2XIKA

Structure of human ysk1 (yeast sps1-ste20-related kinase 1)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
290
structure length
288
Chain Sequence
b'HLRGFANQHSRVDPEELFTKLDRIGKGSFGEVYKGIDNHTKEVVAIKIIDLEEAEEIEDIQQEITVLSQCDSPYITRYFGSYLKSTKLWIIMEYLGGGSALDLLKPGPLEETYIATILREILKGLDYLHSERKIHRDIKAANVLLSEQGDVKLADFGVAGQLTDTQIKRNFVGTPFWMAPEVIKQSAYDFKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKNSPPTLEGQHSKPFKEFVEACLNKDPRFRPTAKELLKHKFITRYTKKTSFLTELIDRYKRWKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE PROTEIN KINASE 25
publication title Structure of Human Ysk1 (Yeast Sps1-Ste20-Related Kinase 1)
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 92
structure length 288
sequence length 290
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-06-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2xikA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xikA01
3CBLA 4MVFA 1NT2A 4ZTRA 2OXYA 4L52A 2WTDA 4TPTA 2YIRA 4BL1A 3VHEA 3QCQA 3GENA 2X8EA 4XRJA 3UO4A 3VUIA 3LQ3A 4GMYA 4K1BA 4E6DA 4BKZA 2PZYA 3V04A 2HZ0A 3FY2A 4ZSLA 2OGVA 1TQIA 3HV5A 3IQ7A 2Y6OA 2EXEA 2XYUA 5CEQA 4C4HA 2J0MB 3CXWA 4FTUA 3AXWA 4GSBA 1JLUE 3A7HA 4R3RA 5CVHA 4EHEA 3GC8A 4FV6A 4NT4A 3EN6A 3PFQA 3C4ZA 3BQCA 2ACXA 4GIIA 3QCYA 2G2IA 3P0MA 4PMSA 5ANIA 5I5ZA 2ONLA 2QOKA 3DBQA 3CC6A 3EWHA 3MJ2A 3UOLA 4BCGA 3E8CA 4MXXA 2Y8OA 1JPAA 2X7FA 4LV8A 1CM8A 4QPAA 4ERWA 2JBPA 4OW8A 4X3FC 3ZM9A 2P2IA 4DFXE 4LOQA 4MBJA 5AA9A 2UZBA 1WZYA 2G2HA 3SXFA 3G2FA 3MVLA 4QD6A 1YXXA 4QP4A 3CTJA 5A14A 4V01A 3R2YA 5EHLA 3DA6A 5CEKA 3PA5A 5J8IA 1UNHA 2YIWA 4QMTA 5DFPA 5IKWA 2C6DA 4M3QA 5GZAA 2WQEA 1H00A 3I60A 3EN7A 3UG1A 4C4EA 4NKSA 4K0YA 3IS5A 3VW6A 2R4BA 3JPVA 2ZB1A 5H8GA 5DT3A 4UWCA 4IWPA 3LFDA 4HZSA 3II5A 3NS9A 3BLHA 4C4JA 1PXPA 4B7TA 3E62A 5EM8A 1A06A 4RVKA 3TV4A 3LLAA 3F3ZA 1KWPA 5F20A 3CY3A 3AD4A 4AT3A 4K11A 3RZBA 5M57A 4O7ZA 1WVYA 4I20A 3WYYA 3DKFA 5IZFA 1IAJA 4QMVA 3R30A 5HO6A 3KXZA 2UW5A 3PY1A 3LJ0A 4FTNA 3CE3A 2QOHA 4CV9A 4GK3A 4G3EA 4CTBA 5CVFA 3FHRA 3E5AA 3R9RA 2BMCA 4ENYA 4JT3A 4WHZA 1XH5A 1SYKA 3ZXTA 4BKJA 5ETFA 3VN9A 2FA2A 3ZU7A 3VS0A 1G3NA 5GHVA 4D5KA 4UB7A 3SG9A 4YO4A 5HCXA 2WMBA 2WIHA 2OJ9A 1W8CA 4GJ3A 5I9VA 1WBSA 1V0BA 4QO9A 3GC7A 4ZSAA 4AZFA 5IA1A 3ZRMA 2CKQA 1PKGA 1YXVA 4AW1A 3OP5A 4LRMA 4RIYA 2YN8A 5HIEA 4S2ZA 1OBDA 4GKHA 5HEZA 3LFBA 1NVRA 1L3RE 2PZPA 3ODYX 4M8TA 2C0TA 4NTSA 2XCKA 3FKOA 5CAOA 4FODA 3LIJA 2XKFA 2ETMA 4CKIA 2F57A 4DEIA 4GRBA 4DTKA 3QFVA 4H05A 4Y85A 4X0MA 5A3XA 3EYHA 4F65A 1R0EA 3AC3A 1OIQA 1LR4A 1WBTA 2F7ZE 2REIA 3FPMA 3L1SA 5CSXA 4PRJA 2WMSA 2E9VA 2W1IA 5HO7A 2PUIA 1ZYJA 3DK3A 2XIYA 4APPA 3P08A 3DBCA 3OWPA 5A46A 1UA2A 2ETKA 2W5BA 2YAAA 3TZMA 5HU3A 4O7NA 4CFWA 5CEOA 4F7SA 4M97A 3RP9A 1OL5A 2Z7LA 4ZSJA 4APCA 1HOWA 4USFA 4A9TA 2FSLX 3ATTA 5LVNA 3KL8A 4BDAA 1H25A 2B54A 2ZMCA 3DLSA 3DXNA 3QZFA 4FZ6A 5F94A 3V3VA 5LVOA 3KXNA 4RGJA 3LHJA 3ZSIA 3JS2A 3DBDA 2OJJA 4EHGA 3GBZA 1R3CA 4NU1A 4U3YA 5BVWA 5TKDA 3P7CA 4ZZMA 4DG2E 4E93A 4PY1A 1NXKA 3BWJA 5KMLA 2WTJA 4F9BA 3ZEWA 3AT2A 1Q5KA 3QCXA 1YOMA 2XK4A 2WOTA 3K54A 3PVBA 4M12A 3UODA 4BCNA 5CASA 2LGCA 4NUSA 2CLQA 4CCBA 3FI8A 3OWKA 3QU0A 3GUBA 2XKEA 4M84A 4OAVB 4FKTA 5K5XA 4UYAA 4X3FA 3QX2A 1GJOA 3G15A 3OUKA 3D5XA 2PPQA 4ITJA 2VTNA 4LGGA 3ANQA 4R7IA 3LFEA 3DJ6A 5LMAA 3BPRA 3V51A 1YWRA 1UKIA 4IZAA 1MRUA 2ERKA 3PXKA 2CKEA 4FTRA 5M07A 4GYIA 2XNPA 3OY1A 4Z9LA 1JKSA 4GUEA 3KCKA 3SRVA 2B53A 5T68A 2JITA 3D7TA 3OOGA 4C36A 1OL2A 5AP0A 3FLSA 5TT7A 2WU7A 5HIDA 4IAAA 1PXNA 4I5HA 2ITUA 3DDQA 4L6QA 5I3RA 3G6GA 1CMKE 3LQ8A 4J7BA 2VTOA 4ZLZA 4HCUA 2YJSA 3BGQA 4MHAA 3CLYA 1ZXEA 3AC5A 4W4WA 5BVKA 4AOJA 2XIKA 4NWMA 3PJCA 2VV9A 3KULB 2B9IA 5GZ9A 4EH3A 5L8LA 3R00A 4DCAA 5A54A 3RALA 2J90A 2R5TA 4CZUA 3QA8A 1M2PA 2RL5A 3IW4A 3PJ1A 5AAFA 3NIZA 4HGLA 5HVYA 4DH8A 3Q4TA 4DH3A 2XS0A 1MUOA 1ZZ2A 5IH5A 4KIPA 2VX0A 2RIOA 2JIUA 3R63A 4H58A 2HENA 4I21A 3MIYA 4OTQA 3FMLA 4TY1A 2VX3A 1KOBA 4C4IA 5GIPE 4YSMA 3ZTXA 5M53A 4IFGA 2W5AA 3M2WA 5JZJA 4G16A 2R9SA 4FG7A 3LMGA 4W9WA 1DM2A 1KV2A 4A9SA 3F69A 4IVAA 4RFYA 3NUNA 1WBNA 4NTTA 2WFYA 5BNJA 1F3MC 4I4FA 1OPKA 4MNFA 5C9CA 4MYGA 1YHSA 3CPCA 5BVFA 3COHA 3D2IA 1KE9A 2ITZA 2R3MA 1OVEA 2WQMA 4USDA 3TNPC 4TWOA 3PSCA 3CY2A 3GT8A 5B0XA 3V5WA 3VS4A 3PJ8A 4D0WA 3KMMA 4O38A 2WHBA 2FO0A 5G1XA 4EORA 3FYKX 4GG5A 4IAZA 1ZOGA 3LFFA 3O7LB 3TJDA 2OZAA 2IVUA 4BHNA 3LJ2A 5HE3A 4HOKA 4U44A 2F9GA 3U4UA 4XBUA 4AE9A 4CMOA 4EKKA 3FC2A 1W0XC 4FE2A 2XK3A 2QVSE 1PXKA 4RC3A 3PVWA 3ORNA 2ITYA 4ACMA 4GUBA 2VNYA 5CAUA 3QTQA 1OPLA 5FD2A 3COKA 5AWMA 3VUGA 2JDTA 2X8DA 3R6XA 4IJPA 3VJNA 5A4CA 3L8XA 5M09A 2C1BA 4DT8A 5AR4A 4IAKA 3R7EA 3OTVA 5E4HA 4QP6A 4IX6A 1E1VA 2QI8A 5CNOA 5DIAA 3FLWA 5CI6A 3UO5A 3QUEA 2WMWA 3AT3A 3CGFA 4L67A 4ZS0A 4O0SA 4QMMA 4EK8A 5KO1A 5H9BA 3CTHA 5IPJA 2Z7QA 4X6RA 1PMNA 3WIGA 3HKOA 4HYHA 3MIAA 3P79A 4OTHA 2VWBA 1OUYA 4FSTA 4QT1A 4N70A 4QPMA 5J95A 3GCUA 2BRHA 1W83A 4K77A 3E87A 4WNMA 4L53A 3ZM4A 4FKPA 3RMFA 1Q8YA 5GIOE 3ZUTA 4ZZNA 4WG4A 1H1SA 3HECA 4FNZA 3ETAA 2ZDTA 1KV1A 1OB3A 3F82A 3LCKA 1H27A 1XH6A 4FZ7A 5CSPA 1UU3A 3TL8A 3PLSA 3F2NA 4G6NA 3D83A 