2XJ9A

Dimer structure of the bacterial cell division regulator mipz
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
268
structure length
265
Chain Sequence
ETRVIVVGNEKGGAGKSTIAVHLVTALLYGGAKVAVIDLALRQRTSARFFENRRAWLDNKKIELPEPLALNLSDNDVALAERPEEEQVAGFEAAFARAMAECDFILIDTPGGDSAITRMAHGRADLVVTPMNDSFVDFDMLGTVDPLELTKPSLYSLTVWEGRKQRALSGQRQAMDWVVLRNRLATTARNRKRLEDRLNALAKRVGFRIGPGLRDRVIYRELFPFGLTIADLSPQVRPVPVSLQHLAARQELRALMHSLGLSAYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MIPZ
publication title Localized Dimerization and Nucleoid Binding Drive Gradient Formation by the Bacterial Cell Division Inhibitor Mipz.
pubmed doi rcsb
source organism Caulobacter crescentus
molecule tags Replication
total genus 84
structure length 265
sequence length 268
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09140 MipZ ATPase MipZ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2xj9A00
3I1FA 4PC2A 1F6BA 2VYFA 2CL0X 4EDHA 4TZ0A 4LRWA 1GNRA 3QXHA 2IUTA 3AH8A 2WV9A 4IXNA 4BZXA 1KMHA 4JLOA 3AF2A 5FUVA 1X8KA 4B2PA 2HCBA 1Z0JA 1E4YA 3CX6A 4DLSA 2HF9A 1SVOA 4HZUB 5FR1A 1E94E 3IKJA 4ASUD 3I3SR 4QM6A 2ZR7A 3CX8A 3RS0A 1N6RA 4OI4A 2ZR9A 4PQRA 2NGRA 2KSQA 1UPTA 4XWOA 5BYKA 1A5TA 4JBYA 2ZI9A 1P4SA 1XPUA 3B13B 1ZU5A 4XJXA 1GSIA 3TSZA 3FB4A 4DSOA 2BCJQ 3K70B 1IY2A 1OXSC 4Q9HA 3GP8A 2Z4RA 4TSFD 1RRCA 1E69A 2VRWA 1Z6XA 1GWNA 2ZJZA 1M34E 4Z8XA 2VTKA 3PEYA 2X8AA 2ZE5A 1XBTA 5G3ZA 3CRW1 1E79D 4O2RA 4RKEA 5FOUA 1HE8B 2MSCB 4GP6A 4PPNA 4D25A 3PUZA 2PX0A 4URWR 4XOIA 3B8HA 4KODA 1NY5A 3LLMA 1Z2CA 1OIVA 4DCTA 3ZJYA 3RRMA 2FFAA 4HLCA 2HEIA 4GI7A 1VHLA 1OYWA 3QBTA 1U8YA 3DZDA 3ZZUA 1M6NA 1CTQA 1MT0A 1RRFA 3SJCA 4JVLA 1MOZA 2FZLA 2ZRBA 3OE7A 4RZUA 3CUEF 3MUFA 4KFSA 3L0IB 4JLNA 2OHFA 3ICQB 2ZTSA 3WY9A 3LH5A 2CCKA 4BQSA 3CH5A 4TMZA 4LJ6A 1ZIPA 2P0EA 5DI3B 3HDTA 2AWOA 4MDEA 2OFOA 4B6EA 5KSYA 3K9LA 1XMIA 1AM4D 4DEXA 1VYTA 2IX3A 3AB3A 3AQ4A 4DLVA 3C5CA 4G5RA 4UXJA 2QENA 2D06A 4URUR 2F6RA 3BD9A 1W48A 4XVQA 3TQCA 4A8JC 1DOAA 2RH5A 1G4UR 2G3YA 2Q3MA 4BFSA 3QXCA 4L9WA 2GBLC 4DCVA 1MABB 2XXAB 1CIPA 1JJVA 4QGFA 3GJ5A 2ORWA 1NY6A 2VH5R 5GVRA 3WRYC 4JKIA 4RFSA 3U4QA 2O8FB 2FDCA 3E5HA 1BYUA 3N5CA 4M0LA 3KUCA 2IYXA 5G53C 3MJRA 4FCWA 3I61A 3MLEA 2ZAOA 2DFLA 3W90A 4V0MA 1S4QA 3U60B 4C0SA 1M7HA 5DYGA 2ZVPX 1Q44A 4DCSA 4MA4A 1Q1QA 3GLGA 3TVDA 2DR3A 2ZANA 4BFUA 1XD2A 4F38A 4TLBA 4XSHA 1WE2A 2Y8EA 3E2IA 4LHYA 4Q7JB 3DM5A 2BDTA 3FVQA 5AR1A 3WNDA 3WMGA 2XITA 2UZ3A 2FFBA 2WPDD 2Q3FA 2A5JA 3QVVA 2F43A 4KVGA 4D0GA 1G6OA 1CKEA 2FPMA 2ZJ5A 3N70A 4CEJB 1JB1A 1U94A 2J59A 3QKRB 3H2YA 3IUYA 5CDFA 2RMKA 3FKSD 1KO8A 3FMOB 1D8TA 1G17A 1E1RA 3R8CA 3GD7A 4P33A 2D7DA 4UXHA 4RZ3A 1EFTA 4MRVA 1E2LA 3LVRE 1Q20A 4GMDA 4EUNA 2IC5A 3CB4A 4TL9A 1LY1A 1Q22A 1V5WA 2J0SA 3VNVA 3CM0A 1F2UA 1EFCA 2E9SA 4ZDWA 2DWQA 2WVJA 4DEYA 2G1JA 4U02A 3M1IA 3UIEA 5EE0A 4UNPA 3RDPA 5C1BA 3AGPA 3CZPA 5JRJA 3U3JA 5DSZA 4F4JA 3EPHA 3A4NA 2WBLC 4K8OA 4LHWA 1IBRA 1N5KA 1G64A 3W6NA 1NG1A 2DWPA 5DHAA 5EE5B 5EXSA 2H92A 4C7OB 4HB0A 4RZ2A 5HZHA 2OFXA 1ZUHA 2ZE6A 2GDJA 2ZJBA 4KO8A 3GLIE 3LWNA 2HXYA 4QGAA 5DN6D 4L15A 3CWZA 1GG2A 1ZMXA 1K5GA 2PZGA 2VIIA 3RS3A 2CL7X 3ND9A 3PENA 2ZRNA 1GL6A 2VPPA 2QNRA 4TLCA 1JALA 1U0LA 1ZAKA 4FCTA 3TUIC 2OFWA 1RPZA 1KI6A 1LNZA 1NBME 3THYB 2WJIA 1DS6A 5LD2B 4M21A 2I1VB 1IN8A 1G9XA 2GHIA 4PAQA 1MO6A 2AR7A 1HUQA 4LV6A 4ZIRA 1KO4A 1KK3A 1OJLA 2BEJA 3SFVA 4D26A 4CGZA 3OIWA 2AK3A 2R6AA 1W5SA 4FN5A 3BE4A 1II8A 2AKAB 4Y0AA 1CLUA 3KQHA 3OIVA 2FH5B 4HDQB 4Z1MD 4B2IA 3KKOA 2JLUA 4MDFA 4EPXA 1T8TA 1RYHA 4RJLA 1K6MA 1SKYE 1S0UA 3DM9B 2C78A 1IONA 2FWRA 1QVRA 4KHZA 1W36B 2ZJAA 2VHCA 3K0SA 3OEED 4H1VA 3R9WA 2P6NA 2WMOB 5C4MA 2W6IA 1XEXB 2PMKA 3MRSA 4QHTA 1FW6A 4PPFA 2N42A 3SNHA 1OLOA 3A1UA 4Q02A 3X1YA 1GNQA 2XX3A 3SE0A 3C15C 3SYLA 5BQ5A 3CRQA 3TRFA 3AF3A 1W4AA 1E2KA 1SXJD 4LGMA 2ZRFA 3P32A 2JLWA 1JR6A 4W7SA 2ORIA 2VP9A 3RS7A 3BC1A 5EP3A 2IYVA 1G8FA 1UDWA 4QHSA 1NG9A 4EJSC 1Y3AA 3RWOA 3VNUA 3KXIA 2WJHA 5KO2A 2KB0A 2FN4A 3CNNA 4XH9B 2B8WA 2EFGA 2FGJA 4D0LB 1GZSA 1ANKA 4DKXA 2CVHA 3RWMB 1XJCA 5AUPB 2AWNA 1GITA 2JJ8A 1KI4A 3AVOA 2YINC 2KI5A 2J46A 2ZE7A 4Q4JB 3NH6A 3L82B 2C95A 1HURA 5FUYA 2R62A 2XZPA 5HKKA 4QM7A 3AV0B 5HKKD 1SKYB 1X8LA 4QNRA 4GOJA 1M8PA 4ZCIA 2YKGA 1OXXK 3WYFA 2Q9BA 2P5TB 3M4YA 1BKDR 3VX4A 4C2UA 5CYPA 1W7AA 1ZUNB 5E7IA 2P3SA 4PZYA 4HZUA 2XTMA 3W8RA 3HPRA 4FMCB 3BS4A 4OQFA 3I8SA 4YXWD 4ZV4A 8OHMA 5F98A 1OFUX 3AVYA 4M1YA 1AS0A 1QBKC 3PUVA 1ZD9A 3LRPA 4Q7KA 5BW8A 4LJ8A 3MWYW 2ZROA 4NYIR 1W4CA 1W1WA 4TL7A 1G7RA 2ZRJA 2JLRA 4BLQA 1NN5A 4E22A 4Q66C 1R10A 4L4UA 4BFVA 2C8VA 1R0ZA 2ZIAA 2XZOA 3NTUA 3KJIA 3RLFA 2QT1A 1ZP6A 5CK5A 4CW7A 1D9ZA 4IEIA 2QTHA 2V55B 1XU4A 1YQTA 2P65A 1PJRA 4I1OA 3AM1A 1DE0A 1G7TA 2C77A 1AS3A 3B1VA 3NHBA 1CU1A 4PX9A 2RHMA 4P32A 2YJTD 4CF7A 1I4LD 3NXSA 5EP4A 1SGWA 1GAJA 2L0XA 2P6UA 3FHCB 4DHEA 1WDTA 4CZ2A 2KJQA 2R6CA 1D9XA 1N0UA 4DLRA 1FNMA 1TTTA 1E2NA 1Z29A 3ZZTA 1F60A 5JCPA 3K8YA 4MKGA 4IDPA 4RZXA 2B8TA 2Z5FA 4G3XA 1ZNZA 4OHVA 1VCOA 2BM0A 2R8RA 5E3HA 4DDTA 2BMJA 5DI3A 5JLJA 3K09A 5L3VA 4GT1A 2W2TA 4FMDF 1J2JA 1P2VA 4XSGA 5JJIA 2C2HA 421PA 