2XJ9A

Dimer structure of the bacterial cell division regulator mipz
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
268
structure length
265
Chain Sequence
b'ETRVIVVGNEKGGAGKSTIAVHLVTALLYGGAKVAVIDLALRQRTSARFFENRRAWLDNKKIELPEPLALNLSDNDVALAERPEEEQVAGFEAAFARAMAECDFILIDTPGGDSAITRMAHGRADLVVTPMNDSFVDFDMLGTVDPLELTKPSLYSLTVWEGRKQRALSGQRQAMDWVVLRNRLATTARNRKRLEDRLNALAKRVGFRIGPGLRDRVIYRELFPFGLTIADLSPQVRPVPVSLQHLAARQELRALMHSLGLSAYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MIPZ
publication title Localized Dimerization and Nucleoid Binding Drive Gradient Formation by the Bacterial Cell Division Inhibitor Mipz.
pubmed doi rcsb
source organism Caulobacter crescentus
molecule tags Replication
total genus 84
structure length 265
sequence length 268
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09140 MipZ ATPase MipZ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2xj9A00
5E7IA 1TUIA 2HLDA 3E1SA 4TSFA 3KQUA 1GKUB 2Q9AA 4V0MA 2XITA 2CHQA 3KTAB 3OAAA 4PANA 5DE3A 3OFND 1UBCA 5SZJA 2ZSEA 3C8UA 5E7MA 1Q1EA 3I5XA 1TF2A 2UKDA 1GFIA 3FKQA 4I1SA 5C2JB 4B6FA 4A9AA 1D9XA 1SKYE 1KSGA 2D62A 3DZDA 4AURA 1E0KA 4BFUA 4PC7A 1OH6A 1Q0UA 4DSNA 5FR2A 4D4KA 4AK9A 2ZJZA 1XX6A 4HAXA 4Z51A 1N6OA 3O47A 1S8FA 1X8LA 5TDHA 5EXPA 4JYCA 2WVJA 4UJ3A 2QTHA 4A6XA 2OAQ1 4I81A 2JJ1A 3HYTA 1KY3A 2ZSAA 4A8JC 4DLZA 4C30A 4B43A 3T61A 3QKUA 4GBMA 3MG9A 3KKQA 3OHMA 1OB5A 2KE5A 1R5OA 3AVVA 1RFLA 3LY5A 5AK0A 2E87A 5DI9A 2XGJA 3A1UA 3GMTA 1D2EA 1W0JA 3OE7D 4PX9A 2BMEA 4BFVA 4CW7A 3DVLA 1MR3F 2ORVA 2IYVA 3AF4A 1A7JA 4DT1A 2JLRA 3H0KA 3DKPA 1F3OA 1HV8A 1LVGA 1XJ0A 4KXFB 4N0EA 4QGGA 2C2HA 4RSGA 2HXSA 4RCZA 4AKIA 2V1XA 4JLJA 1LW7A 3EIHA 3AF3A 1OV4A 4P4SA 3GFOA 2QP3A 4BE7B 2VIIA 2CVFA 3GP8A 3OIYA 4KFTA 4GL2A 3CF2A 2A3RA 4X8OA 1R5BA 2ZRLA 4LJ6A 1Y63A 4Q1BA 5LPNA 4CEHB 4RD0A 4LK2A 4D81A 3FDIA 1I4TD 5DI3A 4BQSA 4AYTA 4EFMA 2JLYA 5F2EA 1SULA 3W3ZB 2IHYA 4BRWA 2QM7A 1ESNA 3E5HA 4V02A 1CJMA 3OEHA 3BXZA 3UG7A 1E9DA 1DAKA 2G1KA 2IEYA 2HV8A 2FMXA 2MMGA 3W9YA 5IK2D 1XB2A 3FHOA 1VYUA 1SVKA 3Q85A 1OH5A 3AGQA 1CU1A 1KJZA 4G5GA 2WJVA 4Q7LA 3AF0A 5HCNA 1KO8A 2ZR7A 2CHVA 3LLUA 1G9XA 5DLQC 5DNYB 1FMJA 3WYAA 2B7CA 2VSFA 4QHTA 3CNLA 4Q1FA 2XZOA 3CIOA 1OF1A 2NZJA 4C7OB 3NXSA 1W2HA 2AXPA 2OCAA 2Q3FA 5FTNA 2C95A 2DR3A 1IN8A 4N3NA 4JSYA 3QKSB 2QMUA 4NMMA 4IW3B 1ZBDA 4II7A 3RDPA 3VX4A 4D4LA 4EQ6A 3AV0B 4OKSA 5EJEA 3GLIB 1S4QA 4IXMA 1N0WA 2VP0A 4PO8A 4AKEA 3TQFA 3ECCA 2F3TA 2FE4A 1I2MA 1X3SA 2V9PA 3IILA 4EPRA 4ZV4A 3GJXC 3EZ9A 2FOLA 1MABA 2JJ2D 4QGAA 3MSXA 1F6BA 2VTKA 2Q3MA 2WMOB 3Q8XB 5H8WA 1QVRA 2BEKA 2ZI5A 5F9HA 4JVSB 1TF7A 1E2JA 4P31A 2CE2X 2JGNA 1P4SA 1Z0DA 3TGPA 2IYZA 1Z0AA 3FKSD 5JWHA 1Q57A 5A4JA 4C3ZA 1HQYE 3FMOB 1AQUA 2ONKA 4TMWA 2PCJA 5IDVA 2IS4A 4H1VA 1OH8A 1B23P 5BYJA 4FMCB 4M1TA 5BQ5A 3OEED 5CK4A 5CLLA 3I4LA 1EG7A 1TNDA 1ZNZA 4D26A 5EE5B 1CJKC 4JVLA 4MRPA 4RVCA 4ZCLA 2V3CC 4NYJQ 3I32A 2WKPA 2W83A 1DS6A 3MD0A 3IGFA 1Z83A 4JMPA 4Q4AA 5FFMA 1EFHA 2C96A 4NYMR 2I4IA 4KFUA 4Q4JB 1BO6A 5BN4A 4Q00A 2CCKA 2FPKA 2YYZA 1Z47A 2H5EA 3EC2A 4MYHA 2WPDA 4RZ3A 4CT4B 1UKEA 5IF9A 3U6BA 3EPHA 3LV8A 4JT2A 1SVSA 3B1WA 3MWYW 3I1FA 1ZIPA 3HPRA 1D2NA 1SKQA 1E2KA 2IXEA 3AKCA 3ZIAA 4M1YA 1AIPA 2DFLA 1DAFA 4KCGA 3J81k 2OFOA 4A82A 3T06B 1W36C 1KZ7B 3IHWA 3TSZA 2W6IA 1R4AA 4C2UA 2J45A 2R6FA 4URZR 1XTKA 1OH7A 2J0QA 1ZJ6A 3NH9A 1JB1A 2IYWA 2ASEA 1J8MF 1Z07A 4P4UA 1GIAA 4GOKA 4EPYA 5IRCD 4HATA 4M9ZA 1BMFA 4C0HA 4JL6A 2VHTA 4EFLA 3CPEA 3GEHA 4I99A 2HT6A 2ZANA 1G64A 4ZDIA 2OILA 5G41A 1M8PA 3CF6R 1FQJA 3O8BA 4IOMA 4JL8A 3A36A 2F6RA 3BB4A 4TTPA 4DSOA 2YOFA 1NBMD 1Q3HA 1YZGA 4LJYA 3K70C 4B2PA 3KDSE 1II8A 1NBME 2P5SA 5AR1A 4B48A 4LBVA 4QGHA 4RFSB 3RC3A 4QKQA 2YOGA 1BH2A 5JZVA 1DVRA 2GJ8A 3HPQA 4CYMA 4OJKA 2VP5A 5CB6A 1YZTA 2ZRCA 3P26A 4BFTA 1CF4A 5EE9A 3ZD6A 2OCBA 5J4VA 3EC1A 2ZR0A 2IWRA 3F3YA 3CH5A 3ND9A 5EXXA 2DBYA 3H86A 1PZNA 4KO8A 3DOFA 4XOIA 4F4CA 3KKMA 3EPLA 4GP7A 2IS6A 1G4AE 4NYIQ 4DSUA 5FOSA 4RD2A 2KB0A 2GJ9A 2ZUBA 1ZNWA 3AP3A 1TPZA 4R71A 2OM2A 3N5CA 1PLKA 4DC9A 1UEIA 1XD2A 4BFSA 3GJ0A 1H8ED 1JPNA 3DKVA 4M1KA 1AS2A 2OBMA 4TMZA 3NWJA 5CYOA 1KAGA 2NG1A 2X2FA 3CRRA 1CR4A 2F3RA 2V4ZA 1L4YA 5J4YA 3R9XA 3GLFB 4GDFA 2PMDA 4A8JB 2AXNA 3U7GA 4DLVA 1VG1A 2IYUA 2C9YA 1DAGA 1WP9A 4JKIA 2GVDC 1KI1A 1U99A 1NSFA 2ZE6A 1W4AA 4TWZA 3WBJA 2IYTA 4TQUS 5LBIA 1COWD 1OXVA 2PZGA 1J8YF 2QE7A 1Q44A 4URWR 3RABA 3I72A 2DY1A 3BC1A 4Q7JB 4DUGD 4Y0AA 1LTQA 2RMKA 4YMUA 1RYFA 3MJHA 4FCVA 1JQLB 1YZKA 