3TN8A 3TNWA 3F61A 3R1QA 2XBAA 4KRCA 3W2OA 4AT4A 5JFSA 1SNXA 4UXLA 4FTJA 2XZSA 3MFUA 1PXJA 4GKIA 4EYJA 2CGXA 4ANBA 4FKGA 4FTIA 2IG7A 3Q6WA 1XBCA 3FSKA 3LZBA 5CXHA 5E8VA 3UVQA 3U6IA 2VO6A 2R3HA 4DH1A 2YZLA 4ZK5A 1PJKA 2HW6A 5KMIA 1WBOA 2ZOQA 4EYMA 4U45A 2CSNA 4LMNA 5AUZA 4DLIA 1M52A 4I0RA 3Q60A 1OM1A 4BB4A 4D4SA 4HVIA 4HVHA 3OT3A 3U8WA 4UV0A 3QQJA 4UWBA 3FYJX 3H3CA 5L6OA 3RKBA 3MPAA 5D41A 3SW4A 1SMHA 1XBBA 5E8YA 5FXRA 2UZOA 1R1WA 4AF3A 3MB6A 1UNLA 3WF5A 5C8NA 4D1XA 2BR1A 3TKHA 3VS2A 2F4JA 4FTAA 4Y8DA 4O83A 2WTWA 2XK7A 4O2PA 5HLWA 3KU2A 2XK9A 3JYAA 2BROA 5ANJA 3UDBA 4CYIA 5F95A 1ZY4A 3R9HA 5CXZA 4FZAB 4YLLA 4DFBA 3FKLA 3O23A 4GK4A 4XV2A 5A4LA 1LP4A 4EL9A 4C35A 5KKRB 4MXYA 3D2KA 3C4WA 5AUYA 3NW5A 2Y6MA 3PVGA 3BX5A 3ANRA 3A8WA 4OBPA 5CU2A 4CFVA 4KBKA 2W9FB 1FMOE 5TF9A 3RCJA 4NCTC 2XBJA 4RWLA 3RI1A 5ETIA 4TZRA 5HHWA 1R0PA 1WBPA 2B9FA 3HV3A 5HKMA 5B2LA 2XNBA 2XNMA 4WBOA 3OY3A 3F3TA 5ANGA 3AOXA 5E8SA 4XHKB 4LRKA 4PDSA 1ZOHA 1JNKA 5EYDA 4MF0A 2PVKA 3LCTA 3MFTA 4IM2A 4PMPA 4PNKA 4IVDA 4M7IA 2JKOA 4ZTMA 1OKYA 2QO7A 3AD5A 4FTQA 3QD0A 4FEQA 3PRFA 3FEGA 1V0OA 3C4EA 3FXXA 4AAAA 4AE6A 4D2SA 5IA0A 4AA4A 4QQJA 2ITTA 4FKSA 5T3QA 4S34A 3DKGA 3PIXA 4E4XA 3QKLA 2C5VA 1QPDA 4DEBA 3ERKA 5C27A 4B6LA 4J98A 1JSVA 4IMYA 2GQRA 3CD8A 3BELA 2VTIA 2G2FA 2HYYA 4H39A 4CFMA 3VUHA 1OL7A 1K9AA 5HCZA 2C1AA 2XF0A 2OLCA 2GMXA 3QKMA 4I1ZA 5E8UA 1WMKA 3ZCLA 3BQRA 4BBEA 2HIWA 5I0BA 1OI9A 1OIUA 2J0KA 4RWKA 4EQMA 3D0EA 1ZY5A 4XX9A 1PYXA 4K6ZA 2PL0A 1ZYDA 4QTBA 5CTPA 3I4BA 1VYZA 3IO7A 4IEBA 2QO9A 4AA0A 4WSYA 3CR0A 1YWNA 5CAPA 3EFKA 4FSQA 5D11A 4W4YA 3EFJA 4GU6A 4C3RA 4E6AA 1GIJA 3MH3A 4RG0A 2JAVA 3KA0A 5LVLA 5IEYA 4PNIA 4F7LA 3PXRA 2GPHA 4FMQA 4N6YA 4RC4A 4DINA 4FVQA 2JDOA 3V6RA 1H1RA 2FB8A 4RLLA 5GJDA 3RAWA 4AGCA 4F70A 2W96B 5AEPA 5I3OA 4MXOA 1W84A 1XKKA 1B39A 2WMXA 1GZOA 5CY3A 1OIRA 4AOIA 3QXOA 2EWAA 5AV2A 3ZSHA 4MKCA 4DN5A 3VBXA 3E8EA 4FK6A 3KN6A 4I4EA 4ZOGA 4X2KA 5M4UA 3DFCB 2NPQA 4F0IA 3BU6A 2PVRA 3FXWA 4MBLA 5J7HA 3Q96A 3BYUA 4GEOA 4O21A 5DR9A 3TJCA 5D1JA 1XH7A 5CEPA 3FSFA 1UKHA 3SV0A 3D7ZA 2BRGA 1HCLA 5EW8A 3G9LX 3BHHA 4UMQA 4NH1A 5JQ8A 3MTLA 5AM7A 4IX4A 4ZXTA 4ALUA 4FNXA 5HBJA 5IMXA 5M4IA 4FR4A 2O63A 1PW2A 3DKOA 4KBCA 4FTLA 5FXQA 2R7BA 5L2WA 4G3CA 4TWPA 4ANNA 2VO0A 3WF8A 3BWFA 4AGUA 2OG8A 4UN0C 1H0VA 1YWVA 1H0WA 4V05A 4IX5A 2FYSA 4FT5A 4BWPA 1WBWA 3T3UA 1ERKA 2YM3A 5LVPA 2XUUA 3MDYA 4RQKA 5HD4A 4FIHA 3S2PA 2HW7A 4FUYA 4BTJA 2B7AA 3UYSA 4BCIA 3TACA 2YIYA 4XP0A 4YGAA 2GNJA 3LCOA 4CZTA 2IW6A 2QD9A 1STCE 3FLZA 5HESA 2BZJA 4FV8A 2UUEA 2UW8A 2VWUA 2C6TA 4L9IA 5FM3A 5C8MA 1Q4LA 3FMNA 2J0JA 3Q6UA 4FIIA 4KS8A 2J5FA 5DEYA 3TNHA 4YC3A 4BBMA 4EKLA 5FBNC 3RNYA 4GH2A 1YRPA 4EH4A 5JQ5A 1ZOEA 4WSQA 1NVSA 3TKIA 4U79A 4CSVA 3VVHA 3QAME 4TNDA 4LG4A 5ETCA 5AUUA 4J1RA 5CT7A 4FG9A 3IOKA 4NCTA 4O86A 2WTCA 4RPVA 4O27B 4YJNA 1Q8ZA 3EQHA 1X8BA 1Q24A 2QOFA 3TV7A 4NIFB 5HBHA 5AR8A 4L44A 2GNHA 5HQ0A 4MEDA 2RFDA 1PHKA 1Q8UA 2YCRA 3FL4A 4FIJA 4RIXA 5AV3A 2ZAZA 1Z9XA 2X8IA 4M0YA 3EZVA 4PMTA 4ONAA 1YOJA 5AADA 3RAHA 2I40A 3TZ9A 1ZARA 4NJDA 1M2QA 3WF9A 5BVNA 4B0GA 5HLNA 5DR6A 3UC3A 2UVXA 5BYYA 4DTAA 4PDPA 1BUHA 1IRKA 4YC6A 4QMNA 3GU8A 3S95A 5M56A 2F2UA 2IZRA 3BV3A 3C50A 2W1ZA 3E3BX 3SQQA 4IQ6A 5CZIA 3OCBA 4WUNA 3QZGA 4OTIA 3W2RA 1QPJA 1TKIA 3NCZA 3QTZA 4A4XA 4CKRA 4O7TA 2A2AA 4BTKA 4BWXA 4F6WA 5BMMA 5ANEA 5HBEA 3L9LA 4QYGA 2OK1A 3ORTA 4RJ5A 1GNGA 3VUDA 2J6MA 2W7XA 4EOIA 5E8ZA 4ZTQA 3LM0A 4M0ZA 2CGVA 3A7JA 3GFEA 1OBGA 2ZV8A 4FV1A 4FKVA 4Y95A 3ZUUA 2OO8X 3K2LA 4FL3A 2XA4A 1XJDA 4G5JA 5E91A 3ZO3A 1JWHA 4QMUA 4DGMA 5KMOA 1L8TA 4W9XA 1DI9A 2JC6A 3OVVA 4JOAA 3E64A 4ACHA 4AW5A 4AXAA 4ERKA 1J1CA 5D7AA 4YJVA 3CS9A 3EQGA 4TT7A 5J7BA 5HTCA 4ZLOA 3C4XA 1GZ8A 4FNYA 2PSQA 4J71A 3FQHA 3ULIA 5HNBA 1O6LA 3IKAA 4KS7A 3GU6A 4QMZA 4X2GA 3ATSA 3QC9A 2IPXA 5E90A 3E8NA 4ORKA 3H10A 4O0XA 4KABA 4BGGA 4XG2A 4TWCA 3QTRA 4CRLA 5CF5A 5AFVA 3OT8A 4BCJA 4QQ5A 3HMPA 4EHVA 3FUPA 4FL2A 1GIHA 3V5QA 3CSVA 2QHNA 3HA8A 4P5QA 4BCMA 4TN6A 4K33A 3KEXA 3R71A 4M69B 3DTWA 5EI6A 4FKIA 5CF4A 5E7RA 3V5JA 1H4LA 2X1NA 4WNPA 4JG6A 5L8JA 2R3PA 2YIXA 3OC1A 3T9IA 5IEXA 1PYEA 4A9UA 4CFXA 4EUTA 4L45A 4DFYA 1AQ1A 3FI4A 5AA8A 4O7SA 1W82A 4RBLA 4GU9A 3D9VA 5BPYA 3P7BA 4IWQA 4LFIA 4GJ2A 4YTIA 4QMPA 3OD6X 2SRCA 4JDIA 4WNKA 5DRDA 3I5ZA 4JVGA 4HNFA 5A9UA 3W33A 4XYFA 2OJGA 4C8BA 1QPEA 3MSSA 4O7RA 1U4DA 4CQGA 3Q32A 2Z8CA 1YXUA 5CU4A 5K3YA 4DC2A 4O22A 4FGRA 4M68A 4BY9E 1YI3A 4FV3A 3QTWA 2WNTA 5AR2A 5DT0A 3KN5A 5H8BA 4C3PA 1GOLA 4DA5A 4L8MA 3DPKA 4KA3A 3IK3A 4QP3A 3MH2A 3RAIA 4ANQA 3TTJA 1FGKA 4DYMA 4L00A 3ENHA 3TT0A 4DG0E 5M4FA 5IQEA 3GQLA 4DCEA 2VO3A 1PY5A 3BE9A 4XLIA 4FC0A 3O96A 4ZSEA 3VWAA 5ANKA 3W8QA 1J7IA 3F3VA 4W4XA 1J1BA 3MY0A 3QRTA 1VYWA 3Q4ZA 1S9IA 4XG3A 2B4SB 3BEAA 2BHHA 4USEA 4E3CA 2X9EA 3R1YA 3IGGA 2P2HA 4ZEGA 4FV2A 3BRBA 4RVLA 3QRJA 5HZNA 3Q4UA 1IG1A 3ACKA 5CF8A 2XNOA 1H24A 2BALA 3AGLA 2EUFB 3OBJA 4PDOA 4N57A 4CNHA 1SZMA 3AC2A 4BZDA 2UZUE 4WKQA 3FXZA 4LGDA 3W2PA 5AP2A 1ZYSA 5AP1A 4WRSA 3AC1A 3K5UA 3LJ1A 4BICA 5BMSA 5L4QA 3MH0A 3H0ZA 4OBOA 4FIGA 4AU8A 2CLXA 2IWIA 4D0XA 1H01A 2H6DA 2RGPA 3LVPA 