2XJ9A

Dimer structure of the bacterial cell division regulator mipz
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
268
structure length
265
Chain Sequence
b'ETRVIVVGNEKGGAGKSTIAVHLVTALLYGGAKVAVIDLALRQRTSARFFENRRAWLDNKKIELPEPLALNLSDNDVALAERPEEEQVAGFEAAFARAMAECDFILIDTPGGDSAITRMAHGRADLVVTPMNDSFVDFDMLGTVDPLELTKPSLYSLTVWEGRKQRALSGQRQAMDWVVLRNRLATTARNRKRLEDRLNALAKRVGFRIGPGLRDRVIYRELFPFGLTIADLSPQVRPVPVSLQHLAARQELRALMHSLGLSAYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MIPZ
molecule tags Replication
source organism Caulobacter crescentus
publication title Localized Dimerization and Nucleoid Binding Drive Gradient Formation by the Bacterial Cell Division Inhibitor Mipz.
pubmed doi rcsb
total genus 84
structure length 265
sequence length 268
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09140 MipZ ATPase MipZ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2xj9A00
2OCPA 3RABA 2YC4C 4DXAA 1YZTA 1ONBA 1KK1A 3WNDA 2QGZA 3UWOA 1E98A 1X1RA 4MYCA 2IYQA 3LLUA 4IW3B 3ZD6A 2XJ4A 4QC2A 1KSFX 4W7SA 4DT1A 4L15A 1EK0A 2O8BB 2ZSFA 2VQSA 1T5IA 2JLRA 3AQ4A 2FA9A 4ZCIA 1N3BA 1GNPA 3R7WA 1EG7A 4R2HA 1ZU4A 4RVCA 5EE5B 5EUMA 1ETUA 4NBSA 4ZDJA 1F2UA 2IYTA 3A36A 2JLWA 3I5YA 1Z63A 2EQBA 5LB4A 4R2IA 2ZYWX 4EUNA 1WQ1R 2DFTA 5TV2A 1RZ3A 4NE2A 2O8FB 4DSNA 1X86B 3QJYA 5JI2E 1CF4A 3BE4A 5AJWA 2GZDA 1Q1QA 3HU1A 2WMOB 1E94E 4DIDA 1GUAA 1SULA 1PUIA 1EFTA 1H8HA 1OFUX 1OFTA 5J4VA 3B1YA 3NH9A 2B21A 2O8BA 1TQ6A 3Q5DA 5LBIA 4URZR 5K8IA 4EJSC 1G8GA 1Z0IA 3A1VA 3FKSD 5ELXA 2GNOA 4S35A 3SYLA 3QXCA 2W6IA 4B2IA 2BM0A 4M2LA 1YR8A 1DELA 1OHHD 1Z47A 5LD2B 4POAA 4URXR 5HZKA 2FJUA 1E2FA 1W0JD 2KJQA 2JDIA 5EZ6B 3KJEA 2CXXA 1H65A 1HV8A 2ZRFA 3REGA 2XB2A 1KSHA 3I92A 4BGDA 3HPQA 4I1SA 4XSHA 5DGXA 2QP3A 3CZQA 3W3AA 1GP2A 4XSGA 3DM9B 1W1WA 4MRNA 5KO2A 2MMGA 1NMZA 1YZUA 4MRVA 4OI0A 3BFKA 1OE0A 1W5SA 1OFIA 1E0AA 4G5GA 3UATA 4B74A 4A9AA 2XSZD 3KUDA 2N46A 4AK9A 1E2PA 1A2BA 2IYZA 1OPXA 5AWFC 2OXRA 3ZD7A 1XTJA 3BIFA 3L8ZA 4II7A 4M9XA 1FQJA 1SHZA 3PR1A 4MGKR 2XB4A 1Q1ZA 1BIFA 3GMTA 4IOJA 3PITA 1SXJC 1VCIA 1ZP6A 1KI1A 2OHFA 2WOOA 2GF0A 4OQMA 3X1XA 3NKVA 3TR5A 4CIDA 4LBWA 1E96A 4AKHA 2IXFA 4TQUS 5D3MA 1KI6A 3W90A 3BAFA 4Q18A 1VTKA 1NBME 4Q1CA 4TQ9A 3U7HB 2VRWA 2X77A 2C78A 5KTYA 2WWGA 1U90A 2P0EA 2WJGA 4D0LB 3NBYC 1CJKC 4O0MA 5JHGB 5KOYA 2Q3MA 3AVTA 3U3RA 1FW6A 2ZYTX 1W46A 4BLPA 5GADl 3NEYA 3UIEA 4B44A 5CK4A 1DAHA 3SQXA 1KK2A 2X8AA 4I1OA 2J7KA 4IDHA 3HU3A 2RCNA 4IDPA 4PC1A 3TLXA 3SFVA 4PO8A 4FXPA 5E7MA 2R8RA 2C9OA 1D5CA 1MOZA 1W2HA 4KAXA 2JLYA 1YRAA 4NDZA 4B3BA 2QRZA 3K9GA 2V6IA 3QPVA 3R8FA 5JI3E 2VP4A 4LJ9A 4NYIQ 4ZCLA 2QAGC 4V02A 4YC7A 1XEWX 4JLAA 1GTVA 2IXGA 1J90A 1NL3A 1L2TA 2A5YB 2HF9A 3N2IA 4AURA 3GLIA 2J9RA 2HJGA 1GOTA 2FFQA 3GJ3A 4C3ZA 3L0PA 4Q01A 1CKEA 3QKSA 1A1VA 1R0ZA 1GM5A 2VP5A 4N0DA 1O87A 4DLTA 3BB4A 4ACAA 4RZUA 1YHNA 4M1YA 2IWRA 4LYHA 1U94A 2IYVA 1P60A 1NSFA 3TNFA 1OH5A 1IXZA 1UADA 2R6AA 4DC9A 1KI3A 1XD2A 1IN5A 1R5OA 1XZPA 5HE9A 2BMEA 4TLCA 1FL9A 1TUIA 2GEUA 2GJAA 1JAIA 2DPXA 3H86A 1AS0A 4RZ3A 3WP1B 3W6PA 2FNAA 4Q1BA 3IDQA 4C0BA 1E2HA 1Z0AA 4Q7LA 1DAFA 1E79D 1GDDA 2G6BA 1W0JA 1J8YF 4E22A 1VHTA 1LTQA 2VP2A 4JBWA 4DHEA 1ZM9A 2LCFA 4IFBA 5E7IA 4HZIA 3QF4A 3BXZA 4KXFB 2VIIA 5EXTA 4ESHA 4Q9JA 1AKYA 1HE1C 2WPDD 2EFCB 3GJ4A 3FFAA 1VIYA 3CWZA 4BWYA 2IXEA 4TSFD 3KQKA 2XTZA 4UNNA 1ZM7A 1E0SA 4N0EA 4NTZA 2H17A 3DMDA 4JLDA 4NCHA 1S9DA 1UBCA 4XIGS 5SZIA 4GI7A 1WB9A 4ARZA 1FNMA 1HQCA 2F6RA 2GAOA 3LNCA 4D6PA 1TTTA 1Z07A 2V9PA 2FSIA 2HCJB 2SHKA 1G3IA 4DSUA 2B92A 1WA5A 5BN4A 1G291 2ZR9A 4MRPA 1E3MA 5F9FA 1AGPA 1A82A 2CBZA 2QP9X 2AL7A 2ZU6A 5GVRA 4B76A 4XVQA 1NG9A 1H8ED 1U98A 3CO5A 4AWXA 4CGZA 4CEIA 4RJLA 3SYNA 2CCGA 2NO6A 4HB4A 3CNNA 3K9HA 4LJ4A 4FN5A 2Q3HA 1NJGA 2ZRNA 4GZMA 1KHTA 1QHGA 4PAMA 2ZSBA 3WBKA 3SHWA 3W6NA 1I2DA 5C18A 3T15A 2QBYB 2OFWA 3GEEA 1ZAKA 1KI8A 2ZTSA 4FMCF 4DSOA 4BPBA 2VF8A 2WJIA 5IT5A 2ZI3A 1RW4A 2B8TA 4L5BA 4MGYR 1E99A 1Q12A 4Q47A 5HKKD 3QPUA 2ZRPA 1U9IC 2IEZA 2ODWA 3P20A 1G3QA 4UNPA 2QI9C 2GVDC 4IOMA 1RYHA 4QJ4A 3P4XA 2OE2A 3KTAA 4KSCA 4BECA 3OFNA 3CR7A 2VHTA 2DFNA 1CTQA 4OHYA 4LV5B 3KKQA 3DPUA 2G0NA 2X2FA 2Z43A 2ZS9A 3FDIA 3KKMA 3CWQA 3CX8A 3QF7A 5DO9A 4KLNA 3K70D 4K46A 2Q21A 2JJ1A 1F60A 2W2TA 3SBEA 3EASA 1MT0A 4BFSA 4US1R 1P2VA 4PAQA 2IWHA 5JJIA 1R5BA 3JZAA 4PSKA 3RSOA 3N2EA 4IJMA 2QORA 3EZ7A 1CR1A 3BS4A 2CHVA 3B9QA 2OEPA 1W0KD 3RRYA 4M1TA 1NF3A 4HATA 1U8AA 3WHKA 5KSZA 1EESA 1ODFA 4NCKA 1P2UA 3K70B 2VHCA 5EP3A 1GWNA 4MUBA 2ZE7A 3AKDA 3C15C 1RJ9A 5BWMA 2BKUA 3DZ8A 3SJBA 2FSHA 1Z2AA 1A5TA 5DI3B 4CEJB 4D4KA 2H57A 1G8FA 3BBPA 4DIEA 2ONKA 1OW3B 1QHIA 3TRFA 3F3YA 4RFSA 3TKLA 3LQQA 4JKYA 2XTNA 4RY2A 4LYJA 3CRRA 4B2LA 2GXQA 2DFLA 2CDNA 1QVAA 4Q21A 2P67A 1C9KA 3A1SA 2CK3A 4YDSA 1JPNA 2FEOA 2WIBA 5FI0B 2V55B 1M7GA 2QL6A 5G40A 1VCMA 1S9HA 1PZNA 3RC3A 3TAUA 2PX3A 2JEOA 5CIWA 1SXJA 2KI5A 4L9WA 1KI2A 3TH5A 5DI3A 4DDVA 4CEJA 4AKEA 5AJZA 4Q02A 5AUQA 3GFTA 4P4TA 4B47A 4P0TA 5B58C 1W47A 4G3XA 3Q8XB 3CBQA 1OH7A 3FWYA 4QHYA 4XTRA 4GOXA 2PEYA 3A4NA 2YOGA 4LJYA 2ZJZA 4DKXA 3C8UA 3FE2A 3RDPA 1WF3A 3MWKA 5CYPA 1D6JA 