2QU8A 3AVQA 4A0RA 3CF2A 4S2EA 2GWHA 1E0KA 5D3MB 3DEFA 2J9RA 3LX5A 2QN6A 2QPOA 1U90A 1Z3IX 1AIPA 3KKMA 5IK2D 4JS0A 1G6HA 3WP0A 1MR3F 2GXQA 3QPVA 5EE9A 1NMXA 1MABA 4G5GA 3QVUA 4NCNA 2XXAA 3GLGE 1FX0A 3ADKA 2PLRA 2C9YA 2QA5A 2I3BA 2O8FA 1KHTA 2GTPA 1DVRA 3O8DA 3AVWA 1XTIA 3HU2A 4QJ4A 5HCIA 2G83A 1II0A 4F91B 1RE0A 4BFXA 3ZYCA 4DB4A 5EZ6B 1AKEA 4JSTA 2XB2A 4B74A 2F9MA 4KV9A 4P3YA 3X1ZA 4P4SB 4BFYA 3CBQA 1EG7A 3CONA 5TV2A 1E0SA 1JR3D 3BORA 4B3BA 3L8ZA 4DDWA 2CE7A 2JATA 2DPXA 3E70C 2FE4A 4GRAA 4POAA 1XTRA 4PC7A 1I4TD 1R0WA 2JIZA 3AKEA 2VHTA 4CEJA 1GRQA 1K8RA 4B32A 1Z5ZA 4B33A 1U99A 3O8CA 5LB4A 3QKRA 2G88A 5CLLA 1VPLA 2RB4A 3SS8A 4ARZB 4A9AA 4I4LA 2HCJB 2MMCA 2FEMA 4C0AC 3U6KA 2QEQA 5L3QB 4W5WA 1XEFA 4PTLA 3H0KA 3T5DA 3BH7A 3KDSE 4B48A 1RRGA 1XMSA 2CL6X 3OIYA 4LBWA 4QC2A 5FBRB 3K0AB 3EARA 3Q9LA 5FPTA 5KDLA 4MRRA 4TWZA 3QKTA 5SZKB 1NN0A 3MCAA 2CNWD 2GXUA 3QOFA 2FPLA 4Q4LA 2ZUBA 3ASZA 5CB6A 5AJVB 2UZIR 2C96A 3EWAA 3C14C 3PUYA 2D7CA 3TVTA 3W3ZB 2IYZA 3EZ9A 3KJGA 5K8LA 2VEDA 2ZI5A 1OW3B 4S35A 1OV4A 1BOFA 1OPXA 5GJWC 4L8GA 1J70A 5FBQB 2ZRDA 4FIDA 3RC3A 2RHDA 3SJBA 1QHHB 3NEYA 4EQ6B 2ZU0C 3A1SA 2QGZA 4C7OA 2QMHA 1C4OA 1ZC3A 4NYMR 1LF0A 2IW3A 3KZ1E 1UF9A 2HLDD 3OZXA 2EU8A 5CM9C 2BJVA 2ZI7A 2J45A 1AK2A 3L0PA 1E9RA 2F3RA 3KXKA 4PPGA 2RGGA 1S96A 3P20A 5GVSA 3EPLA 1IJEA 2AXPA 2Q9AA 2QI9C 2VQSA 4KAXA 4LYFA 1WB9A 5GADl 1EGAA 2VP5A 5KU1A 4TMKA 3LX8A 1W46A 3THYA 1MH1A 4Z51A 4X8LA 1XEWY 3B2EA 2QM7A 4E09A 1P3JA 2QSYA 3O8RA 4HB3A 4QJ3A 3WHLA 3A58B 1XZQA 2CE2X 3PITA 3EIHA 2QRZA 1CJKC 2ZS7A 3MAAC 3R7WB 4CRWB 1GM5A 2PCJA 4ZI3A 1VCIA 1FNNA 2CLCX 1T91A 3UMRA 4TQAA 2AFIE 3RANA 1NN1A 3M0EA 4RVCA 4OL0A 3ETLA 4B3CA 2JLZA 1NVWQ 2WWWA 2ZJ2A 2FJUA 2FV8A 3AVPA 3RRNA 1WRBA 4DC9A 4C4PA 4DCNA 2ZYTX 2J3EA 2O8EB 3DMNA 4B34A 5J4KA 1WXQA 2P6RA 2YYZA 3MWJA 3PEUA 4UNSA 5AJYA 1CBUA 3RAPR 1J90A 3AUYA 2D74A 4LPKA 2J7PA 1Q1ZA 2YHSA 3GQBA 2GCOB 3IIMA 3QXJA 1XEXA 4IOJA 4KBFA 5AJZA 4ZCMA 1KK0A 1CR1A 4LHZA 4QL3A 3Q7PA 2WWGA 4GDFA 2ODNA 4TLEA 2IEYA 2W2XA 3RABA 4O0MA 2OSBA 3OHMA 4UNNA 3IIKA 4M2LA 4ACAA 1IHUA 4OQMA 1G20E 4YMWA 3EPJA 5CB8A 4L16A 2OBMA 4Q1DA 3MSXA 4AYXA 1VG9B 2ECKA 1QDEA 5JWOA 1FPMA 3K9HA 3WP1B 4C0KA 1NIJA 1XTJA 4G0NA 4PFSA 1E9CA 3NC0C 1LF5A 1NBMD 5FL7A 3VKGA 1E9BA 1XXHE 5FL7D 1SVIA 3KFVA 3ZS9A 1Z0AA 4PHFA 4PC3A 3ZH9B 1NVVQ 2NZJA 2WWFA 4TTRA 5CYOA 3L0OA 6Q21A 3K9NA 3MWKA 4UKDA 5FBLB 4JIMA 4Q1AA 1GL7A 2ZS9A 5M04A 5EQTA 3LY5A 3HR8A 3OEHA 4IVPA 4Q4JA 2ATXA 5P21A 4D4JA 2CK3A 1KZGB 2WICA 1E98A 1EESA 1AQYA 1AQUA 3ZZ0A 5HR5A 1UEIA 1FFHA 3NG1A 1IXRC 1G19A 1TL7C 2VBCA 4PANA 3V4RA 5A5GA 3K0CA 1DADA 3QKUA 3P4YA 4B3DA 5JS7A 3U6BA 3IPXA 5J4VA 1QG4A 3DPUA 4H9GA 3THXB 4OQNA 3C16C 1UKEA 2C99A 5J4HA 4F7WA 1W2GA 4GP7A 4D80A 2IT1A 5FBVB 3P26A 3CF6R 1L4UA 4EAQA 3H1TA 3BERA 4US1R 1IXSB 1NKTA 3K70C 2QGNA 3PUXA 1MO5A 1X1RA 3ZVNA 3BIFA 3U3RA 5FTLA 1S3GA 1DPFA 1LS6A 4DLYA 5L3SB 2FSHA 1YE8A 4HAYA 2V7QA 1DAIA 3C5HA 2OZEA 4OHZA 4BLOA 5E7MA 1FZQA 2RGNA 3K0FB 3UATA 2WM9B 4FXPA 3CW2A 1XXHB 1ZINA 4LUCA 3TIFA 5TY0A 1KSFX 3GJ8A 4D0NA 1G8PA 4M1KA 3Q3JB 4PSVA 2PBRA 5BN4A 2GRJA 1OKKA 2Q6TA 4X8HA 5IHPA 1IAQA 1U8AA 3EZ6A 2NO1A 4O2LA 5DH9A 1KSGA 3EX7C 2A5FA 2XTZA 3AP2A 4A82A 1E2PA 1L7VC 2YOFA 2VHUA 4II7A 1KKLA 5KNBA 3A8TA 1KNQA 1II9A 3DZ8A 2WOJA 5UKDA 4YMTA 4KYIB 5AJWA 1E32A 3I73A 2H1LA 621PA 3AEZA 2Q0HA 3K0EA 3JVUA 1TUEA 1ZM9A 4X8OA 1M7GA 1Z0FA 2IS4A 3T34A 2Q9CA 3IO3A 4BWYA 3K09C 3VR3A 4OQLA 1H8HA 1W47A 4M9SA 4DLTA 4M9XA 5D3MA 2BKEA 3T1QA 3W9YA 3H86A 1X3SA 2VLIA 5H70A 3DMDA 1DEKA 2H16A 3LQRA 3UANA 2ZEJA 3UWKA 3OESA 3CH4B 2GEDA 2BBSA 2W2VA 3X1XA 1U98A 5KUTA 1JAIA 1Z63A 3QSYA 4A6PA 1GRNA 2GEVA 1XNJA 1RC8A 4KJZA 1Q3HA 4J0QA 4V0LA 1G7CA 1X8JA 4KYUA 4Z54A 5JHHB 3I72A 2H8KA 1NRJB 3TQFA 1PLKA 4CEIB 1TEXA 1Q0UA 1KYIA 1NSFA 2XJ9A 1D2EA 1OT3A 4P4SA 2F3TA 3OE7D 2QTVB 4FMBB 1ZM2A 4LC1A 5JSZB 2MMGA 2OO7A 3QIAA 3QUSA 3ZIAA 1TUIA 4MGYR 1ZRHA 4IOKA 3VU9B 2OXCA 5IRCD 1ZYUA 4RCYA 4TQUS 4H1UA 4F93B 2JDIA 2H17A 4Q1BA 1QHSA 2JDID 2JA1A 3PR1A 3A6PC 2ZRIA 1R0XA 2LKDA 3ADCA 1XJQA 5EJEA 1KK1A 4ARZA 4N3NA 5AUOB 2JLQA 3LNCA 5L3QA 2IYWA 2QAJA 2J1LA 3HU3A 4DT1A 1DAHA 1FX0B 3W34A 2ZYVX 2NPIA 4PC1A 5GJCA 3KTAB 2LCFA 4GZMA 2FNAA 4RD3A 3ZQJA 721PA 3K0AA 5KNCA 1Q1EA 1NI3A 1F3OA 1NNEA 3EIQA 1EWQA 1XJ0A 1GKUB 5FPYA 2OESA 1XX6A 4ZDJA 2PZFA 5DHFA 2VO1A 4IDHA 4AKIA 2HUPA 3A4MA 2N46A 5SZHB 4PQFA 4C9BA 1NN3A 3IIJA 3D31A 4TLDA 1Q57A 1FP6A 2V8OA 1XRJA 1A7JA 3EIEA 1G3UA 5B57C 1GFIA 1NSTA 1QHHA 4M1WA 4LHXA 3AF1A 5LBIA 1LV7A 2XNSA 4OJQA 4EQ6A 4M8NE 3G0HA 1TF5A 1YHNA 2VSOA 2BBOA 1ZNXA 3D6TB 2RGAA 4RY2A 3AF0A 3GJXC 3K53A 1FTSA 4QBGB 2EYUA 2DYKA 3IO5A 3W5IA 4TTPA 2EFHB 4KFUA 1E1RD 5K8IA 1TQ2A 3C7KA 4MRNA 1OIWA 3KJEA 3QF4B 2CCGA 1NLFA 4HB2A 1SVSA 4OK3A 3WBKA 5J47A 4LJ4A 3FPAA 2DY1A 2A78A 5LD2C 2OCBA 2QL6A 2ZYWX 2J0VA 4L9SA 2R6FA 1AGPA 1Q12A 2BIFA 2ODBA 2ZJOA 4ZPXA 3TAUA 5LDDC 2GZAA 2IYTA 3M6AA 4LJYA 3R7WA 1QRAA 4YMSA 1ZNWA 2PX3A 5TXGA 1NF3A 3CRVA 3FFBA 1XDBA 1DTSA 1KO5A 1YZTA 2WIBA 1PUJA 3SYKA 2BBWA 4LPSA 5AK0A 2O52A 1S1MA 3UMFA 3CRRA 1CP2A 1T4GA 1N2CE 2A7QA 3I8XA 1KO1A 5LB2A 2O8EA 1LB1B 3RS5A 2VHQA 