 2QOLA 2O63A 3SVVA 2YM7A 1LEZA 2PMOX 4MTAA 4UBAA 4ZSGA 3V5JA 2PULA 1O6YA 3FMHA 4K11A 5D7VA 4A06A 4HW7A 1PRYA 3ZHPC 2SRCA 1RJBA 2ZVAA 2R3MA 1ZMUA 2W17A 3R2BA 2XNBA 5HU9A 3OXZA 4U44A 3R83A 5AM7A 3BEAA 3DAEA 3ROYA 4FI1A 5A9UA 4RIYB 3EYGA 4O2PA 5G6VA 2C6MA 3AC1A 3R2YA 4RBLA 4RSSA 3WZKA 4XG3A 2YLEA 4IAYA 2IG7A 2A1AB 4AE9A 4FKIA 4FTJA 4C7TA 3C13A 5IA3A 4RIYA 4QQCA 3TTJA 1STCE 5C8MA 5CF4A 3E7VA 3O51A 1UNHA 4TYGA 4D4YA 4ERWA 4I5CA 2B9FA 4D9UA 3RPYA 3VS1A 5K5NA 3NS9A 3NRMA 2J50A 5FTOA 3NYNA 3HV6A 3ZOSA 1DI9A 4KA3A 3A60A 2GNJA 3UO4A 1Q3WA 2J0KA 3II5A 3CQEA 4RVLA 5K3YA 4GJ2A 4BBFA 2PUNA 4RWJA 1H0WA 4WSQA 3E8DA 4QMUA 4XHKB 4DGOA 4ZSLA 2CDZA 1H0VA 4CT2A 4FEVA 3UODA 2PTKA 4E5AX 4GUEA 5FWKK 4F6SA 5HIBA 1JOWB 4C4JA 1CSNA 5GIOE 3SG9A 1YI3A 2IZTA 4JG6A 4JDKA 4BICA 4JQEA 2RFSA 2CCIA 2WMVA 3ANQA 2JKQA 3K2LA 1YXTA 3O7LB 3QD3A 4AAAA 4CV9A 1M14A 5J79A 2EXMA 1IASA 3EYHA 2XKFA 2ZV8A 3SRVB 2OLCA 4L68A 3M1SA 1SMHA 1JSUA 3LZBA 3RAIA 3KN6A 2WMUA 4EZ5A 4IJPA 3QRKA 4FL1A 4PDOA 3UYTA 4YPSA 3ZC5A 3TKHA 3PLSA 3KVWA 4DC2A 4IAAA 4YC3A 5IQEA 1W8CA 5AP7A 3VRZA 4DG2E 4PDYA 2CN5A 2VZ6A 1H4LA 4C59A 3F82A 3GP0A 3A7HA 3DCVA 1OB3A 3EJ1A 3IOPA 2WEVA 2BAQA 4PPAA 1A48A 3HAMA 4CG9A 2J51A 2QOHA 2FVDA 4M3QA 1OMWA 4DINA 4FEUA 1HCLA 3ID6C 4B9DA 1Y57A 3I0QA 3UP2A 3FE3A 4FL2A 4PPCA 4PQNA 4HYUA 2W5AA 4FIEA 5CI6A 2VO3A 1GAGA 3RZFA 4C38A 1IAHA 4OAVB 3N51A 4F9CA 1GZKA 5FTGA 2VO7A 5CEQA 5ANEA 4JDIA 1YKRA 5C27A 2WTKB 2XNMA 1YWVA 4FKSA 3SXSA 2Z02A 4S32A 5TE0A 2UZOA 3OXTA 2HZ4A 3K5UA 3TJCA 4F1MA 5IQAA 4L3LA 3F5GA 2UW3A 4FSZA 4LMNA 3PIXA 4CQGA 1SZMA 3R7IA 4KS7A 3BHVA 1J1CA 3P7BA 4C61A 4F9AA 5IEVA 3QZFA 5AX9A 4U8ZA 5FLFA 5M09A 4C0TA 4OT5A 4HPTE 5FXRA 2ZM3A 3AC8A 5HVJA 4IB1A 4CZTA 2C6DA 3EWHA 3KK9A 2XRWA 3NAYA 3Q4UA 1FPUA 3BU6A 4XJ0A 3U87A 1Y8GA 2AC3A 2GNLA 4G6OA 4QP1A 2VNWA 3QCSA 3SAYA 4F99A 5IEXA 5H8EA 5J8IA 2I40A 2V7OA 1ZOGA 4DLIA 5HI2A 3RTPA 1UWJA 4O2ZA 5CVGA 4BCFA 3BCEA 5BVWA 4GFGA 3DY7A 4CZUA 1XKKA 5DLSA 4XV9A 4KS8A 3IW5A 4F6UA 2XJ0A 3KMUA 3PPJA 5F1ZA 2X2MA 3H9RA 3HRFA 4ACHA 1JKTA 1PXLA 2HENA 2Z7SA 5JFWA 1QCFA 1VZOA 4WIHA 4PL4A 4E6QA 2FH9A 4GK4A 2OG8A 4GG5A 4JBPA 5AV0A 4AZWA 4DCAA 1OL5A 2CN8A 2VO0A 3EFKA 3GFEA 4YNEA 4EYMA 3SW7A 1W83A 4NUSA 4QNYA 3UQFA 4V05A 1UU3A 3A62A 3IW4A 1WAKA 4AU8A 4E93A 2W05A 5C8KA 3HP2A 4YZMA 5AP1A 3R8VA 2P4IA 2WHBA 3QZHA 5B2KA 2GU8A 1R0PA 2DS1A 4RA5A 3TZ9A 2F2UA 3V01A 2IVUA 4ACGA 5DMZA 5KHXA 3VUKA 2UW8A 2YM3A 5EM7A 4JLCA 3VW8A 5CXZA 3FMDA 4Z7HA 5IQGA 4AW0A 2WMBA 4X21A 1CM8A 2X9EA 2XK6A 4I22A 1H1SA 1HCKA 3RZBA 4JG8A 3UOJA 1U4DA 3NAXA 3PIZA 3Q9YA 4U97A 4BTFA 4FV6A 3T9TA 4WOVA 2WAJA 4TTHB 5K5XA 4PNKA 5CAOA 4MQ1A 5BMMA 4ANQA 3CCNA 2E9VA 4AWIA 5AAFA 3ZLYA 2C5VA 1ATPE 2HELA 4CG8A 2C1AA 1W0XC 4MHAA 4W4WA 2YACA 3KKVA 3KB7A 4EHGA 4C02A 5ANIA 3LVPA 3G0EA 3DXQA 3TUBA 3MJ2A 3QAME 3VS3A 3ORMA 1PYEA 1H8FA 4FX3A 4UXLA 4A9RA 5LVOA 3QX4A 2C1BA 2I0EA 3E88A 1YXUA 3DOGA 1WBPA 2YERA 4LUEA 2WTVA 4QMQA 3UOLA 2FSTX 3EN7A 4FV4A 3PE1A 4YLJA 1O6KA 3R9RA 2QD9A 2YN8A 3PY0A 1GY3A 3W2SA 2QOQA 5CVHA 5HG5A 1BUHA 3DBQA 4M7IA 1OKWA 2YDJA 3MH2A 1R1WA 4A4LA 5KO1A 4FKUA 4LFIA 5F95A 3R0TA 2VTAA 4XP2A 3DQWA 2XEZA 2OJIA 4UMPA 3R7OA 4YTIA 3LQ3A 5AP0A 3W2OA 3HV4A 3R8PA 5C4KA 4EH6A 3GCPA 2X7GA 4AT3A 5BVOA 3I81A 1WVXA 4RIWA 4UMRA 3RK7A 3GU8A 3EHAA 3RINA 3MFSA 5LARA 4AP7A 4O0UA 4FT9A 2QOKA 4CFUA 2ZMDA 4G2FA 3FMJA 3ORXA 2OICA 3NPCA 4AGUA 1JPAA 1MUOA 1PY5A 1OVEA 4ZSAA 4PMPA 1H25A 3PXFA 4IWDA 2C4GA 4RX5A 4Z7GA 3TDVA 4TYHB 2H6DA 4XV3A 3SGCA 3V5PA 3W1FA 3F7ZA 3FY0A 3NW5A 4FSTA 3W32A 4C4GA 2UZVA 1G3NA 4G31A 3CPBA 3PJ1A 4D4RA 2GMXA 2VV9A 4FSYA 2BZJA 3VUIA 4XG6A 4YHJA 4XOZA 2YIRA 3QZGA 4O38A 2PUUA 3FKNA 3THBA 2W7XA 5FBOA 1TKIA 4D0XA 2B9IA 4ZLOA 4JVGA 2WB8A 4W8DA 3MWUA 4YJSA 4FBXA 5K4IA 4A4XA 2C3LA 3SOCA 2UVYA 3UO6A 4DH3A 4R7IA 2CNUA 1BL6A 3DV3A 4PV0A 3QD4A 3CQWA 3EFJA 4AW2A 5HX8A 3OEZA 4UB7A 3FPMA 4MF0A 4N6ZA 2IZRA 3FZOA 4TWOA 4ZP5A 4ZTHA 3DS6A 4CFMA 4OUCA 5IDPA 5GINE 1QL6A 2ETRA 5AMNA 4E20A 4FV1A 4O7VA 2P3GX 2XH5A 3GEQA 3NCZA 2XJ1A 4DAWA 2O8YA 2W9FB 3QQHA 4NYEA 2Y7JA 3HEGA 3D5UA 4A4OA 