4GL9A 2VTLA 4XNEA 4PPAA 3W32A 4BDDA 3LAUA 5EI8A 2O5KA 4C58A 2C68A 1YW2A 2PVFA 3PPZA 4TYHA 2OF2A 3A60A 3BYMA 2ITXA 3TUCA 5FLFA 4IB5A 3UJGA 1NY3A 5JGAA 2V7OA 1M7NA 3NZ0A 4NM5A 4G5PA 5J87A 2OSCA 3DQXA 3PG1A 4B9DA 1W98A 2GQSA 3H30A 5AX3A 4JRVA 4J99A 4PUZA 3F5UA 3F7ZA 4I92A 4AFJA 2W0JA 4DLJA 3OZ6A 4YMJA 4BDGA 1LEWA 4Y46A 1ZMUA 3NEWA 4F1OA 4YJSA 3TWJA 4ZMFA 3ORZA 2G15A 2VD5A 3R02A 4MTAA 3QTIA 1BLXA 4ACDA 5KHWA 2ZV7A 3QBNA 2HAKA 1DS5A 4E5WA 3DZOA 2C6EA 4OTFA 4TRLA 4KWPA 4MAOA 3NVKI 3LXLA 3KK9A 4EK3A 2DUVA 3R22A 2IZTA 5IA2A 3FV8A 1K2PA 1OMWA 4YPSA 3CD3A 4JG8A 3WZJA 3HGKA 3GU4A 2I6LA 5GJGA 4RJ8A 2F7XE 2VX1A 3PJ3A 2X6EA 3KK8A 5CEMA 3LMIA 4DTBA 2KTYA 4BYJA 5KMKA 3KVWA 3Q3BA 4XUFA 5EFQA 4E6CA 1AD5A 5M06A 4I6FA 3F3UA 4F6UA 4GT3A 4YR8A 1MRVA 4WUAA 3P5KA 5JFVA 3HYHA 3Q52A 4PTEA 5LXMA 4OAUC 3F6XA 5FQDC 1GAGA 2HZ4A 4LM5A 2PVNA 2XK8A 4IVCA 5HE2A 2BTRA 2XCHA 4H1MA 1YHWA 2YJRA 5J9YA 3QTUA 3I5NA 3PZEA 2PZ5A 4JRNA 3ZMMA 2W1GA 1APME 3CPBA 3PSDA 2BDFA 2X39A 2XP2A 3HL7A 2QHMA 2QR8A 3ZBFA 5FDPA 4AN2A 4ZLYA 4H36A 3UQFA 3BU3A 5KUPA 4D4VA 3LFNA 4AN3A 4BDBA 5CU6A 3PIYA 3ZS5A 3VQUA 3C51A 1XH9A 3PE2A 2VTAA 4FT3A 4JDJA 2AUHA 3D7TB 4CFUA 3KF4A 3ZXZA 3SHEA 1UV5A 3GU7A 3HV6A 4A4LA 4E4MA 1JQHA 4NW6A 3GNIB 2IO6A 3DU8A 4EC9A 2JKMA 5IUGA 4HYSA 1KE7A 2VTJA 1TQPA 3AGMA 3PYYA 4I6BA 4W8EA 4KIOA 4B4LA 2XRUA 3NX8A 5K0KA 2UV2A 5KMJA 4L3JA 3HUBA 2YISA 2PE0A 2XH5A 3HA6A 3QWJA 1CDKA 4YLKA 3FQEA 4RJ6A 5J1WA 1BX6A 1WAKA 3GOPA 1XO2B 3FMJA 4FZDB 5CU0A 3ZHPC 5AV0A 3R8ZA 4PX6A 2PVHA 3DK6A 2PK9A 4QNAA 3CJGA 3QLFA 4ZTNA 5E1SA 3TIZA 4C2VA 3FLQA 4FTKA 3U4WA 5DMZA 5IA4A 5I4NA 2ZM3A 4BDFA 5FUTA 4ITIA 3UZPA 4WIHA 3S0OA 3CQUA 4JDKA 4EOLA 2C3JA 2QOBA 3OWJA 4S32A 1BMKA 3ZDUA 4CD0A 2PMNX 3MV5A 3VIDA 5EDPA 4EOOA 2HXLA 4O0WA 3ROYA 1LUFA 4HVSA 4RVTA 4EOQA 4FKQA 2PZRA 3IGOA 4FSZA 3FZSA 2BVAA 3JR1A 4FG8A 4O81A 2Z60A 3FMKA 3NYNA 4F0GA 4O1PA 5D10A 4O96A 3QQUA 4PV0A 1PMUA 3EN4A 2QNJA 3E88A 4I6QA 1RJBA 3W16A 4QMSA 4CYJA 2C0IA 2P4IA 4DH5A 3IW5A 5HD7A 3DOGA 3EB0A 4QP8A 5LMBA 3U9NA 3BYOA 2VNWA 5FTQA 5F9EA 4R7BA 1OPJA 1Y91A 3PE1A 5EOBA 5HG9A 3MB7A 5HICA 2YAKA 3R9OA 4EH6A 2R3QA 3REPA 2BRBA 3L9PA 4CCUA 3QA0A 2CNVA 4ASDA 4K8AA 4QTDA 1F0QA 4U7ZA 5DEWA 4PDYA 3KQ7A 4G3GA 4WG5A 3NGAA 4G6OA 4LRJA 3UO6A 2C5YA 2ZV2A 2X81A 2B9JA 3E93A 3DB8A 4F64A 3QC4A 4BCKA 3BCEA 4Q2AA 4P4CA 2R3OA 4CT2A 5E8WA 3IW7A 5JT2A 3TXOA 4FA2A 5BVDA 2OIQA 5CAVA 4C57A 4CRSA 2H9VA 1F5QA 5CU3A 3ZO4A 4MNEA 3R7YA 3R2BA 3FMHA 3NYOA 2IW9A 3GP0A 1M17A 3QWKA 3VUMA 5CSWA 4F7JA 4YLJA 3RVGA 4PTGA 4HVGA 4YU2A 5CANA 2XNEA 3B8QA 5KX8A 4Q5EA 3D5VA 1BI7A 3F3WA 3LFQA 3EL8A 3O17A 3KFAA 5HNGA 3C9WA 5KBRA 3R83A 2FSMX 4TYGA 3N4UA 2ESMA 1G8SA 2BRNA 2WMUA 3FMMA 4JXFA 3WARA 1M2RA 2XIZA 3LFAA 2X7OA 3GQIA 4HYIA 4FTCA 4X2FA 2O65A 3I6UA 5DBXA 1ZRZA 4CT1A 3QKKA 4FT7A 4AACA 3QQFA 5HIBA 3VUKA 2C47A 3ORIA 5CEIA 4NEUA 4QP9A 3RK9A 2W1HA 4B8LA 1G5SA 3U51A 3FZ1A 3KY2A 4W4VA 3RAKA 5KHXA 1R78A 1PF8A 3I0QA 2XYNA 1KE8A 5D7VA 4M66A 1RDQE 4IWOA 3I0OA 5HG7A 3O0GA 2WQOA 3G0FA 2OIDA 1FVVA 3DDPA 5DPVA 1QMZA 2OFVA 2FSOX 4FSWA 4N4SA 4KBAA 3B2TA 4G3FA 4OUCA 2VUWA 4H3QA 4FV7A 1KE6A 3GI3A 4Q5HA 5JEBA 4A7CA 1PRYA 2XJ1A 2V55A 5T6KA 2I0HA 4U40A 3VF9A 4AN9A 4DAWA 5TE0A 4PF4A 2Q83A 4FF8A 3TIYA 2C6IA 3NIEA 3UP2A 2GDOA 2C3KA 4YHJA 3KREA 3DJ5A 4JJRA 5AIKA 4AZEA 3WZKA 2PVJA 1H08A 3PXYA 2GS7A 4YZMA 3UVRA 3A61A 3WZEA 4F08A 3MH1A 3QYWA 4RMZA 4E6QA 1UVRA 3ZUVA 3SLSA 2XMYA 1KOAA 3KMWA 5C1QB 3WE8A 1GZNA 4CLIA 4DBNA 3FZTA 3QQLA 2JAMA 5IQFA 5L3AA 4R77A 2CPKE 2DS1A 4YJRA 2X2MA 4NW5A 5KKRC 4C59A 3N4TA 4LV5A 4JAIA 4UYNA 3LCDA 4F6SA 2XKDA 2J4ZA 4R3PA 1SVHA 2EXCX 3RJCA 2ERZE 4YP8A 5HTIA 4FTMA 3VBVA 3ET7A 4RFZA 3LCSA 4TWNA 1YDSE 4EZ7A 5AP7A 2ITOA 3VAPA 4C62A 4DE4A 3FE3A 5CX9A 1U59A 5M51A 4QYHA 1IA9A 1OITA 2X2KA 4I24A 3C0IA 4Y5HA 4AW0A 3JY9A 5HTBA 4XRLA 3PXZA 4U43A 4TYEA 4XV9A 3VRZA 4DGGA 2BZKB 2YFXA 2W1DA 3BHTA 2RKUA 3K5VA 3UE4A 1LEZA 4X21A 5E92A 4BTMA 4BDCA 1VR2A 4TNBA 1XQZA 4BKYA 3Q9YA 2XJ0A 2X7GA 3CKXA 4J96A 1Y8YA 1P14A 3HP5A 4BDKA 4PL3A 2AC5A 2W99B 4U41A 2JFLA 4GYGA 3W55A 3HDNA 4RQVA 4Z7GA 2B0QA 3F5GA 3GCPA 2GQGA 3DAKA 3IDPA 3PA4A 3MJ1A 5EYKA 3QQHA 4NZWB 2VWWA 4XP3A 5EHYA 3EFWA 1KE5A 3HMNA 4O0VA 5AAEA 5IDPA 3OG7A 3LPBA 3Q9ZA 4Q9SA 5CI7A 3SOAA 1OKZA 4R6VA 3FBVA 4JS8A 4DEGA 2J51A 2ITWA 4MQ1A 2W1EA 4FV0A 4V0GB 4FVPA 1G8AA 2LAVA 2JFMA 4AZSA 5HVKA 4FEXA 4FIFA 4D9UA 1P4FA 3DBEA 4K18A 4A9YA 3KRXA 2QONA 3D4QA 3OXZA 4R7HA 4EQUA 4HW7A 2V7AA 2YIQA 3I7CA 3RPOA 4AUAA 1U54B 4G6LA 4MD7E 3U9CA 3LKMA 2C5XA 4ITHA 3LM5A 2R3RA 3L8SA 3LQ5A 5FG8A 5CYIA 4ASZA 2EB3A 3E92A 3VUTA 4D28A 3EQPA 4FKRA 2VWVA 1URCA 3ALNA 3LE6A 4X2NA 2W06A 3ITZA 2C30A 2Q0BA 1B38A 4L01A 5C4KA 4I41A 2WO6A 3DV3A 3JVRA 4ZAUA 5IQIA 4A4OA 1J7LA 5DGZA 5IISA 3O7LD 3NWWA 4CMTA 5KBQA 2PUPA 2WEVA 5C4LA 5CF6A 2GHGA 3OW4A 1OGUA 4LL0A 2V22A 4U42A 3BGZA 2PVLA 2I0VA 2R3LA 3VBQA 4DGNA 3ACJA 1VEBA 3ODZX 4FTOA 4YJOA 3SXSA 4ZIMA 4QQTA 4D2WA 4RIWA 3EIDA 3UOJA 1UU9A 1Q97A 1J7UA 4XLVA 1P4OA 4BDEA 3UMXA 4NFMA 4E4LA 4UWYA 5HO8A 4EK5A 3ID6C 3ZRLA 2J0IA 1VJYA 3A8XA 2YABA 4YO6A 3OTUA 1XH4A 2VN9A 3MN3A 3A7GA 3V5LA 3O8UA 4JNWA 5EQPA 3FHIA 