4LX0A 4EPXA 3AF1A 4KO8A 5DYGA 2XOKA 3GQBA 2IYYA 3SS8A 3BB1A 3O8DA 1VHLA 4G1UC 3RRZA 1F6BA 3AP2A 3VX3A 1ZIPA 2BCJQ 1KY3A 4ON9A 2PZGA 5FTMA 1G3RA 3ETLA 2WWIA 5FTLA 4M4SA 3CPHA 4QBGB 1XP8A 3O8BA 3MJRA 1N5LA 2FSFA 2IL1A 2ZROA 3WXMA 3THWB 2O8CA 4JL5A 3AKYA 2ZJBA 2ZREA 3FMIA 4IOLA 1G41A 2QPAA 1X3SA 2ZRLA 3R8CA 4OI2A 621PA 4LCBA 2ZJ8A 4LC0A 3WYFA 2NZ8A 5FI1B 1P6XA 2CCJA 2IHYA 5TY0A 4IVRA 2J0SA 3VMFA 1L8QA 5FOWA 2YZ2A 3VFDA 2MMCA 1XEFA 3UK6A 2VHQA 4GZLA 3RAPR 4B3DA 4L16A 3EA0A 2ZRAA 4YXWD 1W36D 2H7VA 4TZ0A 4OHVA 4IVQA 1V5WA 3LD9A 5FUWA 2C03A 4WZ6A 3I4LA 4A36A 2WPDA 4Z1MD 2Q3FA 4UXHA 4KITB 2PH1A 3AEZA 1EFRD 3MFYA 4OQFA 1YZGA 1WBBA 5LPNA 1CRPA 2VP0A 3N70A 4RD3A 2GJ8A 3PEVA 5C2JB 1MO5A 4R7ZA 1G64A 3AVWA 2FGJA 3B6EA 5D3QA 4HB3A 1GFIA 2QM8A 1ZCBA 4RCZA 1KKLA 3H0KA 4R9UC 2ZRDA 3K0FB 4EPVA 3OFND 5FUVA 3UMFA 1KO5A 4BZPA 2V1XA 4HB2A 4PQYA 2CLCX 5F2EA 1UDWA 4P4SB 3RWOA 1MO4A 4IFEA 1KO1A 3VR3A 1KO7A 4YXWA 3SDZA 3ZJYA 1GKUB 4Q9IA 5KNDA 1ZINA 2O8DA 4HB0A 5JCZA 4ZCMA 4NYJQ 2F7SA 2ZM5A 1NN5A 4Q19A 4Z8XA 4G5QA 2HEIA 3X2SA 1E2KA 1SGWA 3HU2A 1GAJA 4RKFA 3R9IA 5KSYA 3VNVA 1NLZA 3LA6A 4GRAA 1NY6A 1E1QA 1LVGA 2AWOA 2YHSA 3OEEA 2WSSD 4QBFA 1KO4A 3QY0A 5JSZB 2N1BA 1OKKD 3RHFA 3WMGA 3UMSA 4CYMA 1Z06A 2KWIA 4EIWA 1Z29A 2V1UA 4G01B 1YZLA 5JRZA 1T6NA 3RRMA 3X1YA 4E5UA 1KJWA 2OUKA 2ZSAA 3ND8A 4JL6A 3QKUA 3NBZC 4Q4LA 1OB5A 3VKHA 4HZUB 4AKGA 4OI4A 2Q9AA 1ZCAA 5TMPA 4PX9A 4ZKDA 4QGFA 1TQ2A 2W2XA 2ZI6A 5IHPA 2BBSA 4Q4HB 1BS1A 5GVSA 2OSBA 3DOEA 4M21A 1OSNA 5P21A 1U8YA 3PUWA 2G3YA 5IK2A 2PBRA 1DAMA 2IBMA 2ZETA 4U5XA 1RRPA 3AVXA 4Q1DA 2GJ9A 1R7RA 1LS6A 2D4HA 1AQYA 121PA 1XXHB 2ZJYA 2BJWA 4BLQA 1IY0A 2WKQA 4M8NE 4ABYA 3QXJA 2RHDA 1LNZA 5DSZA 4CW7A 4NU0A 4JKIA 3T5DA 1EX7A 1XEWY 3CPJB 3B82A 1WDTA 3AVOA 5FFMA 3THYB 5K8UA 2AD5A 1HURA 3QI2A 2FMXA 4BFTA 1VMAA 3IKJA 4LHYA 1RC8A 3SC3A 2GTPA 5KNCA 4PC6A 3U3OA 2VBCA 1XTKA 1S1MA 5TARA 3K0CA 1JB1A 1WP9A 3N5CA 1CP2A 2NPIA 1CULC 3HR7A 5AK0A 2XAUA 3EWAA 5E7JA 5D3MB 3TSOA 1KDPA 1N6IA 2YINC 3RRNA 3BH7A 1JI0A 3QXXA 4JLPA 2JJ8A 3TVTA 4GL2A 2BMJA 4BQSA 4D82A 3IHLA 4LDJA 4P33A 5KDDA 3R20A 3V4RA 2PZFA 5FL7D 3U44B 1W2GA 4NP6A 3SI7A 4V0OA 1TPZA 4C0HA 3U4QB 2WIAA 1BH2A 3Q7PA 3IIMA 1E0JA 5JS7A 1KZ7B 1QHNA 2IYLD 3WHLA 3KKPA 4EPRA 1MRNA 1KO8A 2IEYA 2OLKA 5FPTA 5KDLA 3L43A 1A7JA 2ZRJA 4IEEA 1N2CE 1N5IA 2YNMA 3CF0A 4PFSA 1CIPA 1E32A 4XH9B 5JCPA 4ZPXA 2CJWB 5KPDA 1SKYB 1LW7A 2JLQA 4PHFA 1FP7A 4YMUA 1KNXA 1Z08A 4HUQA 3C41J 4JVSB 5HCNA 4O2RA 5J40A 1UPTA 3QEJA 3LAWA 4Q9HA 4XWKA 5EE9A 1JXMA 2WOJA 2NO1A 2NO7A 4LWZA 4GBMA 2W6JA 2WWYA 4KVGA 1EGAA 3NG1A 3VHLB 1FX0B 3T35A 1GVNB 2FE4A 2CVHA 2NZJA 4CF7A 1W7AA 3KZ1E 3RLFA 4DWJA 5B57C 3WNCA 1OIVA 1NKSA 2IF0A 2FH5B 2BVNA 3FTQA 4DLWA 8OHMA 2A9KA 3J81k 2J7PD 1CR4A 1OYYA 2IW3A 1J7KA 4D0NA 3VAAA 5AJVB 2HDNB 1AK2A 1ESMA 4MUAA 3DM5A 2E1RA 3IPXA 3O8RA 2VPPA 4LBYA 1QHYA 5JSZA 1E9FA 2C77A 3NHAA 4NKRA 2OBLA 1IONA 1RFLA 2R6FA 4PSVA 3I61A 1H8EA 3QE0A 4FMDB 3HDTA 1QG4A 3M1IA 3KX2A 1ZM3A 3BJIC 2FZ4A 2XZPA 2RGAA 3A4LA 3BWDD 4WA7A 2C9YA 2CL7X 1E1RA 3OHMA 3BOSA 5EUQB 1GG2A 3A4MA 1KSGA 2QQ0A 3VU9A 5JEEA 4NYJR 4FD2A 4JLJA 5HTKA 4JYCA 3KKNA 3W9YA 3ZS8A 4FMBB 5FH9A 2F9MA 4Z51A 1TQ4A 3OEHD 1EFCA 4RFSB 1GRRA 3K9LA 2ERXA 2CEAA 2JA1A 1I2MA 1E2DA 5L3QB 5B2ZA 1T8TA 3LXXA 3JZMA 4DRZA 1II8B 4LOAA 4A0FA 3L0IB 3U60B 1UM8A 4C2TA 3MWLA 4J0QA 3SHFA 4E07A 2FX3A 4D0GA 4F4CA 3GJ0A 2W83A 4I1VA 1XPRA 2DHRA 4M1SA 3KJHA 1KIMA 1MRSA 2AN9A 4JLVA 3LWNA 2E9SA 3KKOA 3F5FA 3OIYA 2A3RA 3IHWA 5EP1A 3FHCB 1KI4A 1FZQA 2OFXA 1G20E 1RRGA 4AC9A 4C7OA 3CH5A 1P2SA 1E9AA 2EW1A 1ZD1A 1BMFD 2NG1A 5CB8A 3WMFA 2J5XA 5KDOA 1AS3A 1SVIA 4G0NA 2AFHE 2FG5A 3IGFA 4MGZR 1XD8A 1JR3A 2BJVA 3WYAA 5KSPA 4JBYA 3U44A 2W58A 1OXVA 5TVKA 2PX0A 1ZIOA 3LXRA 4DUGD 3DKVA 1RRFA 1TNDA 1G16A 1W4RA 2WVJA 3KXLA 1RPZA 1CJVC 1QDEA 2H8KA 4M1WA 4NMMA 5CJ2A 2NTYC 4LJ5A 2RGNC 5BXQC 1K8RA 3NH6A 4KYIB 1R0WA 4NCIA 3E70C 4A8JC 2NPFA 3V9PA 4D4JA 1XFAA 4WAUA 5FPHA 2PL3A 2GXSA 5HE8A 2ZPTX 1OT3A 1Z0FA 5CDFE 1CBUA 1J99A 4PZZA 4W9MC 3NVAA 1FNNA 4TT3A 2CNWD 3PENA 4OKSA 4D4MA 1JXOA 3D7MA 4PC3A 1FUKA 3HYRA 1E4YA 2CLSA 4O3MA 5AJXA 2EYUA 5BN3A 1G5TA 2F43B 5IK2D 2ZJOA 2FFHA 3NBXX 4PO1A 4A6PA 1SVSA 3CPEA 1IXRC 2Q6TA 3PUYA 4MGIR 1GRNA 2ASEA 2AWNA 1R4AA 4PQRA 5JBQA 4EDHA 4TYNA 2CK3D 3D3QA 1IY1A 3NWJA 1OLOA 3NDBB 3FVQA 5J4YA 2R62A 4F4JA 3VR5A 1G8YA 1P9RA 1VG8A 5FL7A 3GLIE 3HYTA 3AGQA 2Z0MA 2EFDB 2EWVA 2XEXA 1E1QD 2PLRA 1ZU5A 3ZGXA 4K8OA 2AXNA 4TTPA 5FTNA 4D4LA 4IDQA 3UANA 2DWOA 3OESA 5F9HA 1II9A 4LJ8A 1ZUHA 3MJHA 3ZVRA 2HXSA 4KVAA 1Z5ZA 1D9XA 1FMLA 1MO3A 3SYKA 1P5ZB 1TAGA 2QROA 3VX4A 2HYDA 3U3KA 2H18A 3QEOA 5DHFA 1K5DA 1UKEA 2BMFA 5FR2A 3EZ2A 1ZVQA 3QVUA 3T12A 2O52A 1E6CA 1XD2B 4KCGA 4Q9LA 4BLOA 1XU4A 4C0SA 1F5NA 2CMKA 2L0XA 1JECA 4GT1A 3PEYA 2RGXA 1NVVQ 4FCWA 3MWJA 2QU8A 2RH5A 3B5JA 4B71A 2W00A 4DLYA 4FW9A 4US2R 3AKCA 1M1YE 2ZJAA 221PA 3T61A 5LB2A 1H8HD 2JCSA 3TW4A 4FMDF 2ZUBA 2K5UA 4Z8YA 2ATXA 2ZANA 1G7RA 1P9NA 1WRBA 3K0AB 2QP4A 2UZ3A 3SE0A 2VTKA 2ODEA 2PT7A 4KFTA 2OLJA 2ZJ2A 1MV5A 4QRHA 1HT1E 3AVUA 1S1CA 2OESA 1Q0UA 1PUJA 2JGNA 2OCAA 1WCV1 4DDUA 1HA3A 2A5FA 3CRVA 4LHWA 