5JKGA 2Y4IB 3T9IA 3DB8A 4O7SA 3MDYA 3VO3A 3FMKA 3WBLA 3VHEA 5E8WA 5ACBC 3FMMA 5HQ0A 4Q9SA 1XH5A 4JQ7A 3D5XA 3FJQE 3I6WA 4I6BA 4O86A 3DU8A 2W06A 1Y6BA 3RI1A 3FBVA 4QPSA 1YQJA 5DHJA 3FI3A 4EONA 5H3QA 3LXKA 1U5RA 4O7NA 3VS2A 2JIUA 3OTVA 2XF0A 4QMPA 2W4OA 4EL9A 4QMXA 2OGVA 4YJNA 2W0JA 3KXXA 2W96B 5HX6A 1YXVA 3MTLA 2WZJA 4EK3A 1U46A 2YIQA 2FUMA 1VYWA 1Q8WA 1OL1A 2A27A 3WZUA 5JFXA 4AW1A 1G8AA 2PZPA 2BVAA 5AP5A 1YHVA 2BDFA 2WNTA 2OJJA 4H1MA 5F4NA 5DR9A 2OFUA 4CXAA 4JNWA 1A9UA 1ZYLA 3HYHA 4KKEA 2IJMA 2JITA 5IG1A 2XK7A 5LXMA 3F3ZA 4RVMA 5M06A 5HNBA 2B9HA 2GS2A 5CAUA 2ZDTA 5A3XA 3RNIA 4QMTA 4F65A 4HVSA 3ANRA 4MCVA 4LUDA 4ANOA 4QNAA 5J87A 5KE0A 5LWMA 4BDAA 2GHLA 3Q2JA 4FSQA 5CEPA 3LMIA 1KV2A 3AT3A 3JPVA 1U54B 3BI6A 1WBTA 4GCJA 3MJ1A 5GNKA 1R3CA 3PZHA 2UZBA 3F3UA 3RK5A 3ZZEA 4DEBA 4EOMA 1U54A 4UALA 1ZLTA 3NNXA 4PL5A 4FODA 4GL9A 1JNKA 1Q8ZA 5ETFA 5AR2A 5FP5A 4L6QA 1LPUA 2JD5A 5DG5A 4BC6A 3E3BX 4FL3A 2R3NA 2Y0AA 4GYIA 2UUEA 4CRLA 5JQ8A 4O7ZA 3HMOA 3CPCA 3E93A 4ZS0A 2X8DA 3UOHA 4CLIA 2J0LA 3UO5A 4G5PA 1Y6AA 2ITZA 3AMAA 4HVGA 1KE8A 3RHXA 4L3JA 1XH8A 4I94A 3R00A 2B55A 4FT0A 3AMYA 4X0MA 3V5WA 5AUTA 5HIDA 3P9JA 3NIZA 3LQ5A 5HLPA 3OCTA 4KD1A 2BKZA 4B4LA 4E5BA 1H01A 1PMVA 4J8NA 3SOAA 4B99A 5JN2A 3WI6A 3OW4A 1RE8A 3C51A 3EL8A 4YHFA 2BPMA 4D4SA 3C5IA 2C6KA 4FIFA 4L53A 4UMUA 4AE6A 2XS0A 3TJDA 3WE4A 4G6LA 5CY3A 4BBEA 4MD8E 4XV1A 5DIAA 1UU8A 4YC6A 1E9HA 3QCYA 4U0IA 4L67A 1OL6A 3MTFA 3UIXA 4DFBA 3EOCA 4IIRA 2BHHA 2ZDUA 2R0IA 4EK5A 4YU2A 3CGFA 5CZHA 4JDJA 4YJOA 3VS4A 3NW7A 5IH4A 2ITNA 3AD6A 4AG8A 4RGJA 3ET7A 4CCUA 3FZTA 3F66A 3MH0A 3MY5A 5EW8A 3VBTA 1AQ1A 3HA6A 3G6GA 4NK9A 2QHNA 3PG3A 2Y6MA 5HE2A 3TNWA 3FKLA 3QWJA 2XIRA 3R21A 3EN9A 2C6EA 4CZYB 3BYSA 1WBVA 5DT4A 3CIKA 3NWWA 3NVMB 3F3WA 2OH4A 5AJQA 4K1BA 2NO3A 4XUFA 2WO6A 5GHVA 1B38A 5F94A 1DM2A 3COHA 2YJRA 4FIIA 3R1SA 2B9JA 4BGGA 2GNIA 3OCBA 3KF7A 3OZ6A 4O0TA 4FKRA 2YAAA 4HZRA 4KINA 3HVCA 5F9EA 2C6IA 1REJA 4ZTQA 2GCDA 4DGGA 4FZAB 2GQRA 2WOUA 4F09A 4BIDA 4RC3A 4BCQA 2XK8A 4XG2A 2R3PA 4FR4A 4DTBA 5EM6A 3HA8A 1OKVA 2CKQA 2YZAA 2I7QA 4FKOA 4NU1A 1M7QA 5TKDA 1QPEA 3RMFA 5J5SA 2EB2A 3DFCB 1J7IA 2UZTA 2PVJA 1Q4LA 3FYKX 4BCOA 1FVTA 3NDMA 4BGHA 3RBWA 3EN5A 3OWPA 1WBSA 3ODZX 3LMHA 2WXVA 2ZV7A 5LMBA 5FBNC 4PMSA 4DGLC 4EOIA 4FA2A 1X8BA 4JRNA 2WTIA 3LOKA 2C3KA 4QMLA 2HW7A 3V04A 4TWNA 2ETKA 4R3PA 2UZEA 5CX9A 4UZHA 2W1FA 3VC4A 3ZO4A 2C69A 4H1JA 1UU9A 3R7YA 4QTDA 3LW0A 5FQDC 2WMSA 1QPDA 2VX0A 4IEBA 4O21A 3KVXA 3O0GA 3NNUA 4BDFA 3HGKA 5CAQA 4J95A 3O7LD 3IDPA 3A7JA 1ZYSA 3NMUF 2EXEA 5E1EA 4CTBA 4ZAUA 2XIXA 3D7TB 4IXPA 2GPHA 4IB3A 3BHHA 3TACA 5LCJA 4FNZA 3OVVA 3OT8A 1CKIA 4ENXA 4EWQA 3ATSA 5CQWA 3A99A 5DA3A 3PXYA 2UW4A 3H9FA 2VN9A 4L3PA 2HW6A 1NY3A 3RM7A 2JIIA 3UZTA 2UW5A 4QQJA 5AIRA 5IUHA 5LOHA 1M2QA 4QPAA 3N4UA 4XG8A 4DF3A 5E1SA 2FSLX 1AGWA 4UMTA 2PU8A 4BTJA 5C1QB 3COMA 3GI3A 2PHKA 4AA0A 3I6UA 3MN3A 5CTPA 1Q97A 1KE9A 1T45A 3F61A 2JAVA 2ESMA 3PA4A 3R73A 5M51A 3LE6A 4MXYA 4MF1A 3FZSA 3V3VA 1J3HA 5BQ0A 4BWKA 4HVHA 4GH2A 2HZNA 5D7AA 1IG1A 3BGZA 3T3VA 4GV1A 4KABA 1XQZA 2UZLA 3L8SA 4RC2A 5FP6A 2DWBA 2H8HA 3DFAA 5AUWA 2WMXA 1LP4A 5HCZA 4DFXE 4UEUA 3P1AA 2O64A 4PF4A 2WELA 2W4JA 5C8NA 2PMLX 3PG1A 4I6HA 2RKUA 5K0XA 4ARKA 3PXQA 5JRSA 4YZNA 1NXKA 3Q5IA 3W2CA 2QU6A 1ZZ2A 3VVHA 5J7BA 5A4CA 1VEBA 3IW8A 2J2IB 3H4JA 3LFQA 3TNIA 3BYMA 4F1TA 3V8TA 3H0YA 3IDBA 3RPVA 4C8BA 2F4JA 2PMNX 5M44A 4QMOA 4AT4A 3DDPA 3QHWA 4G3CA 4YP8A 4XP3A 3MVLA 5M4FA 4GEOA 5HTIA 5HBJA 2JDOA 4P7EA 4CQEA 2BIYA 3UPXA 2RFNA 4UV0A 4WUNA 5IDNA 2QODA 4QYGA 4L7FA 3ZM9A 2P2IA 3MI9A 2IO6A 5HO8A 2XIKA 2X6EA 3PLAE 4S2ZA 5T3QA 3IS5A 4HGLA 3O71A 1PF8A 3D2IA 4BZOA 4C34A 4TL0A 3W2PA 5D41A 1OUYA 4TN6A 1O6LA 3DTWA 3H9OA 1YWRA 4USFA 4PNIA 4AA5A 3Q32A 3H30A 4FGBA 5I3OA 3A4PA 3FI2A 3UTOA 2G9XA 1WCCA 3QTZA 4ANLA 3DKCA 4RMZA 4Q5HA 3UNKA 2CLXA 2OJFE 1L3RE 2C47A 2JAMA 4L42A 3VBQA 2AYPA 1NW1A 3ACKA 3FQSA 3JVRA 4MEDA 3R01A 4FMQA 1WMKA 3BU5A 3UIBA 5IA5A 4BF2A 2XJ2A 3VS7A 3HL7A 3MPTA 5EKNA 2C6LA 2XBAA 5KCVA 4M14A 4MBLA 4LOPA 4AUAA 5IMEA 4WNOA 2WTKC 3C5UA 4Y95A 4QMYA 