3R8FA 1LB1B 4XVUA 2PT7A 3ASZA 2OZEA 3TLXA 2UZ3A 3K53A 3LAWA 4DRZA 1NF3A 1UKZA 2AX4A 2Y8EA 2O8DA 3VAAA 4OHYA 2QT1A 4LV6A 1KYIA 4MGZR 1FP6A 2JCSA 4Y0VA 2NPIA 3RAPR 2DFTA 2FWRA 3T15A 2WJGA 2XTZA 2ZTSA 2JDID 4DLTA 2CJWB 3FHCB 3ICEA 3GD7A 4Q4LA 8OHMA 4TZ0A 2BKUA 3HR8A 4LYFA 1P5ZB 1J70A 3G5UA 3VNUA 3GLGA 1W0KD 2ZE7A 3QI2A 2GF9A 1ZD1A 2R6CA 4PQFA 1FL9A 4LV5B 3ZVMA 2ZJAA 4MH0R 1X6VA 1S3SA 2V55B 2QPOA 2A9KA 4KITB 2GK7A 1K8RA 2DPXA 5LDDC 3BFKA 2OAP1 1MO6A 3CWQA 1Z0JA 5L3SB 4IDQA 1K5DA 3IO5A 3DMNA 1VECA 2QBYB 3PEYA 2WWYA 3GJ4A 4MRNA 4Q9JA 4YMVA 2WWHA 1F5NA 2XZLA 4Z54A 4JVMA 2QG6A 3VHXA 3K09A 4D80A 1NKSA 2ZRBA 4LYHA 3BD9A 1T6NA 4TMTA 3ADDA 3D31A 5C46F 3EZ6A 1W4RA 1G8YA 1VIYA 1DARA 2R6AA 2ZSBA 3LQRA 3T1VA 4A2WA 3U44A 4Z8YA 1QHSA 1E9RA 4GMXA 3SS8A 3TSOA 2ORWA 3RNLA 2JATA 2IC5A 4DLUA 2OXCA 4FXPA 5KNBA 5L8VA 1E98A 1S96A 2OG2A 1JR3D 2D74A 1Z08A 3FKSA 3UMRA 3SFZA 1CTQA 1E9AA 3BGWA 3N2EA 3BAFA 2YV5A 3RS3A 2PEYA 5EE0A 1OXXK 4TYQA 2IK8A 1E9CA 2ZI7A 2ODEA 1US8A 1XNJA 3CRQA 1AM4D 1Q1QA 2UVQA 4DB4A 4ZO4A 4IOKA 3NBYC 4OK3A 2PH1A 2YWHA 4US2R 1UPTA 2PBRA 2WMNB 3OIWA 2JLVA 2ZI6A 3CX6A 3D3QA 2GZDA 2BJWA 2J5XA 4NHOA 2HLDD 4JLDA 2GCOB 4FWTA 2VO1A 4IKEA 1W36D 1UF9A 2P6NA 1KSJA 1YR9A 1RJ9B 3OAAD 2NMVA 4V0ME 4JLVA 4OBEA 1E2NA 3QXJA 2XJ4A 1ZP6A 3CUEF 2ZJYA 1W7AA 2ZRMA 2X1VA 4MKIA 3TW4A 5KSOA 3LBIA 3SDZA 1KO7A 4DDUA 1Q12A 4TLDA 1GILA 1XMJA 3IEUA 3B2EA 2FEOA 3KUCA 5KDOA 1S9DA 2CLDX 2YZ2A 4YXWD 4IEIA 1LNZA 1FP7A 5FR1A 1ZU5A 1FUUA 1Q3TA 1W48A 2KBEA 2C78A 2JJ1D 3U3JA 4XVRA 5KPJA 3FWYA 4BPBA 4LJAA 1MO4A 4LHVA 2ZRJA 1QDEA 4BECA 3C15C 3K70D 3EPKA 1UDXA 2FZLA 1VMAA 4HI0E 1PLLA 2OLKA 3R9WA 1E2HA 5TXGA 3DEFA 4MQBA 4GPTA 2OSBA 2D4HA 2YWFA 4GSYA 5GADl 1W36B 2VYFA 1XTSA 1ZM9A 4FCWA 1YR7A 2XX3A 2XNDD 4PSKA 5FBVB 3QOFA 1Z5ZA 5JBQA 1X8KA 4I1UA 2LKDA 3PXGA 1P60A 1P72A 1W44A 2QTFA 3NEJA 3I5YA 4DSTA 1X1RA 1NBMA 2H8KA 4TL6A 4ZIRA 1VYVA 5L3QA 4DLWA 3KXIA 2QSYA 1T5LA 4LZZA 1XPUA 4P3YA 3VKWA 5JWRA 1OXTA 1IN5A 1VG9B 1KDRA 4RD1A 1MKYA 1P2TA 1GG2A 2VRWA 4LJ7A 5B64A 4O3MA 3ND8A 1F2UB 2J3EA 3PEWA 3MJRA 3S1AA 2IF2A 2PJZA 2R9VA 3B85A 1E9EA 1AZTA 5KUTA 4AY2A 3K70B 4QL3A 2YHSA 2J87A 2QL6A 2H16A 4D4JA 1NI3A 1MO3A 4PTLA 3QVVA 3QEOA 1R7RA 1QRAA 2MSCB 4MGYR 3ZDQA 4DT1B 3KZ1E 4E03A 2VBCA 1N2CE 4Q9HA 4DCNA 5BN3A 5C18A 3LWNA 1UBFA 5KNCA 3A58B 2GJKA 1IM2A 3L0IB 5CM9C 2BDTA 4P4SB 1T3SA 3A4NA 3N70A 5EP2A 5TMPA 3BWDD 4TYNA 1QF9A 1FX0A 2YC4C 1Z6TA 1NG9A 2FG5A 3RANA 1XTQA 2BWJA 4DEYA 3GJ3A 2QNRA 5J40A 4I4LA 3PJRA 3QF4A 3PQCA 4JKYA 4PPFA 5DI3B 3NH6A 4BRUA 3V4FA 2BHRA 3FPAA 1YR6A 4L4UA 2WICA 1COWA 2GXSA 3TSWA 1P9WA 4HUQA 4Q18A 1A2KC 3UANA 4DUGA 1ZM3A 4M8NE 3I3SR 1RRPA 1E0AA 3THYA 3FB4A 4ERNA 3AKYA 3ICQB 2F43A 4M9SA 4A0FA 5DO9A 5KSYA 2QP9X 1WXQA 4JLMA 5EUQB 5FPKA 1D6JA 5ANRB 4XWOA 5DHAA 1OSNA 1TF5A 1ZIOA 3C16C 1YU9A 3HP1A 2PT5A 5J4KA 2OT3B 3EA0A 4CRWB 3T34A 2BCJQ 3MWJA 1NIPA 1FNMA 4GZLA 3WHLA 2GDJA 1DOAA 1WQ1R 2I1QA 3E70C 2ODBA 3I92A 3SJBA 5CB8A 3K09C 4HAVA 4HDQB 1DE0A 2WKRA 4EFNA 1W47A 5FBWB 1DO2A 2ZETA 4MGKR 4URUR 1ETUA 3JVVA 2WSMA 4AYWA 4IOJA 3AH8A 4BLPA 1Q21A 4EIWA 4EQ6B 3KQHA 2DWQA 2MSDB 2WV9A 2QORA 4GMDA 1P2SA 4AWXA 4OJQA 1JQJC 1O3YA 3K0CA 1CRPA 2CVHA 1IY1A 2ZRNA 3H1TA 1OXSC 2D7CA 2FGKA 4U5XA 1MABB 3WNBA 4ZCMA 4N0DA 3ADCA 3GFTA 4LOAA 3T12A 2WPDD 4XH9B 3W6NA 3CM0A 1KO4A 4A0HA 4B6EA 2CCGA 4G3XA 4GP6A 2FV8A 3ZIAD 3MFYA 1E94E 2RGGA 3DM9B 2WAXA 3EIEA 4LHXA 2EWVA 5HTKA 3KX2A 2EWWA 1ZUIA 4IDNA 2WM9B 4LX0A 4F92B 2W6ID 2OCPA 5EP3A 3UPUA 3X2SA 2MMCA 3W6OA 5FOVA 2ZI4A 3IIKA 3K8YA 4LDJA 3TVTA 1Z6YA 2AFHE 2V7QA 4FN5A 1GAJA 3FVQA 1NN0A 4MGIR 1TU4A 1X86B 3DO6A 4HZUB 4MRVA 2E9SA 2CXXA 3LNCA 3LW8A 4HLCA 4LJ4A 1ZMXA 4TT3A 4OI1A 1G5PA 3K9HA 1NN1A 4ARZA 2Q9CA 4MYCA 4M22A 5CITA 2H1LA 3GEIA 4G5SA 1KI7A 1YHNA 5F9FA 1I4LD 2VPPA 1Y3AA 3QKTA 4LUCA 1NVUQ 4C9BA 5E95A 5FBLB 1JPJA 2AK3A 3A1SA 1LS1A 2REBA 1QHXA 2G0NA 2FX3A 4PQYA 1F2TA 1C1YA 3L0OA 4RCYA 1SVLA 3SQWA 4LGMA 2WZQA 3RS2A 1K6MA 4IOLA 2JAQA 1KY2A 3SHFA 2IS1A 3KKOA 1U0HC 1N6NA 1XD8A 3MUFA 2GKSA 1XDBA 4TMVA 1WF3A 2HXYA 4XJXA 2HJVA 3AVUA 3CRW1 1GVNB 3ASYA 4FI3C 2HJGA 1CP2A 3ZQ6A 5KOYA 4TN1A 4WZAE 3TRFA 3ZZ0A 2RGAA 4G5QA 4YDHB 3GJ6A 1NMXA 4LSGA 4DDVA 2ZAMA 4CGZA 4HAUA 2P2LA 4L8GA 4PZZA 5CLQA 1NY6A 1SHZA 3F5FA 1GNQA 4YXWA 3TUIC 2FPMA 1HT1E 2GF0A 3L0PA 1KSHA 1T3HA 1FOEB 2IYXA 1KI3A 4B47A 2HF9A 4HLUA 3E2IA 4QFMA 4WAUA 3HWSA 5FI1B 5FBQB 4HEJA 3ZGXA 5FL7A 2AKYA 5CDFE 5KSPA 1AS3A 2P67A 2Q0HA 1II8B 3P4YA 2C98A 4OQNA 3RS4A 1BYIA 3PCRB 2W0MA 2H7VA 1TADA 