4UNRA 5EUQB 4AG5A 5CIWA 2OM2A 4OK5A 1YJ5A 1YR6A 4B35A 1W36C 1U9IA 1UBGA 3ZQ6A 3LBNA 3QI2A 2GCOA 4UXIA 1WMSA 1M74A 4BEJA 3EW9A 3MWLA 3P1JA 2DBYA 3NIBA 4YC7A 3UG6A 3BB1A 4RKFA 4N0DA 2QM8A 1U0JA 3PCRB 3GFPA 4WZBE 5DE3A 5KSZA 1WF3A 2GJAA 1TEVA 4OK6A 3RHFA 4C0LA 1QHYA 2XB4A 4GSYA 4AKHA 1UBFA 2DFKB 2OILA 2QAGB 4URYR 1GUAA 3U7EB 4RD0A 4FWTA 2NZ8A 3N2IA 2ERYA 2QP3A 4EPYA 1FMJA 2QP4A 2JCSA 3S1AB 4Q00A 3X1DA 4MYTA 2BMEA 4JLAA 3T1VA 2F9LA 1EFRA 1EFRD 1E2FA 2W0MA 3KKPA 3FOZA 5EUMA 4HYYA 1WP9A 2IHYA 1XMJA 2CVFA 1IQPA 2HT6A 4KSBA 4X8MA 1UAAA 1T8UA 2ORVA 4HAXA 3LA6A 2NO6A 4NYJQ 5EP2A 5AJXA 1ESNA 5KTYA 5IT5A 1GNPA 1S9HA 2BKUA 2CJWB 1GVNB 2QMOA 2W6ID 5FTMA 1G41A 5GJVC 1BS1A 2ZR0A 2ZSFA 3B1ZA 1AGRA 5J4LA 1A4RA 3GFTA 3BBPA 1DAMA 4TMWA 3FHOA 3TUJC 1E2MA 4RD2A 2D4HA 3CLVA 4Q9KA 1IXZA 3KUDA 4MITA 2GESA 5DYIA 2NO9A 3WBJA 4A0HA 4CVNA 2Q3HA 1TMKA 4M1TA 3K0CC 4XD7A 5BN3A 2DFTA 2MSEB 4MUBA 4PO8A 1VCMA 4CDGA 3THXA 2YWFA 4MUAA 1JXMA 3RVBA 1NVUQ 4WW0A 4FD2A 3GJ4A 2YWHA 1N3BA 2ONJA 2AHOA 3LBIA 4MYCA 1OFTA 2O8CB 3LVQE 4D82A 1KTVA 5JBQA 1OXUA 2KBFA 1CS4C 1ZU4A 2FEOA 3QENA 3T12A 3QBVA 5E7JA 5FL3A 3B1WA 5FTJA 4B75A 1LS1A 2GCPA 5L3SA 2EWWA 3AVTA 4B47A 5FOSA 3AVUA 3CNOA 1TU3A 3K0FA 1RZ3A 4F92B 2PJRA 3RS2A 2RGNC 1YKSA 1Z6AA 1N6OA 4PSKA 1XXHA 3FWYA 4W5JA 3T1TA 1DAGA 4PR0A 3ZVLA 3BB4A 3GJ3A 5FI1B 4DUGA 5B30A 4IRUB 1YZLA 1CR0A 1XWIA 2W6JA 2X2FA 3CPHA 5FH9A 3QF7A 4YONB 2ONKA 3PV0A 1B0UA 3TMKA 4Q7MB 5ELXA 1A1VA 3CKLA 3HR7A 4B73A 5KOYA 1TF7A 3HWSA 4WVFA 5J4YA 2IXFA 1R0YA 1N6KA 3KKQA 3SQXA 4Q9JA 4WZ6A 1KDPA 1KOFA 4QBFA 1VG8A 2GAOA 5G40A 4PZLA 4BZQA 1YRAA 3DL0A 2GAAA 1S3SA 3REFA 3K70D 3L0SA 2ZI4A 3KQKA 2BMFA 1H8EA 4IVQA 1ZD8A 1SVWA 4Q03A 2J41A 4RD1A 1QF9A 1Z6GA 4ON9A 4XTRA 3B1YA 3BGWA 4JT4A 3EXAA 2V9PA 3EPKA 4EPTA 1UKYA 2NOAA 2AXNA 2QT0A 2QUZA 3OAAA 1W0KA 1HH4A 4MH0R 1FTNA 1OHHA 2TMKA 3U3OA 1HYQA 5AWFC 3VKWA 1OB2A 1BMFA 2VP2A 3SBDA 1BMFD 1X1SA 3DVLA 3R8FA 1N6NA 3FFAA 2WMNB 5J5CA 1QHGA 2ZRCA 3QPWA 2FG5A 1NIPA 2ZRHA 4OI1A 3U3MA 1P73A 2HJGA 3IPYA 3NBXX 3IBGA 2JLYA 4JVSB 5CIQA 5KDOA 4CEIA 1QHNA 2J5XA 3TUZC 4EPVA 4TYQA 4QXAA 5JJLA 4FMDB 4P4TA 4QFMA 1TQ4A 5EE3A 2NG1A 4TL8A 4BECA 2ZAMA 4TN1A 5JSZA 3UWOA 2ZRMA 4NCKA 2A9KA 1IM2A 1O87A 3VU9A 2A2ZA 5K8TA 5BYJA 2IA5A 4Q48A 3CX7A 1UBEA 1ZM4A 2JJ1A 4IDOA 4TMXA 3BK7A 2JJ1D 3H4MA 4LBZA 3U2QA 2NMVA 1YRBA 4MQBA 4HUTA 2FOLA 5CM8B 2GF0A 4HAUA 3IEUA 4Q47A 2RKOA 2JAQA 3GFOA 2D2EA 1G5PA 3D8BA 4LJ9A 3H84A 1Z28A 1IOZA 1HY3A 3KTAA 2ZI3A 3VQTA 2JEOA 3ICEA 2ZJYA 4QJ5A 2QBYB 4JYBA 1IN5A 3NDBB 4R9UC 2VF8A 4LJAA 1E96A 2GKSA 2A5GA 2LKCA 5JEEA 1KKMA 4JYCA 1RJ9A 2ZRPA 4ZI2A 2CHVA 2O0JA 2VP0A 1AS2A 5DI9A 4TT3A 3D7MA 4TT3D 3SHWA 3GCGA 1CR4A 4PHGA 4V0NA 1ZNYA 1SQ5A 1CJUC 3V9PA 1DG3A 2IEZA 2H57A 4I99A 1G4AE 1SKQA 2CDNA 1UDXA 3B78A 4AK9A 4M4SA 1R5NA 1W4BA 2ZRLA 5C2JB 3GEIA 2W00A 3F3YA 5H68A 2JIZD 4HLUA 4IOMA 1OYYA 1DBSA 1TX4B 4IKEA 2QZ4A 1G3RA 3L2OB 1KY2A 3QG5A 4PO1A 2XOKA 2ZRAA 2J7KA 3A1WA 4LYJA 4V03A 4EPRA 4MKIA 1XD8A 5DNYB 5GJBA 2KWIA 4DT1B 1UKVY 4NCIA 5JMTA 3LDAA 1E1QA 1TADA 3QF4A 4JJZA 4LV8B 3UXMA 2QPTA 4G5QA 3U7HB 2CLDX 1PUIA 1AN0A 1JECA 4W5HA 1CRQA 4AC9A 2NQ2C 3U7GA 3WXMA 1D5CA 1FUKA 3LD9A 3VR1A 2QE7A 1Z83A 1B23P 2EFDB 4URVR 3T61A 2ZYUX 2CHGA 4DCUA 3C41J 3LXRA 1A2BA 1YZNA 3GEHA 2OLJA 4M1MA 4TYYA 4QNMA 1RYFA 2GXSA 2GJSA 4UNQA 1E2IA 4GZLA 3SN6A 3TBKA 4OI2A 5KYKA 5FOVA 1G1MA 4BEBA 3VMFA 4B2LA 3PQCA 1HQYE 1QHXA 3UPUA 2IYRA 1U9IC 2JLSA 4DVGA 2IYLD 1W49A 1R5BA 3JZMA 3CPEA 1E9FA 1T5IA 2OCPA 4AI6A 1XMVA 3GLHE 1E99A 4LZZA 4A0FA 2OAP1 4NPHA 3IILA 1M1YE 2EWVA 1Z0DA 4PAMA 1UJ2A 4JLPA 2QAGA 4BGDA 4GOKA 4AD8A 3V00A 3QKSA 5JI3E 2YWEA 1F2TB 3HP1A 2O8DB 3S1AA 4KSCA 4LCBA 2WWXA 2HYDA 3ZVRA 1E6CA 2FSFA 4HAWA 1XPRA 4LX0A 4JJKA 4QOSA 4E5UA 1N25A 2ZM5A 1P9RA 1T3HA 1BYIA 2V1UA 2PMDA 2F1JA 3TNFA 3LAWA 4QBIA 2FPKA 5FUWA 3QY0A 3ONWA 3THOA 1N6HA 2H5EA 1W36D 4NCJA 1OE0A 2Z4SA 4EPWA 3KJHA 1PVOA 2A30A 3DOEA 2CJWA 2J7PD 1G3MA 2O5VA 2PLFA 2Z43A 2AKYA 3SJZA 3ADBA 2HXSA 4PHHA 2FZ4A 4NKRA 1NP6A 4QHYA 5CLQA 2G9NA 3SJAA 4B71A 4A36A 4IDQA 3VKHA 1PLJA 2P5SA 2PEZA 1AA9A 2IXEA 1VCNA 1HEIA 2EYQA 1VYVA 2GF9A 1ZIOA 4MKHA 5KNDA 1QVAA 1S9DA 3AKDA 3B9PA 3G5UA 5DIFA 1XTSA 2PT5A 2IS6A 3NBFA 2VSXA 1KI7A 1SXJE 4K81B 3SQWA 1UM8A 2ZITA 3GLHB 2NTYC 4GL2A 4B6FA 3THWB 4G5OA 5D3QA 2O8CA 4K46A 4C0JA 1Z6TA 2G1KA 3BFXA 3PFIA 4WXPA 3X1WA 1RFLA 2UKDA 4HI0E 1ZC4A 5SZIA 5FTKA 2C9OA 1LVGA 1XCMA 2O0HA 2RCNA 3FTQA 4M9ZA 3TR5A 5EXXA 3RSOA 4C0BA 1E2GA 1OF1A 2V6JA 2VF7A 2YC2C 4DLUA 3PXGA 1VTKA 2N1BA 3UMSA 1T5LA 4NYIQ 1FP7A 3AF4A 2BBTA 4MGIR 1RIFA 3OEHD 3B7GA 2BWJA 2X19A 1CF4A 3OFNA 2CK3D 1KY3A 3TLXA 2WJYA 3WYGA 1FQJA 3UKDA 4AWXA 4URXR 3QPUA 4XIGS 4Z8YA 4A2PA 1GOTA 1R5OA 3QNUA 4B3GA 1KO7A 3JZAA 2NIPA 4Q18A 3VFDA 1YR8A 2IHBA 4HATA 3IQWA 1R8QA 2KBEA 2B92A 5EP1A 2IL1A 2R6DA 1JEEA 1UEJA 3DOFA 4WBSA 4Q1CA 5HZKA 4IVRA 3SFZA 3X2SA 3EASA 2OUKA 4WIAA 5JZVA 3MJHA 1KAOA 4YMUA 1N6IA 1NJGA 2GZHA 1KGDA 5G41A 4PAOA 1P6XA 2WAYA 1SXJB 1EX6A 3E1SA 2JJ2A 3HYTA 2HT1A 1G3QA 1E2JA 4CT4B 4DSNA 1XTQA 2V7QD 1I4DD 1ZCAA 2ZSBA 2F55A 4KU4A 1IY1A 1PZNA 4JLMA 1HV8A 1OH6A 4TYPA 4A2WA 3SC3A 2FMXA 