4LJ7A 4A0HA 2J7PA 2BIFA 3QKTA 4KV9A 4TYQA 1ZNWA 5DE3A 4X8OA 3ZVMA 3LFUA 3OEED 2D62A 2RGDA 3NC0C 4WZBE 3ICEA 5FBQB 1K6MA 2G1KA 3CR8A 1OXUA 4UXIA 2GCNA 3GLFE 4HAUA 4Q48A 4JVLA 1N0WA 2OBNA 2XNDA 4HLUC 3U4QA 4KI0A 4M1OA 3EZ6A 2QBYA 4BUJA 4RKEA 4X8MA 3X1WA 1R0YA 2XITA 3PJRA 3W3ZB 4JL8A 3CX7A 4RCYA 1RVDA 2VLIA 1S3SA 4TLBA 5G3ZA 2JLSA 2QTHA 5SZKB 4IOKA 1NLYA 3WY9A 1QG2A 2VA8A 1FPMA 3MGCA 3ASZA 3SFZA 3LVQE 4G5SA 1LS1A 4TMKA 4G5OA 2A2ZA 2ZE8A 3CF6R 4MA4A 2GF9A 2IS2A 5L3SA 4D26A 1T4GA 3CF2A 3IO5A 3AB3A 1SZPA 1E79A 1S0UA 1ZM4A 5FBWB 1BOFA 3SJAA 4Z1MA 1JQLB 1KNQA 1WE2A 4L8GA 4LV6A 4QGHA 2PCLA 4FI3C 4QM7A 1TF7A 4HAWA 4GOJA 2QN6A 3CW2A 1C1YA 1OXTA 2PLFA 4A2QA 2QG6A 3GLGA 3QF4B 1N0UA 1VG0B 1DBSA 2LWIA 3I8XA 3IEVA 2GAAA 2ZVPX 2GEDA 2W0SA 3QG1A 4MKIA 2VYFA 3TSWA 4Q03A 3KL4A 4XWOA 4CEIB 1Z0DA 1DTSA 1XF9A 4YLGA 4B2PA 4JJKA 2ONJA 1TMKA 2ZRMA 1DOAA 2FPLA 4CZ2A 4QGGA 1S2MA 4A6XA 2FFBA 2ORWA 4A4DA 2HYIC 1UFQA 1XXHA 2X19A 3SBDA 3K0SA 421PA 5JEDA 1XCPA 2XJ9A 1JPJA 1X8LA 2QPOA 3O47A 4D2IA 3PEWA 3PXGA 1ZNZA 2EWWA 4ZI2A 1OH8A 2P6NA 2ZRBA 1Z2CA 2GJSA 1MO6A 4EJSB 4QM6A 4M22A 1Z0JA 3WNBA 2R9VA 3QOFA 4Q4HA 4B32A 1E9DA 3QKSB 3ZLJA 2ZRKA 2AHOA 3IQWA 5LD2C 1EWRA 1XJCA 1E4VA 3IEUA 2QMHA 3LBHA 4F92B 4ESVA 1T3HA 4ERNA 3FKSA 2R2AA 3ASYA 1EFRA 1OF1A 1E0KA 2P3SA 2DWPA 1QZXA 5HCIA 2UKDA 3DO6A 5GJVC 4IHQA 4A92A 1M74A 1UBEA 1XCMA 1ZW6A 1RYFA 3QKRB 1UBGA 4A82A 3QNUA 3AF2A 3G5UA 3RSLA 3VKGA 4LJAA 2QSYA 5CM8B 4M9SA 1IXSB 1QHHA 3HP1A 4HLCA 5JECA 3KDSE 5CITA 3E2IA 3U2QA 3ZZ0A 2O0KA 2VSOA 2JJ2D 2J87A 3RANA 1KK0A 4X8LA 5JJLA 3MG9A 4CEHA 3GPLA 4TMZA 2P2LA 4JIMA 1D2MA 5AR1A 5C4GB 3AH8A 2REOA 4XVUA 2ZRIA 4QNMA 4O2LA 4JMPA 4MITA 1OFHA 1US8A 3JVVA 1NKTA 1AQUA 3VR4A 4A8JB 5J4LA 4BRWA 1XPOA 4TZ6A 3IBYA 1W49A 2AFIE 4AIIA 1KDRA 1JJVA 1UJ2A 3U5ZB 3MMPA 4JLBA 1HH4A 1X6VA 2GA8A 3LY5A 3T1QA 1YZKA 4IRUB 2NQ2C 3QIAA 3LVRE 4RD6A 4KFUA 5DISB 1JEEA 4UXJA 2OBMA 1NN0A 2V4ZA 3B8HA 3SZRA 2UZIR 3MLEA 1IJFA 4EFNA 3CB4A 2EFEB 3FKQA 3TGPA 4Q1EA 3LV8A 1N6RA 1B23P 4YDHB 1QHSA 2R6GA 3T06B 4AKIA 2FOLA 4DB4A 1KSJA 2NO9A 2WAXA 2AXPA 3I72A 2IF2A 4OQNA 4FCTA 1N5JA 1KI7A 5DH9A 3NEJA 3KFVA 2YWFA 3KXIA 4URYR 2GEVA 2GDJA 1VG9B 2ZAOA 4DBLC 4S2EA 4TMWA 1N6PA 1ZJ6A 4ZKEA 4LYAA 1E1RD 5FPYA 4NONA 1XRJA 3BERA 1RKBA 2CE2X 3GLGE 4V0MA 3FHTA 1KK3A 4DCVA 1B0UA 4US0R 2ODBA 2DBYA 4ZDIA 1YVDA 1ZNYA 4TMXA 1KTVA 4PXAA 3GLHB 3PG5A 1IM2A 3ADDA 1PLLA 4TN1A 4L4UA 1HUQA 2QPTA 2R65A 5EQTA 4C0LA 3THYA 2O8FA 3MCAA 1T9HA 1M7HA 4GOKA 6Q21A 1I4DD 4PC7A 1BYUA 3TE6A 3IIKA 1RIFA 3B2EA 1GKIA 4LHXA 4PPGA 1SKQA 4Q7KA 3WP0A 3ZYCA 4TMVA 5KYKA 5L3VA 4PAOA 3DDCA 5BN5A 3Q85A 1PLJA 5HKKA 4Q4JB 1BO6A 4AD8A 1TU4A 3B7GA 3CNLA 2RGNA 4C4PA 3PFIA 1M6NA 4IDOA 5GJCA 2P5TB 4YQFA 5BW8A 5J5CA 4ITRC 4PPFA 5FOVA 1D9ZA 3Q7QA 2CNWA 4DCNA 1OIWA 1G9XA 3RS0A 5L8VA 1TADA 4TWZA 3P32A 4XOIA 3QENA 4DSTA 3GFPA 4G5RA 3KB1A 4EFLA 4LY6A 3OZXA 4JT4A 3B85A 2AKYA 1Q1EA 3GLHE 4MH0R 3DVLA 2FGKA 5BQ5A 1NLFA 4P4SA 2G9NA 3PVSA 3GCGA 5KUTA 4URVR 1G7TA 1M2OB 5BYKA 3WBJA 2ZUCA 2WJHA 3QVVA 4JLMA 4YMVA 3KQUA 4A0GA 1JNYA 4Q4AB 4HLQB 4LPKA 1YZNA 5B30A 2OXCA 2D74A 3CM0A 3NBFA 4HLUA 3U3JA 2BMDA 3FMOB 3GP8A 4EQ6B 4DCTA 3TUJC 3DMNA 2IS6A 3RS4A 1Q21A 3THXA 4K81B 4TL6A 3MUFA 2LKCA 4W5JA 3ZZTA 2BHRA 2OILA 1JAHA 4DVGA 3KJIA 1E9SA 4HDCA 4IDNA 2F3RA 4DLRA 2Z4SA 3PIRA 1OKKA 3MRSA 1N5KA 1BKDR 1GNRA 5JJKA 2VHUA 1U99A 2CL6X 4P32A 3LW8A 3UWKA 1HQYE 4EAQA 3C16C 1T8UA 2KBEA 4OJQA 1Q1BA 3ONWA 5G53C 3EZ9A 1SKYE 1GRQA 4OK3A 3EPLA 2HF8A 2IYWA 5E95A 4ZDWA 2JATA 1NN3A 2GHIA 2F1RA 2FU5C 1KMHB 4XD7D 2DCUA 1E9BA 1G7CA 4F38A 5DYIA 4DLUA 5FTJA 5SZJA 5C1BA 2ZI4A 4N1AA 4U00A 2BEKA 5F3WB 2WV9A 1HYQA 3ZVNA 2O8CB 2JIZD 1GZSA 1W4AA 1W4CA 1VYTA 3RVBA 2CVFA 1IBRA 2J3EA 1FMJA 3TK1A 4OJKA 2NGRA 1US8B 3RS2A 5JWRA 2FPMA 1Q44A 2V8OA 3GJ5A 4A1FA 1IN7A 2W2VA 4B3FX 3ZZUA 4B75A 4BFZA 4BEBA 1Z8FA 1ZD8A 4IXNA 4NYMR 1ZUNB 4C9BA 3FYHA 3ZH9B 4GMDA 5B64A 2IX3A 3NXSA 5EJEA 3KJGA 1CS4C 4PZYA 3I62A 2QRNA 2YOHA 4LZZA 4BLSA 1G19A 3C4JA 1D8TA 2QNRA 1OYWA 2HLDD 2A5JA 4PO9A 1WBDA 5IF9A 3VHXA 1NNEA 3U6KA 4FINA 4A15A 3FPAA 2WTUA 1N6LA 3QKRA 3H2YA 2JAQA 4MRSA 4V0ME 3R9WA 1PJRA 1SXJB 3B1VA 2CCKA 5CDFA 4OHZA 4I4LA 2F3TA 2ANCA 2GXUA 2QTVB 1I4TD 3W34A 4DDWA 4Q7MB 3KQLA 4DEYA 4WXRA 4B73A 2FPKA 4Q00A 4KYUA 2WICA 2J41A 1Z6AA 5CJPA 3ZS9A 1XJ0A 3KUCA 4QL3A 1UKYA 3X1DA 2B8WA 3WRXC 2P6UA 2KB0A 1RE0A 4KLZA 4XTCS 4F93B 4YMSA 1NVXQ 1UEIA 1GKYA 2R6CA 2ZAMA 3AF0A 1IHUA 3L2OB 1EFUA 5DNYB 3UMRA 2J0UA 3A6PC 2XZOA 1UEJA 5DN6D 3UG7A 3KQNA 4H1UA 2HLDA 2R44A 4A2PA 3U7FB 4LK2A 1G4UR 1M34E 1PLKA 2EYQA 2R6DA 1N6HA 2C8VA 5FPSA 3BGWA 4HDOB 1UDXA 1U8ZA 1IJEA 1G1MA 1XEXB 4HAVA 4NYIR 4ZV4A 4BLRA 4RFVA 2QAGA 2QAGB 4FWTA 1R8SA 3OAAD 1YR7A 3G82C 5JLJA 1F3OA 1MKYA 4Y0AA 3TIFA 3DEFA 1U0HC 1GIAA 2GCOB 2G77B 3TVDA 1DADA 4B34A 3I1FA 3LBNA 1CJTC 2PMKA 2ZSDA 4WVFA 1P61B 2Q9BA 2JLVA 1XDBA 4NZYA 3B1ZA 1KY2A 4C30A 2J59A 4ZIRB 3LO5A 2AKAB 4AYWA 3L0OA 1YKSA 3BH6A 2NO0A 1M7BA 2V7QA 3KXKA 1OB2A 1T0JB 2WHXA 4HUTA 4WBSA 3VQTA 3TW8B 3VR2A 4Q1AA 1VIAA 3MD0A 3SJCA 3SOPA 2DR3A 3ADBA 1FUUA 1VCOA 2Q0HA 1NIJA 2F43A 2QQEA 4BRUA 4P31A 4GP6A 2B7BA 2WWXA 