5DOSA 4AOTA 4GW8A 4X3FB 4GU9A 3VUGA 5M57A 3E5AA 5E92A 4EZ3A 3L8PA 4U9AA 4W9WA 3LM5A 3P86A 5DRBA 2P2HA 1SVHA 3IPHA 3U51A 3ORPA 2X8EA 4RFZA 5KHWA 2GSFA 4D1XA 3R9NA 3UPZA 5DEYA 1XWSA 4LI5A 5HNIX 4ZOGA 3F2NA 2IVVA 3OS3A 5FG8A 4JAIA 4ASZA 1J91A 4NKSA 3AD5A 5DI1A 4C4IA 4WD5A 5KMKA 3MBLA 2CSNA 2EUFB 4IANA 1YI4A 2JKOA 3FI4A 3JR1A 4FV3A 5I9VA 3G6HA 3ALNA 4DN5A 4EZ7A 1DAWA 4OBOA 2UVXA 3I5NA 4Q2AA 4CNHA 1ND4A 5FTQA 5HHWA 2BR1A 2E9UA 2VTPA 3G33A 3OBGA 1Q8TA 5AP2A 2BRBA 2BILB 2PY3A 1ZY4A 3LCOA 3MA6A 3OY3A 2W99B 3EKKA 3ZRKA 4F9WA 3COKA 3PWDA 3K3IA 2OO8X 4RC4A 3F88A 3ORKA 1IAJA 3LQ8A 5DT0A 4E4XA 3KREA 3MESA 2R3FA 1ZOHA 1T46A 3EIDA 3BHTA 3I60A 4FNYA 3P0MA 1FMOE 2PPQA 3S1HA 4U41A 2JBOA 1PYXA 5HTCA 3AC3A 4CTCA 3D94A 4FZ6A 4RG0A 5ICPA 1URCA 4LMUA 4GT4A 4KSQA 3ZMMA 4AZEA 5E8SA 5A4QA 1PXOA 2YCFA 3CC6A 4FTUA 4L00A 4O0YA 4E8AA 4QMNA 1OIUA 3WIKA 3ZUUA 5KBQA 5B0XA 5EG3A 3S4QA 4G5JA 4GK2A 3Q04A 3F2AA 3R28A 4HYSA 3SDJA 5IMXA 2WTWA 2B0QA 1BI7A 3PVGA 4IZAA 2F7ZE 2OXDA 3FLZA 4J7BA 4DEIA 3EZVA 1GZNA 1PW2A 2PZYA 3M2WA 4OLIA 4DFNA 4JIAA 3LFDA 4U7ZA 4DEEA 5LVMA 3TEIA 4XBRA 3GC8A 4WHZA 4ANMA 2VGOA 3D83A 2UVZA 1GJOA 5HVKA 2JEDA 4F7LA 4C35A 5D11A 5HG9A 3Q9WA 3R8UA 2G1TA 1JBPE 4BWXA 4LOQA 4DBXA 2IZSA 1ZYCA 3BZ3A 4I3ZA 2C30A 1OIRA 3KULB 2BDWA 3UIMA 2OWBA 1WFCA 3VUTA 2YFXA 4WRSA 4CYJA 3KULA 5GJFA 2FGIA 1S9JA 5EK7A 4ZK5A 3LKMA 5A6OA 2HXLA 2G01A 4XMOA 2P55A 4GFMA 2XA4A 4M67A 3FQEA 3NYVA 2CKOA 1PXPA 4AZTA 4BIBA 4CYIA 5LVLA 2OFVA 5HE3A 4AZVA 3DNEA 1YWNA 1L8TA 5AR5A 1H1RA 2VTOA 4MXCA 5CU3A 3WZJA 4DH1A 2RG6A 3V8WA 3JVSA 4DG3E 4ZMEA 5E8YA 4IW0A 4EH5A 3P23A 4R7HA 5EM5A 4LG4A 3PDTA 3DK7A 5TO8A 4G9CA 4HGSA 1OI9A 2A4LA 3I5ZA 4RQVA 4UWYA 2VX1A 2XIZA 5T6KA 4BYIA 4FGRA 3CLYA 2W1DA 3CTJA 5DGZA 2HOGA 4AN3A 3CKWA 3BV2A 4ZSJA 1OPLA 4FOCA 2PWLA 4YLKA 2QKWB 3FC1X 1RW8A 4O0WA 1XBAA 3OHTA 3GB2A 3D15A 4FV9A 1GOLA 2O3PA 2CKPA 1G5SA 1Z9XA 3TXOA 4KIQA 5IA0A 5B7VA 3HZTA 5T68A 4M0ZA 4I0RA 4C4EA 3D7ZA 5DPVA 4RPVA 4FYOA 4ZXTA 5CALA 5HD7A 2R3RA 1LUFA 3ATTA 2R3HA 4J71A 3WF6A 3FHIA 4RQKA 1M2PA 4NIFA 4BDKA 5E4HA 1ZYDA 3S2PA 3RNYA 2ZM4A 3SC1A 4FKQA 2J0JA 2VTTA 2YM4A 5EYKA 3VS6A 2I1MA 2YIXA 4RWKA 3CJGA 4L44A 4JL9A 4L7SA 5DE2A 1VYZA 5AP3A 4O27B 5LMKC 5JGAA 2I0YA 3WOWA 4DT8A 4EOLA 4Y5HA 4FKWA 3E8CA 4EH7A 2XCKA 4YMJA 3TUCA 2VTLA 2V7AA 3AT4A 2GS7A 3T3UA 2Y4IC 1IRKA 4I41A 4G34A 2YCRA 5JEBA 3UJGA 3LLTA 3TN8A 4EOQA 2UZWE 3E87A 3CXWA 1H24A 2OW3A 3LHJA 3OFMA 4KIPA 4NCTA 4QP8A 4QYFA 4XRLA 3EFWA 3VUHA 4BCIA 5FM3A 3NIEA 2WOTA 5E91A 2C0OA 5L3AA 3ZUVA 4G3FA 2IN6A 3FLWA 4JR7A 1URWA 2YHVA 4Y83A 3QRUA 5CYIA 5DWRA 4PP7A 2J4ZA 2QLUA 2IVSA 5ACKA 5IH6A 5KKRB 4R77A 4HGEA 4FTAA 3MFRA 1Q99A 3HV3A 3DJ5A 4J96A 1XBBA 4MXOA 5HE1A 4F0GA 4ZY4A 5D12A 2E9OA 1YOLA 3LCKA 2VNYA 2XKEA 3GCUA 3TIYA 5K4JA 2BTSA 4IQ6A 4GU6A 3RGFA 4DEDA 4O84A 5IZFA 3R9HA 3GT8A 4U42A 5HLNA 2WQBA 2GQSA 4WG4A 3MW1A 3RCJA 2NRUA 1ZOEA 4J1RA 4MBJA 4GRBA 2VWXA 3HUBA 5KNJA 2Q83A 3TM0A 2OI4X 3BWJA 4ACDA 4YR8A 2I0VA 4X2JA 3BPRA 4EBVA 4FKTA 2OF4A 3QQJA 4NWMA 4JX7A 3RP9A 4AFEA 3FMEA 1OPKA 1CKJA 2PZ5A 3G90X 1E1XA 2ITYA 3KRWA 3DA6A 3QGWA 4FG9A 4IZ5A 4FKGA 4RJ4A 4JOAA 4FC0A 3DT1A 4PDPA 4BCJA 4EHVA 2PZIA 2BRNA 5CT7A 2XM9A 2WQEA 3QLFA 4Y73A 3VUMA 4AOJA 4L01A 2FSOX 3HAVA 2W4KA 5G1XA 4BL1A 2WIPA 4O0XA 2J0IA 5EDRA 1Q8UA 3QRIA 3W8QA 1BYGA 5CT0A 2HZ0A 3PJ8A 4X7QA 4BI0A 1QPCA 1MP8A 4NFMA 2YWPA 2WQMA 3QXOA 4NW6A 4MXXA 4FOBA 2E9PA 4YBKA 4ZJIA 3R7VA 5BUEA 4C2WA 4M84A 5AM6A 4Z55A 2I0HA 3EH9A 3KMWA 3QTUA 2X7OA 2H96A 4RIXA 5BX0A 4YTCA 3UVPA 4CFFA 2XNNA 4MK0A 2BRHA 4NTTA 3GU6A 2BRMA 2VTSA 2WMQA 4U3ZA 5AR4A 2VWBA 4LRKA 4IAFA 4RA4A 3TV4A 2FYSA 2RF9A 4Q5EA 2WEIA 3CKXA 2R3GA 1H07A 4E3CA 3CQUA 5J1VA 4R5SA 4D2VA 1KV1A 4I5HA 3UIUA 4A9UA 4EYJA 4CLJA 3HNGA 4IVAA 3KMMA 3QU0A 4JG7A 3ENMA 4RIWB 5EW3A 3KXNA 4Z9LA 4J52A 3FQHA 4GK3A 2JLDA 3Q53A 3E92A 4RX7A 2GTMA 3IDCA 4C3FA 2YLFA 5M4UA 3CE3A 4G3EA 4OTPA 3DAJA 4MAOA 4CKJA 5A4TA 4EOSA 3R8MA 3O8TA 4IVCA 5B2MA 2R2PA 3EQGA 3KRRA 4UY9A 3ODYX 3LFAA 3QCQA 4WO5A 5L8JA 3ZCLA 2BFYA 3LAUA 4M13A 4EH4A 4AW5A 4L43A 2CKEA 2C5XA 3QTSA 5AUUA 