4I81A 3KB1A 1COWA 3TAHA 3GJ0A 3REGA 3BJIC 5KSOA 2VP4A 4E07A 4FWIB 2W0SA 2P2LA 4DIDA 1ZD1A 4M1OA 4CEHB 1OKKD 1Z08A 1EFHA 4DDUA 1AJEA 3W5JA 2PT7A 2WTUA 1EX7A 2G6BA 1NMZA 1YR7A 4PZZA 5EE1A 3IEVA 2XGJA 1MO3A 4TZ6A 1IJFA 1ESMA 3W6OA 1GP2A 5HTKA 3EC1A 4PXAA 1AZSC 1EWRA 2OAQ1 1VG1A 2IYSA 4UJ3A 4ZCLA 2HV8A 4ILEA 1T6NA 2MSDB 4BZPA 1P62B 1N0VC 4TMTA 4BUJA 2ZUCA 1Z6YA 4B3XA 4QKQA 2OLKA 1DAKA 4ASUA 1R7RA 1H8HD 1NLZA 3AKYA 1P9WA 4OQXA 2ODWA 4D2IA 3GLFE 2H18A 3DKVA 1CJVC 4PO9A 3AGQA 3EWSA 4YDHB 4C2TA 1RVDA 3DKPA 4LSGA 1E9AA 1LTQA 2RGXA 1QHIA 3EZFA 1N5IA 4US2R 2RGEA 4LI0A 4BFZA 2QY9A 3T06B 1L4YA 4NTZA 5JHGB 3T15A 1U8ZA 4TSFA 4ABYA 2QBYA 5B58C 3Q7QA 4KFRA 1HQCA 2QP9X 4OJKA 5SZJA 3ZGXA 1P60A 4GPTA 1E2EA 2AD1A 4OHWA 4YMVA 1D6JA 2IUUA 4HDCA 1E79A 3CZQA 4IFEA 5AUQA 1G3IA 2BEKA 4OHXA 4TQ9A 3JVVA 4D4MA 3A37A 1ONBA 1CEEA 4PPQA 1OSNA 2BJWA 2GK7A 5FTNA 2QMUA 3ZIAD 4BLRA 3FE2A 1E0AA 2NO7A 3FHTA 1VIYA 5CJ2A 1JR3E 1A2KC 1K5DA 3CO5A 3WMFA 5K8UA 3BB3A 3QG1A 5FUXA 3VR5A 1GIAA 1FL9A 1JPNA 2Q21A 2WAXA 5TARA 2EFEB 3CNLA 4N1AA 4NDZA 4EFLA 3TGPA 4HLUC 4YQFA 3WHKA 5A4JA 3LLUA 2O0KA 4NCHA 5FFMA 5BXQC 4V0KA 1XCGB 1YZQA 4AG6A 1GTVA 5AUNB 2PEYA 4IJMA 2R65A 3VTKA 3K1JA 1R4AA 1YU9A 2BM1A 2EW1A 2FX3A 3KL4A 1C9KA 4PQYA 4DLZA 3A1TA 4KBGA 1WA5A 2CHQA 4NYMQ 4IW3B 3GLFB 3B85A 3I32A 2AK2A 4C30A 2Z6VA 1JPJA 3HU1A 2OT3B 1KZ7B 2ZJ8A 1W5TA 4AYWA 1KDTA 5JWHA 1RJ9B 1S8FA 3NHAA 3SOPA 3ECCA 4HUQB 3NC1C 3OIUA 3KFXA 4AY2A 2QORA 4IFBA 1LFDB 3MMPA 1ZBDA 3ZVMA 4ITRC 3VR4A 1JXOA 1Z06A 4Q5IA 1HE1C 2PJZA 3V4FA 4RCZA 5CJPA 2O8BB 4PSAA 1WCV1 4GMXA 1U2RA 1GL9B 2XTNA 4URZR 3D3QA 4DXAA 3GEEA 1Q21A 4JVNA 4JVMA 2C98A 1G8HA 3KB2A 1WQ1R 1GKIA 4DRZA 3UG7A 2QG6A 3TSOA 4G01B 3CRMA 4FCVA 5HPYB 2XSZA 3C8UA 2XSZD 4LJ5A 1WBDA 5IF9A 2WSSA 2WSSD 3W6PA 3IHLA 4Q4HB 4LHVA 3VR2A 2XZLA 5BN5A 2WPDA 2FA9A 3GJ6A 4KXFB 1FOEB 2NPFA 2GZDA 4LYAA 2HDNB 3KQNA 1KJWA 2QAGC 1KI9A 4A8JB 1FMLA 2J0UB 5KDDA 1F2TA 3SR0A 1Z0KA 2O8DA 4R2HA 5KHOC 4DZZA 3IDQA 1Y63A 3FKSA 5KPJA 4IXMA 4QGGA 4R71A 1TQ6A 1NKSA 3P4XA 4FINA 3F8TA 2C03A 1NJFA 1CJMA 2ODEA 3FKQA 4KITB 4WZAE 1VDZA 2YVUA 1G5TA 2HJVA 2HYIC 1VECA 2OBNA 1TNDA 4PHTA 1V43A 2RGCA 5F3WB 2XJ4A 1I2DA 1RKBA 4HLQB 1KMQA 1LW7A 4RFVA 4BE7B 2V1XA 1JJ7A 2V6IA 2WIAA 4KFTA 4YLGA 3EAQA 1TF2A 3AUXA 1SZPA 2IYYA 3FMPB 4JBWA 3W3AA 1KI8A 4MYUA 2ZRGA 1E2DA 4US0R 4TTQA 2X1VA 2GCNA 3I4LA 1N5LA 4KLNA 3DDCA 5IDVA 4GOXA 4PC6A 4Q1FA 3A4LA 5FOXA 1MRSA 2JLVA 2IF2A 2K5UA 4JLBA 2BMDA 2IS1A 4A6XA 3BAFA 3QKSB 1CULC 2A5YB 4LBVA 5JFGA 3NVAA 2SHKA 2ANCA 5DN6A 2WWHA 3GLHA 2WKRA 5E4FA 2IWHA 3RS4A 3THWA 2AN9A 2GVDC 4MYHA 3SZRA 1Z8FA 2ZSDA 3B5JA 1UBCA 2GETA 2X2EA 1G8GA 1DO0A 5ANRB 3IQXA 2I4IA 4JSYA 3U44B 2IUSA 1XCPA 5JEDA 1FQKA 3CR8A 3NBYC 1SHKA 3AKCA 4GBMA 3AVXA 2BOVA 2ZU6A 2BC9A 2VHJA 1KSHA 4UQOA 2GXAA 3QEOA 2QROA 4QGHA 1L8QA 2QMEA 2IYUA 1R6BX 4OI0A 1JQLB 4M9QA 1XTKA 1ZM3A 4Z1MA 4HDOB 1XZPA 5C4GB 4IOLA 2GJ8A 3RRYA 1P5ZB 4R2IA 3SYNA 4BPBA 2ZXUA 4V0OA 4BLTA 1EK0A 2F7SA 1SVMA 3KQLA 5CITA 3RNLA 2VP6A 2REOA 3P27A 4XD7D 2YV5A 1W4RA 2OV2A 5C18A 4A2QA 3OEEA 5F2EA 3I5YA 5H8WA 2V3CC 3PEVA 1KSJA 4LY6A 4Q4AB 3EC2A 3SBEA 3AP3A 1SHZA 1KJZA 3T5GA 4Q19A 3CWQA 1OXTA 5JS8A 4LWZA 3WNBA 1P9NA 1QZXA 3RC8A 5JWRA 3EA5A 4M1SA 5FPHA 2WKPA 1VKJA 2AD5A 1SXJA 4BRUA 3GLIB 4U5XA 1DARA 3F0TA 4JMPA 4OBEA 5L8VA 4DBLC 3SI7A 3R20A 3KKNA 4EIWA 2IS2A 1W44A 5B2ZA 1IN4A 4LDJA 4A0GA 2H7VA 3I62A 2C5LA 2AL7A 3QXXA 4DUGD 5DGXA 4Q7LA 2PZEA 4DB2A 1E0JA 2R44A 1XF9A 1AKYA 1RRPA 2W6JD 4R98A 4A92A 5C46F 4CEHA 4B3FX 1JQJC 4D4LA 2YOHA 2A3RA 4C3ZA 1T0HB 2XNDA 4TL6A 4BFWA 1GDDA 2EFCB 2XNDD 1J7KA 1MO4A 3SEAA 3TW8B 4P0TA 5TVKA 3GJ7A 3PJRA 3EG5A 2OEPA 1JAHA 3WMEA 4JZKA 1U0HC 2V54A 4JL5A 5DLQC 3U5ZB 3Q85A 4BRWA 3J81k 1US8B 4P31A 5A0FA 1G18A 4TYWA 2CLSA 4Q9IA 2DFNA 1O3YA 5JCZA 4Y0VA 1N6PA 1H8ED 1MKYA 3BRWD 3ND8A 5KSPA 2VSFA 1G21E 1P61B 2WWYA 4KCGA 1NVVR 2X77A 4YXWA 4KLZA 3TE6A 3VHLB 1XB2A 2FU5C 1G291 4EJSB 5F9HA 2RGDA 2ZUDA 1N6LA 3OAAD 4LC0A 1W0KD 1D2MA 4DIEA 1KIMA 1OHHD 3CR7A 5JRZA 3T1OA 1TQDA 4NH0A 3MD0A 4FMCF 121PA 1W0JA 4RD6A 1E9SA 2KE5A 2ZETA 1NMYA 1W0JD 1EXMA 4G5SA 3RSLA 4F4IA 4OKSA 3VR6A 3PVSA 2GJ9A 4HZIA 5FBWB 2CEAA 4V02A 4GFDA 3O47A 2EVWX 2JLXA 4NBSA 1T0JB 2D3WA 3MFYA 4HB4A 1YR9A 2W83A 3B9QA 5KPDA 4XWKA 3KQUA 2J87A 3B60A 1XEWX 3ZD7A 3WYAA 1OIXA 1CJTC 2OCYC 2FSGA 5G3YA 4O3MA 1ZUIA 1KMHB 4ESHA 4XVRA 3BFVA 2DCUA 4C0QC 2IYQA 3QQ5A 2FSIA 1GRRA 1T3SA 2DHRA 3LV8A 1AZTA 1IN6A 4IDNA 2PH1A 3R9IA 2ZI6A 4D6PA 1OH7A 1QG2A 1FUUA 4NU0A 2GEUA 1E4VA 3QXSA 1NVXQ 1Z22A 3A1VA 4FI3C 3ASYA 2G77B 2B6HA 521PA 1HTWA 3NEJA 5TB5A 2OCAA 3A36A 1ZJ6A 1R8SA 1JI0A 5JI2E 5EZ5A 1XD9A 1P2TA 4NP6A 2R6GA 221PA 3Q8XB 4XTCS 2ZSEA 2LWIA 2GILA 1XFAA 3GLFA 2WJJA 3VHXA 2D62A 3NH9A 1H65A 4XWAA 1EFUA 2AFHE 2FFHA 3IHWA 4JLDA 2WSMA 3SHFA 2BV3A 1DAEA 1ZW6A 4JLJA 1CR2A 5IK2A 4HUQA 4LK2A 2ZQ5A 4NZYA 4W9MC 4FW9A 2D2FA 4V0ME 2G0NA 3G82C 3LO5A 3U3KA 1UADA 1OB5A 3BFKA 1DAFA 4M22A 5TDHA 2YC4C 3FMIA 1HT2E 3I5XA 1C1YA 3VX3A 1CXZA 1L2TA 4NMMA 3U61B 2O8BA 3KXLA 5FPKA 4CYMA 4A15A 4JBXA 3ZLJA 1F5NA 2OG2A 3LBHA 5DISB 2F1IA 4JLVA 1R2QA 3QJYA 3BXZA 2YZ2A 3Q5EA 4B43A 3B6EA 