2DY1A 5TDHA 3OIWA 1SVWA 2CHQA 5KHOC 2TMKA 2H16A 1O3YA 1R10A 5ANRB 4C7OB 2J45A 4MKGA 2YVUA 1MABA 4LBZA 2ZI9A 2V54A 3AV0B 4B48A 3GJ7A 4OK6A 4E09A 1WXQA 3UKDA 4YMTA 2I1VB 3GFOA 4KFSA 5A0FA 3MSXA 4QBIA 3BFXA 3THWA 4QKQA 1LF5A 2XOKD 3AKEA 2I4IA 3RWMB 4C0KA 3RC8A 2E87A 2WKPA 2J0QA 3MWYW 4A0RA 2HUPA 4TQAA 3EA5A 4B3GA 1NJFA 4UQOA 5H1YA 4BFXA 4ARZB 2OAP1 4JYBA 2CL0X 5K8TA 3NC1C 1AZSC 1TUEA 1GILA 2MSCB 4TTQA 2ODNA 5FTKA 1S4QA 3OE7A 3PUVA 3KB2A 1HE8B 2YJTD 3QG5A 2GETA 1Z28A 3PUZA 2REBA 4DUGA 2GZHA 2QA5A 2YC2C 4I1UA 4NL4H 2CHGA 4MQBA 1SVOA 2RGCA 3W6OA 4F7WA 1ZMXA 1DO2A 2XSZA 4JSYA 3V00A 4LHZA 3QBVA 1DEKA 3DOFA 4Q7JB 2BOVA 2Z83A 3E5HA 1R5NA 4GMXA 4PHHA 1GL6A 3CX6A 2D06A 2WJVA 2IC5A 4JSTA 4JS0A 1CJMA 2YOFA 2IYRA 3ZIAA 4I81A 3UXMA 1E2LA 4HI0E 4UJ5A 2QENA 5DI9A 1P75A 1CLUA 2HCBA 5EE1A 1OHHA 3QXSA 4OK5A 1X8KA 5EXPA 3Q3JB 2ZR7A 2GCPA 3CKLA 1W0KA 3W5IA 2D3WA 4BFUA 1F2UB 4L9SA 2XGJA 4W5HA 3OEHA 2I1QA 2F1JA 5EE0A 1G3MA 3EAQA 4PR0A 4LHVA 4Q4AA 2CLDX 4TSFA 1Q20A 3B13B 1CRQA 1XD9A 1W48A 1G5PA 2AX4A 2FZLA 4JVNA 2EFHB 2P65A 2V7QD 4U7DA 3K70C 4TMTA 4V0NA 1ZNXA 1R8QA 2JJ1D 2KBFA 2WJYA 2JLXA 3EX7C 2GXAA 1KZGB 4GNKA 4FIDA 5AJYA 5IDVA 4C0AC 2IT1A 3HPRA 2D7DA 1ZD9A 5EXSA 1QVRA 2WM9B 3LW7A 1N6OA 4QHSA 1AKEA 1ZRHA 3T1VA 4AY2A 3AVQA 5HZHA 2PJRA 1J2JA 3GD7A 4MRRA 2CJWA 1YZQA 3B1XA 2IS4A 2LKDA 5J4KA 1GNQA 3GLIB 1NVUQ 4M1KA 4QGAA 4ACBA 3IQXA 3K9NA 2G83A 3FHOA 1F2TB 2EFGA 3A1TA 1ZUIA 2ZIAA 4QXAA 4R71A 1YQTA 3PQCA 1G3UA 2J1LA 4PTLA 1HTWA 1G6OA 2PMDA 1R2QA 1G8PA 3OIVA 4KHZA 1ELOA 1KJZA 5FOTA 2DYKA 2YWGA 4OQLA 2JIZA 4DLVA 1NVWQ 2GZAA 2ZR0A 1P62B 4KFRA 2CE7A 5DIFA 3P27A 4HUQB 4HYYA 5A4JA 1TF5A 4WIAA 1T91A 2ZVQX 4XD7A 1LF0A 3RS5A 1NMYA 1Y63A 4FCVA 1NIPA 2OZEA 2W6JD 1TEXA 3WYGA 1J8MF 1Z83A 3K0EA 3W8NA 2A5GA 3AUYA 1CEEA 3TUZC 4P3YA 3NTUA 4PANA 1W4BA 3SNHA 2ECKA 4DEXA 3G0HA 2QY9A 4M9ZA 4M0LA 4ZI3A 1NP6A 2QT0A 4FMCB 5J47A 3L8YA 3E1SA 2OCBA 4B43A 2BBOA 1KGDA 4WOPA 4O25A 2D2FA 3M4YA 4LBVA 2BDTA 3KFXA 3CH4B 5EP4A 1ZC4A 2OFOA 4NPHA 3T1OA 1D2EA 4BZQA 5BYJA 5H70A 4URWR 4GP7A 4M9QA 4GFDA 4M53A 1S8FA 4DJTA 1D2NA 2Y8EA 1KOFA 3VKWA 1EX6A 2ATVA 2D2EA 1NMXA 3TUIC 2C5LA 4CT5A 3O8CA 4JLNA 4BFWA 1JR6A 3LRPA 821PA 3ADCA 2H5EA 1E2JA 1S3GA 2FSGA 2JASA 2RHMA 2ZRCA 4PHTA 1Z6XA 2WSSA 1QF9A 3BH0A 3Q72A 4MKFA 4TT3D 5J4HA 2RGEA 4RZ2A 5G41A 4JLOA 4BLTA 3TMKA 1U0JA 5HPYB 1KKMA 2BCGY 2OO7A 1TU3A 5JFGA 1L7VC 4MYTA 1YR9A 1XTQA 2PCJA 2GJKA 3AF3A 3GLFB 2JLZA 3FGNA 4JLKA 2H92A 1E2GA 2UVQA 2WBLC 5AUPB 3LX8A 3U6BA 1KDTA 1G17A 4ZDKA 3V4FA 1CU1A 4DDTA 2C98A 4LGMA 4H9GA 2GWHA 4JT2A 4Q4JA 4KODA 1PV4A 2G88A 4PZLA 3SN6A 3W8RA 4LSGA 2P6RA 1QRAA 4YMWA 4AYXA 1RRCA 2D7CA 2JDID 4C0QC 2X1VA 3U61B 2GKSA 3K09C 3M6AA 2ZEJA 4HZUA 5CLLA 2QZ4A 1OIXA 3F8TA 1DG3A 3NHBA 2Z6VA 1K5GA 4CRWB 5JWOA 1R6BX 1Z0KA 1FX0A 1G7SA 2HT6A 3CLVA 3R7WB 3W5JA 4BFYA 4MDFA 1M8PA 3B78A 4BASA 5KU1A 4P4UA 3LX5A 4A2WA 2ERYA 3QXHA 3CZPA 1CR2A 2QTFA 3CRW1 4QG7A 1U0LA 4X8HA 2FV8A 4IKEA 1G4AE 3U7GA 3TSZA 4ASUA 4PC2A 3RNLA 2DWQA 1KDOA 4LPSA 3Q5EA 4V0LA 1W36C 4NHOA 4TLAA 3GLHA 1VYVA 2YKGA 1L4YA 2BBWA 3SQWA 5FL3A 3VNUA 2PZEA 3P4YA 1KAOA 4RZXA 2AR7A 2BEJA 5FOSA 4D80A 4LJ6A 4B33A 2IS1A 2VHJA 5JRJA 1DVRA 1NY5A 1BYIA 1DE0A 3TQCA 1LFDB 3K09A 1KI6B 4IEIA 2QMEA 2GVZC 1I4LD 3ZQJA 1NRJB 1SHKA 1EXMA 2OCYC 3AGPA 3A58B 1PVOA 1DAKA 2IYXA 1SQ5A 3AP1A 3GJ8A 1DAIA 3NDPA 2XNSA 1L4UA 1JR3E 2RGBA 3C14C 3DHWC 4HAYA 3QSYA 3AF4A 4RD4A 1U81A 4HDQB 2YV5A 1LB1B 3I8SA 3R9XA 3IILA 1KYIA 2WZQA 4I99A 2C2HA 3CRMA 3K0FA 1SVKA 2XZLA 2WMNB 1Q3HA 2RB4A 2ZS8A 3PCRB 2OG2A 3IO3A 3OIUA 5EZ5A 521PA 4GDFA 3DZDA 1IN4A 3MAAC 1AM4D 3THOA 2WJJA 5GJBA 1DS6A 5F98A 1E2EA 5UKDA 1E9RA 4QNRA 5C4MA 2EVWX 1XMVA 1AA9A 2VSXA 5CLQA 3TAHA 5E3HA 1EWQA 3K1JA 3GEIA 2JLUA 1OXXK 1XMIA 2ZU0C 3TR0A 1QHHB 4OBEA 4NCJA 2PEZA 1YU9A 1Z3IX 2C95A 1TL7C 2WSMA 4OHWA 5FUYA 4CVNA 4RD2A 1F2TA 3WRYC 2REXB 3UG6A 4TLDA 2IUUA 4B6EA 2FN4A 1CXZA 4PPNA 1UKVY 3QPWA 2VSFA 1QBKC 5FBRB 1F48A 1KAGA 4D81A 2OM2A 4CEHB 4Q1FA 4BFVA 3IPYA 4HEJA 3I3SR 1OXSC 1E2QA 2WWWA 4HLDA 3GJXC 1HEIA 4V0KA 1DO0A 2A7QA 1IN6A 3DL0A 2I3BA 4TYPA 3VR1A 1IQPA 2YWEA 4JZKA 4OHXA 1UBFA 3QUSA 4CDGA 2B6HA 5TXGA 4EJSA 5M04A 1UAAA 3D31A 3GJ6A 1N6NA 1Z6YA 2ZYUX 5AUNB 1W5TA 2FEMA 4UNSA 4UKDA 1FFHA 1P4SA 1Q3TA 1YE8A 2ZITA 1P2TA 1GL9B 4Z54A 2KE5A 1NBMA 3AVVA 4WW0A 2O0HA 3ICQB 4TYWA 2ORIA 2QM7A 1E9CA 2GCOA 3I73A 3U7EB 1Q22A 1SVLA 1P72A 3LBIA 2O8DB 3PEUA 4OI1A 5EP2A 4AG5A 1W44A 3AVYA 3PUXA 4URUR 5H8WA 3GLGB 4NCNA 1Z6TA 1FTSA 3CONA 1QHXA 3LH5A 1N25A 3BD9A 2RMKA 4QHTA 4XWAA 1JQJC 3RS7A 3M0EA 5DLQC 3TQFA 3I32A 2VP9A 2W0MA 3OE7D 1Z6GA 3D6TB 4TL7A 3EC2A 4KJZA 2G1JA 3T5GA 2JJ2A 4RSGA 3EIQA 4E03A 2ZUDA 2G0TA 3OAAA 3H4MA 5C46F 1COWA 2J46A 4N3NA 1A2KC 4ILEA 3HJNA 4WXPA 4FWIB 5FOUA 2X2EA 1U9IA 4H1VA 3ZQ6A 5SZHB 1XTIA 2VH5R 2H1LA 2XTMA 3B60A 2O5VA 1BMFA 3A1WA 3AUXA 4JJZA 4KSBA 2HXYA 3WMEA 1UKZA 3LLMA 4F4IA 4UJ3A 2QAJA 5CM9C 3OF5A 5EXXA 2GK7A 1XBTA 2IA5A 3FMPB 2Z4RA 1C4OA 1ZC3A 1FOEB 3IBGA 4MDEA 4QJ3A 2J0VA 1KMQA 4PHGA 3BORA 2VL7A 5DN6A 1LV7A 3A8TA 2RAPA 3C7KA 1E2MA 3H84A 3AP3A 1XX6A 5FR1A 5L3SB 2XXAB 3SU8A 3S1AA 1T5LA 3ND9A 5GJWC 4OL0A 