4LRMA 3ZSGA 4QTCA 3DBDA 5M53A 3MH1A 1REKA 3U9NA 2OZAB 2R4BA 1IA8A 1J1BA 2Y9QA 2XNEA 1YW2A 3I4BA 3R1YA 2B52A 4RWLA 5CZIA 3FLSA 3C1XA 4AXAA 4D28A 4L45A 4C37A 4RIOA 2EXCX 2OZAA 4LL5A 3Q4CA 4GVJA 3G0FA 4BI2A 4E1ZA 2OIBA 4RJ5A 5LVPA 4EWHA 4I21A 3UMXA 4A9YA 4BI1A 4D2PA 3GCQA 3HV5A 5IEYA 3FMNA 4NM5A 3ZFYA 3DQXA 4K9YA 4YTHA 4CFNA 3D5VA 3CS9A 5KZ0A 2WU6A 3GU5A 5CAPA 3MYGA 3FPQA 2BZHB 4I0SA 4IM2A 4XH6A 4XV2A 3DKFA 3SG8A 5I9WA 4QRCA 4BYJA 1A06A 4NL0A 1JWHA 4ZZOA 3IG7A 3LJ1A 4MVFA 3W18A 1OECA 4O6EA 2OZOA 4AGCA 3EB0A 1YI6A 1NVQA 2QOFA 4QYYA 1UWHA 3QC9A 3R8LA 4K8AA 4LV5A 4D2WA 3EQFA 2QONA 1OUKA 5FRIA 4ALUA 4IDTA 3HKOA 1CKPA 3NUUA 4ZTLA 5CU6A 3BBWA 2PE2A 2ZAZA 4D1ZA 3AQVA 5AV4A 1GNGA 4A7CA 5K9IA 3R04A 3FXZA 5FEEA 4U45A 1APME 2UW0A 4HYHA 4EH9A 4O1PA 2VO6A 4CRSA 5HESA 4FIHA 3EMGA 3EN4A 5AADA 3BQCA 2W5BA 4FVRA 2PVNA 4FTLA 3CTQA 3QGYA 1YOMA 2VD5A 1WBWA 3EQBA 4FZDB 4WNPA 1W98A 3MGYA 4NJDA 2B1PA 4XRJA 4ZTNA 1ZZLA 3DPKA 4W8EA 3QL8A 3ZBXA 2QG7A 3GGFA 3QTXA 4X2GA 4BDDA 4LGGA 3QD0A 1K3AA 4IM0A 3CGOA 2VWZA 3A61A 2RL5A 2UW6A 3TG1A 4FIGA 2CGWA 3QQUA 4YPDA 1YHWA 5FXQA 3U8WA 2IPXA 2FA2A 3I7BA 2PZRA 3AMBA 4S33A 3JUHA 2R3JA 4MD7E 3KQ7A 3NUYA 4O7TA 3LIJA 4HNIA 1TVOA 3FHRA 3SV0A 3GENA 4FSRA 4EH3A 3BYVA 2DQ7X 4U5JA 1KWPA 5DRDA 2P0CA 4WUAA 1YRPA 3NW6A 2BIKB 2I6LA 4BIEA 4M97A 2WIHA 3BWFA 3I0OA 3V5LA 3C4FA 2IWIA 5EYDA 4P4CA 3IK3A 5D9HA 5CF6A 4YBJA 3E64A 5BVEA 4YJVA 5B2LA 5A46A 5CU0A 1VR2A 3GUBA 3PSDA 4D2RA 2J6MA 4XLVA 5H9BA 4B0GA 1QMZA 5LCKA 3GOPA 2Z2WA 3ZSHA 4O7LA 4GJ3A 4KNBA 2V62A 5HCXA 3ZDIA 4IADA 2XYUA 3OF0A 3SD0A 3UE4A 3NYXA 3OCSA 4L46A 2BALA 2YM5A 1UV5A 5AUZA 3GOKA 3DLZA 3OWJA 3GCSA 3QXPA 3R8ZA 4R5YA 2X6DA 3DJ6A 3UOKA 3ZC6A 3KXZA 4FTQA 4WNKA 4AN9A 4E4NA 5L2IA 2R0UA 4O6LA 3TNPC 3VQUA 3ZU7A 1K2PA 5HOAA 4RVTA 5AR8A 5ANOA 4F6WA 3GC0A 5FEDA 5HKMA 4EORA 1GIIA 3ENHA 3F7WA 4UYAA 1I09A 2WU7A 4OBQA 4BR3A 2BZIB 3VWAA 1PXIA 4HNFA 4F63A 2OIQA 4WBOA 2XUUA 2QOOA 1KSWA 3EKNA 5CNOA 3KCFA 1DS5A 2BTRA 2XNOA 3ZXZA 1UKHA 4O82A 2AC5A 4ZZNA 3DBEA 3PXRA 1HOWA 5HG7A 1W84A 2ZB1A 4NW5A 2PYWA 4FNWA 3U4UA 2X0GA 4RZVA 1O9UA 1W7HA 4D4VA 4FSUA 2XYNA 3OUNB 4F7NA 4C3RA 3KY2A 5AV1A 2RFEA 5JZJA 4IB5A 5HTBA 5JGDA 4WKQA 2PVMA 3OOGA 4YZ9A 1FBNA 4PP9A 3LLAA 2VWIA 4ZLZA 2XKCA 2R7BA 3NR9A 4JBOA 3LXNA 4F1OA 1OM1A 4XEYA 5I3RA 1K9AA 3VQHA 4G3GA 4RJ6A 2OU7A 2YIYA 4ERKA 3KRXA 4GIHA 2PL0A 2FO0A 4F0IA 4BZNA 5J5TA 3PYYA 3V5QA 1ZY5A 4X3FC 2B53A 3ZONA 5E8XA 4FEWA 4YGAA 5L2WA 3ORTA 5IF1A 3DB6A 3ZO2A 4MNFA 5BVKA 5H8BA 3D2KA 4V01A 5JGBA 4BCNA 2IW8A 3TV6A 5AR7A 2R3IA 5BPYA 5CU4A 5AX3A 3SKCA 2ERKA 2YDIA 2WTCA 2UW9A 3KXGA 5EYCA 3VW6A 2J5FA 4QP2A 4B7TA 4QP6A 4EK6A 4QYEA 3U55A 4FVQA 5EDPA 4ZMFA 4NM0A 4RLKA 4EUTA 4BY9E 1M17A 3C9WA 2UV2A 4YTFA 5EI8A 4FT5A 3E62A 1OKYA 2XIYA 5CASA 4IAKA 4CGAA 4BDIA 3RVGA 4EHZA 4YJQA 2H9VA 4C33A 5CQUA 5IQCA 4RVKA 3L9MA 1ZMVA 3R1QA 4H39A 2YM6A 3ELJA 2QOIA 3H10A 2ITOA 3ZEWA 4BCGA 3G51A 4FK6A 4DTKA 1DI8A 3JY9A 3NX8A 4FEXA 1FOTA 4MXAA 3NUXA 2NPQA 4MKCA 4CMOA 3E3PA 4LOOA 4IWQA 4UZDA 4DH8A 4RJ8A 3PRFA 5TOZA 5M55A 4IVDA 4LL0A 3QQFA 3ZRMA 5JH6A 3HMIA 4EK4A 4OW8A 4CD0A 3RPRA 3FYJX 3EQHA 3PVWA 4EEVA 4V0GA 2O5KA 3PXZA 4ZJVA 3FSFA 4TXCA 3DKGA 4GSBA 5AP6A 3UG2A 2BCJA 3R71A 3FL5A 1WVWA 3QBNA 4QTBA 2W9ZB 2RIOA 4B8MA 5J1WA 2G2FA 2JDVA 2VTIA 2GHMA 3JXWA 3BKBA 3L8VA 3VHKA 4AGDA 3Q96A 3VNTA 4IACA 4O0VA 4QMVA 1JKLA 1H1WA 4RFYA 3BE9A 4CFVA 4YZCA 4LRJA 4DGMA 4A07A 5DFPA 4D55A 4YO6A 3CEKA 5HG8A 4APPA 2XM8A 4L8MA 4H36A 3WF9A 4O7RA 4BTKA 1F0QA 5FEQA 2BMCA 4GYGA 4OGRA 5C03A 3IW6A 1UVRA 4OBPA 4FT7A 3TV7A 2ITUA 3Q9ZA 4KKGA 3C4ZA 4QMZA 4QD6A 2YM8A 3QYZA 4D5KA 4FTOA 3ITZA 4DHFA 1BMKA 3K5VA 3ZSIA 3M42A 3U6JA 3L8XA 4BN1A 4C2VA 2XNPA 4O7WA 3MPMA 3ACJA 4I24A 2ONLA 3BHYA 3JYAA 3S0OA 3NVKI 2JFMA 4GFOA 3C4WA 3U9CA 5CSWA 3L9LA 3R9DA 3IGGA 3UG1A 4AZSA 2XVDA 5C01A 1SNXA 3VRYA 3G15A 2XK9A 3NYOA 4PDSA 4BGQA 4QP7A 4FYNA 2KTYA 4A9SA 3B8RA 3BE2A 2J0MB 3LM0A 4YJPA 3F3VA 4YJRA 5AV2A 2EU9A 3MSSA 4FTTA 4AT5A 3PWYA 5AAGA 2CNQA 2BRGA 3WZDA 4E5WA 4F64A 5GIPE 3QHRA 1I44A 3DK6A 4W9XA 2B7AA 4DITA 5E7RA 3ULZA 4E26A 