4TYNA 4EFNA 2XOKD 1A82A 2RGBA 4Q9LA 2CMKA 4TLAA 1JR3A 4NONA 4DSTA 4JL6A 5CDFE 2WZQA 4MRPA 1W2HA 2C9CA 4O25A 4Q4HA 5FOWA 1G8YA 4B44A 3RYTC 1G7SA 1E1QD 1KDOA 4WAUA 1ZCBA 4HLDA 1F48A 2VA8A 4MKFA 3L8YA 4E03A 1WBBA 4N0EA 2ASEA 4A8JA 2J0UA 3B1XA 2QE7D 4B76A 4DSUA 1XPOA 3TSWA 1YVDA 2GBLA 2WWIA 3EZ2A 4KVAA 4LBYA 3Q5DA 2IXGA 1Z2AA 4P4UA 3L43A 3FDIA 4WOPA 4DDVA 821PA 4I1UA 5EXPA 2QTFA 3BOSA 1X6VA 4KI0A 4RFSB 4YDSA 3U4QB 2B21A 2JASA 3FMFA 2GK6A 5FPSA 4F4CA 1TPZA 2CNWA 4EFMA 3O8BA 4LV5B 2RAPA 2ZREA 1M2OB 2Z83A 3ADDA 4LOAA 1GKYA 1DELA 5FOTA 1E9EA 2R9VA 3GLGB 2A5DA 5JECA 2B7BA 4U7DA 3CF0A 2WJGA 2G0TA 1NLYA 1XD2B 2R2AA 2B7CA 4Q1EA 4DLWA 3N2EA 1YZGA 1ZVQA 2QSZA 4WA7A 3U7FB 3VAAA 3AP1A 2GVZC 3QEJA 2E87A 1SVLA 2F43B 2WJVA 3TH5A 5DO9A 1VMAA 1N5JA 2REBA 3TW4A 5HE9A 2HLDA 4ZKDA 1MV5A 2XAUA 4IHQA 1KJYA 2JGNA 1CRPA 1N0WA 1UFQA 3C4JA 4I1VA 5HE8A 2OBLA 1JNYA 2OXRA 4RD4A 1OFHA 1P72A 4R7ZA 4MGZR 4UJ5A 2IWRA 2Z0MA 1ZM7A 4NE2A 4ZO4A 1XP8A 3U44A 1OXVA 1IY0A 1VHTA 4QRHA 2ZVQX 3TR0A 4I1SA 1VIAA 1F2UB 1KK2A 2ATVA 1J99A 4HAVA 2F1HA 5FI0B 3NWJA 5CK4A 4L5BA 3MG9A 2FF7A 3FGNA 5E95A 4ESVA 2EQBA 4ZKEA 5J40A 2BVNA 2V4ZA 4Q21A 2YOGA 1HT1E 4D81A 1D2NA 4HSEA 4CT5A 1HA3A 1Z0IA 4ZDKA 3PEWA 4BLPA 3R9XA 1J8YF 1OH8A 1KNXA 1P7CA 1P75A 2AX4A 4AURA 4A1FA 3CPJB 1NL3A 1KI3A 4M53A 2QQEA 4DJTA 2NO0A 1MRNA 2ANBA 4HAZA 4WXRA 3Q72A 3LXXA 3DHWC 2HF8A 2GNOA 3EZ7A 3RRZA 1KI1A 4Q4AA 1T3LA 1IN7A 1ETUA 2OE2A 1BIFA 2FGKA 1DG1G 2F1RA 2QQ0A 2QRNA 3I92A 1BH2A 1TAGA 4IEEA 1G5RA 3LW7A 3T35A 2P67A 2C04A 2CCJA 4BLSA 1KI6B 4D4KA 2DWOA 3ZD6A 3AVVA 2VL7A 4DWJA 2YNMA 2ZPTX 4XVUA 2PCLA 1SXJC 2E1RA 4JT2A 3GLIA 2DB3A 4DLXA 3NBZC 1S2MA 2GJKA 2WOOA 1P2SA 1Z07A 2ERXA 2FFQA 3SU8A 4ERNA 4ZIRB 5TMPA 1Z47A 3HJNA 1E3MA 3TK1A 2IBMA 3OF5A 1OFIA 2ZS8A 3BWDD 2BHRA 3OFND 1GILA 3B82A 5LPNA 3CIOA 1II8B 1NBMA 1KAGA 4NL4H 1ODFA 1J8MF 2GA8A 2WKQA 3LFUA 1DO2A 2QPAA 4LYHA 4ZDIA 4AKGA 3BH0A 2ZRKA 2YWGA 3TKLA 1TU4A 1YZKA 3BH6A 2PL3A 4RSGA 2XEXA 1ELOA 3GPLA 5JJKA 3DO6A 1T9HA 3F5FA 1JEDA 1M7BA 2IF0A 2J0QA 1G16A 4EKDA 3QE0A 5B64A 3NDPA 3EA0A 3HYRA 4QBHA 1SULA 4A4DA 4GNKA 3WRXC 1U81A 3IGFA 4QG7A 1E2HA 5EXTA 2IK8A 1US8A 4U00A 5FR2A 2UVQA 5H1YA 3TJZA 4AYTA 1RW4A 2BCGY 4LJ7A 4BASA 2WHXA 2ZSAA 4G1UC 1PV4A 1SVKA 3LW8A 4JKYA 5L3RA 1I2MA 4AIIA 4JL8A 2JJ2D 3W8NA 3GMTA 1VYUA 3PG5A 3PUWA 5HCNA 3WNCA 4EJSA 3ZDQA 5F9FA 3SDZA 3HPQA 4MGKR 2I1QA 4C0HA 1X86B 1KDRA 4JLKA 2ZE8A 4NYJR 2CBZA 5BWMA 4AKEA 1BO6A 4OYHA 1COWD 4Q01A 4OHYA 4ACBA 1Q1BA 1Q3TA 2REXB 1E2QA 3NKVA 4MRSA 1PLLA 1JBKA 4NHOA 1S1CA 4TMVA 4BFTA 3LQQA 3MGCA 3IBYA 3FYHA 1VG0B 3KX2A 4CIDA 3UK6A 4HEJA 1YZUA 2W58A 1UKZA 2CXXA 3ZS8A 3PIRA 1E9DA 3K9GA 1KI2A 1OH5A 1P2UA
chains in the Genus database with same CATH superfamily
5K0LA 4D9CA 3DZKA 2J8ZA 3QA3E 2OV4A 4EDHA 5IABA 3ISVA 1KMNA 1Y34E 4UCXA 3M34A 4LRWA 5IARA 3GVHA 4LF8B 2QVZX 3GAFA 2AC7A 4A0QA 4JLOA 4LX8A 1BDIA 4BAZA 1EINA 1Y9DA 2B9EA 3NZEA 4AKTA 3DNFA 4EY4A 3D4BA 1AMOA 1E4YA 4DLSA 2HF9A 1SVOA 2YXEA 4HRAA 2ZAGA 5J1SB 1WUHS 1FXSA 3ILHA 4QM6A 1GXSA 4LQCA 3FVWA 4E21A 1NVTA 2VNSA 4DDKA 2ZQYA 4ZVQA 5CG1A 4PQRA 3U7IA 1A5TA 1L7BA 4H18A 3DE1X 1P4SA 3TLGA 1HNWB 1BROA 1ZU5A 1YK1A 2QUIA 3TSZA 4C01A 2D00A 3PNVA 3NWBA 3FHJA 4QYIA 2XDQA 1QONA 2YFQA 1SY7A 4MDYA 4M60A 4WINA 5E2IA 2WG2A 3ZV3A 1ZJWA 1E69A 1K2VN 1OX4A 1ORRA 2VRWA 3S2YA 2ZJZA 1M34E 2NUAA 4XXHA 1UFKA 5I8PA 1HC7A 2XMDA 1F8XA 3GRVA 4BBZA 4JROA 3DLBA 2ZE5A 3WYNA 1NRWA 4ZQFA 2ZJ4A 3CRW1 3ZIDA 1ONSA 1R1DA 3F1LA 4P7KA 1HE8B 4GP6A 1A9RA 4D25A 5E7QA 1KH2A 1UH5A 3GRZA 4GBJA 1QNFA 4PLHA 4E94A 5CFMA 4XOIA 1K0FA 3INTA 3KR0A 3SR3A 5C5CA 3ZYZA 1IEQA 4YT2A 4UHDA 4EECA 3RRMA 4LXYA 2XCOA 1ORTA 3L1UA 3R0VA 3FPJA 1FYXA 4C22A 4X45A 4YUVA 2N9UA 2PXXA 3QBTA 5TS3A 1U8YA 3DZDA 2L42A 1JPVA 1GU7A 3PRYA 1VPEA 3HBMA 4IQGA 4KG7A 3SJCA 4CLXA 4JVLA 4LNUA 4RZUA 3KQOA 2ZWOA 4OA8A 1C0PA 2HFJA 2OAGA 3CUEF 3KL2A 3L0IB 5CTJA 1JMVA 3QV2A 4G1FA 1Z5NA 4NJMB 3R74A 3UT6A 1VE5A 1KQGA 2DF8A 2O06A 2A6PA 3HM2A 1QRSA 3JQ9A 4DYVA 4LJ6A 1UBNA 4JUCA 3I9LA 3GV0A 2AWOA 3R3HA 1PYOA 2C5HA 4TSKA 5IKOA 1XMIA 1LZLA 5CXXA 4DEXA 1FK8A 3O82A 1QIFA 1XMPA 4MMZB 4BQNA 4DLVA 3C5CA 2IEDA 1Z5PA 2V6FA 3NX4A 4MI3A 3B52X 2J33A 4D41A 1XWFA 4QPPA 1NZDA 5CBPB 2ZCUA 4G09A 3QXCA 3KWMA 4Q3CA 2DMRA 5IW8A 2PDAA 5AT1A 3TBHA 1JBQA 5LM3A 3QMVA 4FFPA 4LE2A 2AE2A 4QUEA 1P7VA 1CIPA 1ZGGA 3CTMA 1C9MA 4QGFA 2ORWA 1E3JA 2P4HX 2VH5R 2Z04A 5F5LA 3RK0A 3ZHRA 4K6MA 1ORDA 1CP3A 2FDCA 1FNDA 1DEAA 3E5HA 3N5CA 4M0LA 3FMGA 4K03A 3MJRA 4FCWA 2DUNA 4FYXA 3I61A 4B6RA 3F49S 1AUVA 2PUWA 2I4TA 5LYYA 3ANSA 4UEKA 1E7QA 2EERA 3N3BC 4GF5A 3HA2A 4WCVA 1E66A 1T1SA 2PRYA 3G59A 4JEMA 4Z4QA 4Q37A 3M6VA 3QW4B 4E5VA 2ZVPX 4DCSA 1Y4ZA 4MA4A 2G7ZA 3G2QA 4KIWA 1X13A 4KRFA 3TVDA 2ZSUA 4UATA 2ZANA 1W52X 1ZCFA 5I7WA 1L6IA 1XD2A 2WF7A 3AHFA 3OZDA 4PG8A 3VU0A 1DU4A 5G1PA 3FVQA 3WMGA 1XYVA 2XITA 1DBVO 2UZ3A 3GPBA 1MB0A 3QE4A 2B1RA 3ADPA 2VZ8A 4QXRA 4B84A 1SIUA 1TIKA 1WHSA 5C1PA 4EGQA 2F43A 3GAZA 4FX5A 4RIEA 4LGCA 4HQFA 3E27A 4D0GA 1G6OA 1VQ1A 4FHFA 1WABA 1QTIA 1BGVA 1U94A 2J59A 2ZOSA 2ZBFA 2OXTA 1L9KA 5CDFA 2JZNA 2CMFA 1K6EA 1DKNA 2FPXA 1CY2A 1KA9H 1VI2A 