3BFVA 3SR0A 1G8HA 1GL7A 4TL8A 4GPTA 3FB4A 4HAXA 2ANBA 4QOSA 1AJEA 3EIEA 4LI0A 1P7CA 1AGRA 3A37A 1G5RA 2C04A 4MYHA 4DLZA 2VP6A 2WWHA 3ZDQA 2NIPA 1P73A 1A4RA 2VF7A 2O8EA 3L0SA 2ORVA 3IIJA 1XPUA 2AK3A 4YONB 1VDZA 1YJ5A 2C9CA 2F9LA 2FWRA 2OAQ1 3CIOA 4D25A 4IVPA 1XMJA 5KNBA 2QSZA 4Q66C 5CK5A 5E4FA 2XXAA 2F55A 1FTNA 1ANKA 1SXJE 2IK8A 4M1MA 1KJYA 4DLSA 1CR0A 2BKEA 1LY1A 2WAYA 1T3LA 3JVUA 1DPFA 1TX4B 1ZBDA 5JS8A 1T0HB 2IHBA 2AD1A 1XJQA 3PV0A 3EPHA 1FP6A 3BRWD 1P3JA 1XB2A 2FFAA 4XJXA 1WMSA 2ZI5A 3T34A 3FMFA 3GEHA 1UF9A 1DAGA 4DCSA 3EPJA 3UPUA 2WWFA 3KTAB 4B3CA 5HR5A 1KMHA 2ZE6A 3H1TA 1KI9A 3QQ5A 4BEJA 2GBLC 2QGNA 1NSTA 3L82B 1MABB 1SVMA 1U2RA 4AI6A 2OT3B 3EIHA 4Q5IA 2ZRGA 3C5CA 3CNOA 3D8BA 4RD1A 4QFMA 4B3XA 4EPTA 2A5DA 4XVRA 1HT2E 1JJ7A 5AUOB 2ZQ5A 1TEVA 2ZI7A 2O0JA 1XXHE 2DB3A 2YWHA 2ZSEA 2XNDD 3K0CC 1OH6A 1AZTA 2V3CC 1XEXA 3REFA 5A5GA 3VR6A 2FDCA 721PA 4C2UA 2AK2A 1E2NA 1X8JA 1XNJA 2A30A 3Q9LA 4TLEA 3U3MA 3THXB 4RD0A 4F91B 2RGGA 1VPLA 1E69A 3ZIAD 5L3QA 4KU4A 2ZE5A 1W36B 4JVMA 1ESNA 1T3SA 3K0AA 4LC1A 4EKDA 3T1TA 4KBFA 2BM1A 1RJ9B 1XTRA 4DZZA 5L3RA 2IUSA 2OV2A 3EWSA 4ASUD 2NOAA 2GRJA 1NG1A 3BB3A 2IYSA 3I5XA 3ADKA 3B1WA 3P1JA 1R0XA 5K8LA 1HY3A 3F0TA 3LQRA 3P26A 4MKHA 2IYUA 4U02A 1COWD 1GITA 4C0JA 4BE7B 5H68A 1IAQA 3K53A 1AS2A 3IUYA 4QBHA 1FQKA 2GESA 3C5HA 5JWHA 5TB5A 1DG1G 4NYMQ 2GK6A 1MR3F 1E9EA 3CUEF 2QE7D 1VECA 1EFHA 4TL9A 5EE3A 4DLXA 3K8YA 1OJLA 1Z22A 2ZS7A 1E2IA 3VTKA 1VCNA 2Q9CA 1CJUC 4V03A 3A1UA 4NH0A 2J0UB 4PPQA 4CT4B 1DARA 1MH1A 5JZVA 4W5WA 2P5SA 4MYUA 2F1IA 3GLFA 2PJZA 3SEAA 4HAZA 4UNQA 4Q9KA 3ECCA 5KPJA 2QT1A 2B7CA 3LDAA 1YRBA 4KBGA 1SXJD 5DHAA 4Y0VA 1VKJA 1Y3AA 3RS3A 2KSQA 2VO1A 1ZYUA 5KSOA 1XZQA 1II0A 1V43A 3AM1A 2PT5A 4TYYA 5FBVB 2V6JA 5FBLB 2HV8A 3QBTA 1X1SA 1JR3D 1OV4A 3FFBA 4IXMA 3B9PA 1NVVR 2F1HA 3EXAA 4WZAE 4OYHA 3EARA 2BBTA 5FPKA 1AIPA 1VG1A 3TBKA 1XMSA 5JHHB 2NMVA 2W6ID 4AG6A 2O8EB 1J70A 4EFMA 5LDDC 5CIQA 2BWJA 5G3YA 1DAEA 2VEDA 2HT1A 2QE7A 3X1ZA 5IRCD 4OQXA 4DCUA 1N0VC 2RKOA 2EU8A 2QUZA 1TQDA 4QJ5A 1XCGB 5FOXA 2C99A 3HWSA 5JMTA 1II8A 3KQHA 3S1AB 2Z5FA 3FOZA 4TTRA 3HR8A 4B35A 4LUCA 3BK7A 5CB6A 5CYOA 4BZXA 1G18A 3EW9A 4UNRA 3SJZA 2N42A 4ZO4A 2QEQA 4EPWA 3RYTC 5FUXA 2HJVA 2ZJ5A 1XWIA 1IN8A 1NN1A 1P9WA 3VU9B 2ZRHA 3EPKA 2BV3A 2GILA 2XX3A 4LRWA 1G21E 1G6HA 1TF2A 2IUTA 4EPYA 3EC1A 4GSYA 1N6KA 4AYTA 1Q57A 4PQFA 4ZIRA 2QMOA 3TJZA 3DKPA 1NI3A 4EQ6A 1XTSA 2WKRA 2YYZA 1AN0A 1IY2A 1JALA 2QMUA 1GSIA 4PSAA 3EZFA 4JBXA 1ZM2A 4LV8B 4DB2A 1JBKA 2ZYVX 2GBLA 3AVPA 2MSEB 2C96A 2BC9A 4A8JA 4DT1B 1JEDA 4LYFA 4HSEA 3EG5A 3NIBA 1NBMD 2MSDB 1YR6A 3ZVLA 2DFKB 2FF7A 1S96A 1VYUA 2ZXUA 1IOZA 4R98A 4B6FA 2A78A 3CRQA 3BC1A
chains in the Genus database with same CATH superfamily
1TU0A 4LOJA 3OLZA 5A4IS 5G0WA 5K6AA 3T7TA 4DXAA 4HNSA 5CA1F 2PX6A 2O48X 2V45A 3AOEA 3FSRA 4K2HA 1YZTA 4NV3A 1XCLA 3WNDA 4NU6A 2GUWA 3T38A 1CQXA 3DLTA 4UHJA 3UWOA 5HIIA 4P0PB 5CVCA 1G1AA 2QTNA 4X85A 1MHTA 4G1EB 1A3CA 4WN9A 1WHTB 3AL2A 3E27A 3NOVA 1AZLA 1BWPA 5EOVA 1T5IA 2JLRA 2DG2A 1CDEA 1ETUA 3P9CA 5F73A 4YRCA 2C4WA 3I6QA 3LCMA 3A36A 2HRZA 5CXSA 4FYIA 1B26A 2JLWA 3E1KA 1J8FA 2BT4A 3LQFA 3N0TA 2JZNA 1TJNA 3C3AA 3I83A 1RZ3A 4NE2A 4L08A 1Q0HA 5HDQA 3QJYA 3S5UA 1J6UA 1QM5A 2O8FB 1CF4A 5TQ2A 1MAUA 1PHRA 2C20A 2BFCB 2QAIA 4QLAA 1Q1QA 4H1WA 2R48A 1SUAA 4IMJB 1EFTA 2IUEA 4BX9A 3TLGB 4BMXA 2HU5A 3H2JA 4G8DA 3U7JA 5LCXA 1P5JA 4JBNA 2I2CA 3GFGA 2J9ZB 4MKZA 3WB2A 4LDZA 4OBXA 5K0CA 3BHNA 1FJGB 4X71A 5AM1A 1T2CA 4RYLA 3MT8A 3FKSD 5KVQA 3SYLA 1IZ9A 2OC9A 2RHHA 3Q7TA 4U0KA 1W4ZA 3QLTA 1OBCA 1YR8A 2IIBA 3F8SA 1OWLA 3MWDB 4M2LA 3L1HA 3DAOA 4POAA 1FTQA 2CNKA 2FJUA 3A2NA 4H2DA 4ND5A 4RPCA 2B5OA 5LQAA 1OXBB 2ZBUA 4EY4A 5EZ6B 3EEIA 3A4YA 1W581 3UT6A 2IDZA 2O3SA 2E3JA 3HPQA 4I1SA 5DGXA 3BWMA 4RVDA 5HGXA 3CNHA 4QOIA 3VKFA 1GP2A 2P9HA 2X9LA 1W1WA 3LKDA 2H9YA 2AEFA 3V32A 1A8SA 3C3JA 1YZUA 4MRVA 3GV0A 4QQFA 2EGHA 1JLMA 1OROA 1M2WA 1W8DA 3IT0A 4QPCA 4WJKB 1W5SA 1E0AA 5H83A 2A0WA 2Y4NA 4G5GA 1A9ZA 1JIUA 4JH0A 4NJEB 1H4VB 1LK7A 3UATA 1JDPA 1ZGCA 4I8DA 4OB6A 3QTLA 2Q5JA 4G25A 1MRZA 5AP9A 1OPXA 2OXRA 3EDOA 3GUVA 1XTJA 4P6VF 4M9XA 3E2PA 4F9TA 3SYTA 1TLFA 1Q1ZA 3WYNA 1BIFA 4IOJA 3T1NA 5HXAA 1SXJC 1SC1A 1VCIA 2DMRA 1ZP6A 3MD9A 1C41A 2GF0A 4OQMA 3BGVA 1S8NA 4CIDA 1JGTA 3WKDA 5LP6B 4BO0A 5JZ9A 4RQTA 1KQNA 1UODA 5AESA 1OWPA 4Q18A 3R6DA 2Z2XA 1HEYA 3RTAA 3U7HB 4GBJA 3SAJA 1CQWA 1TJYA 3FCCA 4DV3B 5F4BA 4ATNA 5KTYA 4CV1A 1U90A 2WJGA 2QRVB 1B73A 1WLSA 4UVDA 5IAJA 3TD6A 2GCGA 1MP0A 2I7CA 3RSSA 1F6DA 2JAUA 2VQ6A 2P6OA 3BMQB 1NXPA 2ZYTX 4PLHA 3STXA 5EMNA 2V7PA 4C89A 1EMDA 2HMAA 2VCHA 3MIZA 2EEPA 4CMAA 4EDFA 3R6GA 1LBSA 4BLPA 1QGUA 2JBAA 2MJLA 2Y0CA 3CR3C 3NEYA 3PFKA 3CKMA 5CNKA 3VVBA 4B44A 1KGSA 4I1OA 3HU3A 5BV1A 3TLXA 4MW1A 2KYRA 4RVNA 1ECBA 2NT3A 3QPBA 2C9OA 1W2HA 2JLYA 3L0DA 3F6SA 2P79A 2GPWA 3K9GA 2EDCA 3K2IA 2V6IA 3QE2A 4Y9RA 4PY2A 5JSUA 4INAA 4FZ3A 4BNKA 4QBKA 4CUKA 4Q9DA 4ZHQA 1JJFA 3GJRA 4ZCLA 2XE7A 2BE9A 2QYOA 3NYRA 1XEWX 2AEEA 4XDZA 3PX2A 1EM8A 1MH9A 1RAAA 4DBZA 1L5YA 1M6VA 3L04A 3SXUB 3GLIA 5JZOA 2K87A 3R3UA 3DBHA 5JG7A 2FFQA 3FUXA 3GJ3A 1NDHA 3HL0A 