4GCJA 3NNUA 5AUWA 3QGYA 2B9HA 1XHAA 2X9FA 3V8WA 4TL0A 4GVAA 2YHVA 4M67A 3DXQA 5IQAA 1YDTE 3VO3A 4EWHA 4J8MA 1S9JA 3PJ2A 2P3GX 3GOKA 3SXRA 4AZVA 3QD3A 4FT9A 4O7LA 4ALVA 3ZYAA 3QTXA 2BPMA 3JUHA 3RHKA 4R78A 2XEYA 5IUHA 4ZSGA 2JDRA 4JBOA 2YDIA 1OIYA 5DT4A 3R8MA 5JGBA 5IUIA 4CZYB 5AP5A 5HG8A 2F49A 3UC4A 2I1MA 3NVMB 4DGOA 4FT0A 2W1FA 1PMVA 2BDJA 4NJ3A 4FNWA 4O0RA 4TXCA 2WMRA 4CEGA 4RRVA 3RHXA 2R64A 3BYSA 3N9XA 4LYNA 4I0SA 3TUBA 3HUCA 3QL8A 4XG6A 3TZ7A 3MA6A 4G1WA 2VAGA 2BCJA 1REJA 4I6HA 4O2ZA 4ANMA 4BHZA 4GW8A 2BRMA 4IC7A 2XVDA 2FSTX 2OXDA 3O71A 3EN9A 3PVUA 5ANDA 1WVWA 3E3PA 3PXFA 4D2VA 3ZZWA 4J8NA 4E5BA 3OS3A 4U9AA 4L7FA 5AV1A 5DOSA 5F1ZA 5EKOA 1KSWA 4G3DA 4PP9A 3SX9A 3LMHA 4YUQA 2VWZA 4TYJA 3POZA 5HX6A 3R8UA 3VS5A 2DYLA 4N6ZA 5DH3A 1YVJA 1HCKA 2WMAA 2E2BA 4PWNA 2XKCA 3EKKA 1FPUA 5LCJA 4N0SA 4BC6A 4C34A 4ZMEA 3EMGA 5EKNA 5IQDA 1Z5MA 2BAQA 2QOLA 2WELA 4U81A 4YC8A 2BFXA 2JEDA 4ZY5A 4D58A 5LOHA 4YNEA 5FTGA 2QOOA 4RZWA 3RWQA 5IU2A 3DJ7A 1H1QA 4B8MA 5AP6A 4EZ3A 2CN5A 2PUUA 2WXVA 3ZFYA 2FVDA 2R3KA 3FAAA 3VS6A 3ZLYA 5DLSA 2OW3A 4H3PA 4ZY6A 4K9YA 2BFYA 2GTNA 2ETRA 4O91A 4LL5A 2GHLA 3DT1A 4H3BA 2QU5A 1J3HA 2RF9A 3POOA 4BCFA 4BCQA 2QR7A 3A4PA 5A4TA 3MY1A 2E9UA 1PXLA 3HEGA 4M13A 3LXNA 3NW7A 2OICA 4YZBA 5A4QA 4JX7A 2WMVA 3IONA 3N51A 4DEAA 4WRGA 1SNUA 2YM4A 4H1JA 4KKGA 1UWJA 3PPKA 4JBVA 4AZTA 4CFNA 1E1XA 3RCDA 3KXGA 4YPDA 3R9DA 1OKVA 3QHRA 3W2CA 3OMVA 4JIAA 5AR7A 3F2AA 5HE1A 3UIMA 4ASEA 3VC4A 2CN8A 4JI9A 3HMOA 2W4OA 3JXWA 4BIEA 3E7VA 2YDJA 3JVSA 4BN1A 1J91A 3R0TA 1NA7A 3MFRA 4FOCA 2PY3A 3QQKA 4JR3A 4FK3A 5FXSA 4YZNA 5EDQA 4FEWA 1JSUA 4YJUA 4LQMA 4FI1A 3PLAE 4R5SA 5EH0A 2GNIA 3B8RA 4IZ5A 2BZIB 2BTSA 4NSTA 4RX8A 4EOKA 4LMUA 4R5YA 1QCFA 3ZEPA 3PZHA 5AV4A 3COIA 3R28A 5CZHA 3QF9A 3UPXA 2Z7SA 4O7VA 3C1XA 4UZDA 5HLPA 5C01A 4BIBA 2WTVA 5HCYA 5BUIA 1FGIA 2QQ7A 5IH4A 2UW0A 3C4FA 4LUEA 4J52A 4KIKA 3EKNA 2VO7A 3CIKA 4MH7A 2UZEA 3R7UA 3MESA 2FH9A 4RJ4A 4C33A 3W2QA 2DQ7X 3UZTA 4F1MA 5IG1A 5AJQA 2YM7A 2NRUA 3TI1A 4UMRA 5IQGA 3OWLA 1XH8A 3BEGA 4IACA 2CNUA 5HG5A 3S4QA 4FSUA 2Y4IB 4FEUA 2I0EA 3GC9A 2UZNA 1Q8TA 3PWYA 4RX7A 2WGJA 2B1PA 1OL1A 3DAJA 4HCTA 4DFZE 5I9XA 5A6NA 3ROCA 5CENA 3ZOSA 3QQGA 4ZJJA 4CKJA 4GG7A 3MY5A 5C26A 4FEVA 4NIFA 4OBQA 3NUUA 3ORMA 3A4OX 4RSSA 2C5OA 3PPJA 4S30A 3OXIA 2QOCA 2H34A 4GFGA 4I5CA 3FI2A 4CQEA 4S31A 3EQCA 2YM6A 3WI6A 4QTEA 3QX4A 4D2PA 2YACA 5JK3A 4I22A 1V1KA 2JGZA 2AC3A 4UXQA 5FBOA 3DAEA 3BLRA 3WBLA 4HPUE 3UNKA 3FZOA 2IN6A 5L2QA 5AIRA 4KIQA 1FINA 3SOCA 4NM3A 3PTGA 3FL5A 2UW4A 2YLEA 4IANA 4JAJA 3DTCA 2CGUA 4RFMA 3W18A 2R7IA 3EQFA 4AOTA 2HXQA 2YA9A 4FKJA 3Q2JA 2RFSA 3EZRA 4F9CA 5DN3A 2QG7A 2GCDA 2XIRA 3QLGA 1EH4A 2BAJA 3N4VA 3MVHA 5DYJA 3SG8A 4F9YA 2G1TA 4YJQA 2OZOA 2VTTA 5HE0A 3CCNA 4GK2A 4Z7HA 3MVJA 2QKWB 3TNIA 2YCFA 4FSMA 3IECA 2BDWA 3TUDA 3WZUA 4A07A 3VNTA 2IVSA 1URWA 5I9YA 3VS1A 2R3IA 3BZ3A 3ZLSA 3GVUA 4KUJA 2E9OA 4HPTE 4BR3A 5KZIA 3R8LA 4KAOA 1Y57A 3VJOA 3UIXA 5LJJA 4DF3A 1Q41A 3VQHA 1BL7A 2ITQA 3WF7A 4D1SA 3GU5A 4UBAA 2VGPA 3ULZA 2YLFA 4RLKA 4ZTLA 4BZOA 3VS7A 3IPHA 3JY0A 5BYLA 4BF2A 5H3QA 4IFCA 3RBWA 4NK9A 4AT5A 4EK4A 3SW7A 1OUKA 4G2FA 4XCUA 4MX9A 4DFNA 3C7QA 3NNXA 3R04A 4I5PA 5J9LA 4IH8A 3EOCA 3KMUA 2WTKB 4DEHA 4GT4A 3EYGA 2PU8A 5DHJA 1FMKA 3QZIA 1NW1A 2QURA 2NP8A 4JBQA 5AP3A 2QOIA 4D9TA 4DG3E 1ZLTA 3C13A 2W1CA 3UIUA 5IQCA 3WOWA 4NYEA 3R7IA 2WZJA 3F66A 4M69A 1ZYCA 2X0GA 3O2MA 4UALA 3RM6A 4RIYB 4DFLA 3NW6A 4FL1A 3PWDA 3F9NA 4BZNA 3GCSA 5BUEA 3Q9WA 2WTIA 2X4FA 3Q53A 4FV5A 2BIYA 5DI1A 5HORA 5FM2A 2JBOA 4EK6A 4PTCA 2OFUA 3SDJA 2QC6A 4BDHA 5LQFA 4O0YA 1TQMA 3SAYA 2FGIA 3OUNB 3SVVA 1I44A 3UBDA 2WMQA 2PYWA 2VU3A 3ZSGA 3PG3A 3UP7A 1Q3DA 2Z2WA 5F4NA 3BHVA 4LI5A 1IAHA 4JQEA 3WE4A 3V5PA 3A7FA 1FOTA 1JVPP 1U5RA 3NAXA 4HGSA 2ZM4A 3QZHA 3SKCA 2UW3A 4C3FA 2W17A 2BIKB 2RSVA 3DNEA 4YHFA 3BU5A 2IW8A 2OIBA 5JH6A 4ZS4A 1M14A 3NCGA 4FOBA 2W4JA 5D12A 3QD4A 3CP9A 4MD8E 4YJTA 2BZHB 4GFMA 3QXPA 4IX3A 4CVAA 3OBGA 2R0UA 1CKJA 1GY3A 2P33A 4CG8A 4U5JA 1YI4A 4RZVA 5IMEA 4O6LA 5KE0A 3RPSA 3Q4CA 3R73A 3P23A 2JIVA 4IBMA 4LOOA 5M55A 4FKOA 3RGFA 2VTQA 3GCVA 1O9UA 5AR5A 4BDJA 2A4LA 3DNDA 5HOAA 2UW9A 2GTMA 3OHTA 1Y6BA 3VBTA 2RFEA 4KNBA 2B55A 4E8AA 4ZTHA 3TZ8A 4FZFB 1T45A 4MD9E 2XK6A 4RA5A 4MCVA 4A9RA 5FTOA 4HYUA 4KRDA 4F9WA 1V0PA 2CHLA 4Q9ZA 5C03A 4X3FB 4FBXA 4X6QC 3ZO1A 4U6RA 3T8OA 3ZLWA 4LOPA 1ATPE 3RTPA 4JLCA 3KF7A 5AR3A 3WF6A 3IW8A 3TV6A 4DT9A 4XMOA 3H4JA 4AZWA 4UEUA 2I7QA 3F5PA 3GEQA 3QRUA 4O0TA 4EQCA 2WIPA 2O0UA 3UQCA 4X7QA 4IJ9A 4TW9A 4WD5A 1YOLA 3SRVB 3OCTA 4XH6A 2ZJWA 3K3IA 3UOHA 5HNIX 4O84A 5CSHA 3VULA 4RWJA 2OKRA 4GVJA 1JKKA 3R7GA 4KKEA 2XEZA 4BVUA 3UIBA 3DGKA 3IOPA 3FLYA 2J50A 1PMEA 1REKA 3OXTA 3EJ1A 2RFNA 5JZNA 2HY0A 2WU6A 1O6YA 4IE9A 3HVCA 4R3CA 3GC0A 4S33A 4UY9A 2E9NA 4CFFA 2OJFE 4RA4A 2GFSA 2IZSA 3Q5ZA 1U46A 3UNJA 4BGQA 2UZLA 3G6HA 3HP2A 4C61A 3HMMA 3TNQB 5EHOA 3NPCA 3VBWA 5DA3A 2HZNA 3ZLXA 3LXPA 3R7VA 3FDNA 1ZAOA 2W5HA 4PPBA 3KGAA 5JRSA 4C4FA 3I7BA 4MF1A 1O6KA 3MBLA 5ACBC 2CKPA 3LOKA 3FLNC 2UZVA 3TDVA 2VGOA 2OJIA 3ZFMA 4MXZA 4MNEB 2IZUA 4NL0A 4C38A 3ELJA 4ZP5A 4AA5A 5FEDA 3NYXA 5BUJA 4EBVA 