3LXLA 3WF5A 5LVNA 4ZZMA 4USDA 5BYZA 3GU7A 1MRUA 3C7QA 4MYGA 3TKIA 4FV7A 4S30A 2Z8CA 5DBXA 4XG7A 2C6OA 3O96A 4BDJA 5I5ZA 5EYMA 3REPA 3BX5A 1LEWA 4BDHA 4IC7A 2O2UA 2OH0E 1H27A 3NUPA 3B8QA 3UZPA 4OTHA 5AA8A 2ITVA 5IU2A 3MS9A 1J7UA 1OL7A 4Y85A 5EI2A 1FMKA 3DZOA 5ETIA 2XNGA 3K3JA 4GIIA 1RDQE 3S00A 3ORLA 4M69A 4X3JA 4Y72A 2ZM1A 3K54A 4HCUA 4ZJJA 3FZPA 2YIWA 5BYYA 2YISA 5KMMA 1Q24A 3AOXA 1GZOA 2X1NA 3R7GA 1KUTA 2YWVA 5FXSA 4D9TA 3Q60A 5DNRA 4NM3A 2GNFA 4XLIA 3EFLA 3Q4TA 4H3QA 4YLLA 3RAKA 2F2CB 2Z7RA 3TI1A 1UNGA 4ZTMA 2XK3A 1Q5KA 3FLYA 4ITHA 1SNUA 4QYHA 4AGWA 4IH8A 4KSPA 4TNBA 1OIYA 3VAPA 3O23A 2O65A 3FEGA 5AA9A 2J9MA 4X2NA 4BKZA 5IUIA 4GMYA 4QP3A 3F6XA 1WVYA 1JQHA 5HGIA 3FSKA 3FXWA 3IO7A 4JBQA 2VWUA 5GZ9A 4NCTC 4O22A 3L9NA 4N4SA 4FTRA 3EQIA 3OC1A 5IKWA 3TWJA 2VWVA 4YJTA 4ANBA 1JKKA 2XMYA 5F20A 4BKJA 3GFWA 5DYJA 5JZNA 3V6SA 5CSPA 2X2KA 2VTQA 3UC3A 4WT6A 3OXIA 4WRGA 2A0CX 1VJYA 3QYWA 4CFWA 3FLQA 4NEUA 4LQMA 3ORNA 5KKRC 2OJ9A 4M15A 2Z60A 2RG5A 4RWIA 2Y4PA 1AD5A 4IVBA 2BDJA 4K33A 2HIWA 1ZAOA 5AIKA 5HIEA 4M68A 3IKAA 3KN5A 4LM5A 3EZRA 4X6QC 3ZLWA 1OL2A 1TQPA 5L6OA 2GNHA 1XO2B 1BX6A 2V55A 3SX9A 4AACA 1OITA 3FV8A 4PRJA 4O91A 3ULIA 5HO7A 3U6HA 4PTCA 2Z7LA 2XB7A 3Q3BA 4IWOA 1KE5A 3FI8A 3A7GA 2F9GA 4BFMA 4FUYA 3NUAA 1PJKA 1H26A 3A8WA 2GHGA 3DKOA 2VTHA 3PXKA 4IX4A 4KRDA 4GT3A 3VBVA 5M56A 5TR6A 4ID7A 5L6WL 1KOBA 5FM2A 1JLUE 2Y8OA 3WYYA 1IA9A 5AUXA 3BRBA 2C3IB 3P78A 3C0GA 3WARA 3ZYAA 3UMWA 3DGKA 5JFSA 3F2RA 4HYIA 2VTRA 4X6RA 3TZ8A 4UMQA 1SVGA 4L52A 3SXFA 3UVRA 5BMSA 3C0IA 4TNDA 3W55A 4W4XA 5H2UA 3A8XA 3O17A 1WBOA 4XOYA 2HCKA 1OIQA 3AXWA 2OXXA 2PVKA 4X2FA 4FG8A 3N4VA 4U80A 3DTCA 2R7IA 4RX9A 3BYUA 1Q61A 1TQMA 1XHAA 4AFJA 2IW6A 5BVFA 2VAGA 3KFAA 4OT6A 1Q8YA 1V0PA 3OWLA 4RX8A 3AGMA 3W2RA 2XBJA 4FV5A 4YC8A 5AR3A 2C0TA 4RLLA 3D14A 1YDSE 5BNJA 5IA2A 4Z16A 4C57A 3ORZA 4W4VA 3UC4A 3QLGA 3M11A 5CWZA 3C4CA 5E8ZA 3PFQA 4I92A 3NEWA 3MA3A 4O0RA 4BVUA 3F5PA 2ERZE 1FVVA 4FKLA 2JDRA 2A19B 5C26A 3QCXA 1SVEA 3OD6X 4FKVA 4O1OA 4ANSA 3NUNA 2GS6A 1M2RA 1P14A 4P90A 1H28A 2PSQA 2GNGA 2JIVA 3GU4A 3PPZA 2YZLA 4O0SA 1Z57A 4EUUA 1WZYA 2PE0A 2Q0BA 4AN2A 2X4FA 4JRVA 4DCEA 5C4LA 3LJ2A 4V04A 3VULA 4D2TA 2BAKA 2CMWA 3FMLA 3HX4A 3SRVA 4P5QA 4J8MA 4YJUA 4NIFB 3VBXA 3FY2A 5KUPA 3Q6WA 1PMNA 4WBBB 3LFBA 3C4EA 4IHPA 4IBMA 5CF8A 3F9NA 4O7YA 4RFMA 5EHYA 3PTGA 3VS0A 3VJNA 3NNWA 2R5TA 4BKYA 2WTDA 5AWMA 2QVSE 3LFSA 4FSMA 3R6XA 5DVRA 1XH7A 2OKRA 3PA5A 3O2MA 5DEWA 4WNMA 4EQMA 5FUTA 4FNXA 3PA3A 5A54A 4H58A 4NTSA 3ZDUA 3WE8A 4DTAA 2QCSA 2VTMA 4TYIA 3SHEA 3WIGA 4KBAA 2R3OA 4ZIMA
chains in the Genus database with same CATH superfamily
4UWCA 5GZ8A 1TQIA 2QOBA 2X8IA 3LCDA 2JC6A 4BBMA 3QALE 3H0ZA 4R1VA 4F7SA 2V22A 3UVQA 3VF8A 4E4LA 5JMSA 5IQFA 1FQ1B 3GNIB 4J97A 5ETCA 3POOA 1JSTA 4PUZA 1XBCA 1FVRA 3DJ7A 2YAKA 3FZ1A 1V1KA 4EI4A 3TUDA 3Q5ZA 3CR0A 2XCHA 2PVLA 5CSHA 5CSVA 3R1NA 4TPTA 3AC5A 4NFNA 4EKKA 2G2IA 3DZQA 3H3CA 4M12A 3TZ7A 4U81A 4DBNA 3LFNA 3QKMA 2BUJA 2OBJA 4PTGA 2Y6OA 3LXPA 2J7TA 2HY0A 2VGPA 4IZ7A 5H8GA 3VUDA 1NVSA 3KRJA 4YO4A 4IFGA 5KMJA 3CBLA 4JS8A 4BHZA 5L2SA 5CLPA 5HZNA 1NT2A 4I93A 4BDBA 4EOJA 3EQPA 4HJOA 4ENYA 4BRXA 2W1ZA 3ZUTA 3BLHA 3MIYA 1P4OA 4HZSA 3U4WA 4O4CA 1NA7A 2QO7A 3WILA 5IQHA 3UGCA 2BROA 5HLWA 1SYKA 3HMPA 4DH5A 2G15A 4PPBA 5EH0A 1XR1A 2BKKA 3QD2B 4CKRA 4XG9A 2R3LA 3G9NA 3ZFMA 1P2AA 2OK1A 2QNJA 4XBUA 2QQ7A 5M4CA 4G1WA 4OR5A 3ML1A 3HRBA 3N4TA 1MRYA 2GFSA 3O50A 4HCVA 4DEGA 1G8SA 5EQPA 3ZXTA 2RGPA 5D1JA 2B4SB 2CGXA 2WKMA 3HDMA 1XH6A 3DDQA 3LFCA 2JDTA 4YHTA 4I23A 4UYNA 3B2WA 5HBEA 3ZEPA 3G5DA 1E1VA 2A2AA 3QQGA 4O81A 1UA2A 4BCPA 2WPAA 2GQGA 3EQDA 2ITXA 4U43A 1PMEA 1Q41A 3MV5A 4B6LA 3PJCA 3NFGB 4EH2A 2LGCA 3POZA 5CEMA 3KXMA 3KC3A 5M4IA 4HVDA 3BHUA 3VJOA 4FKJA 4TT7A 3SQQA 5L8KA 2F7EE 2QOCA 4RIXB 4BWPA 5KMLA 4AS0A 3L9PA 3IGOA 5E8TA 4PMMA 3UQGA 3G9LX 5EDQA 3DBFA 4R1YA 2DYLA 3R7UA 2VRXA 4NZWB 4EJNA 3FC2A 4OAUC 4FKPA 3MVJA 4ORKA 4DFUA 4ASXA 2B54A 3CY3A 3HMNA 4C62A 3V6RA 3GCVA 5E90A 4WSYA 3NGAA 4DGNA 4JDHA 3TNQB 4F08A 2X9FA 3FUPA 2HWOA 3GBZA 4MBIA 4N70A 5BYLA 2WQNA 