4YRPA 2J4DA 2ZJFA 4PLTA 4D43A 4Z7QB 3VKVA 4CQNA 4HR7A 1A1VA 4N0DA 4DLTA 2XNKA 1K6XA 4LZJA 5COQA 1JE1A 1YHNA 4OVKA 5IUNC 1HC7A 4LYHA 2ZIUB 2V5VA 2HRCA 3EXHC 2I6QA 3P9SA 4YRFA 3DF7A 1PWYE 2PZLA 3OA0A 4DC9A 1KI3A 4PIVA 3U4DA 4KAFA 4X20B 4DIFA 4TLCA 4UW9A 3EG9B 1COZA 1JAIA 2DPXA 1GD1O 5DTIA 4EMTA 3RSHA 5BOSB 3LPDA 3WBFA 4X7BA 3BRWA 2QX6A 1Z0AA 1JU4A 4OLAA 3QX3A 1JQEA 4MVJE 1DAFA 1TTHA 2G6BA 1L5HA 4E22A 2FMTA 2EG5A 1VHTA 1LTQA 2V9CA 2IEDA 3TGWA 4UU0A 3K6SA 1SPBS 2LCFA 4R31A 4PRKA 3P2MA 4ZYZA 4HZIA 3GHHA 4IUBS 3BXZA 5E2AA 3H9CA 3UTCA 2C4NA 4ZEMA 4AQ7A 4JP5A 4ESHA 1X1QA 2ZPAA 3Q7RA 5JADA 3ZY2A 1XG5A 5LQRA 1HE1C 3GJ4A 3WK5A 4L1KA 3IDSA 1WXIA 2IXEA 4TSFD 4WSOA 1WR8A 2ZT5A 3DNPA 4UNNA 1ZM7A 2W11A 4EYQA 1SB8A 1V6CA 1S9DA 4WKOA 2WVHA 3IPRA 2RH8A 2ZJ0A 1QUEA 4YDRA 1I4EB 4ARZA 3PT9A 4U8HA 2FSIA 1G3IA 5HJ2A 4DSUA 2ZB8A 1SO8A 2NXJA 1ZH4A 2CBZA 2ZU6A 2AL7A 4B76A 3KZVA 5DNVA 4CEIA 3HUFA 2EV9A 3CO5A 4AWXA 2E18A 3UF0A 2DXIA 4CF5A 1WXHA 2VJCA 3AWDA 1IB0A 2KX7A 4DXDA 5FWXB 5LVAA 1L4NA 3W6NA 5AI5A 3TIIA 5C18A 2QBYB 4OIFA 4X6XA 3WWPA 1MLDA 1EUCA 4HC4A 5FX2A 2VXCA 1BS2A 4KXQA 4S24A 5DLEA 5EHXA 5AK6A 4BPBA 1RW4A 1SCUA 4L5BA 4Q47A 5EKXA 1R50A 3AHDA 3KDPA 5IYZF 3WA7A 1P44A 2E4WA 1EXDA 1U9IC 4HEA6 9LDTA 3JY6A 3OC0A 4CM6A 1KOGA 4D9KA 3DUFA 5FPQA 1IWBB 3AO0B 4U7FA 5FYQA 3VH3A 1JSXA 1NVAA 2D8MA 2QVLA 3EZYA 4JFAA 1B6GA 2ENWA 2HHLA 1M9NA 3O92A 4QJ4A 5F4ZA 1BC5A 3O4IA 2XUJA 4IILA 4X94A 4NBRA 3WO1A 4WV3A 1V1MA 3BHMA 1MZPA 3H0EA 3D3WA 4GSLA 3W8DA 2DFNA 1CTQA 4UREA 4OHYA 4IG9A 4LXIA 2COKA 5JNSA 4KNVA 3BD8A 4B9AA 3V97A 4YCBA 5JZMA 2YW9A 5DBOA 4CG2A 3CWQA 3CX8A 3G5MA 3QF7A 5DO9A 2Q21A 2W2TA 1AUQA 3H0CA 1GA1A 9ABPA 3LUPA 4BFSA 1DJPA 3ZWVA 3TCNA 1L7AA 4AS2A 4DADA 3HA7A 3GDFA 4PAQA 1KC1A 1MG5A 5E9QA 3VGPA 2A9PA 3JZAA 5C5DA 5IZCA 4B79A 4N65A 1JDNA 3BS4A 1SOMA 2P5YA 2Q45A 5TMDA 5AI6A 6REQA 3FPFA 2OEPA 1NZFA 1W0KD 1Q0LA 4M1TA 3HCRA 4YR7A 1BDIA 2XNCA 4F3TA 2V5UA 4W9NC 2F3SA 1U8AA 4HATA 5FBKA 3WHKA 5BMVA 2B3TA 5BR4A 5JJCA 5IM4F 1NOJA 3M70A 4P7FA 3WIVA 1ORHA 1JH9A 1GWNA 1ESEA 4I1IA 1J2RA 4M1EA 1JTFA 3ZN2A 3AB7A 3EVNA 4DARA 3C1UA 1BW9A 1RJ9A 2BKUA 2Q9UA 2QLBA 5J43A 2UZ4A 2WNHA 3FVVA 1H2RS 4KQMA 4D4KA 1E7RA 3BBPA 2GD2A 3OUTA 1QHIA 1Y4SA 2JCGA 2P4QA 2XGMA 3I9JA 4RAQA 1JU3A 4UEWA 2D5IA 1RJFA 3DGFC 3NNNA 1NF2A 1TM5E 5TT1A 1KR5A 2AC2A 4B2LA 5CFRA 2DFLA 1RZVA 4N41A 2CHFA 1DB3A 3KR9A 1EX9A 5AI4A 5FTWA 4RTMA 3A1SA 2P9JA 3ND7A 1JPNA 3BRCA 1C9YA 4EUFA 1MC8A 1RABA 1PZHA 1ZUD1 4JR1A 3ZDFA 4CMIA 1HE5A 2V55B 3H19A 4DIBA 1M7GA 1B93A 5G40A 1IEWA 1IMJA 1QWOA 4EL5A 3WB9A 5IJ9B 2O2IA 4DFDA 3I2YX 4Y7DA 5EGNA 4AS1A 4HNGA 1SVUA 3M33A 1WUYA 1UJ6A 2MSWA 3V1KA 4BO7A 4BNYA 3MJFA 4XUGB 1J07A 1SXJA 3LVFO 4L9WA 3TH5A 1MF7A 5DI3A 3RYCA 1PQUA 3TD9A 3KSZO 1PDWA 5AJZA 5AUQA 1QF6A 1TUBB 3H18A 1RI2A 5ALHA 3TG2A 3HP7A 2PEYA 5B1SA 1YQXA 2VWQA 1Y4DE 2WFLB 3OPVA 4H7IA 3EFHA 4EARA 5EEGA 2NW6A 3B7PA 1OV6A 1YB7A 3FE2A 4QYMA 4R0VA 3A6EA 1HFEL 4R8SA 3RB8A 1K7CA 3F6RA 4LX0A 3QVMA 1YFLA 1QDUA 3AF1A 4OU5A 5DYGA 3E8XA 3DO8A 4QQNA 1V1MB 4HH3C 3CLHA 1ISJA 4LY9A 3UC9A 3I5MA 4G1UC 2Q6VA 4NENB 3RRZA 3ZBUA 4DJAA 3QMMA 4E1BA 1XR3A 4HEA1 5ISMA 1K0FA 3EMVA 3AHCA 5F5NA 3VX3A 1U6KA 2BCJQ 3R0VA 4EX6A 1IBMB 1XK7A 1J20A 3BWEA 4E14A 1TCCA 2J3QA 4J2OA 2PZGA 2ZAYA 1A71A 5E6SB 3T41A 3V4PB 1EDBA 2AOTA 2OD9A 3CPHA 1R0RE 2JW5A 4KAAA 3S2IA 4DL9A 1M8JA 1DC7A 3LP8A 4IH4A 3RKRA 2FWIA 1N5LA 2IL1A 2ONYA 1H05A 1QIMA 3DHVA 3DZHA 4F4DA 3FIJA 5K03A 4JL5A 3AKYA 5HJ7A 2XDQA 4FLFA 1DI0A 4QVKA 1G41A 2GYVA 4Y2YA 1E89A 3FAKA 4PLYA 5JISA 2VJOA 4Q9AA 2F8MA 2BEWA 3BXGA 4U9HS 3DOJA 3ZNPA 3SSMA 2CCJA 1SU7A 2EBUA 3C3KA 1LWOA 3K9CA 3D4IA 1LDMA 1VBFA 1L8QA 4XFJA 4PQEA 5IYZA 3MTEA 1UBOS 2YZ2A 4MQLA 3HB1A 4X92A 5GZ3A 5FQOA 3UK6A 1FJ2A 3RAPR 1CY8A 3PNQA 4PR3A 4RK0A 1JEAA 2NUTB 4LG1A 4UCQA 1CUGA 4WFKA 2VXYA 1F8YA 1W36D 1GZ4A 3GFFA 4OHVA 4WFJA 5KYTA 3HFGA 1YKGA 5FUWA 1QIHA 3NTQA 3O94A 1IOLA 4Z1MD 2GX6A 3AEZA 2H0AA 1F0KA 1LC3A 4G37A 1E3LA 3ZDXB 4HNTA 5LM3A 4WBNF 3SF0A 3PEVA 4DKJA 3UT5A 2R1TB 3C3XA 3DFKA 2XMBA 3L92A 4R7ZA 3IH5A 3PVZA 3S4YA 2ZUEA 3FJOA 2WFMA 1BXRB 4H3VA 1PT8A 5D3QA 5F77A 3E9ZA 4Z4CA 4XLTA 1ZD4A 5DW0A 1ZL2A 1PL0A 4EPVA 2ZRDA 1CY6A 1NX6A 2JEYA 3G23A 1KYQA 1KO5A 4IIBA 3UMJA 1H2YA 5A02A 4O33A 3R5KA 4Q93A 2EBFX 2G40A 3GJTA 2AX3A 1UDWA 1EUCB 2PTGA 2X42A 5M34A 3O7MA 4IFEA 4NR0A 2WJPA 5JD4A 1KZ9A 4BNMA 2YFHA 2HJWA 3R23A 2VPYA 1CQJA 3MINB 1UBKS 4QU8A 5GAJA 2KW5A 4Q9IA 4YXWA 8MHTA 4L4SA 4D7AA 1ACLA 4RIHA 1U3TA 1Q14A 1J5XA 2V6GA 4WKGA 1WSBA 1NN5A 2DE0X 4Q19A 1UZLA 2O59A 3BCUA 3PDUA 1K8QA 5B37A 3EDRA 3X2SA 3HU2A 1ML4A 1BHJA 4IRMA 5KSYA 1NLZA 3DLIA 3LA6A 4RMIA 1NY6A 1T35A 3IBSA 4QBFA 3DW3X 3WIEA 4DMLA 5JSZB 1FSSA 1ZY2A 2N1BA 4AJIA 4RKRA 1WCXA 2KWIA 4HWGA 3WFJA 5EJ8A 2ECFA 1YZLA 3A6JA 2XXBA 1T6NA 3F5DA 3W1VA 2Q3BA 1MW9X 4CTKA 1KJWA 1R6DA 1Y8CA 4I0WB 3WFZA 4EUKA 5J4VA 5J2TF 4JL6A 1V9LA 4RY0A 5EIBD 3DP9A 2Z6UA 3K9WA 4BAZA 1JP7A 4KWEA 4AKGA 1CZKA 1Q74A 5K6TA 3NP9A 3WLNA 2W8ZA 4QGFA 2ODQA 5DULA 4YLYA 4I8IA 2BBSA 4FDLA 4Q4HB 5BNZA 5GVSA 5P21A 5B1EA 1KZYC 2A33A 3R0XA 3RJZA 3RLIA 2IBMA 5L4LA 3LCCA 5FJJA 1JB9A 3AVXA 1FUIA 