2XNDA 2WAYA 3DL0A 5TARA 5HE8A 2XAUA 5FI0B 3WP1B 1SKYB 4XSGA 2HF8A 4RZUA 2QPTA 4HZIA 3EIQA 4H9GA 3SC3A 5DSZA 4A4DA 2O8FA 1E9BA 2QU8A 1GNRA 2QE7D 1AZSC 2HT1A 2O0HA 4PC6A 4US0R 4DLRA 2BBOA 1WRBA 1ZNYA 2DCUA 4BLQA 1C9KA 1ZC4A 1U90A 1J90A 1E2DA 1Z6XA 1XF9A 4M2LA 5J4LA 1TMKA 4MA4A 1XD2B 3GPLA 4M21A 3IQWA 5HZKA 4CIDA 1UEJA 4IFEA 1CKEA 2I1VB 2FU5C 2O8EA 2ZROA 4MRRA 2ZRPA 1XZQA 3AVYA 1KO1A 5HPYB 3AF2A 3B1XA 3PFIA 4RD6A 3UKDA 1OE0A 2ZIAA 1WB9A 2J0UA 3SYNA 1PLJA 1Q1ZA 2F9LA 2J41A 2QGNA 2D2FA 4IFBA 4WZ6A 4OI2A 1KKLA 1GKYA 4NH0A 4DCVA 3FHTA 1R6BX 2RGEA 4UXJA 3LA6A 3GLGE 1WE2A 3DHWC 1CEEA 3TQCA 1G3QA 2EU8A 1EK0A 2WIBA 1XTIA 5EE1A 1RIFA 4D6PA 1Q22A 3Q9LA 1FTNA 1Z28A 2O0JA 4HDCA 2C03A 4KSCA 2Q21A 521PA 3SEAA 1HQCA 4G01B 2ZJOA 1JNYA 2O8DB 1SVOA 1UBGA 1VTKA 3EWSA 4DCTA 1OKKA 2G88A 3QIAA 5J47A 2BBWA 1EX6A 1R10A 3QPWA 4R9UC 5GJBA 3CKLA 2QT0A 4DIDA 5FTKA 3K0CC 3TW8B 2V8OA 4IDHA 2GZAA 2WWXA 5HCIA 4DCUA 1FZQA 5AJYA 3DM5A 2B6HA 4Z1MA 4YQFA 4W5HA 3TK1A 2FFHA 3THXA 3Q7QA 1T3LA 3UG6A 1E1QA 3BB1A 2RHDA 3EW9A 1IY2A 3BK7A 3TBKA 1QHNA 3FYHA 3MAAC 1DAHA 3QXSA 3M1IA 3BJIC 1TQ2A 4Q66C 4OYHA 3NC1C 2GCNA 2XOKD 2AN9A 2FSFA 2O5VA 5M04A 2YWGA 3A1VA 1E3MA 4FINA 2F1IA 3WMEA 3QBTA 3X1DA 2R8RA 2ZITA 4ZCIA 1YRBA 3A1TA 3Q3JB 3P27A 4FW9A 5FOTA 2IS2A 1E2PA 2EYUA 2VF7A 5SZHB 2GRJA 3UATA 4MDFA 2BM1A 2BBSA 3AM1A 3I62A 3U44B 5JSZA 3EWAA 3A8TA 2W00A 1SGWA 1ESMA 2HCBA 2Q6TA 4NBSA 5FOUA 3TJZA 5J5CA 1GL9B 1OXUA 3OIUA 4OHWA 2CCJA 1E0JA 1E0SA 3CX8A 3IHLA 3IQXA 2GHIA 2WWFA 2OHFA 1S2MA 3NG1A 4OK5A 1M7GA 2IYQA 1GM5A 4QG7A 4CEJA 1G8GA 2R6DA 4PHGA 3M6AA 1HUQA 2O0KA 2GK6A 5FTMA 4QRHA 1US8B 3FTQA 4TL7A 3GLHE 4KU4A 1OYWA 2O8CA 2QI9C 4WZBE 3X1XA 3EZ2A 5JFGA 3SJAA 1N25A 1RYHA 3QPUA 2ZSDA 4A2PA 4BUJA 2W0SA 3F8TA 1E2QA 2IWHA 1G4UR 3SZRA 3UWOA 1Z2CA 3CNOA 4LPKA 4URVR 4UNSA 2D3WA 1D8TA 4IHQA 2GAOA 2HUPA 1Z8FA 2Z6VA 2OV2A 1ZM2A 3AB3A 2PEZA 3AEZA 3RYTC 1CJTC 3RSOA 2BMDA 5JLJA 2NO1A 5GJWC 2R62A 1P9NA 4HLUC 4G1UC 3ZS9A 3QBVA 4QM7A 4OQFA 4EAQA 3R7WA 5FTLA 2Z83A 4WVFA 1P73A 3W3AA 2VHUA 3QKRA 4KAXA 1L4UA 1E99A 1N6LA 2FZ4A 2CHGA 3SQXA 4LHZA 1KI6A 1T91A 4A6PA 3W5JA 3MLEA 4ZPXA 3LX8A 4JLBA 4D0GA 1WBBA 3KJEA 3WXMA 1E2GA 1PV4A 4B32A 4U00A 3PVSA 4PR0A 1K5GA 2C04A 2Z0MA 2ZSFA 1OHHA 4QJ3A 4OI0A 3PV0A 4XSHA 1DG1G 2NIPA 4X8LA 5FBRB 2GXAA 3RWOA 1OJLA 4WXPA 3EXAA 4E07A 2YKGA 4BZXA 1NIJA 4HSEA 5CDFA 2P6UA 3ZYCA 1OFTA 4C0BA 4CF7A 4B3XA 4LJ9A 3V00A 5H70A 3B5JA 1CR2A 2GEVA 2QQ0A 4AI6A 1YE8A 1Z3IX 5L3QB 2G1JA 3PUXA 5FOWA 3ZLJA 1XXHE 1KI2A 3T5GA 4W9MC 4PC3A 1R8SA 2BIFA 2ZS7A 2P3SA 2VP2A 4G5OA 2WJIA 3PG5A 4JLAA 4XVQA 5EP4A 4F93B 2E1RA 3IPYA 3S1AB 2XNSA 2ECKA 3P1JA 3WNDA 4B76A 1IXZA 2AWNA 2DYKA 4MUAA 1C4OA 4F38A 1T8UA 2QN6A 2RGBA 2VQSA 5GVRA 1XTRA 1EGAA 2NOAA 2KWIA 3QXXA 3VR6A 5J4HA 4R2IA 4CEHA 1UDWA 1F48A 4Q19A 1LFDB 2RH5A 4E5UA 1OIWA 3K9GA 2ODNA 4EPTA 1P2VA 2A78A 3CNNA 4G0NA 2I3BA 1U8ZA 1M1YE 3FE2A 2DFKB 3PUVA 1XEWX 4QXAA 3C14C 4M1WA 1IONA 4C4PA 5K8TA 4PO9A 1FX0B 3B78A 4MKHA 2A5FA 2PCLA 4HAZA 1FNNA 3THWA 1RE0A 4IVQA 3CH4B 1CLUA 3U7EB 3QF4B 2WHXA 3KUDA 4DDTA 4FMBB 1JJVA 3PUZA 1G6HA 1RRGA 1OFHA 5CYPA 4C7OA 4HUQB 4N1AA 4L9WA 1XP8A 4QM6A 1G5RA 4BEJA 3QKSA 2A5JA 3THYB 3W6PA 3CONA 5L3RA 3QSYA 3WYGA 5F3WB 4S35A 2F43B 621PA 3KB1A 3FMIA 5EXTA 1RPZA 4EKDA 2EFDB 3O8RA 2BC9A 3U4QA 3VHLB 2UZIR 1CJVC 4RZ2A 4V0KA 1YVDA 2QAGA 4ESHA 3KXLA 4POAA 4C0QC 5KU1A 1N5LA 2D06A 2QGZA 3GCGA 1XEWY 5C4GB 2WJJA 1R5NA 4DLXA 1TQ4A 2LWIA 4PHTA 1XTJA 1ZUNB 4M9XA 2PLRA 4D0LB 4MITA 3WRXC 4C0SA 4A2QA 5B30A 1U0JA 3K0AA 2H57A 1ZM7A 221PA 4JLNA 2VF8A 4KFRA 4LC0A 5JEDA 1JXOA 1J7KA 2V7QD 3RS5A 1FTSA 3AVTA 2AFIE 2G9NA 1CR1A 1WDTA 4H1UA 5JMTA 4TT3D 2BV3A 2XOKA 3LVQE 4JL5A 4LBWA 1YZQA 2RGNA 3ZZUA 1R0ZA 1ZCBA 5FUWA 2GNOA 2IT1A 2F7SA 1E4VA 4UXHA 2VL7A 1FFHA 4JS0A 3B9QA 3HU2A 1XCPA 1KMHA 1E96A 3FMFA 3REGA 3CWZA 2CL7X 5IT5A 4Z8XA 2ZQ5A 3LQQA 3RRMA 4O0MA 3DMDA 2RHMA 2BJVA 4PQRA 2C99A 5D3QA 1VCNA 4WA7A 4LYJA 1S9HA 2ZXUA 1IAQA 4A0RA 1CULC 1P3JA 3IIMA 4NPHA 4A92A 3EG5A 3W90A 5JI2E 5CK5A 4HLDA 2EQBA 4L15A 5JJIA 3K0SA 2OLJA 4LC1A 1V5WA 4ARZB 1XPOA 2V54A 3KL4A 1DO0A 3PUWA 5LD2C 3GLHA 3U2QA 1S1MA 2R65A 1YJ5A 4RFVA 2GZHA 1G18A 2ATXA 3AVQA 3SFVA 1IY0A 1NG1A 1PUJA 1Z0FA 4LRWA 4TTRA 1AS0A 121PA 5FL7D 3RC8A 4RKFA 4V0NA 4JLKA 1NVWQ 4BLRA 4TLBA 2EVWX 4ON9A 1F2TB 5G3ZA 4Q02A 1I4DD 2FF7A 2QRNA 4GOJA 5CJ2A 2QSZA 5SZKB 5FPSA 5AJXA 3L8YA 3B60A 3BOSA 1MOZA 3WP0A 4NYMQ 1ELOA 3TR0A 1AN0A 3K1JA 2XXAA 2IEZA 1GL6A 3G0HA 2FFQA 3JZAA 4ESVA 5EE3A 4AYXA 4UNQA 