2Y4PA 3F5XA 2CCIA 5LWMA 4I23A 2QO2A 4CGAA 2HWPA 4EEVA 3D15A 2R2PA 3QRIA 2OU7A 4XG8A 5IA5A 3DCVA 3ZC6A 5BVOA 2G01A 1YHVA 2XNNA 5HGIA 3CQWA 3RK7A 5ETAA 1ZYLA 5JKGA 3OCSA 4IHPA 4JL9A 2R3NA 4BCPA 4KINA 3ZRKA 2ZB0A 3BLQA 3P9JA 1WVXA 3P78A 4I3ZA 3PXQA 4EJ7A 2PMLX 2WB8A 2CMWA 1H07A 4XOZA 5I9UA 3VF8A 4BFMA 3OCGA 5GZ8A 3TTIA 4CMUA 4EJNA 4D2RA 3UMWA 1YXSA 3VRYA 5HU9A 5J1VA 3B2WA 4AP7A 3G90X 1JKLA 4U97A 4U80A 4QYYA 2PTKA 3NAYA 3UOKA 1BI8A 2A27A 1QPCA 2OZAB 5LARA 1WBVA 2YDKA 2GNFA 4AFEA 2YCSA 4YSJA 5EQYA 2Y0AA 4ANLA 2QLUA 4O82A 3FWQA 2R3GA 3BIZA 2YM8A 1AGWA 3NUYA 3UVPA 1P2AA 2JD5A 3H9RA 3LXKA 4BTFA 4Y5QA 3DXPA 1H1WA 3AT4A 2XIXA 2HOGA 4BGHA 4F4PA 3CKWA 3WZDA 1WFCA 3DKCA 4WG3A 2R3FA 4FSNA 3KXHA 2A19B 3COMA 3MS9A 2ITNA 3NUAA 3A7IA 2J9MA 2EXMA 5L8KA 1H26A 2XRWA 2VWXA 3FY0A 3VBYA 4EOSA 4CLJA 4L43A 3PIZA 1FVRA 4RIOA 4YJPA 4X2JA 2A0CX 4ACCA 3E8DA 2B52A 1PXOA 1P5EA 5BVEA 4IAIA 4OGRA 4YHTA 3BHYA 4E1ZA 1PXIA 3EFLA 1XR1A 3BE2A 3UPZA 3A62A 4Z16A 4G9RA 2OWBA 5AUTA 2GS6A 5AM6A 5EQEA 4MK0A 4NFNA 2PULA 2JIIA 3MFSA 2ITPA 4YBKA 5L6PA 4AGDA 2C6OA 5JFWA 5TR6A 2PVMA 3UTOA 2X6DA 3IG7A 3W1FA 3S00A 4L3LA 3DB6A 2PWLA 4DBXA 3AC8A 5L2SA 5M08A 1Z57A 3K3JA 5BYZA 3RNIA 4QYEA 3NRMA 1M7QA 3A2CA 3P86A 5A6OA 3U55A 1Y6AA 3BKBA 3KC3A 4O7WA 2ZM1A 4XG9A 1Q61A 1ZMVA 3FJQE 1QL6A 5IQHA 1OECA 1XBAA 5FRIA 1BL6A 2JLDA 4YNOA 1IR3A 5K4IA 1Q99A 3NUSA 3LFSA 4OTGA 3R21A 4IDVA 4OTDA 4PQNA 3SD0A 4DFUA 3I79A 4EH9A 4AG8A 3BGPA 3HAVA 3PDTA 2VWIA 4BDIA 2WPAA 4LGHA 1PXMA 4UMUA 1H8FA 2VTMA 1SVEA 2IJMA 3UG2A 3QYZA 3W8LA 4ANOA 4XBRA 3U6HA 3KULA 4QTAA 3R01A 4YZDA 4IAYA 5TOZA 4XV1A 3O8PA 3KB7A 4C37A 1BKXA 5CWZA 3HNGA 4BI1A 2ITVA 3O8TA 4IW0A 3UQGA 4BYIA 3D5WA 3OFMA 3OOMA 1ND4A 5CT0A 2BKKA 3ZBXA 4ZY4A 1VZOA 3QGWA 3V8SA 3OW3A 4FGBA 4G17A 5DVRA 4BI2A 3E63A 2XJ2A 2ZMDA 5AUXA 3O50A 4TYIA 3UZRA 4IVBA 3QTSA 5HVJA 2WD1A 3Q04A 3D5UA 3RPYA 4RX5A 4TKSA 4K2RA 1MQBA 3IDCA 3W2SA 2PZIA 3Q5IA 2OF4A 1E9HA 2QODA 4L46A 4FVRA 4JQ7A 1B6CB 5JFXA 4G31A 3HMIA 4EH2A 4O0UA 2HY81 4MWHA 1CKIA 4EH5A 4R1VA 1JKTA 4BRXA 3THBA 3WILA 2VWYA 2C6LA 4QP1A 4WNOA 4JG7A 5K9IA 1GZKA 4D4RA 3EN5A 4RX9A 4YBJA 4Z55A 4BWKA 2VTSA 3PUPA 3I81A 3EHAA 2BILB 5EW9A 4MQ2A 2GFCA 4FYOA 5L6WL 3V5TA 4BCOA 3LW0A 5BX0A 4FYNA 2DWBA 3G33A 4XV3A 2I0YA 5CQWA 5EM5A 4CV8A 2NRYA 1OKWA 3QALE 4O6EA 3D14A 3E7OA 4HNIA 2X4ZA 4RIWB 2QCSA 5EYCA 4AGWA 5C8KA 3FMDA 4DGLC 4O7YA 4GV1A 3AG9A 4AWIA 5LVMA 2ZV9A 4QMLA 4UMPA 1T46A 2F7EE 4PPCA 4QYFA 4FSYA 4JDHA 5H8EA 3RWPA 2V5QA 1CSNA 2GS2A 2WQNA 3ZZEA 3FMEA 4FKUA 4ID7A 3C0GA 5AMNA 1ZWSA 2H8HA 3DS6A 5FGKA 4XP2A 4D4YA 2WOUA 3ZO2A 4EWQA 4Y72A 3KRLA 1RQQA 4HCVA 1RE8A 3P1AA 5CS6A 3C4CA 5G6VA 1TVOA 5LWNA 4FUXA 3MYGA 3FPQA 5JMSA 4E73A 3BV2A 5AP4A 1IEPA 4OR5A 4F7NA 3PRIA 3L9MA 3DZQA 5ACKA 2C4GA 4FIEA 4MBIA 1U5QA 4EOPA 4NM0A 2HELA 4UX9A 3QD2B 5IDNA 2Y7JA 2YEXA 3EQDA 3OROA 5GNKA 4EHZA 3AC4A 3S1HA 3UNZA 2JKQA 5IEVA 4DEEA 3U6JA 3Q9XA 3ZDIA 2WEIA 4RVMA 4IC8A 2GNLA 2UW6A 4RJ7A 5JRQA 3TEIA 5BQ0A 2C6KA 4AQCA 2VTHA 4CG9A 3ALOA 3QCSA 1XWSA 3M1SA 2Z7RA 3R1SA 4Z3VA 2W4KA 3KRWA 3T3VA 4OTRA 3AMYA 3VHKA 2XM9A 5EOLA 3Q2MA 3RZFA 2J0LA 3PSBA 3QUDA 4EC8A 4YTCA 2CDZA 4EOMA 2EU9A 5EM6A 5KNJA 3NLBA 3DBFA 2P0CA 3OEZA 4U8ZA 4GS6A 4F9AA 4YURA 4RT7A 3HV7A 5EDRA 4IAFA 5A4EA 3VS3A 2CGWA 3ORKA 4L3PA 1LPUA 4FKWA 2AYPA 2BAKA 2UZTA 4D2TA 5ANOA 5DWRA 3LLTA 5KMMA 3DQWA 2JDSA 3MA3A 3NR9A 4I0TA 2O64A 2O2UA 3EL7A 3FKNA 4X3JA 5ICPA 3SGCA 3HLLA 2UZDA 2Y9QA 4G34A 4EZ5A 5J5SA 2Q0NA 2X2LA 5J79A 2YITA 4Y73A 4ENXA 4C4GA 4YTFA 4II5A 2BUJA 4IXPA 1YDRE 5HX8A 3GFWA 4OLIA 3FQSA 3KCFA 3FI3A 4WOVA 5KZ0A 4RC2A 5CQUA 5M4CA 3U54A 4AX8A 2OXXA 4WBBB 4ACGA 3KXMA 3PP1A 3AMAA 1MP8A 4FSRA 2YWVA 3HDMA 4QMYA 2W05A 3PY3A 3MGYA 4QPSA 4R8QA 2OH4A 2F2CB 2UW7A 4FX3A 4GFOA 4IB3A 4KD1A 4M15A 2O3PA 4HGTA 4R1YA 4EONA 4CTCA 3H9FA 3G51A 4V0GA 5E8XA 3MTFA 4NKAA 3CGOA 1UU8A 3L8PA 2J5EA 3CQEA 4BBFA 3G0EA 4QP2A 2YCQA 4RIXB 3CEKA 3WYXA 4KSPA 3QHWA 3KRJA 3M11A 1MQ4A 2HWOA 3QUPA 4HZRA 1U54A 5DG5A 5CLPA 5DRBA 3KVXA 4RJ3A 5ITAA 3ZFXA 4IZYA 3AD6A 3ORLA 2EVAA 5CNNA 4D55A 3KXXA 3MWUA 4A06A 1GIIA 4BI0A 4BCHA 1YI6A 3TKUA 3DFAA 3FZRA 4MWIA 3RK5A 3TDWA 2HZIA 4RWIA 5D9HA 5E1EA 4ALWA 4WT6A 1CTPE 4IIRA 4L7SA 3CJFA 3WIKA 4C7TA 4YZ9A 2YERA 2NNWB 1Q8WA 3ZONA 5GJFA 3L9NA 4DEDA 4D1ZA 2QLQA 2VRXA 4PP7A 4UZHA 4IADA 4IB1A 3VW8A 4MXCA 3CTQA 2OH0E 2R3JA 5LMKC 3F7WA 1I09A 4QRCA 1UWHA 4IWDA 2JDVA 3UYTA 4M14A 3EQBA 2XB7A 3C0HA 5K4JA 3MI9A 3IDBA 1JOWB 5EW3A 1WCCA 4QTCA 3R9NA 3R7OA 1W7HA 4XOYA 3C5UA 3MPMA 4QOXA 2ZDUA 3H9OA 4F09A 2PE1A 4QQCA 4I93A 3AQVA 5FDXA 4EH8A 5CALA 3A99A 4ANSA 3R8PA 4KIKB 2YWPA 4XG4A 3M42A 4ZJIA 3HRCA 4F0FA 4ZJVA 5CAQA 5JSMA 2C69A 3HX4A 3RPVA 3GCQA 1JAMA 4DITA 2WAJA 1UU7A 4PL5A 3AMBA 5B2KA 1FQ1B 5L2TA 2VZ6A 3ZH8A 5L2IA 2CCHA 4QMXA 3NSZA 5FP6A 3O51A 3KRRA 4KKHA 2XM8A 4DH7A 4G9CA 5JGDA 4IZ7A 1FBNA 2PUNA 3I1AA 2E9PA 3QRKA 5LCKA 4C2WA 4EI4A 2QU6A 2HK5A 5I9WA 2UVYA 4J95A 4FKLA 4QMWA 5IF1A 2J2IB 2WQBA 2RG5A 4V04A 3ZC5A 2QKRA 2QOQA 2Y4IC 2BHEA 3GGFA 3IW6A 2Z02A 3FC1X 4AS0A 3OEFX 5IH6A 5EYMA 4E4NA 3R1NA 4JBPA 3UGCA 5KMNA 2CNQA 4JIKA 5DNRA 1K3AA 3DLZA 5TO8A 4GIHA 4IDTA 5IQBA 