4LHEA 1X42A 4Q1DA 1BX3A 3RK0A 4DDKA 3O4HA 2C8KA 2HQBA 2XQJA 3GW8A 4Q16A 1XXHB 3R3VA 4PG8A 3UZUA 1YQQA 2FSVA 3OX4A 3TWOA 3C6XA 1Z0ZA 3E0XA 1XQVA 3MRVA 1E6MA 4RLQA 2WKQA 3ZLTA 3QXJA 4JC0A 3ETGA 3VPFA 5EN4A 1XAJA 5JH7B 2XUKA 4NU0A 4JKIA 2I4LA 4MUNA 2BKAA 3V46A 5C3UA 3T5DA 3WNVA 1EX7A 1XEWY 1YOVB 1I4WA 1WDTA 4UU8A 5KKNB 5MF6A 3TEFA 1EAMA 1DIAA 3QI2A 4BFTA 2VYND 4IDDA 3IKJA 1M33A 3OPYB 4LHYA 2V6FA 2D7JA 4J75A 2WNIA 3IAEA 1XHLA 3IOEA 4PC6A 1UBTS 4JQZA 2P62A 1RHRA 2PFKA 4NBWA 2VBCA 1S1MA 5DF1A 4TV8B 4EYEA 2XAUA 1EFAA 1IK4A 3N8KA 3ICPA 1XMXA 1N6IA 3TSOA 2YINC 2JIPA 3ZCRA 3BH7A 1JI0A 3DE0X 4FOLA 1P1BA 1ATZA 5REQA 4Z0TA 2PHZA 2A3NA 2CV0A 2OO3A 1NW7A 4RHXA 2R1ZA 2BMJA 1HL7A 4ETWA 2FRDA 5I51A 3V4RA 2YIVX 2IP1A 2B4AA 2X0RA 3EOZA 3MGKA 3R20A 4NP6A 5FL7D 1TKBA 4AUEA 3DO5A 1TPZA 1NVMB 4B4OA 3JYQA 5U1PA 1BH2A 1QCDA 4RVFA 3GDHA 2B5VA 1HKHA 4BMZA 3RT9A 1INLA 4YRAA 2H6EA 3A0RB 1TZKA 5TGZA 4EPRA 1U6IA 1MRNA 1CUJA 1PFQA 1Y6JA 3KQYA 4HHEA 4YJ3F 4LXTA 5TQVA 4D8XA 2PUCA 3L79A 3MQ4A 3GRRA 1KYVA 1CIPA 3LE8A 1U9JA 1YRQA 2CJWB 4WGGA 2AUMA 2YTZA 4OXRA 3RU3A 3VJMA 2NO5A 5I5EA 1I7NA 2FVYA 1FP7A 3ROKA 4FFOA 4ZZ1A 1RI4A 2Z8YM 5I9IA 1H2AS 1PK9A 4ARCA 5HCNA 1EK1A 2OYCA 4KHPB 5J40A 3AHJA 3QEJA 3PR2B 1JWBB 4MLPA 4HDNB 3UV7A 5K0FA 5FP0A 1V5FA 1QYRA 2CNBA 1XIVA 4LWZA 3BULA 3E4DA 1SUDA 2WWYA 4B7ZA 2QX7A 2VNHA 3IQDB 3O3CA 4MHSA 4NX2A 2L19A 5EMKA 3B52X 3L9XA 3PRHA 3A0UA 4FGKA 1FX0B 2OLEA 4RNCA 3TLGA 4BKRA 1EK5A 2M6KA 3IOCA 2GZ3A 2CEKA 2W42A 2BFDB 1O6FA 2OV6A 4TYMA 3SEFA 4XJVA 1FQWA 1JKJB 3FCSB 4Y8VA 3A9UA 4EEZA 4H4CA 1PJ4A 3FTQA 1M0WA 3EOAI 3JU3A 3EEBA 4RK1A 2W5UA 1WXEA 5GIOE 5IVIA 1J7KA 2C1ZA 1ZHFA 4WOKA 4QQRA 4CT0A 3VAAA 3DLAA 1U0EA 2H1IA 1UANA 1RE1A 3DE5X 4XFKA 5AJVB 3FOWA 4DF3A 1AO0A 4GMKA 3EUEA 1WB4A 2FWNA 4FW8A 4MUAA 2HO4A 5EIFA 2E1RA 1K0UA 4GOLD 5IF3A 3OZAA 3Q2KA 1TE2A 1UBNA 3I28A 4INZA 1E9FA 3JYLA 4LBYA 2BLLA 3NHAA 2QVCA 5CR9A 4E3WA 3AR9A 3OZRA 4IX1A 4W8GA 1EXVA 1RFLA 4PSVA 3CY6A 3HJTA 3RFXA 1VL1A 4TUYF 3SHTA 1QG4A 2WSIA 2C3OA 4TVBA 4XAQA 1NUHA 5NULA 1LSUA 4C3VA 3IJPA 4NG4A 3BJIC 3REQA 1XQ6A 3SX4A 4AICA 2XZPA 4PZ0A 4WA7A 2GS9A 3RASA 4HFNA 2C9YA 4Q9NA 4F45A 1E1RA 2FSVC 3OHMA 3BOSA 3OTGA 5AYVA 5HWSA 1GG2A 1V3UA 2JIOA 3A4MA 1X13A 3G9UA 4L6IA 2NU8A 1X0VA 2OFFA 3VU9A 2O7SA 4NBVA 1A4UA 4FD2A 2Z2KA 4R2WA 2CZCA 2H0QA 1GZ3A 3FPSA 4JYCA 3I2KA 4MK4A 4QFCA 5SY4A 3ZS8A 4AWAA 2PY6A 3D4BA 2F9MA 2R7NA 2WAOA 3ETNA 4XYLA 4C7KA 3NHUA 3HVRA 1JQBA 2YCLA 3F96A 3P9NA 4AROA 2A0UA 1NXSA 3HCNA 1XQYA 2XRMA 3RREA 5L3QB 2D5AA 1CEXA 1UAGA 1T8TA 3ZU4A 3JZMA 1XZNA 1II8B 1GHTA 2A58A 3U60B 3QE3A 4C2TA 1UM8A 2P9GA 3AZQA 3MWLA 3PQ8A 4TS3A 4D0GA 4DY4A 4E07A 4YRKA 1WKCA 3ZK7A 5KHLB 1KEEA 1NYTA 2ZCVA 3K0HA 5F1YA 1FLNA 2OAGA 2RI6A 3W8EA 4L5CA 2H4XA 1B43A 2DHRA 4Y6LA 2XGSA 1TYDE 2BEVB 1KIMA 3KJHA 3UN1A 2PPVA 3T3DA 1QHEA 1WB5A 2YWJA 4GHWA 4Z3OA 2A3RA 1KRXA 1J23A 1YVRA 1ZIDA 1FU7A 2GKOA 1XWFA 2O23A 3A06A 2OFXA 3FHCB 2NUTA 1TKRA 1Y9AA 1I6LA 4AC9A 4CQMA 4ZP1A 5KTMA 4TXNA 3AETB 4C7OA 1ZD1A 5AKZA 2NG1A 5CB8A 2PJDA 1AS3A 1QDLB 2E0IA 2SECE 5ARCA 4J7CA 2I99A 3IGFA 3T3PB 1VSBA 2Q99A 5G0UA 2FQQA 2PR2A 3IVXA 2BJVA 5EIHA 1Y34E 1XDGA 3GGPA 2WIJA 4JBYA 3I9FA 1OXVA 2Y6UA 1H23A 1ZIOA 5ALSA 5IBQA 3VKUA 4DUGD 3DKVA 4Z5XA 4N3CA 2H4JA 2L42A 2WVJA 5F33A 3VO9A 5LKAA 1A2OA 5D5HA 2CLOB 4M1WA 1RPZA 3DC7A 4J7XA 2IOHA 4LC9A 4LJ5A 4ONEA 3ZG6A 3ZLVA 4CM9A 3OCCA 4B4DA 3NH6A 2V3WA 1Y1PA 3G9XA 4KYIB 3W8FA 4PCAA 3FOFC 4HOYA 4JQYA 3OQPA 2IY7A 3ZI0A 1VL0A 1P1HA 2R1UA 1ZS9A 4BQQA 4PLWA 4D3ZA 4DYVA 4W5RA 4HFJA 1Z7EA 1XKTA 1JMKC 2TMYA 4OSPA 4WAUA 3V9PA 4D4JA 1A7AA 5BRJA 2A1UB 2ZPTX 1OT3A 1Z0FA 1J99A 1UZNA 3CE6A 3ZV3A 2BUBA 2X5OA 3OCWA 3H4VA 4GWKA 4YUWA 1E61A 1XU9A 1Z4MA 2CNWD 1L1RA 1JXOA 2RHGB 3D7MA 4PC3A 3HYRA 3ENKA 4L3OA 2XZTA 2EYUA 1G5TA 2WIFA 3ZHSA 1QBGA 1SVSA 2JVKA 5T8KA 4PONA 5EVCA 4EAAA 1ULSA 3EXIB 4GQBA 2HWKA 3CSUA 4O1HA 1GRNA 2AWNA 4KXXA 4NVRA 4OHCA 4BNVA 4D8VA 4F21A 5JBQA 4TYNA 5DBIA 2FEAA 5EHQA 5TGDA 3UV3A 1CUBA 1IRIA 1RI1A 1Q0PA 3NWJA 5IC5A 2RJ3A 1OLOA 4UBOA 1M75A 3FVQA 1ZH8A 1QO0A 2WHYA 3ON5A 3WL5A 5J4YA 2V7TA 1K7XB 2FG6C 1BS9A 3I6YA 3WWDA 5FL7A 3AYXB 3OQMA 3DQQA 5F3RA 2EWVA 4R2JA 1E1QD 2OHJA 1ZRMA 2QHXA 5A4KA 5KEIA 2CHUA 2JH8A 4K8OA 1S8AA 2HTEA 3DDZX 3UAOA 4DA0A 5F21A 1L8AA 2V6MA 1O77A 1VYHA 2PD6A 3BWYA 4IDQA 5IKXA 4YLEA 2Q1UA 2V7WA 3VOTA 3ZU6A 4LJ8A 2GHQA 3DFIA 1Y1RA 4UAGA 1UXGA 3S5JA 4KVAA 1ONNA 3LFTA 1D9XA 2EP8A 4CIVA 4QULA 1PNTA 1D0IA 1P5ZB 1TAGA 1UZMA 1Y4UA 3BTSA 3AJRA 1GZ5A 3D6AA 1DRUA 1M5TA 3IELA 5DCWA 3PGKA 5DWDA 2W70A 2HYDA 3ZUGA 5BVHA 3LK6A 4KUHA 3U3KA 3MEQA 4I2NA 5DHFA 3QVUA 1ZVQA 1GTG1 1EJ2A 2ACVA 2E49A 3RQSA 5JTTA 5TF4A 2B1QA 1QRUA 1XK6A 4EYGA 4REQB 1WUJS 3FNBA 4C0SA 2PZMA 2ACKA 3FNQA 1BHSA 2CDCA 1N2CB 2L0XA 2O2ZA 1L5GB 1F7VA 3MWJA 3H2KA 2QTAA 2RH5A 3HABA 4XWWA 3UPTA 5B3JA 1IHDA 3TXYA 4ANFA 4ZZ0A 4K05A 1TGYA 2GZ1A 3I05A 4ZA2A 2FUKA 2HF7A 4UM8B 4CKCA 5AW2A 1I3CA 5CFQA 2PG3A 1OBVA 1QMPA 4BWGA 2WD9A 1ORWA 4FMDF 4TRRA 4FYKA 2ZANA 4HL6A 1GO2A 3NT4A 3ZHXA 1WS6A 2QP4A 4MO2A 4YJ2B 3BK1A 3L1IA 2PMCA 3QY9A 4KFTA 3U9SA 3IMEA 5LLSA 2OLJA 1E1CA 1FS4A 1MV5A 2AR9A 2PL5A 3C8MA 