4F4JA 1WA5A 2SHKA 4JSTA 1GP2A 2J46A 1QZXA 5G3YA 4X8MA 2N1BA 1W2GA 4P4TA 2L0XA 4I1VA 3ADKA 1ANKA 4KBGA 1M7BA 3FMPB 2PZFA 3HJNA 4QNMA 2G3YA 4OHXA 3ZH9B 2A2ZA 2R6GA 2GEUA 4BLTA 4QHYA 4UNNA 1QHGA 2GVZC 2G83A 2REOA 1A82A 1GTVA 3TAHA 3OF5A 5AUNB 2ZI9A 4IDPA 2LKCA 2NO6A 4B33A 2ZUCA 2CLSA 2KI5A 1PVOA 2OESA 3RRYA 1ZUHA 3MMPA 1IBRA 1OW3B 3NDBB 2YJTD 4ITRC 1TX4B 3LXXA 4QJ5A 1P62B 2DWPA 2GILA 4Q48A 5CIQA 2OBLA 4MRSA 1GRRA 4BFXA 4D2IA 2O8BA 2ZRHA 1KAOA 1DAEA 1ZU4A 4PXAA 2O8FB 1UJ2A 4NE2A 1XXHA 4IXNA 3QXHA 2QA5A 3L82B 3K0FA 1DAMA 3FFAA 5EZ5A 1JEEA 2XTNA 3AF1A 4W5WA 1BOFA 1VDZA 3C5CA 5HKKA 1LV7A 5EQTA 4Q7MB 4URYR 3UXMA 3U3MA 3IUYA 1II0A 1EFTA 4M53A 4B35A 3SE0A 4LJ8A 1OKKD 3FOZA 3REFA 3L43A 3ZD7A 1R0YA 1QVAA 4ZDJA 3C5HA 3EAQA 2O8EB 1U0LA 3H2YA 3AKEA 4ACAA 2QP4A 1M74A 1KTVA 1NMZA 3HYRA 4Z1MD 1EXMA 1NLZA 2J0UB 3NHAA 4QNRA 2ZJ2A 2FA9A 1P61B 2CJWA 2IYYA 2ZJ8A 3JVUA 1E1QD 4M4SA 4PHHA 3F0TA 2QAGC 2VP4A 4X8HA 5UKDA 3GJ7A 4MUBA 3MWKA 1W49A 4KV9A 2FGJA 4RJLA 2W2VA 3CB4A 3ZVLA 5DYIA 1YZUA 4Q7KA 1NJFA 3TUJC 5KSZA 3GQBA 2OCYC 4M1OA 1JEDA 1NY5A 1TEXA 2A30A 4YC7A 1GOTA 1JJ7A 1WCV1 2GA8A 3T1OA 4RD3A 3EARA 4PSVA 1X8JA 3BH7A 3LX5A 2F1HA 4NCJA 4HB4A 3P4XA 4Q4HA 4C0AC 3Q5DA 2WSSD 5DYGA 2TMKA 4ZKEA 1J2JA 1KIMA 1M7HA 4Q1AA 1YR8A 3RS7A 2EFEB 2WWIA 4B44A 4WOPA 2JLQA 2QUZA 2RGNC 3THXB 5E7JA 4TZ6A 4BEBA 3WBKA 3THOA 3BH0A 1MV5A 4URXR 2B8TA 4E09A 4C2TA 1GRQA 3QXCA 4PC2A 1SXJA 2GESA 2QTVB 4AG5A 4B75A 1TAGA 2X8AA 4HB3A 2B7BA 4JYBA 2IA5A 4O25A 1XMVA 2J0VA 3A4LA 4B3FX 3PEVA 1MT0A 4L9SA 1E79A 1JAIA 4TTQA 1T9HA 2JLXA 3BORA 2QMOA 4DVGA 1A2BA 4DJTA 4UXIA 1G7TA 1KK3A 1GUAA 2YINC 3L8ZA 4B73A 4D4MA 2A5DA 1G291 4Q4AB 1I2DA 1U8YA 2PLFA 3ZQJA 2A5GA 1P9RA 4YDSA 3CX7A 3TKLA 5HE9A 4JBYA 5JSZB 1HT2E 1TUEA 2PL3A 1N0VC 3EX7C 3IO3A 3U3RA 5FUVA 1XPRA 4B3DA 2Q3HA 1UKVY 1N0UA 3QY0A 4WXRA 3Q7PA 1MH1A 4UKDA 1EFCA 1A5TA 4M9QA 4HLQB 3UMFA 1BIFA 4JT4A 3T1QA 5K8LA 3FGNA 3SR0A 4CEJB 4P33A 1U81A 2ZI3A 5DN6D 3R8CA 3SJCA 5FUXA 1DADA 2O8CB 2K5UA 3FFBA 4L5BA 5JHHB 2JA1A 2ZM5A 3IIJA 2VH5R 3AKDA 3V4RA 2ZS9A 2CMKA 3H84A 1HA3A 5G53C 2ZRAA 1HE8B 1OHHD 3PITA 2BCGY 5JCPA 1AK2A 1KNQA 1XZPA 4QBIA 3NTUA 2LCFA 1NKTA 1U94A 1GSIA 2ZVPX 3A37A 4BFYA 2NTYC 2QY9A 3T1TA 2FN4A 4CEIA 4QC2A 1X1SA 1XFAA 2R2AA 3VR3A 3VKGA 1VHLA 4B2IA 4JIMA 2WJYA 2J59A 3R7WB 5D3MA 4XTCS 5AWFC 3BE4A 3SJZA 1G3MA 3QKRB 5LD2B 4MYTA 4TLEA 1U8AA 1Z06A 1KI6B 3SBEA 3ZJYA 1FMLA 4NCIA 1YZNA 2IX3A 2NQ2C 3AP2A 3MRSA 4A1FA 4ACBA 1AKYA 4PZYA 5DIFA 3WRYC 2ATVA 1IHUA 3NHBA 1PJRA 4QOSA 4F7WA 2ZRIA 1IN4A 1GITA 3KJGA 1AGPA 2VHJA 4LY6A 1F2UA 4AG6A 3NBXX 4QBHA 1EFUA 2GXQA 1IJEA 1G7RA 4PPQA 1R2QA 1FUKA 1GDDA 2CL6X 3WY9A 3AVWA 2FFAA 3PR1A 3LRPA 4OI4A 2F1JA 3MWLA 5CJPA 2IUTA 2WWWA 3Q5EA 5FPTA 4C0KA 3RRNA 4HB2A 4BLOA 1XBTA 5EUMA 2OXRA 2N42A 4F91B 2J7KA 2AKAB 4K81B 2Z5FA 2CBZA 2EFHB 3TAUA 1E9SA 2WOOA 4KYIB 2JLZA 2ANCA 1Q20A 4NKRA 1KSFX 1KI4A 3AQ4A 2JIZA 1M34E 3BBPA 2MSEB 4DXAA 3A6PC 1VHTA 2GTPA 5K8IA 3ETLA 3WMFA 4DLYA 3I8SA 3NDPA 3NBFA 3TNFA 1QHHA 3KXKA 4D82A 2A5YB 1G8PA 4ILEA 3LO5A 2G77B 5L3VA 4UNPA 2WWGA 3KQLA 2VP6A 1G8FA 3SNHA 1DELA 4LCBA 3GLIE 4BGDA 3PUYA 4PO1A 2BEJA 1YQTA 2GBLA 5P21A 2ZREA 4EPVA 3VQTA 2ZRKA 4FMDB 2PMKA 1WBDA 1VCIA 5GVSA 2KSQA 1NSTA 1W1WA 1XJCA 3MGCA 2QMEA 3PIRA 3LBHA 4IVRA 2AHOA 3KFXA 3VR1A 4Q47A 3U61B 3THWB 4DB2A 5JCZA 1KDPA 2ZUDA 4RZXA 4A36A 1LF5A 4QHSA 2NZ8A 3IBGA 1XEXA 2EW1A 4HAWA 3RHFA 1A1VA 3CPHA 4OHZA 1ZCAA 5FH9A 3OZXA 3GLGB 2WOJA 1LS6A 4NCHA 3G82C 2GETA 3VU9A 2XSZA 2J1LA 1SXJC 3D7MA 1GNPA 1G21E 2G0TA 1XJQA 4ASUA 1JXMA 5JEEA 5BXQC 3U4QB 5DHFA 1QG4A 5KPDA 1KGDA 3CR7A 1HEIA 4MKGA 2J0SA 4PSAA 2QAGB 4XWAA 1Q1BA 3NVAA 4FWIB 1ZNXA 3OIVA 3UK6A 4PAQA 2C5LA 5CIWA 4DWJA 3KFVA 3SYLA 1OPXA 4Q21A 4MDEA 1AQYA 2WSSA 1UFQA 2AD1A 3P32A 3IKJA 3EZ7A 2CE7A 3EPJA 3C4JA 2YC2C 1AA9A 3AP1A 1ZC3A 3VTKA 2JLWA 2C9OA 4O2LA 1VKJA 3K0AB 5KYKA 4O2RA 5LB4A 1GZSA 3PEUA 5G40A 4JLOA 3WHKA 1P2UA 1ONBA 1P6XA 5TY0A 2DWOA 4FIDA 2OFWA 2OO7A 5KDDA 1EX7A 2CEAA 3VMFA 3PENA 4KODA 4YONB 5B57C 1BYUA 2HEIA 3TMKA 1XMIA 1G41A 1ZD8A 3V9PA 3KJIA 4V0LA 4ZDWA 1IXRC 4HZUA 2Z43A 4PFSA 2ZR9A 3ZS8A 4OHVA 4QBGB 4BFWA 1XEFA 5CM8B 3X1WA 4PHFA 1KMHB 2AWOA 4ZDKA 3W5IA 4B34A 1G3RA 2J7PA 4LHWA 1E4YA 4EJSA 1T5IA 5FPHA 5C4MA 3D6TB 1KOFA 4JJKA 2FDCA 2RKOA 3C41J 4GNKA 3SN6A 4EPXA 2ZU0C 2HYIC 4KSBA 3L2OB 1NNEA 2BKEA 1SZPA 4AIIA 2H92A 5B2ZA 1KZGB 2EFCB 4DIEA 1UM8A 4LJ5A 3WYFA 1TQ6A 3ONWA 3QF7A 3AVXA 1ZD9A 3KTAA 4FCTA 3BFVA 3VFDA 1DG3A 3I8XA 1N3BA 4E22A 2Z4RA 4F4IA 1HE1C 