3GO4A 4OMDA 4EW6A 1KO8A 2WK1A 1G17A 3DC2A 1E1RA 3I2YX 4E5KA 4LZAA 5JQGF 4QOJA 1KMMA 4UXHA 2WABA 4EG3A 1EFTA 5KQLA 1E2LA 3WGIA 3RFUA 1DCFA 3U0VA 3CB4A 1JLLA 4TL9A 4BNWA 4E7OA 2WILA 5M29A 5CLIA 5IM4F 1K2WA 3ONVA 5B37A 1IMOA 1R18A 1VHWA 2NWQA 3OC0A 5F4ZA 2HNAA 2FAXA 4TKZA 5EWLA 4TVBA 4N5LA 5EUBA 2H2HA 2HPHA 2I8LA 1VB5A 3FKJA 3H5WA 4GLLA 3HC7A 3ZD8A 5EE0A 3PRHA 2XIQA 5C1BA 3GWGA 1U3VA 4RL4A 5FLEX 3U3JA 4EM6A 4F4JA 1TYEB 4J91A 3A4NA 4EEKA 1N7HA 3DG9A 2HHLA 2WBLC 1KERA 4LHWA 1BWPA 1XDSA 4N47A 1G64A 3W6NA 1NG1A 1NVEA 1L5YA 5EXSA 5HZHA 2OFXA 2OO3A 1PNQA 2HK9A 4IHJB 1ZUHA 3FDFA 4DYDA 3BXPA 3TX2A 4FQ7A 4N18A 3GLIE 3LWNA 2WFLA 3K2IA 5IDYA 3LIIA 3CWZA 2MIIA 2QHXA 1MNQA 1I4EB 3FSEA 4PSCA 2RAVA 3UJ9A 3U4MA 3RS3A 5I3ZA 1TA4A 1ZH0A 2FSUA 2ZJFA 5LQSA 2GERA 1GL6A 2VPPA 3EXIA 4YV7A 4TLCA 3TUIC 1U0LA 4F5EA 7AT1A 2QTGA 2AKEA 2CB0A 1KI6A 1LNZA 1ZH6A 3PHJA 4Z4EA 1NBME 3JARB 4XPIB 4Y2RA 2C4HA 5IUKC 3ZE8A 5LD2B 3QH4A 1QDLB 3QVSA 1IN8A 3MCZA 2RJNA 3AR7A 4NZPA 3AJDA 4LV6A 3B6IA 4TTAA 1GG8A 2JLAA 3JR7A 4Y2GA 3ENKA 4KR7A 2Q8QA 3GGOA 1JVSA 1YVEI 3DHYA 2AK3A 3IDSA 1W5SA 1N1MA 3OIWA 4MQFB 4RMGA 2X6QA 1QX4A 3ZWDA 3ANYB 3KHTA 3OZFA 1E3LA 5TJ9A 4HDQB 3I2JA 4IQ8A 4EG4A 4RQUA 5ITZA 1QH8B 2JLUA 4RXMA 2PUFA 2NUPA 3P0RA 1P74A 1K6MA 1SKYE 2WQZA 2AOTA 1D2CA 1HOXA 4G8BA 3WK6A 3C3CA 2H3HA 1IONA 4B17A 2P40A 1W36B 3CUKA 1G8SA 4HFMA 3BKWA 2ZJAA 5CX4A 3UWSA 3OEED 4DPMA 4H1VA 2AFIA 3S8YA 3T7DA 2HWKA 1JJIA 1XEXB 1JWAB 2PMKA 3MRSA 4QDTA 4RVNA 1FW6A 2GD1O 1Z35A 3WWYA 2WIGA 3IP9A 2YJ5A 3DW1X 5DMHA 3MF4A 1OTXA 3NWEA 4UHJA 2YIJA 3UHOA 5LP1A 2XUGA 5IZCA 4NRDA 3R75A 3SYLA 3JSAA 1DQSA 3CRQA 3URKA 1E3QA 2H5LA 1Z9BA 3GGSA 4OB8A 1W4AA 4QYSA 1N4AA 4B8WA 5EQDA 2H4YA 1R37A 3F73A 3H11B 2JHGA 1NG9A 1TZJA 2NVBA 3L5OA 3EGVA 3ZHZA 2D8AA 3KXIA 4MWZA 3RAEC 1BX1A 2J6BA 1P0QA 2RAUA 1I0ZA 3ML1A 5FRDA 2PQ6A 2FN4A 3DD1A 2SBTA 3JWIA 4CV0A 3VBCA 2Q1XA 1Z38A 3QHPA 2Y4OA 5DT2A 5B3AA 3UW3A 3C45A 3CWCA 4I5GA 1DI0A 1EX1A 3EFOA 1JX6A 4BCDA 1GITA 1KMIY 5KVCA 4JI3B 1KI4A 4M0PA 1B0PA 3AVOA 4IUBS 1YOBA 2KI5A 4IX9A 3HB4X 3FD8A 2KX7A 2VAPA 4OKNA 2PAFA 4QZVA 5B55A 3BD8A 4DABA 2XZPA 4FSHA 2IDJA 5HKKA 5F3RA 1XQVA 1IRIA 1WSDA 1KEUA 1X8LA 2QU7A 3KAKA 4GOJA 4KLAA 3SC2A 4ZCIA 4M6WA 1FF9A 3Q6IA 2Q9BA 4BO6A 3ET4A 3PS9A 3M1AA 4IR7A 4OCZA 3VZDA 3VX4A 4F9EA 1AUOA 5EI5A 1ZUNB 4LXQA 2AH5A 4PZYA 1J0BA 4AJ4A 3N59A 1WNFA 3BS4A 3OU2A 1ISFA 4OQFA 4AJNA 3I8SA 4A5SA 6REQA 8OHMA 5K0FA 3E2PA 4BJ1A 5FUMA 3QYJA 2D0DA 2XHEA 3M4JA 6PFKA 4GKAA 5ICCA 4X62B 1EFLA 4PPYA 1CZHA 4LW8A 2P4EA 3AEQA 3OFVA 4HDMA 4G9BA 3M2PA 3MWYW 1XAHA 4W5OA 3T5MA 1GGHA 2P1ZA 3II6X 1W4CA 2QZZA 3ME5A 4EG1A 1V5GA 2RC6A 4HX2A 3EEBA 1AB6A 4MIYA 4TL7A 3ZY2A 4FGSA 4BLQA 4BVFA 5CB0A 2EGUA 5TQ0B 3RU3A 4BFVA 1HL7A 5BVGB 4D9KA 5AM5A 2FCRA 2XD4A 3KJIA 1SOAA 1Y9AA 1ZP6A 2XD9A 5CK5A 1ZO8A 5MGNA 4CW7A 1D9ZA 1TUBB 1LCIA 2W4QA 2QTHA 4IEIA 4IJUA 2V55B 4LYYA 5B3JC 1YQTA 2A3NA 2P65A 4XRGA 2Z98A 3KOMA 1NURA 3MILA 3AM1A 2C77A 4W6ZA 1AS3A 3SM9A 2BGUA 3BSFA 2ZB8A 1URPA 2X5KO 5L40A 4YALA 1U0OC 1P33A 3KQVA 3B3GA 5F77A 1XDUA 2H4HA 2A14A 4JB3A 5BN4B 5GINE 3NXSA 1PEYA 2GK4A 3NM6B 4BVGA 1XZJA 4MIOA 1UBLS 3QTTA 1MPTA 3B89A 5E9AA 4BAUA 5C8ZA 4EUKA 3JATA 1N0UA 1GXSB 1Z29A 3GA7A 1F60A 4RVHA 1Z2DA 1MC4A 2JAPA 2Q3JA 4MKGA 2Z2YA 2B8TA 3LYLA 3F5SA 2IZ0A 3SJ7A 2G9RA 3FYUB 4AQYB 1WIWA 4HH1A 3BHJA 1HK7A 1QF6A 4HS9A 1NF2A 1ONOA 2CFSA 4XUGB 4OP2A 8ATCA 4EVIA 2BM0A 1X1QA 2R8RA 4DDTA 1FB5A 2YWXA 1XRSB 1ENZA 2RHWA 5DI3A 5L3VA 2K2QB 1T5TA 1O4WA 1TJNA 2HIGA 1OX4B 1NU6A 2MTBA 3CF2A 1D2HA 3O92A 5D3MB 3DEFA 2O1XA 4F2HA 2QN6A 1FP4A 4LISA 1A8UA 3SFTA 5AIBA 1U90A 4YMGA 2J09A 1Y6ZA 4D42A 1JIQA 4JS0A 1RXWA 4HP8A 1A69A 3I83A 4MWSA 2GBCA 2WUEA 4JK3A 1MR3F 3T7KA 2C58A 4OMFG 3WJAA 3NJ4A 2UUOA 3EXEB 3OUUA 4J43A 1FX0A 2W9XA 4WGGA 1CYDA 2C9YA 4ZRDA 2I3BA 2O8FA 1PUXA 3KR2A 4CKEB 2J07A 2WIKA 4LMBA 4NBKA 4KHPB 2W2NA 5I4KA 2QMZA 4QJ4A 5K3OA 4X97A 1II0A 4M7PA 1ZLXA 4WFQA 4MVJG 4G1EB 1EDEA 4BFXA 2V98A 3LQ4A 2RIRA 3FPBA 5CXQA 3T3PB 2W98A 1X1AA 1W0CA 2XB2A 3PNKA 3KSRA 2F9MA 1IBLB 3EXHA 4AZSA 3EGXA 5D7BA 2OV8A 1RJWA 2F17A 2G25A 3CONA 5E9JA 1VMDA 1JR3D 2J6HA 4B3BA 5LQRA 1VGRA 4H31A 4TUYF 3WLEA 4MUXA 1UAGA 4CBVA 1V9CA 2J3JA 2EJVA 4UM7A 2ZB7A 4BS9A 4DDWA 2Q5JA 2O7SA 1LX7A 4NQZA 4POAA 1TLLA 3NT5A 1ESZA 4TPKA 3BFJA 3V3KA 1I4TD 3FWKA 3PDHA 4MNTA 2ODPA 4HWOA 4K86A 4V3CA 3JQAB 4KR9A 2X8JA 4P93A 3WSTA 5JTUA 1XTPA 4Q34A 1Z5ZA 3KJFA 1VOTA 2ZJ6A 1WU7A 3CVWA 3NHMA 1JIXA 2CD9A 3GFFA 2MMCA 2Y77A 3U6KA 1O1YA 2QN2A 3EUWA 4W5WA 4S1WA 3RBXA 5CVEA 4C2BA 1JJBA 2P6MA 3H0KA 1GPYA 1GCOA 1SEVA 4RS3A 1NXTA 5KOJA 3W3AH 2G06A 2V3VA 3SP1A 1LU9A 4QC2A 2NV2B 1B16A 2Q28A 3Q9LA 4B9EA 4OQ4A 2IXTA 4RA9A 1XA0A 4MS1A 3OX4A 4FI3F 3Q12A 2OVFA 3DCJA 3QOFA 1JDBC 3WDMA 3Q10A 4K1XA 2FPLA 1LSUA 4G25A 4JXXA 2XYGA 1OV6A 2ZLBA 2ZYSA 3ASZA 4XQGA 1AUPA 3G49A 4HQ0A 3EWAA 3GVCA 1SUCA 2BUBA 4YP7A 2AXEA 2IYZA 5IAAA 5K8LA 2DR0A 1Z75A 2IHVA 4LQ4A 1HLDA 1WXFA 1OV4A 2SKEA 1OC4A 2WYHA 2ZRDA 4FIDA 4D3FA 2RHDA 1E1DA 1QHHB 3ORYA 1G8MA 5AI9A 2QGZA 3EBLA 1XZBA 3PUIA 5ALKA 3ERCA 2QMHA 3A9RA 4WBNA 4C7OA 5IJ9A 4PRLA 3SIXA 2HLDD 1KDVA 4LVOA 2BJVA 