2CKOA 1UNGA 2ZYBA 1JSTA 5GINE 5J5TA 3NNVA 1YKRA 5B2MA 3HAMA 3SC1A 2GSFA 2J7TA 4J97A 1YXTA 4OT6A 3P4KA 3ORPA 3MPTA 4NM7A 5FWKK 3BYVA 2PMOX 2GHMA 1Y8GA 5H2UA 3TG1A 4ASXA 4EBWA 2PE2A 4YZCA 5EM7A 2JKKA 3FZPA 2ONLC 1NVQA 3GXLA 5EG3A 1DAYA 1MRYA 4FV9A 1FVTA 5AX9A 4J53A 5CVGA 2QG5A 4OT5A 1SM2A 3HRFA 2BKZA 3MVMA 4BIDA 3F2RA 2W9ZB 4LUDA 3G9NA 2ZVAA 5E8TA 2P55A 3BHUA 4XS2A 2O8YA 4W8DA 1KUTA 1IA8A 1JBPE 1H1PA 4KB8A 1DI8A 2C5NA 3T9TA 4DHFA 4U3ZA 3RPRA 4ARKA 2PMIA 4XG7A 3PP0A 4L68A 4JQ8A 5I9ZA 3C5IA 3LFCA 4E7WA 4TTHB 5EI2A 5E9EA 4OTWA 3TM0A 2C6MA 2EB2A 4QMOA 3NMUF 2GU8A 2WMTA 3H0YA 1RW8A 2C0OA 2VTPA 1CKPA 3I6WA 3F88A 2C3IB 3DK7A 5KCVA 3G5DA 3BBWA 4IM0A 4E20A 3TCPA 2WKMA 5K0XA 2G9XA 3NUXA 4ZTSA 1YQJA 2NO3A 2IVVA 4EUUA 5K5NA 2OI4X 5FEQA 2CJMA 4O1OA 1ZMWA 4CXAA 3S3IA 4HVDA 1DAWA 3GB2A 4JX3A 4XJ0A 2PHKA 3DY7A 3L8VA 3ORXA 1IASA 3R8VA 4FTTA 4P7EA 5B7VA 4UMTA 4WA9A 5IA3A 1BYGA 3EQRA 5AAGA 5DR2A 1Q62A 1R39A 2UZWE 3U87A 2KULA 1ZZLA 2C3LA 4KSQA 2H96A 4YTHA 4AW2A 4XEYA 4F63A 2YM5A 2WTKC 4GT5A 4I94A 4U0IA 4QMQA 5FEEA 3EH9A 3HRBA 4F1TA 2GNGA 4FICA 4TYHB 4D5HA 3PY0A 5LMKA 4WO5A 4E26A 1A48A 5J9ZA 3BI6A 3W10A 3BBTB 4P90A 2VTRA 4PMMA 3SA0A 5CSVA 3V01A 2RG6A 1OZ1A 3P7AA 2FUMA 2V62A 1Q3WA 1PKDA 4QP7A 2YZAA 2IVTA 4Y83A 4JR7A 4HJOA 4FV4A 4PL4A 3HZTA 3NYVA 4OTPA 5AUVA 4E5AX 4C02A 4EH7A 3KKVA 4IM3A 4I5MA 4F99A 3HV4A 4IB0A 1OL6A 1SVGA 4HGEA 5HI2A 3V6SA 3V8TA 4B99A 2A1AB 2OBJA 3MW1A 2PVYA 4L42A 5M44A 3EQIA 2V0DA 3PA3A 2XNGA 3ENMA 3NNWA 4QNYA 4P2KA 5DE2A 3NUPA 3RM7A 4C0TA 3D94A 4EOJA 3RINA 5JN2A 1A9UA 5EK7A 1H28A 5FP5A 4P5ZA 4MXAA 3OF0A 4ZZOA 3NDMA 2R0IA 2HCKA 2UVZA
chains in the Genus database with same CATH superfamily
3CBLA 4MVFA 1NT2A 4ZTRA 2OXYA 4L52A 2WTDA 4TPTA 2YIRA 4BL1A 3VHEA 3QCQA 3GENA 2X8EA 4XRJA 3UO4A 3VUIA 3LQ3A 4GMYA 4K1BA 4E6DA 4BKZA 2PZYA 3V04A 2HZ0A 3FY2A 4ZSLA 2OGVA 1TQIA 3HV5A 3IQ7A 2Y6OA 2EXEA 2XYUA 5CEQA 4C4HA 2J0MB 3CXWA 4FTUA 3AXWA 4GSBA 1JLUE 3A7HA 4R3RA 5CVHA 4EHEA 2AQXA 3GC8A 2XAOA 4FV6A 4NT4A 3EN6A 3PFQA 3C4ZA 3BQCA 2ACXA 4GIIA 3QCYA 2G2IA 3P0MA 4PMSA 5ANIA 5I5ZA 2ONLA 2QOKA 3DBQA 3CC6A 3EWHA 3MJ2A 3UOLA 4BCGA 3E8CA 4MXXA 2Y8OA 1JPAA 2X7FA 4LV8A 1CM8A 4QPAA 4ERWA 2JBPA 4OW8A 4X3FC 3ZM9A 2P2IA 4DFXE 4LOQA 4MBJA 5AA9A 2UZBA 1WZYA 2G2HA 3SXFA 3G2FA 3MVLA 4QD6A 1YXXA 4QP4A 3CTJA 5A14A 4V01A 3R2YA 5EHLA 3DA6A 5CEKA 3PA5A 5J8IA 1UNHA 2YIWA 4QMTA 5DFPA 5IKWA 2C6DA 4M3QA 5GZAA 2WQEA 1H00A 3I60A 3EN7A 3UG1A 4C4EA 4NKSA 4K0YA 3IS5A 3VW6A 2R4BA 3JPVA 2ZB1A 5H8GA 5DT3A 4UWCA 4IWPA 3LFDA 4HZSA 3II5A 3NS9A 3BLHA 4C4JA 1PXPA 4B7TA 3E62A 5EM8A 1A06A 4RVKA 3TV4A 3LLAA 3F3ZA 1KWPA 5F20A 3CY3A 3AD4A 4AT3A 4K11A 3RZBA 5M57A 4O7ZA 1WVYA 4I20A 3WYYA 3DKFA 5IZFA 1IAJA 4QMVA 3R30A 5HO6A 3KXZA 2UW5A 3PY1A 3LJ0A 4FTNA 3CE3A 2QOHA 4CV9A 4GK3A 1W2CA 4G3EA 5CVFA 4CTBA 3FHRA 3E5AA 3R9RA 2BMCA 4ENYA 4JT3A 4WHZA 1XH5A 1SYKA 3ZXTA 4BKJA 3TYKA 5ETFA 3VN9A 2FA2A 3ZU7A 3VS0A 1G3NA 5GHVA 4D5KA 4UB7A 3SG9A 4YO4A 5HCXA 2WMBA 2WIHA 2OJ9A 1W8CA 4GJ3A 5I9VA 1WBSA 1V0BA 4QO9A 3GC7A 4ZSAA 4AZFA 5IA1A 3ZRMA 2CKQA 1PKGA 1YXVA 4AW1A 4QEBA 3OP5A 4LRMA 4RIYA 2YN8A 5HIEA 4S2ZA 1OBDA 4GKHA 5HEZA 3LFBA 1NVRA 1L3RE 2PZPA 3ODYX 4M8TA 2C0TA 4NTSA 2XCKA 3FKOA 5CAOA 4FODA 3LIJA 2XKFA 2ETMA 4CKIA 2F57A 4DEIA 4GRBA 4DTKA 3QFVA 4H05A 4Y85A 4X0MA 5A3XA 3EYHA 4F65A 1R0EA 3AC3A 1OIQA 1LR4A 1WBTA 2F7ZE 2REIA 3FPMA 3L1SA 5CSXA 4PRJA 2WMSA 2E9VA 2W1IA 5HO7A 2PUIA 1ZYJA 3DK3A 2XIYA 4APPA 3P08A 3DBCA 3OWPA 5A46A 1UA2A 2ETKA 2W5BA 2YAAA 3TZMA 5HU3A 4O7NA 4CFWA 5CEOA 4O4EA 4F7SA 4M97A 3RP9A 1OL5A 2Z7LA 4ZSJA 4APCA 1HOWA 4USFA 4A9TA 2FSLX 3ATTA 5LVNA 3KL8A 4BDAA 1H25A 2B54A 2ZMCA 3DLSA 3DXNA 3QZFA 4FZ6A 5F94A 3V3VA 5LVOA 3KXNA 4RGJA 3LHJA 3ZSIA 3JS2A 3DBDA 2OJJA 4EHGA 3GBZA 1R3CA 4NU1A 4U3YA 5BVWA 5TKDA 3P7CA 4ZZMA 4DG2E 4E93A 4PY1A 1NXKA 3BWJA 5KMLA 2WTJA 4F9BA 3ZEWA 3AT2A 1Q5KA 3QCXA 1YOMA 2XK4A 2WOTA 3K54A 3PVBA 4M12A 3UODA 4BCNA 5CASA 2LGCA 4NUSA 2CLQA 4CCBA 3FI8A 3OWKA 3QU0A 3GUBA 2XKEA 4M84A 4OAVB 4FKTA 5K5XA 4UYAA 4X3FA 3QX2A 1GJOA 3G15A 3OUKA 3D5XA 2PPQA 4ITJA 2VTNA 4LGGA 3ANQA 4R7IA 3LFEA 3DJ6A 5LMAA 3BPRA 3V51A 1YWRA 1UKIA 4IZAA 1MRUA 2ERKA 3PXKA 2CKEA 4FTRA 5M07A 4GYIA 2XNPA 3OY1A 4Z9LA 1JKSA 4GUEA 3KCKA 3SRVA 2B53A 5T68A 2JITA 3D7TA 3OOGA 4C36A 1OL2A 1ST0A 5AP0A 3FLSA 5TT7A 2WU7A 5HIDA 4IAAA 1PXNA 4I5HA 2ITUA 3DDQA 4L6QA 5I3RA 3G6GA 1CMKE 3LQ8A 4J7BA 2VTOA 4ZLZA 4HCUA 2YJSA 3BGQA 4MHAA 3CLYA 1ZXEA 3AC5A 4W4WA 5BVKA 4AOJA 2XIKA 4NWMA 3PJCA 2VV9A 3KULB 2B9IA 5GZ9A 4EH3A 5L8LA 3R00A 4DCAA 5A54A 3RALA 2J90A 2R5TA 4CZUA 3QA8A 1M2PA 2RL5A 3IW4A 3PJ1A 5AAFA 3KIOC 3NIZA 4HGLA 5HVYA 4DH8A 3Q4TA 4DH3A 2XS0A 1MUOA 1ZZ2A 5IH5A 4KIPA 2VX0A 3W0RA 2RIOA 2JIUA 3R63A 4H58A 2HENA 4I21A 3MIYA 4OTQA 3FMLA 4TY1A 2VX3A 1KOBA 4C4IA 5GIPE 4YSMA 3ZTXA 5M53A 4IFGA 2W5AA 3M2WA 5JZJA 4G16A 2R9SA 4FG7A 3LMGA 4W9WA 1DM2A 1KV2A 4A9SA 3F69A 4IVAA 4RFYA 3NUNA 1WBNA 4NTTA 2WFYA 5BNJA 1F3MC 4I4FA 1OPKA 4MNFA 5C9CA 4MYGA 1YHSA 3CPCA 5BVFA 3COHA 3D2IA 1KE9A 2ITZA 2R3MA 1OVEA 2WQMA 4USDA 3TNPC 4TWOA 3PSCA 3CY2A 3GT8A 5B0XA 3V5WA 3VS4A 3PJ8A 4D0WA 3KMMA 4O38A 2WHBA 2FO0A 5G1XA 