2FB8A 2NP8A 2QURA 4K0YA 3PSBA 3D5WA 5J7HA 1RQQA 2EB3A 3KGAA 3BBTB 3PVBA 4FIJA 3FLNC 4ZTSA 3SW4A 5L2QA 4DT9A 4LGDA 3VS5A 4J53A 2C68A 3LPBA 4E73A 4EC9A 4DFYA 4CVAA 3QFVA 2YDKA 4JJRA 4ZS4A 5CANA 3Q52A 2CGUA 4QMWA 4M0YA 4ACMA 5JSMA 3TDWA 5HBHA 4ITIA 4C4FA 4U3YA 1Y91A 2R9SA 4S34A 1H1QA 1BLXA 1MQ4A 5JT2A 1PMUA 3C50A 4S31A 3RALA 3AT2A 3BGQA 4FICA 5CNNA 4UN0C 5I9XA 3QX2A 3RM6A 2VU3A 3E8NA 4TYJA 4CSVA 1Y8YA 4AOIA 3QKLA 3KL8A 3OG7A 4F70A 5KMNA 2R3QA 2RSVA 4LGHA 1M52A 3SXRA 4I1ZA 4BDGA 2CCHA 4TZRA 5CS6A 4FT3A 4PTEA 3CTHA 3LCTA 3FZRA 4KBKA 2BFXA 2V0DA 3IOKA 3KU2A 4G3DA 4KRCA 4EK8A 4PL3A 2H34A 2P33A 1PXMA 1W82A 1YDRE 2PK9A 3UP7A 3IQ7A 3D4QA 4FK3A 4U79A 4CMUA 5BVDA 3Q2MA 4BDEA 4KB8A 2XRUA 3NLBA 4YSJA 4I20A 3IECA 3TTIA 2W1IA 2NRYA 3EL7A 4IWPA 3P4KA 5J9ZA 3OTUA 1JKSA 2BZKB 2PE1A 3EQRA 5J9LA 3COIA 3HECA 4TYHA 4CCBA 3PVUA 3UYSA 1YXXA 5KMIA 3TKUA 4XNEA 3QA0A 4IDVA 5TT7A 4D5HA 5A4EA 3QQKA 3BIZA 4FEQA 4LYNA 3P7CA 3T8OA 3BLQA 3QRJA 2EVAA 4RJ3A 4CKIA 4E6AA 3W10A 5IQBA 5EOLA 3OOMA 4XS2A 4JR3A 3ETAA 3U6IA 4Y8DA 2HZIA 3OT3A 3N9XA 5ANDA 1R0EA 3DLSA 3JS2A 3QZIA 2NYAA 2E9NA 2BAJA 3FL4A 2ZB0A 4IZYA 4APCA 3BYOA 4UXQA 3RJCA 2XARA 1EH4A 3RAHA 4IAIA 3W8LA 5FDPA 3GQIA 5CF5A 3EN6A 3SLSA 5JRQA 3ZFXA 2C5YA 2UW7A 3A4OX 5CSXA 4CT1A 4TY1A 3B2TA 3MFUA 4ASDA 4FG7A 4FZFB 4UWBA 5IPJA 3VBWA 4GT5A 5LMKA 4G16A 4BCKA 2FSMX 3HLLA 1BKXA 3IW7A 5EI6A 3AC2A 4MWIA 5AUYA 4GKIA 1IR3A 4IM3A 5HEZA 1KE7A 4MNEB 4MX9A 4FZ7A 4EHEA 3RPOA 4N57A 2JKMA 1B39A 3F3TA 4IC8A 3ZM4A 3AD4A 5CI7A 4M66A 4MNEA 3BLRA 3F5UA 5EFQA 3KRLA 3S3IA 2PMIA 3WF7A 4FV2A 1BL7A 1OPJA 3FWQA 3R7EA 2CNVA 2CLQA 3R02A 2JBPA 5HNGA 3QUEA 5BVNA 5IA4A 1OGUA 4K6ZA 4P5ZA 2G2HA 1WBNA 3MB7A 4J98A 4MWHA 4R3CA 4ALVA 5DR6A 4CV8A 2YCSA 5LJJA 5DR2A 4HVIA 4CMTA 5HO6A 4QTEA 1ST4A 3R22A 5CEOA 4WA9A 5CENA 4JXFA 2Z7QA 3QWKA 5A4LA 3AGLA 5A14A 4D0WA 2NNWB 4BB4A 3I79A 3VBYA 4BZDA 1PXNA 2QLQA 2X81A 3ZO3A 3QRTA 4MQ2A 3W0PA 2XP2A 2X39A 1PKDA 3OCGA 3Q6UA 3DBCA 4ZY6A 4QDVA 4A9TA 3GXLA 4XP0A 3UNZA 1IEPA 4KBCA 4FSWA 1MQBA 2VWWA 2ITQA 3DXPA 3CD8A 4NH1A 4IX6A 4F78A 3WZEA 4U6RA 4YSMA 4ACCA 3GVUA 4EOPA 4G6NA 3MH3A 2PVFA 1ZMWA 2WMTA 3O8UA 2ONLC 5CEIA 5AFVA 1CDKA 4XYFA 1P5EA 4EJ7A 1PXKA 4C36A 5EQEA 2ETMA 5FGKA 4M8TA 5I9UA 4AQCA 2JFLA 4D58A 4YNOA 5D10A 3MB6A 2V5QA 5I0BA 4QQTA 4R3RA 4QOXA 5K0KA 2VX3A 4RRVA 5ANJA 2ZOQA 3MY0A 3QF9A 2CGVA 4DEAA 4KKHA 4R7BA 3Q9XA 3ALOA 3OP5A 4EOOA 4AXFA 1Q62A 4J99A 3KK8A 3PRIA 2PVRA 4X2KA 3OW3A 3VN9A 4I6QA 4QTAA 1F3MC 2HAKA 1PHKA 4WG5A 4LV7A 3OY1A 5HVYA 3ROCA 4GUBA 5IUGA 4DA5A 3HP5A 5IA1A 3SA0A 3FXXA 3PZEA 4TRLA 4JMQA 3W2QA 2QR8A 4I0TA 3TL8A 2EWAA 1GIJA 2WMWA 3QTWA 2PVHA 3ERKA 4MH7A 2X4ZA 4BCHA 4AZFA 4DLJA 2W1GA 2YEXA 3QTRA 2X7FA 3BELA 4KAOA 2IVTA 3RPSA 5I4NA 3QKKA 2PUPA 2UZNA 4JT3A 5EOBA 3CJFA 5KMOA 3E8EA 4JQ8A 4QQ5A 5GJGA 4BCMA 3CSVA 3V5TA 4I6FA 2QO2A 4K2RA 2VWYA 4TYEA 3ZZWA 1FGKA 3LFEA 4EQCA 3P5KA 5L6PA 2CHLA 5E9EA 4MD9E 5IH5A 4IB0A 4B8LA 4O96A 2AUHA 2VTNA 4NKAA 5TF9A 3PUPA 4TW9A 1OBDA 2CJMA 5HD4A 4Q9ZA 4IMYA 1MRVA 2W5HA 3EQCA 4HGTA 4II5A 1XH9A 1XJDA 5A6NA 3WYXA 4QO9A 1OKZA 4QMSA 5CEKA 4PX6A 3GC9A 3MFTA 5FD2A 3UDBA 2VUWA 4Y46A 4H3BA 4OTWA 4I4FA 2KULA 4FTCA 4RJ7A 4C3PA 5IISA 4HCTA 4GG7A 4L9IA 2ZJWA 4U40A 4ZTRA 3BQRA 4BTMA 2QC6A 3JY0A 3IONA 4N6YA 4ANNA 5HU3A 4DE4A 2OIDA 2YJSA 3FDNA 2QG5A 4R6VA 4AA4A 4F9YA 3NUSA 4IJ9A 2QI8A 3OROA 5CVFA 3GQLA 3TCPA 3V51A 1GIHA 4ITJA 1SM2A 2QKRA 2ZV2A 4H3PA 5DT3A 3PJ2A 2YA9A 3RKBA 4FV8A 4TWCA 2R3KA 5AUVA 1P4FA 2VTJA 3CP9A 4IAZA 3PSCA 3PY1A 4V0GB 3ZBFA 4F4PA 3QA8A 3QQLA 4ONAA 2F49A 3V8SA 3NCGA 5FDXA 2JKKA 2OSCA 4D1SA 5ITAA 3P7AA 3MIAA 3W16A 4ZY5A 4HPUE 4FF8A 4N0SA 3PIYA 4C58A 4USEA 4NT4A 1QPJA 3W0NA 5HORA 1H1PA 3TIZA 1XH4A 3ZTXA 3LCSA 5EHLA 4DG0E 1DAYA 3HV7A 4DEHA 4FVPA 2XKDA 4Y5QA 4IFCA 3C0HA 4KUJA 3BGPA 5C9CA 4AF3A 3E7OA 1U5QA 2HYYA 3PPKA 1YVJA 4QP4A 4H05A 1U59A 4EBWA 2QO9A 2UZDA 3R63A 4OTGA 3TNHA 3ZO1A 3HUCA 3D7TA 2O0UA 5L8LA 3KA0A 1KOAA 5E8UA 5EW9A 3RK9A 4RT7A 3OBJA 3U54A 2QR7A 4E6CA 4QMMA 3ZLSA 4JAJA 2REIA 3QUDA 2WD1A 5EKOA 4ZEGA 3RWPA 5IQDA 2YITA 2GDOA 1YXSA 3P08A 