1QG0A 3B48A 3HKBA 3L40A 2VQDA 2OESA 2PX5A 4XGIA 3WQBA 3G0CA 3AVUA 3MTQA 3VH2A 2OCAA 1TA4A 1WCV1 3VYWA 5C1IA 1HNNA 1PD0A 4NOJA 2A5FA 3RYHA 4AJLA 2DAPA 4EVQA 2J7PA 4KV9A 2P7HA 1SXHA 1TZJA 3L7MA 3PQ5A 4Q34A 4J3NA 3UWMA 3H5WA 1FYWA 2V0CA 4K03A 2HY7A 1QFJA 4Q3NA 5JS6A 5IAOA 3OEED 2EOAA 4JUCA 5EXDA 4J94A 4QXQA 4EVRA 4QE3A 3NC0C 4O4HB 4DM4A 2M98A 3QELB 4WZBE 2HQRA 3TTTA 3OKAA 1GGFA 5BVGB 4CIBA 4MUXA 3QITA 4HWOA 2C4HA 3LZCA 3QQPA 2H1VA 5KQRA 4Z1OA 2B37A 1EJ0A 1CUUA 5JSQA 1K2VN 1ZBQA 1T9GS 3N05A 2WR8A 4JVLA 5I8WA 5FFFA 3W5UA 4HLUC 2OBNA 4NFSA 4QXOA 1PJCA 4OFXA 2ECPA 4ODIA 2QBYA 5JANA 4BUJA 1WZCA 4J1TC 3MTAA 4R8LA 4MR7B 2XITA 2VT3A 3X1WA 4DJEC 2XT0A 4KR2A 1K75A 1UM9A 3U4QA 3U37A 1S3SA 4TLBA 4HSGA 4MW4A 2QTHA 3W04A 4ERXA 4RE6A 4QGSA 4A5SA 1Z0SA 2D1TA 3IKLA 4N7BA 2C2KA 2R7KA 2XECA 1XLTA 3MGCA 4MVXA 3T1YB 2BGWA 1O0CA 3M5WA 1AXEA 5FB3A 3DZFA 3UYKA 1OTYA 1QX4A 2AMFA 4MUYA 2A2ZA 1MXFA 4G09A 5E9WA 4YVFA 3NJ4A 5L3SA 2CXOA 2IS2A 1GEEA 2VQFB 3GGOA 4KMSA 3D3EA 4J0HA 5EY5B 5B3AA 1E79A 1S0UA 2C9BA 3EF0A 3EQ6A 5I9LA 1BOFA 1HMYA 4G5HA 4Z1MA 2ZUTA 1A7KA 3HL4A 5CCDA 1C9MA 4GYYA 3P9KA 5IWAB 1YA6A 4LSWA 5BT8A 3HTXA 1MG0A 4KXMA 4FI3C 1YO6A 2P0AA 4B0OA 4QM7A 4GOJA 1WXXA 3SQMA 1GNSA 2PLFA 2DGDA 1ISFA 4NEQA 1N4AA 2X0EA 2ZYGA 1KEVA 3VV2A 2FJ0A 1LKZA 3PNLA 1O5OA 3QF4B 4X1IA 3NTOA 3V4SA 1P8AA 2HRBA 4MKIA 3QG1A 2VYFA 5EERA 3ESZA 4EVSA 1CDOA 1U9YA 3KL4A 4XWOA 4CEIB 3QK7A 3IAS6 2VZ8A 1DTSA 2V7XA 5ALRA 3TKYA 3TM5A 1TM1E 1DOAA 1V6AA 2WI8A 4TWBA 3W77A 2O8VA 4F97A 2Y93A 4BDTA 2H07A 1CZUA 3THSA 2HYIC 2ORWA 4A4DA 4L8YA 1UFQA 2EATA 2ZWOA 1KERA 2VSNA 3O2NA 2NXEA 4G2TA 1T9DA 421PA 3GDGA 1XCPA 4ZOLA 1U1DA 3HZZA 4BO5A 2QPOA 3CYFA 4H7DA 3O47A 1A69A 3OQHA 1OH8A 1PWXA 1B16A 1GQQA 2GJSA 2O3TA 2YJGA 3E8MA 4X3PA 5ALIA 4BJHB 4EJSB 4MR9B 2NU9B 3E7XA 4AX4A 2ASVA 4L4ZA 1PO7A 2ZRKA 3GCXA 2AHOA 2P5UA 3IQWA 5LD2C 3DFZA 4IXDA 4OV6B 4B3SB 3E58A 4JLWA 4HXFB 3KVNA 1CIVA 1C7ZA 2YWBA 2QM0A 3PGVA 1E0KA 1JXQA 5E9AA 1N9GB 3F6CA 4ND6A 1B0AA 2NVUB 2UKDA 2ZUWA 1AOXA 3Q6IA 3EZGA 4IWYA 4OP1A 4EGJA 3KT0A 1TLLA 2A4MA 4GXRA 4ZI5A 4TROA 2YNMC 3EG9A 2HW8A 2XB8A 3QKRB 2CFIA 1L5QA 4LX8A 1NUUA 4U6QA 3KQPA 3NM5A 3P97A 3RSLA 3MZ0A 3S7TA 1UDRA 1WZEA 2Z3WA 1USVA 4G9BA 4RIIA 2PA0A 4EBBA 4UAVA 5ADUS 4UQLA 3HSYA 4ZOLF 1MBZA 5CITA 3K1TA 1C7IA 3L05A 4WE3A 2O0KA 2NUAA 4FYYA 3G5TA 4GI1A 2P68A 3IAAA 1BD4A 1NONA 1QGUB 3DOOA 4PG6A 4TMZA 4B3TB 4KXLA 4G0WA 5HM8A 1Z4IA 1N1GA 5AR1A 4P2GA 4EA7A 4N39A 2ZRIA 4QNMA 4LY0A 2DUUA 4JMPA 1TDJA 2YZNA 3BRSA 1J0EA 1US8A 1V4NA 4KN5A 2ZKLA 2IJGX 4WZBB 3V8RA 1JIIA 4A8JB 5JBNA 2AOWA 5M3BA 3G79A 1BXRA 4YB8A 1A8IA 1Q3KA 1HNZB 1UOQA 3HKEA 5BN1A 3CRQA 4O4JF 4B09A 1ZZGA 5DT2A 1HH4A 1X6VA 4ILKA 3M3PA 3L5OA 1CZHA 3R09A 4O63O 3KK0A 5ICFA 5DISB 4ZU1X 4RTNA 1C3OA 1Y8QB 4UXJA 3PRJA 1NN0A 4Q3AA 2Y2UA 5CU7A 1RM0A 1WPXA 5IUKC 3MERA 3MLEA 2GBGA 4F85A 3KSMA 4MQEA 2HHCA 1K27A 1E1KA 2CYAA 2C4MA 1Y1SA 2NXCA 3CNEA 3TGPA 2XBMA 2XMZA 1N6RA 3LV8A 3ZWDA 1JL3A 1QHSA 4GLLA 1B23P 1T36B 3T06B 2JFVA 4YREA 2FOLA 3O3MB 3C6YA 4B4KA 3UGJA 4RAOA 2WAXA 1W96A 3T5BA 3EVTA 4UHCA 4KUEA 1SQSA 1J49A 1ZGGA 3JD4A 1N5JA 4YWJA 4DNXA 4CFYA 5B6JA 1B2RA 3D2CA 3H1BA 3CO0S 4IG4A 1F12A 1QOPB 2YWFA 3G89A 4B6GA 1K6IA 2GPAA 3HHPA 3SKVA 3GUHA 3PHHA 1B42A 4YCLA 1YJXA 2IQ5A 3LUKA 4FM9A 4KMRA 4TMWA 4L5YA 4F60A 1ZJ6A 2O2SA 1M6EX 4YGXB 1U0TA 2XR1A 4LYAA 1XGKA 5IU6A 4NONA 3BERA 1JR2A 3OWXA 1OTXA 3WK6A 3H5AA 1CVRA 2OCDA 3A2LA 2Q0SA 3ANLA 1QIKA 2TECE 3SZOA 5KX5B 5BSFA 5AOVA 2J85A 4QXPA 4I5IA 5DNUA 5LQJA 1E1LA 1XLWA 4UTVA 1YVDA 2ISQA 2NNLD 1KZ4A 4ENQA 4O2AA 1ZNYA 2FPSA 1B6SA 2CNNA 4HKTA 1M66A 2X8JB 4PBRA 1GZ7A 4TMXA 4L75A 2Q1SA 1FBNA 4IP0A 1JBEA 4MLCA 4N5IX 1PNQA 1IM2A 1C4WA 3SY8A 5FHRA 4MS4B 4ZYVA 1HUQA 2QPTA 4PLVA 5EQTA 3F4LA 3HUDA 3HC7A 4DLAA 1BRTA 2HGSA 2JG3A 3W9SA 2AZ4A 1I4DD 1PEAA 3OPMA 1BYUA 3S2SA 4LF7B 1RWOA 4PPGA 4Q7KA 3ZEIA 1YR2A 4KC0A 4GBGA 4KXYA 3HCDA 1PLJA 5HKKA 3H16A 4TQGA 3GCWA 3LT5A 3KM0A 3PS9A 2JFGA 2WG0A 1P19A 1APBA 1VB5A 3U19A 2X0FA 3SMQA 1WMFA 1XTZA 2VPQA 2X7JA 3HGQA 5IDYA 3ZZ1A 1AY0A 2VK4A 1CP3A 4YQFA 1FP1D 2JAXA 4ITRC 4PPFA 1Y8AA 4CFSA 1D9ZA 2JIMA 3Q7QA 1V41E 3K16A 4UTRA 1G9XA 1NM5C 2P2YA 2QJOA 4IS3A 4V2IA 5D86A 3GUCA 5L8VA 3Q9SA 1E6EA 4KGDA 3CPSA 4XOIA 3OTOB 1DPGA 3PE4A 2V4UA 1NNLA 3CLRD 4ES6A 2XA2A 3B85A 1XNQB 2ZWAA 1Q1EA 1X7ZB 4MH0R 5BQ5A 2J0SA 4PNZA 4LNAA 5AVOA 2X0IA 3W1EA 1M2OB 5HIMA 1YR3A 1YACA 5BYKA 3OU2A 3W2GA 4W5OA 3CEMA 4ALLA 4TV9B 3HCCA 3O8LA 4JLMA 3KQUA 1W29A 3GAAA 4RY9A 5IVPA 3PF9A 3TJMA 3WDKA 1RC0A 2OXCA 3KYJB 1QLJA 2OZVA 2WYWA 4G97A 4Y0NA 3SOZA 3VPGA 3EXFB 2WKWA 1UJCA 1VE6A 3DDWA 4UEOA 3Q5GA 3QYPA 1C50A 5JCOA 3TUJC 2IS6A 3RS4A 1Q21A 5AKKA 3DKKA 4K81B 5HQJA 4PXYA 1RXYA 3FYDA 2OILA 2A57A 3ZQ4A 4DVGA 1E9SA 1N0IA 2F3RA 4JLUA 4EI2A 2Q46A 5EWJB 1T10A 1OKKA 1B4DA 2X8BA 3PHCA 4OTZA 5F7JA 5FAKA 5K3CA 2WF8A 4DAEA 1B8NA 5AO9A 2ENUA 5JJKA 2IYFA 3ZOZA 5JASA 2WAMA 5EINA 3IXMA 1GPDG 2CL6X 2WHPA 4IJKA 4P32A 1XCJA 3UFBA 4EAQA 5LZ4A 3D8UA 1T8UA 4OBWA 1XZ8A 2PKRA 1PGJA 4OJQA 2IBTA 3SC6A 5G53C 1UMCA 4L85A 4OK3A 1SKYE 1LPOA 2N9UA 2B99A 4PX2A 3RS5A 1U2GC 4ZDWA 4MDYA 1P33A 2GHIA 4NZ9A