3QVUA 2OBNA 2RAPA 5KTYA 2V1UA 3KB2A 5AUPB 1DAIA 4BZPA 2CK3A 2FSGA 2FPLA 4TLCA 3T5DA 1KJWA 3GLHB 1VYTA 2REXB 2XB4A 3H4MA 1S1CA 4LHYA 5DN6A 2WBLC 3U60B 1HH4A 3BRWD 2HCJB 1T8TA 4PPNA 4IVPA 3WNCA 1N6PA 5KO2A 4OK6A 4PAOA 4NCKA 2H18A 1ZYUA 2D2EA 4RD4A 3R9IA 4YMTA 1NLYA 4QGFA 4NTZA 2RCNA 4ZKDA 1DPFA 4BASA 2F55A 4XIGS 1W5TA 1G20E 1CS4C 1OT3A 1VCOA 2XXAB 1RKBA 2KBFA 2QZ4A 3OFNA 2F9MA 4DZZA 2IXGA 5HR5A 1EWRA 2HDNB 3HR7A 1OIVA 1R8QA 3AVOA 3BB3A 3B13B 3A4MA 4ZIRB 4P32A 3CPJB 3GLFE 4LI0A 2QQEA 1R0WA 3KQKA 4KLNA 3VR5A 1L7VC 2ZYVX 4A0GA 4JJZA 3AUYA 3BIFA 2V6JA 2AR7A 3CR8A 4YLGA 5E3HA 2CNWD 4NL4H 4BWYA 4Q1CA 2ZRDA 5BWMA 1S0UA 5HKKD 3N2IA 5KNDA 2D7DA 1JAHA 2O52A 3KQNA 4HB0A 2VA8A 1TEVA 1G3IA 4XTRA 1NVVR 1W4CA 1H65A 4TQAA 1PUIA 2RGXA 3Q72A 1ZAKA 1OFIA 2VSXA 1SHKA 2OE2A 3B6EA 3U6KA 4D0NA 1KK0A 3RVBA 1T0JB 3U7FB 2PX0A 3I73A 4CZ2A 1LY1A 2X2EA 1HY3A 3IEVA 2Q9BA 2JLUA 3OE7A 1ZM4A 2O8BB 2WJHA 2ONJA 4LYAA 3CF0A 4KBFA 2GBLC 1GWNA 5FTJA 1XXHB 1N6IA 1RRFA 1TU3A 4NDZA 1YZLA 1OLOA 3K0FB 4TYPA 3RRZA 2FEMA 1DBSA 1E6CA 2B92A 2X77A 2R44A 3LH5A 2BOVA 4B74A 1KJYA 1E1RD 4V0OA 5GJCA 3CZPA 2ZVQX 3GEEA 4TL8A 2ZRGA 1Z22A 2NO7A 2W2TA 4NP6A 4L16A 1EWQA 3M0EA 4Q01A 2QEQA 4B2LA 1KK2A 2ZYWX 4WIAA 5FL3A 1NVXQ 1SVMA 4AKHA 1R0XA 1XD9A 1N6HA 3UIEA 1DTSA 4Q9IA 3NEYA 4DDWA 1NP6A 4NCNA 1H8HD 1JBKA 3EASA 4XD7D 2QAJA 3GLIA 5AUOB 5BYKA 3VKHA 1OYYA 1E69A 1EFRD 1QHIA 3K9NA 4GFDA 4KFSA 4YMWA 2P6RA 2ZEJA 2ERYA 4Q9KA 3EZFA 2J9RA 4BFZA 1YKSA 1SXJD 5IK2A 1SXJE 5H1YA 4B3CA 1TQDA 3B7GA 4R2HA 1HTWA 3EA5A 1E79D 2IW3A 1QBKC 2OUKA 2ANBA 1N6KA 5EZ6B 2VSOA 3IPXA 4Q5IA 3SOPA 1IJFA 1MRSA 1KI8A 3CBQA 4EUNA 5BW8A 3M4YA 4YMSA 4S2EA 4Q4HB 3CRVA 4W7SA 4TYYA 3W34A 1N5JA 6Q21A 3O8CA 4IJMA 2PJRA 3SI7A 3HDTA 2JLSA 2ZS8A 3RLFA 1KKMA 4ZI3A 2P5TB 1SQ5A 3NC0C 1VG8A 2EYQA 3SBDA 1FW6A 2IL1A 1U9IA 4CT5A 5E4FA 1T4GA 3C7KA 4J0QA 3NKVA 3QPVA 1NLFA 3IBYA 4Q4JA 3LBNA 2JJ2A 1SXJB 2WTUA 2GEDA 4OQLA 5JJKA 2XJ9A 3JZMA 4EJSC 3L0SA 1KNXA 4W5JA 1A4RA 1CBUA 1VG0B 4CDGA 3QENA 1JR3E 4AKGA 3QQ5A 1OIXA 1Z0KA 2N46A 2W6JD 2VHQA 3OEEA 1KDTA 4NU0A 3U3OA 2ZAOA 3RSLA 4ZI2A 2DFNA 3IDQA 4QBFA 3DDCA 2JJ8A 5SZIA 2AD5A 3KKPA 1G1MA 2ZJ5A 3ZZTA 1JALA 2FH5B 2C77A 3CRMA 1VIAA 3RS0A 4WBSA 2Z4SA 2GAAA 4TSFD 1O87A 3HU1A 3TUZC 2RGDA 3X1ZA 2WIAA 1N6RA 1RC8A 1CR0A 4LWZA 3DZ8A 4A15A 1KHTA 4IRUB 4OQMA 2QM8A 4KLZA 1Z6AA 2HYDA 2ZPTX 1MRNA 2P0EA 4TL9A 2IHBA 4AC9A 2C9CA 4NONA 5EXSA 1Z6GA 1BKDR 2YNMA 5KDLA 3SYKA 1J99A 2H17A 2CL0X 1KDOA 1U2RA 2XTMA 4RFSA 3LDAA 2F1RA 2IUSA 4KHZA 4KJZA 1ZINA 1E2FA 3OESA 1DEKA 4P0TA 2FSIA 2ODWA 4TLAA 2RGCA 3D8BA 1NMYA 3B82A 4MYUA 1YRAA 5A5GA 2W58A 2ZRFA 3B1YA 4D25A 4HYYA 3HU3A 2NO0A 1QHYA 1UKYA 1IOZA 1G7CA 3LVRE 4CEIB 2PZEA 2JEOA 1E2EA 2IUUA 3AVPA 4OL0A 5AJVB 2GXUA 3VR2A 3TE6A 1W0JD 1XU4A 2JASA 5FPYA 3CLVA 5D3MB 3MCAA 5JI3E 2BMFA 1Z2AA 1G17A 1G3UA 3VX3A 5JECA 3QE0A 2OFXA 1E32A 3CZQA 4MKFA 1E9FA 2EFGA 2DB3A 4OQXA 4KVAA 1NJGA 1CJUC 3LD9A 4K46A 1B0UA 3B1VA 4R7ZA 5DH9A 3SU8A 3AUXA 5TB5A 2YWEA 2FJUA 5K8UA 4RY2A 1KI9A 2ORIA 2JIZD 4LV8B 5A0FA 1E2MA 2AK2A 1FQKA 5EP1A 3GLFA 2VHCA 3GJ5A 4A8JA 821PA 2XB2A 3X1YA 4HAYA 2CLCX 4M0LA 1NL3A 4CVNA 4KI0A 5JS8A 2AL7A 3SHWA 1CXZA 2QPAA 1U98A 3BFXA 1CIPA 1GKIA 2CNWA 4B71A 4Q9LA 3I61A 4Q1DA 5BN5A 1EESA 5ELXA 3WMGA 1XCGB 5IHPA 3T35A 4U7DA 2BVNA 1XWIA 4KYUA 5DGXA 4C0JA 3P20A 1G7SA 1ZW6A 3OEHD 4UNRA 3RWMB 1HYQA 1V43A 3TR5A 2IF0A 1CRQA 4NZYA 1E2IA 3TH5A 2ERXA 1MO5A 2FSHA 3QJYA 1UADA 2IYSA 4LBYA 4M1MA 1E2LA 1JECA 2IYLD 3NBZC 2ZE5A 3NIBA 3U7HB 2GJSA 3BERA 1W4BA 1H8EA 3CW2A 4BLSA 1XRJA 2ZJBA 2BM0A 4G5RA 4U02A 1L8QA 4EPWA 4B3GA 1G19A 1ZVQA 3W8RA 4I1OA 3LLMA 4NYJR 1D5CA 1P7CA 2X19A 4IEEA 2W2XA 3ZVNA 1Z63A 5AJZA 5H68A 2XSZD 5DISB 3TVDA 1JI0A 1T0HB 4DHEA 1QHHB 1D9ZA 3LW7A 1FPMA 3R20A 5TVKA 4FD2A 3QEJA 1M6NA 2RB4A 4PC1A 3UMSA 2KJQA 5LB2A 4ASUD 4Q03A 4QJ4A 1VPLA 3GFPA 1E1RA 721PA 4FMDF 4HDOB 2BMJA 4DKXA 4Q1EA 4GT1A 3DPUA 3ADBA 1XMSA 2FFBA 4DCSA 3U5ZB 3VNVA 5JS7A 2B21A 4XWKA 5L3SA 2IBMA 1AKEA 3UWKA 1NVVQ 1AGRA 3KJHA 4LBZA 2GWHA 4LPSA 2QBYA 2QROA 4IDOA 1H8HA 1GRNA 2GCPA 4GOXA 4XD7A 3TIFA 3U3KA 4US1R 4B3BA 1JR6A 2DHRA 1HURA 1U9IC 1XEXB 4DLSA 1SVWA 1UBEA 1EFRA 2JDIA 421PA 2ZE8A 5F98A 1W46A 3BH6A 3QNUA 5JJLA 2PX3A 3ZVRA 1W5SA 5C1BA 4BZQA 1ZRHA 3VU9B 1NN3A 4GI7A 1G8HA 1TL7C 2C8VA 3B1ZA 2G6BA 1RW4A 1S3GA 1VCMA 4M1SA 1W0KA 3W8NA 1KK1A 5JWOA 1OFUX 1WMSA 4PZLA 4RKEA 1F60A 3B9PA 2NPFA 1XCMA 1AJEA 1IN6A 4GZMA 5B58C 2QRZA 5TV2A 1KO5A 2IXFA 1IN7A 4PAMA 2IYRA 4JVNA 2QENA 1KMQA 5JRJA 3B8HA 