4BHNA 5M08A 1ZARA 3R9OA 3D9VA 4NSTA 4I4EA 3RWQA 3F69A 4TKSA 3TT0A 4DFLA 3QTIA 3LMGA 5DN3A 3RCDA 3QUPA 5CAVA 3KCKA 4CFXA 5AAEA 3UBDA 5JFVA 4YUQA 3A7IA 2WTJA 4R8QA 1PKGA 2J90A 3UNJA 4O4DA 2BHEA 4FUXA 1S9IA 4KIOA 2W1EA 2WMAA 2X2LA 5J95A 5I9ZA 3DK3A 4FTMA 2LAVA 5EHOA 2IW9A 4FTIA 2DUVA 4E6DA 4W4YA 2HWPA 5KX8A 5AP4A 5LQFA 4OTRA 1H08A 3A2CA 3FAAA 4YURA 4UX9A 4FSNA 4EH8A 3ORIA 5BUIA 1J7LA 3FKOA 4DFZE 4F7JA 3CD3A 1UNLA 5HICA 2AEGA 1M7NA 2F57A 3E63A 1CTPE 4FE2A 2Q0NA 3NZ0A 4P2KA 3QTQA 1V0OA 2C3JA 1KE6A 3NNVA 3OUKA 1ZRZA 3CY2A 3OWKA 3MPAA 3PE2A 1BI8A 1ZYJA 5JK3A 4GVAA 2ZYBA 4OTQA 4E7WA 4GS6A 2GTNA 4G17A 3BEGA 4ZSEA 2OJGA 1R39A 1ZXEA 5CXHA 4YZDA 3OEFX 1UKIA 5AEPA 3F5XA 5DH3A 3HDNA 2ZMCA 1YDTE 4M69B 2AQXA 3LFFA 1LR4A 4D2SA 1JAMA 3PY3A 2ITTA 2ACXA 3KXHA 4KWPA 3AG9A 2XK4A 1B6CB 4JBVA 2OXYA 5GZAA 3NSZA 5ANKA 5HE0A 3C4XA 2YCQA 3P79A 5EM8A 3ZS5A 5I9YA 4RZWA 3AC4A 4I5PA 4E4MA 2OF2A 1R78A 4PY1A 2QU5A 4EC8A 4GKHA 4IE9A 1W2DA 3GC7A 1OZ1A 2WGJA 3A7FA 3OMVA 3BU3A 4QP9A 5KZIA 5L2TA 4LDTA 2C5NA 3UZRA 4WG3A 5BUJA 2HY81 5M07A 4DH7A 2YABA 5EQYA 4DHJA 2HXQA 2ITWA 4DYMA 3DNDA 1H00A 4EQUA 2ZV9A 4O83A 3MVHA 3PJ3A 3S95A 1FINA 2QHMA 5LWNA 4HOKA 4IX5A 2JGZA 4MXZA 4G9RA 4KIKB 2W1CA 4OTFA 1Z5MA 1PXJA 3ZRLA 5HCYA 3UQCA 3L1SA 3QC4A 4R78A 1CMKE 1F5QA 5CU2A 1V0BA 4KIKA 4NJ3A 4EOKA 3UDSA 3MY1A 1YHSA 4X3FA 4ASEA 4PWNA 2JDSA 5AV3A 3Q4ZA 5ANGA 2IF8A 3WF8A 4JX3A 5ETAA 1JVPP 3D0EA 2PVYA 3HRCA 2C0IA 3RAWA 5L4QA 3O8PA 3I1AA 1GZ8A 4EKLA 4F0FA 4JIKA 4K77A 1Q3DA 4YZBA 3VF9A 5J9YA 4XG4A 3VIDA 4BDCA 2RFDA 5IQIA 2UZUE 2WQOA 1ERKA 1XMMA 2WMRA 4AX8A 4JI9A 4IX3A 3DXNA 3RHKA 4FTNA 3R30A 4F9BA 5KBRA 4K18A 3ZH8A 2R64A 5E8VA 1ZWSA 3LJ0A 4OTDA 3W33A 4ALWA 4Z3VA 4QT1A 4C4HA 2C5OA 1UU7A 3TZMA 2W1HA 5JQ5A 2C6TA 5GJDA 3HMMA 4AQKA 4FTKA 2XEYA 3KEXA 2CPKE 4CEGA 2IZUA 1JSVA 2HK5A 2GFCA 4NM7A 3ZLXA 4ZLYA 2PUIA 1NVRA 3G2FA 2J5EA 4OTIA 3PP0A 2F7XE 3BV3A 3MVMA 4I5MA 4TWPA 2ITPA 3DAKA 2WFYA 3KF4A 4LV8A 3PP1A 4QPMA 4XCUA 4XX9A 3I7CA 2E2BA 1FGIA 4FV0A 1YOJA 2XZSA 5LMAA 4PMTA 1OBGA 2QOLA 2O63A 3SVVA 2YM7A 1LEZA 2PMOX 4MTAA 4UBAA 4ZSGA 3V5JA 2PULA 1O6YA 3FMHA 4K11A 5D7VA 4A06A 4HW7A 1PRYA 3ZHPC 2SRCA 1RJBA 2ZVAA 2R3MA 1ZMUA 2W17A 3R2BA 2XNBA 5HU9A 3OXZA 4U44A 3R83A 5AM7A 3BEAA 3DAEA 3PFYA 3ROYA 4FI1A 5A9UA 4RIYB 3EYGA 4O2PA 5G6VA 2C6MA 3AC1A 3R2YA 4RBLA 4RSSA 3WZKA 4XG3A 2YLEA 4IAYA 3W0MA 2IG7A 2A1AB 4AE9A 4FKIA 4FTJA 4C7TA 3C13A 5IA3A 4RIYA 4QQCA 3TTJA 1STCE 5C8MA 5CF4A 3E7VA 3O51A 1UNHA 4TYGA 4D4YA 4ERWA 4I5CA 2B9FA 4D9UA 3RPYA 3VS1A 5K5NA 3NS9A 3NRMA 2J50A 5FTOA 3NYNA 3HV6A 3ZOSA 1DI9A 4KA3A 3A60A 2GNJA 3UO4A 1Q3WA 2J0KA 3II5A 3CQEA 4RVLA 5K3YA 4GJ2A 4BBFA 2PUNA 4RWJA 1H0WA 4WSQA 3E8DA 4QMUA 4XHKB 4DGOA 4ZSLA 2CDZA 1H0VA 4CT2A 4FEVA 3UODA 2PTKA 4E5AX 4GUEA 5FWKK 4F6SA 5HIBA 1JOWB 4C4JA 1CSNA 5GIOE 3SG9A 1YI3A 2IZTA 4JG6A 4JDKA 4BICA 4JQEA 2RFSA 2CCIA 2WMVA 3ANQA 2JKQA 3K2LA 1YXTA 3O7LB 3QD3A 4AAAA 4CV9A 1M14A 5J79A 2EXMA 1IASA 3EYHA 2XKFA 2ZV8A 3SRVB 2OLCA 4L68A 3M1SA 1SMHA 1JSUA 3LZBA 3RAIA 3KN6A 2WMUA 4EZ5A 4IJPA 3QRKA 4FL1A 4PDOA 3UYTA 4YPSA 3ZC5A 3TKHA 3PLSA 3KVWA 4DC2A 4IAAA 4YC3A 5IQEA 1W8CA 5AP7A 3VRZA 4DG2E 4PDYA 2CN5A 2VZ6A 1H4LA 4C59A 3F82A 3GP0A 3A7HA 3DCVA 1OB3A 3EJ1A 3IOPA 2WEVA 2BAQA 4PPAA 1A48A 3HAMA 4CG9A 2J51A 2QOHA 2FVDA 4M3QA 1OMWA 4DINA 4FEUA 1HCLA 3ID6C 4B9DA 1Y57A 3I0QA 3UP2A 3FE3A 4FL2A 4PPCA 4PQNA 4HYUA 2W5AA 4FIEA 5CI6A 2VO3A 1GAGA 3RZFA 4C38A 1IAHA 4OAVB 3N51A 4F9CA 1GZKA 5FTGA 2VO7A 5CEQA 5ANEA 4JDIA 1YKRA 5C27A 3AKLA 2WTKB 2XNMA 1YWVA 4FKSA 3SXSA 2Z02A 4S32A 5TE0A 2UZOA 3OXTA 2HZ4A 3K5UA 3TJCA 4F1MA 5IQAA 4L3LA 3F5GA 2UW3A 4FSZA 4LMNA 3PIXA 4FRFA 4CQGA 1SZMA 3R7IA 4KS7A 3BHVA 1J1CA 3P7BA 4C61A 4F9AA 5IEVA 3QZFA 5AX9A 4U8ZA 5FLFA 5M09A 4C0TA 4OT5A 4HPTE 5FXRA 2ZM3A 3AC8A 5HVJA 4IB1A 4CZTA 2C6DA 3EWHA 3KK9A 2XRWA 3NAYA 3Q4UA 1FPUA 3BU6A 4XJ0A 3U87A 1Y8GA 2AC3A 2GNLA 4G6OA 4QP1A 2VNWA 3QCSA 3SAYA 4F99A 5IEXA 5H8EA 5J8IA 2I40A 2V7OA 1ZOGA 4DLIA 5HI2A 1G8KA 3RTPA 1UWJA 4O2ZA 5CVGA 4BCFA 3BCEA 5BVWA 4GFGA 3DY7A 4CZUA 1XKKA 5DLSA 4XV9A 4KS8A 3IW5A 4F6UA 2XJ0A 