4PG5A 2PUEA 3L0PA 1E9RA 1PNTA 1VE1A 2F3RA 3A14A 3I6ZA 2RGGA 3KXKA 3P20A 3EPLA 2PIAA 3LBFA 5YASA 4AY4A 1KYXA 1DBRA 2Q9AA 1QIKA 2QI9C 2JAUA 4KQXA 5GADl 2C31A 1LJ8A 1B8NA 2I4MA 4CIXA 1EGAA 4PX5A 1JG2A 2ILTA 3DTYA 4YO8A 5JZBA 1AHHA 3W2EA 3GFRA 3UTCA 1EEHA 2X4IA 1VL5A 3IMKA 4N12A 3OZCA 3AUUA 1R8XA 4X8LA 2QSYA 5HIIA 3VDRA 5LMCA 4MUYA 3A58B 4FYHA 3PITA 3PFFA 2C4VA 2QRZA 4DZTA 2BP7B 1GAEO 1RQPA 2GLUA 3HKBA 1IUNA 4QDKA 4CRWB 2PCJA 1NC3A 1VCIA 2CLCX 3Q87B 3AF6A 4ZHQA 2GBIA 2UUPA 2HN9A 3RANA 3OCYA 2Y6UA 3LDFA 1IY9A 3ETLA 3GDWA 4PRZA 5SYMA 5KZMB 2FV8A 2JHFA 5L9AA 1X7YA 4LSMA 3KUUA 5FAXA 5IT9A 1PI3A 3D4NA 1F2VA 2ZYTX 3BBLA 2Z4TA 3CNHA 1G5IA 3A2KA 3A2MA 3LKZA 2SCUB 3PEUA 3LCUA 5FKJA 3PYLA 1Z5VA 2B8JA 2OV1A 4MYDA 3OZUA 3E9MA 2D74A 2J7PA 1Q1ZA 3HCRA 3IIMA 3O4HA 1MG0A 5D1NA 5SY4A 3KYCA 4IOJA 4YASA 4L8FA 4LHZA 4R8KA 2D0OB 2CJFA 2EKDA 5AJZA 3H7IA 3TLYA 4GDFA 4R1OA 4A73A 4TLEA 2J9FA 5KTNA 2IEYA 1T2NA 1ZESA 4O0MA 3S5JA 1NX9A 4M55A 3D3WA 3W7BA 4HS4A 3S0JA 2QLNA 3L3BA 5CA1B 4ACAA 1WVMA 4NATA 3ESRA 1TZ2A 4OQMA 2WUGA 4GI3A 3T0IA 1Z16A 2JJQA 1IIBA 3HCCA 2IUEA 5CB8A 1Q5PA 1VJ5A 4LJSA 4O1IA 4ZEOA 3MSXA 6ADHA 1VG9B 3RYCA 2E49A 1F0PA 3PGMA 3UICA 1IVNA 5BURA 1MB4A 3WP1B 1NW8A 2CBXA 1ACMA 4G5HA 3ZJVA 3VDNB 4WCDA 4Y2TA 4G0NA 1MPXA 4B81A 4DC0A 2BR3A 3UA3A 1LF5A 2WT8A 1PT5A 1NBMD 2Y1XA 4PNHA 5E6UB 1OAOC 4DR7B 5FL7D 1SVIA 1XL0A 2WD7B 2B35A 4PC3A 3U3ZA 2NZJA 4F5WA 2R8OA 3SVLA 1I2AA 3L0OA 6Q21A 2OD2A 2FZEA 5AW8A 1C81A 3MWKA 4UKDA 5KJ6A 4JIMA 3ZQKA 3GPCA 2OCXA 4Q1AA 3TB4A 5M04A 3I76A 4BOYA 3ESQA 3E9YA 3TSCA 3FTCA 1EJ6A 2O4UX 1CUIA 2IP1A 2FUG6 2ATXA 2VYND 3HMKA 1R4MB 4Q4JA 3TLCA 3U13A 4D4JA 2EJTA 5C7YA 2J3DA 4RHFA 1PWYE 2UZAA 1AQUA 1C50A 3B9RA 1P0CA 3JPYA 4HFNA 1UEIA 2BPOA 4LZPA 3AXSA 3NG1A 4OATA 3UFXB 2AGVA 4ETWA 1IXRC 1FDRA 1K7CA 2I6FA 3UKOA 3NAQA 5JCJD 4ZVOA 3KVVA 2NUTA 1G19A 3TQQA 4YDQA 4J4TA 4BKUA 5HRUA 1THTA 5A5GA 1DADA 3QKUA 4O4IA 3PHLA 2NZYA 5BN3B 4ARBA 1C1HA 2OBBA 2XEDA 3NRCA 5BSTA 3BJMA 4KW7A 1R16A 1SXGA 1K1EA 2C4KA 2EC5A 4BP9A 3GUZA 4HVLA 4RJKA 4U0KA 3QEAZ 1HZZC 4TRRA 1YZHA 2HCRA 2P9FA 3L4BC 3P26A 4YT8A 3OD5A 1G20B 1PTJA 1QKKA 1YDGA 1ZZGA 3GMDA 3H1TA 3BERA 3O1IC 3E7DA 3IOEA 3R9KA 3HWX1 3R0IA 3U1BA 4FZRA 1SZJG 3IAHA 1A95A 3BIFA 3S2ZA 1OBOA 1DPFA 2HK6A 1CJBA 2Z09A 3H5VA 1YS6A 4BVHA 5ARCA 1YE8A 3TOZA 4HAYA 2FP4B 2V7QA 4F96A 4BMSA 1FZQA 2WM8A 3VBEA 1JIKA 2WM9B 3Q15C 1XXHB 3H1AA 2CV1A 4LUCA 3WYEA 1PR2A 3BXHA 3GJ8A 2R47A 1QP7A 2YDXA 3AESB 4OBWA 4I55A 1G8PA 1E6MA 4DQLA 5BRJA 1QQTA 4E30A 1FBNA 2X76A 1PL7A 4K9LA 3LQ1A 3WNZA 5KX5F 1C1DA 3AYZB 2DBZA 4ESOA 1D3AA 4R8LA 3B70A 5IHPA 2Q4OA 2Y1DA 2VDOB 5D86A 3HJCA 1KSGA 5LNK6 1ODIA 4M0UA 4UEWA 1J56A 3EX7C 2OHJA 2E48A 3PX2A 3KG2A 4II7A 3TL6A 4R2KA 1KNQA 2MINB 5UKDA 4BO9A 3OCXA 5HNKA 1QKIA 1WP4A 4KYIB 2H1LA 2XUHA 3AEZA 5KAPA 621PA 5JXHA 2WU1A 3VZQA 3KQMA 3K0EA 5CMLA 3JVUA 1TUEA 1ZM9A 2HFKA 3BL8A 4X8OA 5FEUA 3O26A 3RI3A 1U7PA 1JQ5A 2IS4A 2Q9CA 4JOCA 3DCNA 3A9UA 3KLOA 5K99A 3I2KA 4Z3OA 5L7WA 3K09C 2QUBA 1WS6A 3DVAA 1W47A 3L5KA 4D9FA 3AQIA 4M9XA 2JK0A 3FTNA 5HRCA 3LI2A 4WECA 3WNQA 3DMDA 2WHPB 2GDZA 3S2IA 3LQRA 2ZEJA 4H1WA 3UWKA 4RYDA 1D1QA 1UFVA 4F6CA 2GEDA 3W1WA 3FLAA 1XTZA 1S5PA 3OCJA 1Z63A 5JAUA 3I52A 4V38A 2M9MA 4E33A 2W2KA 3I12A 3IEIA 3ZPXA 4KJZA 2CC2A 4J0QA 4V0LA 4KYUA 4RQTA 1TECE 5E2AA 5C5IA 5JADA 3B36A 2CVZA 1EEXB 1E2UA 4YCBA 2YH2A 4NFHA 3UO8B 2APJA 5PGMA 2H8KA 4D6XA 5EHNA 4AZ3A 2ZIXA 1TEXA 2O2EA 3UUGA 3RG2A 1KYIA 4S12A 1NSFA 3KR1A 4ND2A 2HMAA 3NS7A 2QTVB 4LC1A 1YJCA 1Y3FE 1P6UA 2OO7A 4EF5A 3GFSA 4S1NA 4B4OA 2PFGA 1LBSA 1A97A 5CB4F 4B80A 4QPNA 4MGYR 3I5MA 4E7PA 1YZFA 2JGRA 2H1RA 4HWSA 1TCBA 2AUNA 4I5DA 4BMZA 4RCYA 2JDIA 1B6RA 2Q7OE 2H17A 4Q1BA 3NGMA 3NGXA 1RHRA 2D5CA 4YJFA 3W0LB 4RY9A 5C8YA 3OKCA 8ABPA 2QLLA 3H7AA 4G84A 1R0XA 2XTJA 4G0ZA 4HLNA 1RBMA 3V1MA 3ADCA 2BAGA 5DGIA 1KARA 4KO3S 2X0FA 4OG2A 1KK1A 4PXSA 5EMHA 2X0DA 4HAIA 4EW1A 1LDEA 4Y1EA 1VJ1A 4FZJA 5AUOB 4YAEA 5L3QA 1XLVA 2IKSA 4I4NA 1K8ZB 1DAHA 1FX0B 4UZSA 2ZYVX 2UUCB 4OHBA 3E22A 2I8AA 4GZMA 1S2GA 1R9JA 2LCIA 5ALEA 4CLOB 1Q7BA 1RAGA 5LKAA 5LP6C 1EWQA 2JARA 1XJ0A 3Q7RA 5DB4A 3U4GA 3JYHA 4EX6A 3ZDDA 3HY6A 1IHPA 3LO8A 4U63A 3WZMA 4ZI5A 2HUPA 5T8KA 7MDHA 3T9BA 3NVKI 2BRUC 4HTFA 1IQ0A 3PQ7A 3DE6X 3NTQA 1T8YA 4OXKA 2BFFA 4C9BA 3ZI0A 2RIPA 3AL3A 3D31A 3LUBA 1JKXA 1Q77A 1RQGA 2F8LA 5DSXA 4DTCA 2V8OA 5HQ3A 1XRJA 1A7JA 2WUVA 1NSTA 2V5AA 4LZWA 1WF6A 2BW0A 2ORYA 3C3WA 1YQDA 3MWDA 3ZR4B 4EQ6A 1YHNA 4LOHA 2IPMA 2J3MA 4EBBA 1GT91 1CIJA 2ZUSA 5JC1A 2VTBB 3K5HA 3D6TB 1QV7A 2VPXA 2QRQA 3GJXC 3H9CA 4RY2A 3AUJB 3BMQB 1QIDA 4KQ2A 1I7PA 4BQPA 3CG4A 1G2OA 1SEPA 2VXYA 3W5IA 4N7JA 1GGNA 4GZ6A 2EFHB 4TTPA 1LV8A 3QI7A 3V9AA 1E6KA 3E1KA 5K8IA 4MRNA 1ZVMA 5AW5A 1GPKA 1P4AA 1T5BA 4Y2UA 5IKMA 3P2MA 2C3OA 2DY1A 1NQVA 4RA9B 2OZVA 3KVRA 3IT2A 3MB8A 4RSHA 1GZ7A 1YBFA 2IGBA 3P2OA 3O03A 1UPCA 3T99A 5KNDH 2PKEA 3JD4A 4CQLA 3IR7A 1LRKA 1OWLA 1Q12A 1RABA 2ODBA 2WP8J 4ZPXA 4AG3A 5LDDC 2GZAA 2IYTA 5C3MA 3R7WA 2IEBA 1AXGA 2WJAA 4MEJA 3IERA 4HY3A 4INZA 4YMSA 3Q8MA 2PX3A 3GFGA 4ZT6A 3FFBA 4A27A 1XDBA 1DTSA 2VJYA 2QSJA 1KO5A 5COQA 1XCJA 3A6GA 3DDZX 3N8DA 