4EORA 3FYKX 4GG5A 4IAZA 1ZOGA 3LFFA 3O7LB 3TJDA 2OZAA 2IVUA 4BHNA 3LJ2A 5HE3A 4HOKA 4U44A 2F9GA 3U4UA 4XBUA 4AE9A 4CMOA 4EKKA 3FC2A 1W0XC 4FE2A 2XK3A 2QVSE 1PXKA 4RC3A 3PVWA 3ORNA 2ITYA 4ACMA 4GUBA 2VNYA 5CAUA 3QTQA 1OPLA 5FD2A 3COKA 5AWMA 3VUGA 2JDTA 2X8DA 3R6XA 4IJPA 3VJNA 5A4CA 3L8XA 5M09A 2C1BA 4DT8A 5AR4A 4IAKA 3R7EA 3OTVA 5E4HA 4QP6A 4IX6A 1E1VA 2QI8A 5CNOA 5DIAA 3FLWA 5CI6A 3UO5A 3QUEA 2WMWA 3AT3A 3CGFA 4L67A 4ZS0A 4O0SA 4QMMA 4EK8A 5KO1A 5H9BA 3CTHA 5IPJA 2Z7QA 4X6RA 1PMNA 3WIGA 3HKOA 4HYHA 3MIAA 3P79A 4OTHA 2VWBA 1OUYA 4FSTA 4QT1A 4N70A 4QPMA 5J95A 3GCUA 2BRHA 1W83A 4K77A 3E87A 3NFGB 4WNMA 4L53A 3ZM4A 4FKPA 3RMFA 1Q8YA 5GIOE 3ZUTA 4ZZNA 4WG4A 1H1SA 3HECA 4FNZA 3ETAA 2ZDTA 1KV1A 1OB3A 3F82A 3LCKA 1H27A 1XH6A 4FZ7A 5CSPA 1UU3A 3TL8A 4MUQA 3PLSA 3F2NA 4G6NA 3D83A 3TN8A 3TNWA 3F61A 3R1QA 2XBAA 4KRCA 3W2OA 4AT4A 5JFSA 4F78A 1SNXA 4UXLA 4FTJA 2XZSA 3MFUA 1PXJA 4GKIA 4EYJA 2CGXA 4ANBA 4FKGA 4FTIA 2IG7A 3Q6WA 1XBCA 3FSKA 3LZBA 5CXHA 5E8VA 3UVQA 3U6IA 2VO6A 2R3HA 4DH1A 2YZLA 4ZK5A 1PJKA 2HW6A 5KMIA 3P5JC 1WBOA 2ZOQA 4EYMA 4U45A 2CSNA 4LMNA 5AUZA 4DLIA 1M52A 4I0RA 3Q60A 1OM1A 4BB4A 4D4SA 4HVIA 4HVHA 3OT3A 3U8WA 4UV0A 3QQJA 4UWBA 3FYJX 3H3CA 5L6OA 3RKBA 3MPAA 5D41A 3SW4A 1SMHA 1XBBA 5E8YA 5FXRA 2UZOA 1R1WA 4AF3A 3MB6A 1UNLA 3WF5A 5C8NA 4D1XA 2BR1A 3TKHA 4O4CA 3VS2A 2F4JA 4FTAA 4Y8DA 4O83A 2WTWA 2XK7A 4O2PA 5HLWA 3KU2A 2XK9A 3JYAA 2BROA 5ANJA 3UDBA 4CYIA 5F95A 1ZY4A 3R9HA 5CXZA 4FZAB 4YLLA 4DFBA 3FKLA 3O23A 4GK4A 4XV2A 5A4LA 1LP4A 4EL9A 4C35A 5KKRB 4MXYA 3D2KA 3C4WA 5AUYA 3NW5A 2Y6MA 3PVGA 3BX5A 3ANRA 3A8WA 4OBPA 5CU2A 4QDVA 4CFVA 4KBKA 2W9FB 1FMOE 5TF9A 3RCJA 4NCTC 2XBJA 4RWLA 3RI1A 4LV7A 5ETIA 2XALA 4TZRA 5HHWA 1R0PA 1WBPA 2B9FA 3HV3A 5HKMA 5B2LA 2XNBA 2XNMA 4WBOA 3OY3A 3F3TA 5ANGA 3AOXA 5E8SA 4XHKB 4LRKA 4PDSA 1ZOHA 1JNKA 5EYDA 4MF0A 2PVKA 3LCTA 3MFTA 4IM2A 4PMPA 4PNKA 1TZDA 4IVDA 4M7IA 2JKOA 4ZTMA 1OKYA 2QO7A 3AD5A 4FTQA 3QD0A 4FEQA 3PRFA 3FEGA 1V0OA 3C4EA 3FXXA 4AAAA 4AE6A 4D2SA 5IA0A 4AA4A 4QQJA 2ITTA 4FKSA 5T3QA 4S34A 3DKGA 3PIXA 4E4XA 4O4FA 3QKLA 2C5VA 1QPDA 4DEBA 3ERKA 5C27A 4B6LA 1TFFA 4J98A 1JSVA 4IMYA 2GQRA 3CD8A 3PUFC 3BELA 2VTIA 2G2FA 2HYYA 4H39A 4CFMA 3VUHA 1OL7A 1K9AA 5HCZA 2C1AA 2XF0A 2OLCA 2GMXA 3QKMA 4I1ZA 5E8UA 1WMKA 3ZCLA 3BQRA 4BBEA 2HIWA 5I0BA 1OI9A 1OIUA 2J0KA 4RWKA 4EQMA 3D0EA 1ZY5A 4XX9A 1PYXA 4K6ZA 2PL0A 1ZYDA 4QTBA 5CTPA 3I4BA 1VYZA 3IO7A 2A98A 4IEBA 2QO9A 4AA0A 4WSYA 3CR0A 1YWNA 5CAPA 3EFKA 4FSQA 5D11A 4W4YA 3EFJA 4GU6A 4C3RA 4E6AA 1GIJA 3MH3A 4RG0A 2JAVA 3KA0A 5LVLA 5IEYA 4PNIA 4F7LA 3PXRA 2GPHA 4FMQA 4N6YA 4RC4A 4DINA 4FVQA 2JDOA 3V6RA 1H1RA 2FB8A 4RLLA 5GJDA 3RAWA 4AGCA 4F70A 2W96B 5AEPA 5I3OA 4MXOA 1W84A 1XKKA 1B39A 2WMXA 1GZOA 5CY3A 1OIRA 4AOIA 3QXOA 2EWAA 5AV2A 3ZSHA 4MKCA 4DN5A 3VBXA 3E8EA 4FK6A 3KN6A 4I4EA 4ZOGA 4X2KA 5M4UA 3DFCB 2NPQA 4F0IA 3BU6A 2PVRA 3FXWA 4MBLA 5J7HA 1G8KA 3Q96A 3BYUA 4GEOA 4O21A 5DR9A 3TJCA 5D1JA 1XH7A 5CEPA 3FSFA 1UKHA 3SV0A 3D7ZA 2BRGA 1HCLA 5EW8A 3G9LX 3BHHA 4UMQA 4NH1A 5JQ8A 3MTLA 5AM7A 4IX4A 4ZXTA 4ALUA 4FNXA 5HBJA 5IMXA 5M4IA 4FR4A 2O63A 1PW2A 3DKOA 4KBCA 4FTLA 5FXQA 2R7BA 5L2WA 4G3CA 4TWPA 4ANNA 2VO0A 3WF8A 3BWFA 4AGUA 2OG8A 4UN0C 1H0VA 1YWVA 1H0WA 4V05A 4IX5A 2FYSA 4FT5A 4BWPA 1WBWA 3T3UA 1ERKA 2YM3A 5LVPA 2XUUA 3MDYA 4RQKA 5HD4A 4FIHA 3S2PA 2HW7A 4FUYA 4BTJA 2B7AA 3UYSA 4BCIA 3TACA 2YIYA 4XP0A 4YGAA 2GNJA 3LCOA 4CZTA 2IW6A 2QD9A 1STCE 3FLZA 5HESA 2BZJA 4FV8A 2UUEA 2UW8A 2VWUA 2C6TA 4L9IA 5FM3A 5C8MA 1Q4LA 3FMNA 2J0JA 3Q6UA 4FIIA 4KS8A 2J5FA 5DEYA 3TNHA 4YC3A 4BBMA 4EKLA 5FBNC 3RNYA 4GH2A 1YRPA 4EH4A 5JQ5A 1ZOEA 4WSQA 1NVSA 3TKIA 4U79A 4CSVA 3VVHA 3QAME 4TNDA 4LG4A 5ETCA 5AUUA 4J1RA 5CT7A 4FG9A 3IOKA 4NCTA 4O86A 2WTCA 4RPVA 4O27B 4YJNA 1Q8ZA 3EQHA 1X8BA 1Q24A 2QOFA 3TV7A 4NIFB 5HBHA 5AR8A 4L44A 2GNHA 5HQ0A 4MEDA 2RFDA 1PHKA 1Q8UA 2YCRA 3FL4A 4FIJA 4RIXA 5AV3A 2ZAZA 1Z9XA 2X8IA 4M0YA 3EZVA 4PMTA 4ONAA 1YOJA 5AADA 3RAHA 2I40A 3TZ9A 1ZARA 4NJDA 1M2QA 3WF9A 5BVNA 4B0GA 5HLNA 5DR6A 3UC3A 2UVXA 5BYYA 4DTAA 4PDPA 1BUHA 1IRKA 4YC6A 4QMNA 3GU8A 3S95A 5M56A 2F2UA 2IZRA 3BV3A 3C50A 2W1ZA 3E3BX 3SQQA 4IQ6A 5CZIA 3OCBA 4WUNA 3QZGA 4OTIA 3W2RA 1QPJA 1TKIA 3NCZA 3QTZA 4A4XA 4CKRA 4O7TA 2A2AA 4BTKA 4BWXA 4F6WA 5BMMA 5ANEA 5HBEA 3L9LA 4QYGA 2OK1A 3ORTA 4RJ5A 1GNGA 3VUDA 2J6MA 2W7XA 4EOIA 5E8ZA 4ZTQA 3LM0A 4M0ZA 2CGVA 3A7JA 3GFEA 1OBGA 2ZV8A 4FV1A 4FKVA 4Y95A 3ZUUA 2OO8X 3K2LA 4FL3A 2XA4A 1XJDA 4G5JA 5E91A 3ZO3A 1JWHA 4QMUA 4DGMA 5KMOA 1L8TA 4W9XA 1DI9A 2JC6A 3OVVA 4JOAA 3E64A 4ACHA 4AW5A 4AXAA 4ERKA 1J1CA 5D7AA 4YJVA 3CS9A 3EQGA 4TT7A 5J7BA 5HTCA 4ZLOA 3C4XA 1GZ8A 4FNYA 2PSQA 4J71A 3FQHA 3ULIA 5HNBA 1O6LA 3IKAA 4KS7A 3GU6A 4QMZA 4X2GA 3ATSA 3QC9A 2IPXA 5E90A 3E8NA 4ORKA 3H10A 4O0XA 4KABA 4BGGA 4XG2A 4TWCA 3QTRA 4CRLA 5CF5A 5AFVA 3OT8A 4BCJA 4QQ5A 3HMPA 4EHVA 3FUPA 4FL2A 1GIHA 3V5QA 3CSVA 2QHNA 3HA8A 4P5QA 4BCMA 4TN6A 4K33A 3KEXA 3R71A 4M69B 3DTWA 5EI6A 4FKIA 5CF4A 5E7RA 3V5JA 1H4LA 2X1NA 4WNPA 4JG6A 5L8JA 2R3PA 2YIXA 3OC1A 3T9IA 5IEXA 1PYEA 4A9UA 4CFXA 4EUTA 4L45A 4DFYA 1AQ1A 3FI4A 5AA8A 4O7SA 1W82A 4RBLA 4GU9A 3D9VA 5BPYA 