2YVUA 2XZPA 2V6IA 3QG5A 3A1WA 4R98A 5HZHA 1L2TA 2J7PD 1RVDA 3LXRA 3LFUA 4UQOA 3QG1A 4HUTA 1OB2A 4AD8A 4JZKA 2XEXA 4DEXA 4K8OA 4GRAA 3BS4A 4FMCF 5FUYA 1ODFA 2BBTA 2ZYTX 5JHGB 2VP9A 3KKNA 4TYWA 1D2MA 1IXSB 1GL7A 1G6OA 5JRZA 2GCOA 3AGPA 4JBXA 1LF0A 1QG2A 2QMHA 2ZU6A 4EDHA 2VLIA 4DBLC 1RJ9A 4V03A 5GJVC 2VEDA 4UJ5A 1Z29A 1G16A 1N5IA 1NN5A 1Z0IA 3CO5A 4TQ9A 3VR4A 3GJ8A 1II9A 3K0EA 4WW0A 2CK3D 2WKQA 1JR3A 2CDNA 1M2OB 3DOEA 1IQPA 5AJWA 1BS1A 4NYIR 4C0LA 4JLPA 4KVGA 4TMXA 2NGRA 1NRJB 1RZ3A 1BMFD 2B8WA 2W6JA 5FOXA 4JBWA 4ABYA 1G5TA 1P75A 1RRCA 4EJSB 2GJAA 2A7QA 2YOHA 5KHOC 4PPGA 2FNAA 2NO9A 2ZYUX 3QUSA 4TMKA 1UAAA 1TTTA 1SVIA 1N5KA 3K9LA 3O8DA 5AUQA 2P65A 2OEPA
chains in the Genus database with same CATH superfamily
1TUIA 1ZO8A 3E1SA 4TSFA 3W06A 3KQUA 1T0IA 4V0MA 5IAKA 4TXMA 3N87A 3OAAA 3PKZA 1YA8A 2GPSA 3QLJA 1TM4E 5LA6F 3ZV7A 1XGKA 1YCHA 2ZSEA 4ZOAA 3U48A 1Q1EA 1W29A 3USES 1MAVA 2PXXA 1TZKA 2Y67A 1GFIA 1TI7A 2EZ8A 1K63A 4ZZIA 1M2KA 2ISSD 4I1SA 4YQYA 5REQA 3EG9B 2FQ1A 4A9AA 3GWGA 2EJUA 1BSVA 3LDFA 1KSGA 5H4GA 2D62A 1IHXA 3DZDA 1E0KA 4N3GA 5JCJA 4AURA 3T1HB 3ON5A 2WF9A 2AC4A 1V96A 4QNNA 2NYVA 1GNSA 4UUPA 2O05A 2HTFA 5K8JB 1QP7A 3EE6A 4Z51A 4I8DA 2NUTA 1N6OA 1PIWA 1UZNA 4YP0A 1NLUA 4G2TA 3ELBA 4YCBA 1X8LA 3O0TA 4NI5A 5TDHA 3TMYA 4PG7A 2MHCA 2ZBVA 1L5FA 1OJ7A 4YP1A 4ADSG 1GNVA 4I81A 4UMDA 3TLJA 4WVLA 1KY3A 2ZSAA 3NJ8A 4XB2A 3X44A 4BNHA 4Z3DA 3QKUA 1ST2A 3PGKA 4G0ZA 5THXA 1XAIA 5JC1A 1S7CA 2BD0A 5KWSA 1OB5A 2KE5A 4UPEA 3AVVA 4P0PB 1MA3A 1RFLA 3T5PA 3LY5A 3ZR4B 1MAHA 2PX2A 1FRNA 1ZVJA 3UGJA 2O4CA 3ASVA 3DMTA 3OOJA 2QTZA 1JDPA 2EDCA 2PMBA 1FFEA 1NE2A 1TQHA 2I2DA 1V7CA 3JWEA 3KHTA 2QXYA 4FYPA 1QYWA 1U2GC 2BMEA 4CW7A 4DT1A 3DVLA 2ORVA 2IYVA 4QUIA 1GT91 3H0KA 1F3OA 1MEOA 1ISGA 4D8VA 4DCCA 1XJ0A 2GTHA 3AY0A 4QGGA 4RSGA 5HFJA 4DJ5X 4AKIA 3WHPA 5BYAA 4DM7A 3QWIA 3AF3A 2VZ8A 4R8SA 4S12A 2XUPA 2HHLA 4MR9A 2D5IA 4WCVA 1NVGA 3GZTB 1CHNA 1PV2A 4KQ9A 5J58A 5DTMA 1G5HA 2A84A 1CUUA 5KOJB 4JP2A 3W5VA 4ALNA 3GP8A 3OIYA 4KFTA 3G5AA 2KLHA 4X8OA 5IN5A 4R8RA 1M66A 2JJYA 1UANA 1YR2A 1NXVA 5HS4A 2ZRLA 4G0UA 1KAHA 4MMXB 4NLLA 2G80A 5ECGC 2C9ZA 4RACA 4HS4A 1I4TD 4RVFA 4UHJA 3KUUA 3WFJA 2Z2KA 5KMGA 4NZZA 5BO5A 2GF2A 2QD5A 4Q9AA 4AYTA 4JROA 1AO3A 3HDGA 1UZAA 2W2LA 3U09A 2XKBA 1QQ6A 3EGVA 4BRWA 3W7AA 2HHAA 3CLRD 1QYCA 1PX0A 4IHJF 2XA9A 4MCIA 4M6WB 1DAKA 4BLWA 4PO3X 3LKBA 2G1KA 2MMGA 1Y3FE 3W9YA 4AQDA 3COJA 1XQVA 4MNTA 5DT9A 3GVPA 4OKNA 3EZXA 4RORA 3W9BA 1KO8A 2ZR7A 3GRRA 5CD1A 4HMOA 5J2TA 2AEEA 4FYIA 5AKYA 4QOHA 3TCNA 5DLQC 1FYFA 1ZS9A 2RONA 1X1BA 3IELA 3IQDB 3SBXA 1K27A 3WYAA 4MB6A 2VSFA 5TPWA 1ZK1A 1QCZA 4GWLA 2H3EA 1R8XA 2NZJA 4YCLA 3NXSA 4C7OB 1C4KA 2JIRA 2OCAA 4XGQA 2WNSA 1SD1A 2C95A 2DR3A 2GPWA 4N3NA 1MQ8B 2WA2A 1SPXA 1JDBB 4JSYA 2IRWA 4EY3A 1TIKA 1H69A 2OBFA 4MARA 3RDPA 3O4FA 4CFYA 1Z4JA 1SXQA 1AQIA 3OT4A 2CL5A 2PGNA 3OPYB 2RK6A 1LVHA 5EHGA 1QAOA 1U2TA 2V9PA 1I2MA 1X3SA 2FOLA 2Y1LA 2YZGA 3GUYA 2FRDC 2WMOB 2QN3A 4IF4A 4XFDA 2BEKA 2CVZA 2ZI5A 3D5QA 3INNA 1K66A 1X87A 4NBRA 3RHTA 1FFXB 1E2JA 3PK0A 2CE2X 2W22A 3E9QA 4HXYA 5DF1A 1RYZA 3NRJA 4GW3A 3DVRX 4JOSA 2IYZA 4MEAA 3O2QB 5JWHA 4V1CA 2XMSA 1Q57A 1GZ3A 3ICPA 3MTJA 4M9CA 4XYLA 3DEZA 2YZKA 2PCJA 2RCYA 5DN9A 5CA0F 4GVXA 1XRSB 5KYYA 5C8YF 5TE9A 1OH8A 5DEOA 3PD7A 5CLLA 3ADPA 3SQNA 3CTMA 4ZRMA 1R18A 2VTVA 2AOWA 2X1HA 3DS8A 2W93A 1QIDA 3GFRA 4JVLA 1K4YA 1G21B 1NXWA 2VXYA 2NP7A 3PCXA 4F72A 2V6BA 1J25A 4N6GA 1T9GS 3M33A 1XLTA 4BO5A 5IH7A 2PMEA 1U2ZA 3BE8A 4QPNA 3N7TA 2ODPA 5LNK6 3ZGLA 4JMPA 2CB9A 1X3LA 1T1SA 5FFMA 4NYMR 4N3BA 4KFUA 1K8XB 4XB6B 4FBMA 2QRJA 1BO6A 5BN4A 4Q00A 2CCKA 2FPKA 3ENVA 1NW9B 1WHTB 3IMKA 2YYZA 3O8QA 2NTEA 3PXXA 4XIFA 3SXPA 5I5EA 1DC5A 1D4FA 2BF7A 2H5EA 2WFLA 3BGIA 3EC2A 4RZ3A 3REOA 3IR6A 4MUMA 3UMMA 3BA1A 4OHKA 1DRWA 1CSEE 3QEMA 1RT9A 1SVSA 3KQMA 4TX1A 1E2KA 1GZUA 1GPLA 3CUUA 4IZHA 4XOUA 4X7BA 3E3LA 1AIPA 1I9CA 1DAFA 1VIDA 2DFLA 1GRVA 2DP4E 3KKZA 4FONA 4Q3CA 4OM7A 3AM3A 4QECA 1L4NA 3LT2A 4QU9A 2OFOA 3KK0A 5DNAA 3J81k 3B6MA 3UAYA 3ZDCA 1CDEA 1NTOA 1KC1A 1MX5A 2CLHB 2QLJA 3IB6A 1KZ7B 3HLKA 3N2YA 2JRCA 1YJAA 3TSZA 1R4AA 2FSPA 2ZYAA 3QVWA 2J45A 1ZNQO 1CVLA 1R00A 1QH0A 2DR2A 3H8JA 4II2A 1ZJ6A 4YRJA 4IWNA 4YUXA 3IP1A 2PZMA 5EMNA 1PEKE 4L9AA 4ZO8A 4GLFA 1W5AA 1KXZA 4PLYA 4NWIA 3ZWCA 4GOKA 1QF6A 4GOND 4DNPA 3OQ1A 2W4QA 4MAFA 2IP1A 1XRPA 3CPEA 3GEHA 4Z49A 3LUDA 3KHSA 2RGRA 1B8UA 2OILA 1DBQA 1XMOB 1SBQA 2ASVA 2I3ZA 1MQ9A 3D3WA 4D74A 1SRQA 1EWVA 3ZE1B 3C6ZA 1H42A 4JL8A 4BS9A 