3KMUA 3PPJA 5F1ZA 2X2MA 3H9RA 3HRFA 4ACHA 1JKTA 1PXLA 2HENA 2Z7SA 5JFWA 1QCFA 1VZOA 4WIHA 4PL4A 4E6QA 2FH9A 4GK4A 2OG8A 4GG5A 4JBPA 5AV0A 4AZWA 4DCAA 1OL5A 2CN8A 2VO0A 3EFKA 3GFEA 4YNEA 4EYMA 3SW7A 5BV3A 1W83A 4NUSA 4QNYA 3UQFA 4V05A 1UU3A 3A62A 3IW4A 1WAKA 4AU8A 4E93A 4FJVA 2W05A 5C8KA 3HP2A 4YZMA 5AP1A 3R8VA 2P4IA 2WHBA 3QZHA 5B2KA 2GU8A 1R0PA 2DS1A 4RA5A 3TZ9A 2F2UA 3V01A 2IVUA 4ACGA 5DMZA 5KHXA 3VUKA 2UW8A 2YM3A 5EM7A 4JLCA 3VW8A 5CXZA 3FMDA 4Z7HA 5IQGA 4AW0A 2WMBA 4X21A 1CM8A 2X9EA 2XK6A 4I22A 1H1SA 1HCKA 3RZBA 4JG8A 3UOJA 1U4DA 3NAXA 3PIZA 3Q9YA 4U97A 4BTFA 4FV6A 3T9TA 4WOVA 2WAJA 4TTHB 5K5XA 4PNKA 5CAOA 4MQ1A 5BMMA 4ANQA 3CCNA 2E9VA 4AWIA 5AAFA 3ZLYA 2C5VA 1ATPE 2HELA 4CG8A 2C1AA 1W0XC 4MHAA 4W4WA 2YACA 3KKVA 3KB7A 4EHGA 4C02A 5ANIA 3LVPA 3G0EA 3DXQA 3TUBA 3MJ2A 3QAME 3VS3A 3ORMA 1PYEA 1H8FA 4FX3A 4UXLA 4A9RA 5LVOA 3QX4A 2C1BA 2I0EA 3E88A 1TFFA 1YXUA 3DOGA 1WBPA 2YERA 4LUEA 2WTVA 4QMQA 3UOLA 2FSTX 3EN7A 4FV4A 3PE1A 4YLJA 1O6KA 3R9RA 2QD9A 2YN8A 3PY0A 1GY3A 3W2SA 2QOQA 5CVHA 5HG5A 1BUHA 3DBQA 4M7IA 1OKWA 2YDJA 3MH2A 1R1WA 4A4LA 5KO1A 4FKUA 4LFIA 5F95A 3R0TA 2VTAA 4XP2A 3DQWA 2XEZA 2OJIA 4UMPA 3R7OA 4YTIA 3LQ3A 5AP0A 3W2OA 3HV4A 3R8PA 5C4KA 3TYKA 4EH6A 3GCPA 2X7GA 4AT3A 5BVOA 3I81A 1WVXA 4RIWA 4UMRA 3RK7A 3GU8A 3EHAA 3RINA 4BJJB 3MFSA 5LARA 4AP7A 4O0UA 4FT9A 2QOKA 4CFUA 2ZMDA 4G2FA 3FMJA 3ORXA 2OICA 3NPCA 4AGUA 1JPAA 1MUOA 1PY5A 4BJJA 1OVEA 4ZSAA 4PMPA 1H25A 3PXFA 4IWDA 2C4GA 4RX5A 4Z7GA 3TDVA 4TYHB 2H6DA 4XV3A 3SGCA 3V5PA 3W1FA 3F7ZA 3FY0A 3NW5A 4FSTA 3W32A 4C4GA 2UZVA 1G3NA 4G31A 3CPBA 3PJ1A 4D4RA 2GMXA 2VV9A 4FSYA 4DDGA 2BZJA 3VUIA 4XG6A 4YHJA 4XOZA 2YIRA 3QZGA 4O38A 2PUUA 3FKNA 3THBA 2W7XA 5FBOA 1TKIA 4D0XA 2B9IA 4ZLOA 4JVGA 2WB8A 4W8DA 3MWUA 4YJSA 4FBXA 5K4IA 4A4XA 2C3LA 3SOCA 2UVYA 3UO6A 4DH3A 4R7IA 2CNUA 1BL6A 3DV3A 4PV0A 3QD4A 3CQWA 3EFJA 4AW2A 5HX8A 3OEZA 4UB7A 3FPMA 4MF0A 4N6ZA 2IZRA 3FZOA 4TWOA 4ZP5A 4ZTHA 3DS6A 4CFMA 4OUCA 5IDPA 5GINE 1QL6A 2ETRA 5AMNA 4E20A 4FV1A 4O7VA 2P3GX 2XH5A 3GEQA 3NCZA 2XJ1A 4DAWA 2O8YA 2W9FB 3QQHA 4NYEA 2Y7JA 3HEGA 3D5UA 4A4OA 5JKGA 4O4FA 2Y4IB 3T9IA 3DB8A 4O7SA 3MDYA 3VO3A 3FMKA 3WBLA 3VHEA 5E8WA 5ACBC 3FMMA 5HQ0A 4Q9SA 1XH5A 4JQ7A 3D5XA 3FJQE 3I6WA 4I6BA 4O86A 2X0QA 3DU8A 2W06A 1Y6BA 3RI1A 3FBVA 4QPSA 1YQJA 5DHJA 3FI3A 4EONA 5H3QA 3LXKA 1U5RA 4O7NA 3VS2A 2JIUA 3OTVA 2XF0A 4QMPA 2W4OA 4EL9A 4QMXA 2OGVA 4YJNA 2W0JA 3KXXA 2W96B 5HX6A 1YXVA 3MTLA 2WZJA 4EK3A 1U46A 2YIQA 2FUMA 1VYWA 1Q8WA 1OL1A 2A27A 3WZUA 5JFXA 4AW1A 1G8AA 2PZPA 2BVAA 5AP5A 1YHVA 2BDFA 2WNTA 2OJJA 4H1MA 5F4NA 5DR9A 2OFUA 4CXAA 4JNWA 1A9UA 1ZYLA 3HYHA 4KKEA 2IJMA 2JITA 5IG1A 2XK7A 5LXMA 3F3ZA 4RVMA 5M06A 5HNBA 2B9HA 2GS2A 5CAUA 2ZDTA 5A3XA 3RNIA 4QMTA 4F65A 4HVSA 3ANRA 4MCVA 4LUDA 4ANOA 4QNAA 5J87A 5KE0A 4O4EA 5LWMA 4BDAA 2GHLA 3Q2JA 4FSQA 5CEPA 3LMIA 1KV2A 3AT3A 3JPVA 1U54B 3BI6A 1WBTA 4GCJA 3MJ1A 5GNKA 1R3CA 3PZHA 2UZBA 3F3UA 3RK5A 3ZZEA 4DEBA 4EOMA 1U54A 4UALA 1ZLTA 3NNXA 4PL5A 4FODA 4GL9A 1JNKA 1Q8ZA 5ETFA 5AR2A 5FP5A 4L6QA 1LPUA 2JD5A 5DG5A 4BC6A 3E3BX 4FL3A 2R3NA 2Y0AA 4GYIA 2UUEA 4CRLA 5JQ8A 4O7ZA 3HMOA 3CPCA 3E93A 4ZS0A 2X8DA 3UOHA 4CLIA 2J0LA 3UO5A 4G5PA 1Y6AA 2ITZA 3AMAA 4HVGA 1KE8A 3RHXA 4L3JA 1XH8A 4I94A 3R00A 2B55A 4FT0A 3AMYA 4X0MA 3V5WA 5AUTA 5HIDA 3P9JA 3NIZA 3LQ5A 5HLPA 3OCTA 4KD1A 2BKZA 4B4LA 4E5BA 1H01A 1PMVA 4J8NA 3SOAA 4B99A 5JN2A 3WI6A 3OW4A 1RE8A 3C51A 3EL8A 4YHFA 2BPMA 4D4SA 3C5IA 2C6KA 4FIFA 4L53A 4UMUA 4AE6A 2XS0A 3TJDA 3WE4A 4G6LA 5CY3A 4BBEA 4MD8E 4XV1A 5DIAA 1UU8A 4YC6A 1E9HA 3QCYA 4U0IA 4L67A 1OL6A 3MTFA 3UIXA 4DFBA 3EOCA 4IIRA 2BHHA 2ZDUA 2R0IA 4EK5A 4YU2A 3CGFA 5CZHA 4JDJA 4YJOA 3VS4A 3NW7A 5IH4A 2A98A 2ITNA 3AD6A 4AG8A 4RGJA 3ET7A 4CCUA 3FZTA 3F66A 3MH0A 3MY5A 5EW8A 3VBTA 1AQ1A 3HA6A 3G6GA 4NK9A 2QHNA 3PG3A 2Y6MA 5HE2A 3TNWA 3FKLA 3QWJA 2XIRA 3R21A 3EN9A 2C6EA 1TZDA 4CZYB 3BYSA 1WBVA 5DT4A 3CIKA 3NWWA 3NVMB 3F3WA 2OH4A 5AJQA 4K1BA 2NO3A 4XUFA 2WO6A 5GHVA 1B38A 5F94A 1DM2A 3COHA 2YJRA 4FIIA 3R1SA 2B9JA 4BGGA 2GNIA 3OCBA 3KF7A 3OZ6A 4O0TA 4FKRA 2YAAA 4HZRA 4KIN