3P7BA 4IWQA 4LFIA 4GJ2A 4YTIA 4QMPA 3OD6X 2SRCA 4JDIA 4WNKA 5DRDA 3I5ZA 4JVGA 4HNFA 5A9UA 3W33A 4XYFA 2OJGA 4C8BA 1QPEA 3MSSA 4O7RA 1U4DA 4CQGA 3Q32A 2Z8CA 1YXUA 5CU4A 5K3YA 4DC2A 4O22A 4FGRA 4M68A 4BY9E 1YI3A 4FV3A 3QTWA 2WNTA 5AR2A 5DT0A 3KN5A 5H8BA 4C3PA 1GOLA 4DA5A 4L8MA 3DPKA 4KA3A 3IK3A 4QP3A 3MH2A 3RAIA 4ANQA 3TTJA 1FGKA 4DYMA 4L00A 3ENHA 3TT0A 4DG0E 5M4FA 5IQEA 3GQLA 4DCEA 2VO3A 1PY5A 3BE9A 4XLIA 4FC0A 3O96A 4ZSEA 3VWAA 5ANKA 3W8QA 1J7IA 3F3VA 4W4XA 1J1BA 3MY0A 3QRTA 4AXCA 1VYWA 3Q4ZA 1S9IA 4XG3A 2B4SB 3BEAA 2BHHA 4USEA 4E3CA 2X9EA 3R1YA 3IGGA 2P2HA 4ZEGA 4FV2A 3BRBA 4RVLA 3QRJA 5HZNA 3Q4UA 1IG1A 3ACKA 5CF8A 2XNOA 1H24A 2BALA 3AGLA 2EUFB 3OBJA 4PDOA 4N57A 4CNHA 1SZMA 3AC2A 4BZDA 4AXEA 2UZUE 4FRFA 4WKQA 3FXZA 4LGDA 3W2PA 5AP2A 1ZYSA 5AP1A 4WRSA 3AC1A 3K5UA 3LJ1A 4BICA 5BMSA 5L4QA 3MH0A 3H0ZA 4OBOA 4FIGA 4AU8A 2CLXA 2IWIA 4D0XA 1H01A 2H6DA 2RGPA 3LVPA 4GL9A 2VTLA 4XNEA 4PPAA 3W32A 4BDDA 3LAUA 5EI8A 2O5KA 4C58A 2C68A 1YW2A 2PVFA 3PPZA 4TYHA 2OF2A 3A60A 3BYMA 2ITXA 3TUCA 5FLFA 4IB5A 3UJGA 1NY3A 5JGAA 2V7OA 1M7NA 3NZ0A 4NM5A 4G5PA 5J87A 2OSCA 3DQXA 3PG1A 4B9DA 1W98A 2GQSA 3H30A 5AX3A 4JRVA 4J99A 4PUZA 3F5UA 3F7ZA 4I92A 4AFJA 2W0JA 4DLJA 3OZ6A 4YMJA 4BDGA 1LEWA 4Y46A 1ZMUA 3NEWA 4F1OA 4YJSA 3TWJA 4ZMFA 3ORZA 2G15A 2VD5A 3R02A 4MTAA 3QTIA 1BLXA 4ACDA 5KHWA 2ZV7A 3QBNA 2HAKA 3UDSA 1DS5A 4E5WA 3DZOA 2C6EA 4OTFA 4TRLA 4KWPA 4MAOA 3NVKI 3LXLA 3KK9A 4EK3A 2DUVA 3R22A 2IZTA 5IA2A 3FV8A 1K2PA 1OMWA 4YPSA 3CD3A 4JG8A 3WZJA 3HGKA 3GU4A 2I6LA 5GJGA 4RJ8A 2F7XE 2VX1A 3PJ3A 2X6EA 3KK8A 5CEMA 3LMIA 4DTBA 2KTYA 4BYJA 5KMKA 3KVWA 3Q3BA 4XUFA 5EFQA 4E6CA 1AD5A 5M06A 4I6FA 3F3UA 4F6UA 4GT3A 4YR8A 1MRVA 4WUAA 3P5KA 5JFVA 3HYHA 3Q52A 4PTEA 5LXMA 4OAUC 3F6XA 5FQDC 1GAGA 2HZ4A 4LM5A 2PVNA 2XK8A 4IVCA 5HE2A 2BTRA 2XCHA 4H1MA 1YHWA 2YJRA 5J9YA 3QTUA 3I5NA 3PZEA 2PZ5A 4JRNA 3ZMMA 2W1GA 1APME 3CPBA 3PSDA 2BDFA 2X39A 2XP2A 3HL7A 2QHMA 2QR8A 3ZBFA 5FDPA 4AN2A 4ZLYA 4H36A 3UQFA 3BU3A 5KUPA 4D4VA 3LFNA 4AN3A 4BDBA 5CU6A 3PIYA 3ZS5A 3VQUA 3C51A 1XH9A 3PE2A 2VTAA 4FT3A 4JDJA 2AUHA 3D7TB 4CFUA 3KF4A 3ZXZA 3SHEA 1UV5A 3GU7A 4LDTA 3HV6A 4A4LA 4E4MA 1JQHA 4NW6A 3GNIB 2IO6A 3DU8A 4EC9A 2JKMA 5IUGA 4HYSA 1KE7A 2VTJA 1TQPA 3AGMA 3PYYA 4I6BA 4W8EA 4KIOA 4B4LA 5BV3A 2XRUA 1W2FA 3NX8A 2UV2A 5K0KA 5KMJA 4L3JA 3HUBA 2YISA 2PE0A 2XH5A 3HA6A 3QWJA 1CDKA 4YLKA 3FQEA 4RJ6A 5J1WA 1BX6A 1WAKA 3GOPA 1XO2B 3FMJA 4FZDB 5CU0A 3ZHPC 5AV0A 3R8ZA 4PX6A 2PVHA 3DK6A 2PK9A 4QNAA 3CJGA 3QLFA 4ZTNA 5E1SA 3TIZA 3AKJA 4C2VA 3FLQA 4FTKA 3U4WA 5DMZA 5IA4A 5I4NA 2ZM3A 4BDFA 5FUTA 4ITIA 3UZPA 4WIHA 3S0OA 3CQUA 4JDKA 4EOLA 2C3JA 2QOBA 3OWJA 4S32A 1BMKA 3ZDUA 4CD0A 2PMNX 3MV5A 3VIDA 5EDPA 4EOOA 2HXLA 4O0WA 1XMMA 3ROYA 1LUFA 4HVSA 4RVTA 4EOQA 4FKQA 2PZRA 3IGOA 4FSZA 3FZSA 2BVAA 3JR1A 4FG8A 4O81A 2Z60A 3FMKA 3NYNA 4F0GA 4O1PA 5D10A 4O96A 3QQUA 4PV0A 1PMUA 3EN4A 2QNJA 3E88A 4I6QA 1RJBA 3W16A 4QMSA 4CYJA 2C0IA 2P4IA 4DH5A 3IW5A 5HD7A 3DOGA 3EB0A 4QP8A 5LMBA 3U9NA 3BYOA 2VNWA 5FTQA 5F9EA 4R7BA 1OPJA 1Y91A 3PE1A 5EOBA 5HG9A 3MB7A 5HICA 2YAKA 3R9OA 4EH6A 2R3QA 3REPA 2BRBA 3L9PA 4CCUA 3QA0A 2CNVA 4ASDA 4K8AA 4QTDA 1F0QA 4U7ZA 5DEWA 4PDYA 3KQ7A 4G3GA 4WG5A 3NGAA 4G6OA 4LRJA 3UO6A 2C5YA 2ZV2A 2X81A 2B9JA 3E93A 3DB8A 4F64A 3QC4A 4BCKA 2IEWA 3BCEA 4Q2AA 4P4CA 2R3OA 4CT2A 5E8WA 3IW7A 5JT2A 3UDZA 3TXOA 4FA2A 5BVDA 2OIQA 5CAVA 4C57A 4CRSA 2H9VA 1F5QA 5CU3A 3ZO4A 4MNEA 3R7YA 3R2BA 3FMHA 3NYOA 2IW9A 3GP0A 1M17A 3QWKA 3VUMA 5CSWA 4F7JA 4YLJA 3RVGA 4PTGA 4HVGA 4YU2A 5CANA 2XNEA 3B8QA 5KX8A 4Q5EA 3D5VA 1BI7A 3F3WA 3LFQA 3EL8A 3O17A 3KFAA 5HNGA 3C9WA 5KBRA 3R83A 2FSMX 4TYGA 3N4UA 2ESMA 1G8SA 2BRNA 2WMUA 3FMMA 4JXFA 3WARA 1M2RA 2XIZA 3LFAA 2X7OA 3GQIA 4HYIA 4FTCA 4X2FA 2O65A 3I6UA 5DBXA 1ZRZA 4CT1A 3QKKA 4FT7A 4AACA 3QQFA 5HIBA 3VUKA 2C47A 3ORIA 5CEIA 4NEUA 4QP9A 3RK9A 2W1HA 4B8LA 1G5SA 3U51A 3FZ1A 3KY2A 4W4VA 3RAKA 5KHXA 1R78A 1PF8A 3I0QA 3AKLA 2XYNA 1KE8A 5D7VA 4M66A 1RDQE 4IWOA 3I0OA 5HG7A 1VLRA 3O0GA 2WQOA 3G0FA 2OIDA 1FVVA 3DDPA 5DPVA 1QMZA 2OFVA 2FSOX 4FSWA 4N4SA 4KBAA 4O4DA 3B2TA 4G3FA 4OUCA 2VUWA 4H3QA 4FV7A 1KE6A 3GI3A 4Q5HA 5JEBA 4A7CA 1PRYA 2XJ1A 2V55A 5T6KA 2I0HA 4U40A 3VF9A 4AN9A 4DAWA 5TE0A 4PF4A 2Q83A 4FF8A 3TIYA 2C6IA 3NIEA 3UP2A 2GDOA 2C3KA 4YHJA 3KREA 3DJ5A 4JJRA 5AIKA 4AZEA 3WZKA 2PVJA 1H08A 3PXYA 2GS7A 4YZMA 3UVRA 3A61A 3WZEA 4F08A 3MH1A 3QYWA 3W0NA 4RMZA 4E6QA 1UVRA 3ZUVA 3SLSA 2XMYA 1KOAA 3KMWA 5C1QB 3WE8A 1GZNA 4CLIA 4DBNA 3FZTA 3QQLA 2JAMA 5IQFA 5L3AA 4R77A 2CPKE 2DS1A 4YJRA 2X2MA 4NW5A 5KKRC 4C59A 3N4TA 4LV5A 4JAIA 4UYNA 3LCDA 4F6SA 2XKDA 2J4ZA 4R3PA 1SVHA 2EXCX 3RJCA 2ERZE 4YP8A 3O5AA 5HTIA 4FTMA 3VBVA 3ET7A 4RFZA 3LCSA 4TWNA 1YDSE 4EZ7A 5AP7A 2ITOA 3VAPA 4C62A 4DE4A 3FE3A 5CX9A 1U59A 5M51A 1W2DA 4QYHA 1IA9A 1OITA 2X2KA 4I24A 3C0IA 4Y5HA 4AW0A 3JY9A 5HTBA 4XRLA 3PXZA 4U43A 4TYEA 4XV9A 3VRZA 4DGGA 4DHJA 2BZKB 2YFXA 2W1DA 3BHTA 2RKUA 3K5VA 3UE4A 1LEZA 4X21A 5E92A 4BTMA 4BDCA 1VR2A 4TNBA 1XQZA 4BKYA 3Q9YA 2XJ0A 2X7GA 3CKXA 4J96A 1Y8YA 1P14A 3HP5A 4BDKA 4PL3A 3NFFB 2AC5A 2W99B 4U41A 2JFLA 4GYGA 3W55A 3HDNA 4RQVA 4Z7GA 2B0QA 3F5GA 3GCPA