4DSOA 5EQJB 2YOFA 1O8BA 1Q3HA 1RC1A 4GQIA 2OD7A 4TSRA 2B4YA 4B2PA 2DQYA 4D8WA 3TQSA 3VHRA 1T24A 2AMFA 3GPCA 2P5SA 4LOKA 5AR1A 5B1IA 3C48A 5DK4A 4LBVA 4IM7A 3ZDXB 1RM0A 1OI2A 1DKQA 2W5UA 5B1YA 4HYEA 5I4IA 4HMPA 1NV8A 2FVYA 1DVRA 4KXVA 1YZFA 2FR0A 4WZAA 3T3IA 4LMBA 1CUJA 1XHFA 4OJKA 5JCOA 2CXRA 3GN1A 4M1ZA 2BZ1A 4UZFA 4BBAA 3G1TA 3HP4A 5EHNA 4WADA 5J4VA 3L7MA 3KYJB 1P1FA 3EQ9A 3F3YA 5HFNA 2PUHA 2PGIA 1S2OA 2DBYA 3ELWA 1J4AA 3H86A 3PJEA 3ZPXA 4PHCA 2NADA 3DOFA 1KQFA 2V98A 2VCYA 2Z3WA 3KKMA 4MS3B 3WO0A 4CMIB 4F4DA 5TS3A 2QNIA 5CDUA 1UBHS 2VI5A 4JB0A 4NYIQ 4XGRA 5C52B 1HFJA 3WQRA 4DSUA 4RD2A 2ZUBA 3AP3A 2NVOA 3ABZA 3PQ5A 1N0IA 2CV0A 2YHIA 2PG3A 3IAXA 1M6VB 4XWTA 3KZKA 4BMNA 4KEAA 2K4MA 1G20B 3AJAA 1TYDE 1JPNA 4M1KA 3DLCA 3OQIA 5AICA 1D7OA 2C9MA 4EHIA 3KSBC 1Y98A 3DUFA 4K6GA 1U7HA 2B37A 1HTTA 2Z58A 3FPLA 3WGOA 4G8JA 3ZCQA 3KQWA 4QIHA 1P1CA 2O2JA 3A04A 2I4MA 3NHRA 3DONA 3P5BA 1CDZA 2XQGA 4WWHA 3JALA 3KD2A 5J4YA 3GLFB 2RD2A 4GVLA 1GFWA 3KUXA 2AXNA 2H1IA 3O7WA 2IYUA 2XYHA 1YV9A 3BXFA 4GX2A 1YDWA 2V58A 2GVDC 3EPRA 3GMIA 2X9LA 1OV6A 1NSFA 1U99A 5JPCA 4G26A 2DLCX 3WBJA 1COWD 3PF8A 1OXVA 2QE7A 4NBKA 3WJ2A 4CLRB 3I72A 4LYDA 4OJTA 5CXXA 5SYNA 2OXEA 5DXFA 1LTQA 1MPTA 1JQLB 2G63A 4EENA 1U63A 4FDUA 5B3KA 3R8FA 1LB1B 4XVUA 2PT7A 1JB9A 1HLGA 1UBNA 2A9PA 2OZEA 4EI2A 5L40A 2TS1A 3KR2A 4DRZA 4P4LA 3GV0A 3NWBA 3O1LA 3FOCA 3TLMA 1RMTA 2FSVC 2ZDGA 2WG0A 4LV6A 1O6ZA 1T5SA 4MO9A 4MGZR 2OZVA 1TMYA 1ZEJA 3VSAA 3FHJA 4G4JA 2FZWA 3RAPR 2DFTA 3T15A 3G89A 3RBVA 2XTZA 1RLTA 2O3JA 2ZTSA 4DLTA 1NHGA 3EPPA 3FHCB 1L7MA 3K2IA 3UHPA 4ZYWA 5KKNB 3D8HA 5T3YA 2NLOA 3GD7A 4DIKA 5CEFA 3KTOA 2BKUA 4BQIA 3JASA 2ZJ0A 3W5CA 1J70A 3G5UA 4QO8A 3K6SB 2JIQA 4DR5B 1W0KD 2ZE7A 3G0BA 2VJCA 4NU8X 5FD8A 1OLSB 4DLPA 2A0WA 1B1CA 3STTA 1O6FA 1D0SA 1OX6A 2JGMA 2ZJAA 1ADBA 1UMDA 1X6VA 4XLLA 3A6JA 4RWEA 1IK4A 1DOZA 2GK7A 3UPDA 2DPXA 2WE8A 1WAMA 1SB9A 1K6EA 1T36A 2YIMA 3BFKA 2OAP1 1MO6A 3I53A 5LDDC 1T9KA 2WFMA 5CA0B 3EXIB 5KI6A 3KT0A 3PC4A 1ZLYA 3IO5A 3QVSA 5GGXA 1VECA 3NUZA 4PX2A 5HKOA 1C30B 2GCGA 4F6RA 2VKTA 4QBTA 4Q9JA 1Z3CA 1NDQA 5EWMB 2B2XA 3BXXA 5MN5A 4JYPA 4QOGA 2XZLA 4UBKA 5G1PA 2QG6A 1CFJA 2V5AA 3A9SA 3II6X 4D80A 3ZJ5A 1VMDA 2E89A 5HIAA 3ADDA 3EZ6A 1VIYA 3LQRA 3B6ZA 1QHSA 4GMXA 4AP9A 1QK4A 2Z1NA 3RNLA 4JWKA 1CUWA 3C3BA 4DLUA 4FXPA 2YV1A 2VZ0A 5KNBA 3G3EA 1E98A 4G4IA 3L02A 4C7KA 3UMRA 3ABIA 2XGSA 4KYVA 5KZMB 4RESA 1A88A 2YV5A 3VC1A 1KU6A 2R1ZA 5KAMA 1VRCA 1ZAYA 5LQAA 5JXWA 3ILVA 1X80A 3KKEA 2WWVD 1E9CA 2HLHA 4U7HA 3N28A 1XNJA 5IXYA 1AM4D 2AOUA 2X5NA 4IO0A 2HU5A 3PFNA 2YASA 4ZO4A 1DQRA 3JAKA 4IOKA 3NBYC 2PH1A 5B7GA 2QZ9A 1Y8QB 2YWHA 1AH2A 1UPTA 2PBRA 3QE9Y 3K35A 1FVHA 2NU9A 3Q5GA 3OIWA 1PT8A 2ZI6A 2WU4A 2GERA 4JCCA 5JV5A 4QYXA 2BJWA 4AUKA 1TUBB 2R7LA 3C5VA 5DLPA 3Q8WA 4DNXA 3I61A 3LY8A 1OI7A 1SHUX 1YR9A 1TM1E 1RJ9B 2R6JA 4GYWA 4LFAB 2HCRA 2DT8A 3QXJA 3GA0A 4BE4A 2YVAA 2RFLA 3CSSA 2E85A 4N4AA 5ALDA 3TW4A 3N2LA 3HJFA 1SUSA 1S3FA 1O58A 2ZWOA 3TRHA 4AAYA 4EI9A 1U3FA 2ZK7A 1UFOA 3A9WA 4LVUA 2VJNA 3BDAA 4X45A 4DNFA 4E5SA 4BP3A 4DR6B 1XMJA 5JJ5A 5LUBA 3RRBA 1CUGA 3UMCA 2FEOA 3TEFA 1S9DA 3EMDA 3RKUA 3VR5H 4IEIA 3RSZA 5BQ3A 3FOFC 1LNZA 2FEWB 3G6KA 1A27A 1O89A 1Q3TA 3WWEA 4MZDA 2BRUC 2KBEA 3L8MA 3QV2A 1ID1A 3I09A 2BGMA 2C78A 2O2XA 4BDTA 1ISHA 1PJLA 2O0MA 3B5EA 4BPBA 4FGLA 4LHVA 2ZRJA 4BMOB 3DKKA 4LF7B 2FZLA 4MRMA 1VRWA 2OLKA 4AMVA 3T7AA 4NFSA 5TXGA 1USIA 1WMFA 2M1XA 3DEFA 3IESA 2IV3A 1RHMA 4EG7A 3M5DA 4YREA 1P7VA 1UAYA 4I3GA 1ZM9A 4O1HA 1SCUA 1YR7A 2G9UA 3PC8A 3GYBA 2XNDD 4M0FA 4X65B 2FWJA 3EUAA 5FBVB 1X77A 1P39A 1Z5ZA 4IIGA 4ZMSA 3K4HA 4TUYF 5JBQA 5A3SA 4I1UA 1PHPA 4W9NA 3PXGA 1HI9A 1KJ9A 2DG2A 9ATCA 1E7SA 2QTFA 2EJVA 3I5YA 4FOLA 1KZ4A 2W2NA 3EMVA 1ZGBA 3T5AA 1EUCA 1VYVA 2D00A 2QSYA 3TKYA 1T5LA 2G76A 1U0SY 1FDIA 1PJCA 1TJYA 2G72A 1VG9B 3UJCA 3ZLVA 1P2TA 4O3MA 1LBQA 2UUOA 4N01A 5CBKA 5GM1A 2IF2A 4MXDA 1XRRA 3PHGA 1E9EA 1Y5IA 5AW4A 2HJHA 1AZTA 3K70B 4RK6A 3IKTA 4QL3A 4GWGA 3L8CA 1P0FA 1SR8A 3RS9A 4EAAA 2YHSA 1KFCB 1IEQA 4BO1A 1Y8AA 3BFJA 4G0WA 4FB5A 4ER0A 1N2XA 2BH2A 1D8AA 3IDOA 1GV0A 1MO3A 4Y2RA 1JV2B 2FJPA 2JS7A 4B46A 4KAJA 3QEOA 3ZDQA 1QRAA 4XQEA 2W8ZA 2NU8B 5KQSA 4KO1S 4UD6A 4NV3A 2C3YA 5A9SA 1P1IA 2VBCA 3OOEA 4KB5A 1I2AA 4KDCA 4FOOA 4EHNA 5KWIA 1SC1A 5LXTB 2I2BA 3FLMA 4LRYA 2B4RO 2EL7A 1UBTS 2MR5A 2AJLI 5IT9A 5H02A 3G88A 5CM9C 1PF7E 3L8HA 4G8BA 3UGKA 2VJDA 3UK1A 5J2UA 1YQ9A 3PXDA 4TYNA 1QF9A 3RC7A 1M33A 1S8OA 3EGXA 4PR3A 2P27A 4PZ0A 1DXQA 3DC7A 1Z33A 2YXLA 