4BN5A 4N49A 4O1HA 4YGYA 2TECE 5L7YA 1SUBA 2CJXA 5AK0A 3UMFA 1PWEA 1UJ5A 3N9IA 1ODLA 2C7PA 2VC2B 1CP2A 1T4GA 3QHAA 4AUKA 1T34A 1EA5A 5DM60 4UNRA 3B5IA 3WKAA 4YCAA 2YYYA 5CIWA 1ZD2P 3ZWYA 5FQNA 1AF7A 4B35A 1U4OA 3KQPA 1U9IA 1JYFA 1Z5OA 3SQLA 2RHTA 4XCVA 3V7YA 4PLYA 4J0DA 2R00C 3EIOA 3KSUA 4UXIA 5C8XA 1M74A 3IOMA 2HU5A 3P1JA 2XKKA 4P34A 2CHEA 3F6PA 1JQ3A 2CLLB 1I2CA 4OLJA 5A0TA 5F4BA 4UZFA 3D6NB 4N0DA 1CNMA 3K1ZA 3ZE6A 1U11A 4L85A 5KSZA 4IIJB 3F97A 2H1OA 4N8SA 4K3VA 2BDUA 2PR2A 3JWJA 3PCXA 3PNLA 4OK6A 4BNTA 4C0LA 2FWMX 5J63A 2GN4A 3BGIA 3S1LA 1UBFA 2DFKB 2OILA 1K75A 4URYR 1H23A 2B5WA 3QWFA 3N2IA 1S6YA 1PDVA 2AW5A 1FMJA 1R64A 4EUSA 2Q5FA 2JCSA 3WLTA 1FDTA 3AI1A 3F7NA 3A11A 4QREA 2GN2A 2YFKA 1SOUA 3ZHXA 1I14A 2FWJA 3T1VA 2A8YA 4EGFA 2WB4A 1U9YA 4YRBA 1U7XA 1XZGA 3KDPA 3AU9A 5DYYA 1NUUA 1LDYA 4GOMD 2O23A 4PLVA 3T3DA 1ILWA 2XBMA 1H5NA 1I32A 2VCEA 1I4OA 1Z82A 2CVFA 5ALPA 4KSBA 1FDIA 1TC1A 3L92A 5FHRA 3SLGA 4B40A 1ZAYA 3BRSA 1PGNA 1VLMA 3PA8A 5DV9A 3OLQA 1HT0A 3IMEA 3AHCA 3IKVA 1H9AA 3O5AA 2RKWA 3DYIA 2BKUA 2B20A 2QMOA 3PQ6A 4YCDA 5IT5A 3MEQA 3KYCB 3NDRA 2VUIB 1XROA 4XARA 1EG2A 1G41A 3PPVA 1RI1A 1BS1A 2ZSFA 3L0DA 3B1ZA 3I5AA 5T67A 2X0JA 3NWPA 2OOSA 5J4LA 4IIYA 4QWMA 2P9QA 5H5JA 3BM5A 3GFTA 4ZVLA 4F84A 4YAOA 1DAMA 4TMWA 4YFYA 1HYHA 2D4HA 4TKVA 3G89A 4DILA 2YZGA 3WBJA 2AJLI 1CQPA 1ZJJA 2GESA 1D7OA 2NO9A 4U4AA 3IBFA 4UUNA 3SSAA 4A0HA 3K0CC 5K05A 1P7WA 3THXA 3B7WA 1LVHA 4MUAA 1JXMA 1NVUQ 4DNQA 2GD2A 1NXOA 4WW0A 3TGWA 2YWHA 7REQA 1NR5A 2BDEA 1QLHA 1UC4B 2AHOA 3VC7A 3LBIA 3F2IA 4U2DA 1C7JA 3BMXA 3IAXA 5K3CA 3UFBA 2AN1A 1WUKS 1OFUA 2CZCA 3LVQE 1KTVA 4U8GA 3T9EA 2ZIUB 5JBQA 1OXUA 1F6DA 2FEOA 1FXUA 3LY7A 1ISJA 3H2SA 3B1WA 3UUEA 2HU7A 4OQYA 4FFVA 1LS1A 1NT2A 2EWWA 1JIJA 2BM8A 3H97A 4M49A 1ETHA 1RQXA 2GFQA 2ZTHA 3G13A 3ZGVA 4BVBA 2EG9A 4FJ1A 5KYYA 3AUTA 3Q88A 4BKRA 3K0FA 5D5HA 1ADJA 4ZZ2A 3DZBA 2OCDA 4M76B 5C7OO 4AICA 4EMSA 4GO1A 1QUEA 3FWYA 1KZHA 3O91A 1CEQA 1H1LA 4J0JA 4DUGA 3P96A 3ULKA 2OC9A 2XLBA 3DEAA 1XZIA 1KOLA 1CR0A 2FETA 5LQMA 4WA8A 4LYDA 4DRYA 2JAWA 3NYIA 1R6VA 1WTAA 2FR8A 5AQEA 1DWPA 3IHTA 1N2JA 5KAMA 4MX8A 1TK3A 3ECAA 3R0ZA 4MWTA 4RLQA 3N87A 3W5BA 1A1VA 1E1NA 5ALUA 4B73A 1CUSA 3IJRA 1KPHA 1JKIA 3HWSA 3ND5A 1P4HA 5TX7A 2IXFA 1NQWA 1R0YA 1N6KA 4EELA 3SQXA 1EFPA 1KJQA 4N4AA 5C53B 1RNLA 4HNAB 5HF9A 1E7SA 5IC4A 1YRAA 4O4LA 3KV3O 2I8CA 2RI6A 3AR3A 5A2QA 4WI1A 1JAYA 1S3SA 2GAAA 3AK4A 3IVCA 1RQ2A 4LWPA 5D3ZA 1D4ZA 5FLXA 3L0SA 2ZI4A 3R5XA 2V65A 4JP2A 2BMFA 2VJNA 3BRWA 3RROA 2JD2A 2O19A 2LUOA 1ZD8A 1A4XA 4N7BA 4WNCA 4F71A 2Z5LA 5JCXA 3LUPA 3HZZA 4RD1A 4LOKA 5DW0A 2IV3A 5F9MA 1NUPA 1DIOB 2P2NA 4DDHA 1ZWKA 4PYOA 2NNWB 2I6TA 2EX0A 4JT4A 3EPKA 4D8VA 1UKYA 2A67A 1XTTA 3D4LA 2QUZA 3BGOS 3IQGX 3OECA 4R51A 1HH4A 2JVIA 1XFDA 4TTJA 5AWFC 3IXQA 3VKWA 4F9FA 1BMFA 4BO5A 4BO8A 1UODA 1YGYA 1OR8A 3MOGA 2I1WA 5J5CA 1CVRA 1A2OA 2FG5A 2XWSA 3E3MA 3QPWA 3U3MA 2WUFA 3IBGA 2Q7XA 4REOA 3A26A 3ORSA 3HRIA 2JRCA 2JLYA 3R76A 1K9VF 4ZJZA 5KDOA 2WVGA 4CEIA 2GFIA 1VLQA 5ESXA 1DUIA 4PY2A 3COZA 4EPVA 4TYQA 4QXAA 4M7OA 1W6UA 5IAOA 4P4TA 1IBCA 5CLFA 1EQAA 3KM0A 1TJ5A 4GBGA 4TN1A 4WCFC 5ALIA 2YWRA 4AL4A 4B79A 3UWOA 3CLRD 5JSZA 2O8NA 2OK7A 2PL5A 5AO9A 3LC1O 3IVAA 3AIOA 4WADA 4DVJA 2Q5CA 3ENQA 4FFDA 3GEGA 1O87A 1V4VA 2DECA 2O7NA 1S8NA 4Q48A 3CX7A 3CVOA 1S2DA 1ZM4A 4IDOA 5ALOA 2JJ1D 1CUVA 2VDQB 4LBZA 1QGOA 3U2QA 4MQBA 4ZTUB 3RVQA 1A8IA 1AKMA 2UYGA 3IC5A 3P45A 5CM8B 5FBKA 5BSRA 4L2IB 4B1FA 3BCHA 2I76A 5JOQA 4L6IA 4ND6A 1JSXA 4AS1A 1Q17A 1MXHA 1G5HA 1QS0A 1V6AA 2XUKA 3BMNA 5E6RB 1DQYA 2BHLA 3D8BA 4LJ9A 4X6UA 1ML4A 5LBUA 4E14A 4Q4CA 4EKEA 3CLUD 3H84A 2C83A 2CVPA 2P2CA 1L5OA 1M6VB 2PTGA 1EVJA 1HY3A 2HLNA 3GFQA 3GXBA 1CK4A 2ZJYA 1C3OB 1JJFA 1MW9X 2AN5A 3MC1A 4QJ5A 3AONB 3UAWA 1K92A 4ZRNA 2M6LA 1SQ0A 4NZNA 1L7PA 1U2SA 2FG7C 2GKSA 4KTVE 2LKCA 5JEEA 2X6RA 2GCIA 2ZRPA 5C35A 2RK3A 2PMBA 3NAMA 1FYDA 2CHVA 3AERB 3L9WA 3VVLA 1PQ4A 4XEUA 4TT3D 1GAQA 1KEPA 3P9CA 3GCGA 3JQFA 3K5WA 4KOEC 2Q62A 4HF7A 4RV4A 3SHWA 4EA9A 4X20B 3DDOA 3MLBA 3TPFA 2DP4E 1LQ2A 1GQ2A 4HGNA 5BSVA 4ZGWA 1WUTA 4WDQA 4AK9A 1JHMA 2VNKA 3C6XA 2ZK7A 5F3DA 4CTOA 1I1OA 3W5UA 1M73E 2O6HA 3E1GA 2ID4A 3GRKA 4MI9A 3RH0A 2DPGA 2JIZD 3GHYA 4UBMA 1Z0SA 1D6SA 5HOQA 1DGQA 2CNBA 4IOMA 5CNKA 1VKOA 1G3RA 2WI8A 3FOAA 3L2OB 4CF3A 1LWOA 1JYSA 4X7BA 4NG4A 2J7KA 3BZBA 5DXAA 4IJ5A 1V41E 1PZHA 4UBKA 3ZIUA 5DNYB 1FVFA 2KWIA 3IBTA 3Q8LA 2OORA 4UBNA 3LE8A 3MWFA 1VFNA 4W5QA 1UKVY 3SAJA 1POXA 4GIBA 4HADA 3LDAA 4JJZA 1XDZA 4GWKA 4LV8B 4G5QA 1ECGA 2HWWA 3RUAA 1WULS 3VNAA 4AC9A 1C41A 1CRQA 4KO2S 4RK7A 2NQ2C 4LCJA 3U7GA 1FZTA 3WXMA 3MFQA 1D5CA 1FUKA 1UT8A 4KE6A 3VR1A 4AP5A 1HDYA 1Z83A 3JAWB 1W96A 2EFDB 3DMGA 1GUDA 5CT4A 3VZCA 2PMFA 3KTFA 2UYOA 3BK2A 3C41J 3B12A 5BV8A 1H42A 2PRZA 1YZNA 2QW1A 3K30A 5JXJA 5K9ZA 5IYZA 4NECA 3TBKA 1MUUA 4GZLA 3M3HA 1C1XA 1ZSNA 2I2AA 2Y66A 4OI2A 4WESB 3BL5A 2LIPA 4E4RA 4HDSA 3MWDB 1EVYA 2AUTA 4XB6B 4Y1RA 3LCCA 4QAJA 5FOVA 3SM3A 3UK0A 1PJLA 4A10A 4YAKA 9ABPA 3DZFA 2ZTMA 3IP6A 4B2LA 3QOXA 3J7AC 4B3SB 2JCXA 1JDPA 1BU5A 4BNNA 3FGZA 4DVGA 5KWVA 3LCVB 4Q6WA 2O07A 5GZ6A 3JZMA 4X84A