3VGJA 1LWOA 5J40A 3D0KA 2JD0A 2CBXA 3DB2A 2R6ZA 3ZHBA 1C8VB 3LL4A 3Q0IA 3N0TA 4L4UA 3SXUB 4U5QA 3ED1A 5GZ6A 2I2XB 1GA4A 3K94A 1N92A 4FDTA 5KVVA 5DT2A 3BRCA 3UANA 2V6GA 1UUFA 4Q3NA 3PYXA 4DUGA 1EIZA 1EVYA 4EHBA 1RD4A 4KPUA 1WOYA 3THYA 5T41A 4ERNA 3JZIA 4Z0TA 4BX8A 5AVUA 3ICQB 2EQAA 3NU1A 2ZDHA 2FX2A 5DXAA 1PK7A 5EUQB 1QJ4A 1UXHA 3ABOB 1D6JA 1MT3A 3BHNA 1PJ2A 4HQKA 3DNFA 3VZQA 3A10A 4MDHA 1G8MA 3L06A 4ND8A 3KR9A 1OSNA 2RIPA 4QOEA 4QREA 5TR9A 1UP6A 1YU9A 3C16C 3VMMA 4OGWA 4RF2A 1RXCA 3UYLA 2IYAA 1WIWA 3LG2A 4NECA 5LU8A 3TQRA 3QNMA 5ECYA 2ODBA 5L4SA 4JBGA 1FSZA 4HDQB 1PNQA 3UB3A 1DE0A 4O5AA 1R8JA 1F6DA 1N9ZA 3MAGA 3C6YA 5EJFA 4EFNA 4J7UA 4P98A 4N5HX 1KR2A 3FWPA 1G0NA 4RA9A 4CLOB 1SEVA 4DWOA 1DO2A 3KAQA 4J0CA 1SKAA 4URUR 4CKWB 3JVVA 4MWGA 1OILA 4IOJA 5CFLA 4TPKA 4BLPA 5K6AA 2JGJA 5AVZA 2NZWA 3H2BA 3LF1A 1DTWB 3KQHA 2D2VA 2QORA 3FIUA 3O8OB 1O3YA 2ZRNA 1ZD5A 4MV6A 1THTA 1PQUA 4WLNA 1ECPA 4CM8B 3KJNA 4U5XA 1A96A 1ZUD1 3LPMA 3AU9A 3OETA 2XR1A 4XH9B 5EERA 3EHDA 5T6MA 1QV7A 2PZ8A 3IAEA 2CCGA 4JUFA 4OVKA 1ODIA 3X43A 4BKUA 1ZW1A 3N2KA 1J09A 3AHFA 3BGSA 3AMVA 1OGJA 3C5EA 4FJ0A 4H31A 1NMSA 1FDWA 1SU4A 1ZK2A 2V4MA 4UEJA 2DKFA 4IJKA 1CUEA 4K6OA 4PGAA 4IMJB 2I91A 2EWVA 2EWWA 2VWGA 1GGFA 3E7DA 4JVOA 4CTOA 1QVVA 4UBNA 4RADA 1LPNA 3NUQA 3V32A 2W6ID 4YS6A 3DEKA 4F92B 4NMXB 5LYJB 4E5NA 4BNNA 3LE8A 3LUFA 4NULA 3QHAA 1SUPA 3W6OA 2C7VA 3PC2A 1L5MA 2V7QA 2AFHE 4CF4A 4FN5A 4D9BA 1GAJA 1KYZA 3ZI7A 4DXDA 2RH8A 1TU4A 1X86B 4HZUB 4LWPA 1QC5A 2FPXA 2YVLA 1HDCA 1XKXA 5AHKA 3S81A 2AVNA 4CIWA 4FFDA 3W8FA 4QPPA 4RCVA 1NN1A 3HB4X 4Y18A 4ARZA 5LFAA 5KQGA 4S1VA 1P8AA 3K9FC 2H1LA 3CMCO 3GEIA 2Q4OA 3AFIA 2QV7A 3STWA 1IPFA 2P8SA 1W19A 1TB4A 5E95A 2CUKA 5F7JA 3G17A 5FBLB 4ND4A 3A1SA 3JD0A 4PLCA 1EA5A 3BSSA 3DV0B 1E9VA 5JIBA 2EQ5A 4HT3B 5F76A 4J76A 4PQYA 5ALGA 5B6JA 4CV3A 4ES6A 2KLBA 1VL1A 1SVLA 2Q2VA 3DCJA 4LGMA 1HLDA 2LZ0A 4JT9A 5IAGA 3I6BA 2VF4X 4IOLA 5KX5B 2BZSA 4FGKA 3VVCA 5C8XA 3GDHA 4CV1A 3MCUA 5AM3A 3E53A 1R6DA 4TMVA 1H5UA 1QX4A 1XDBA 2AZMA 2HXYA 2XBLA 4HPJB 4Y9DA 3U7JA 3TQTA 1GVNB 2AMJA 3I01M 1V11B 4X64B 1CP2A 2CFOA 5KOYA 4JU9A 3AKZA 1EDBA 1C0IA 1U0BB 4CI9A 3TRFA 4ETWA 4YDHB 3FM9A 3LMKA 1NMXA 3NHJA 4CIVA 1R0KA 1UKBA 3B2NA 4DDVA 4JFAA 2ZAMA 4CGZA 4HAUA 2H31A 1PFGA 1QYVA 2CYBA 3PYLA 1DBPA 2IOFA 1YSCA 5CLQA 3GIDA 1NF2A 1GNQA 2HM7A 3OBIA 2FPMA 1C4WA 3UMGA 3K71B 3HBFA 3OKCA 5ICMA 2BUBA 1PSWA 4E2FA 2K7FA 1KI3A 5C34B 3WHIA 4QUGA 1D7AA 3HWSA 2PWBA 4Q6BA 4RL4A 3CCBA 5FL7A 1T3ZA 2AKYA 1C7JA 2BZ0A 3ZHYA 2B34A 5LQCA 4IIXA 2P67A 3A3PA 5DM1A 5JR3A 3DAPA 3ODGA 1XTTA 3FBGA 1TA0A 1C3EA 2ZVJA 2QLFA 1E6MA 3DOIA 1DU4A 4HDSB 4LMPA 1EWTA 4YRCA 1NF8A 1UWKA 1FY2A 2C1ZA 4UHBA 4F46A 5F7OA 3JU3A 2WAAA 3HBJA 3NHWA 1A9OA 4AJ9A 3MGAA 4GLLA 5HE8A 1NTRA 3NRBA 3FPGA 4LW8A 5K3FB 2RHTA 2YS7A 1DQSA 4XSGA 3WP1B 4KO2S 2QPTA 4Z86A 1RRKA 1YS9A 4JODA 3BN3A 2BZGA 2XNJA 2ISQA 4O4JA 3EFHA 2P3QA 5JBNA 5HTOA 3SC3A 2I29A 1LJ8A 4ME6A 3JWIA 2O8FA 3E7FA 1UT5A 1XTZA 4MP6A 5SY6A 1YDHA 3KT6A 1EIWA 1YT5A 5KNLA 2Q4TA 1RP1A 3MINB 4PC6A 4F86A 1T6XA 2BBOA 3L6BA 4RA6A 1GU0A 4DMHA 4WGFA 4EMTA 5CVJA 2DPGA 2I78A 5DTQA 1J90A 3ZDAA 1WB5A 1GG8A 2CXPA 5HUHA 4M37A 1ZR4A 4M2LA 3ANLA 4HEQA 1TMKA 4KXQA 4MA4A 3R5JA 3VPGA 5CFRA 4M21A 3D1JA 4Z0PA 2C4MA 1GG9A 4CKXA 4IMIB 5K3SA 1UEJA 4X20A 2OAEA 2SCUB 1RBZA 1CKEA 4RYDA 2CXQA 4QUDA 3I04A 1QFMA 2H1HA 1NQOA 1OYOA 4OH7A 2WD7B 3K72B 1LQTA 1XZQA 2JHFA 4HH1A 1VI2A 1UZUA 2QVGA 3DMFA 4MULA 4RD6A 5T4BA 1OE0A 1DRVA 2ZIAA 4CLDA 3EXEA 1S2NA 1WB9A 4DR4B 3LTNC 2KHZA 3AESA 2ECPA 3BT7A 1O96A 4OI2A 4MWDA 4LZOA 1EVQA 2BI4A 3LUCA 1N5MA 1QK3A 1R6BX 2LIPA 2RGEA 5F1PA 3DHWC 3UPTA 3GLGE 3TQCA 3NTQA 2QRVA 5EE1A 1JP7A 4RVSA 3I2YX 3S8MA 3TOVA 1GAWA 3P0IA 4MPDA 3VRHA 1EP1B 1NXXA 1MIOB 2CYAA 4MO2A 4MR8B 2O0JA 4ISCA 5DTIA 2Q21A 5CLHA 4IH4A 1KPIA 5ILOA 3SEAA 3GI1A 1SELA 1A77A 3DTVD 2X4LA 3E2MA 1WUHS 1UBGA 3ITNA 3JQFC 2PPVA 5AK5A 4MUGA 1XYGA 3OCZA 2XQFA 4N5MA 3DGFC 4HFMA 4FYJA 2CNKA 5A4AA 1E8MA 4CI0B 2QT0A 5IJ0B 3OPQA 3ZCPA 5BWNA 4R05A 3V4VB 4HLNA 1NR7A 3UAOA 3JYNA 4DCUA 2JD2A 1YOVA 3VAYA 1ZJZA 4Q0MA 4YRQA 5AJYA 4YQFA 1Y37A 4PRKA 5FTWA 2MYNA 2VAXA 2I3AA 3THXA 2I9PA 1Y8CA 2JFQA 2WNIA 1DFHA 1T3LA 4QO7A 5LNK1 1E1QA 1VYHA 4F8JA 3BB1A 1JXAA 1NI4B 2Q45A 1PW5A 4RDIA 2O59A 3FYHA 4RANA 2BEUA 3PHCA 5AVRA 1NQ5A 3MAAC 1DAHA 2R97A 3VVLA 5GONA 2CXTA 1EFVA 1TQ2A 2YWRA 3M1IA 3MW8A 3YASA 1IY8A 4HP8A 1AUQA 2AN9A 2N1MA 2XOKD 1ODCA 4G1CA 4TS4A 4AVYA 1CWUA 1HR0B 1I3KA 3A1VA 2WRZA 3TGLA 2FWPA 2PO5A 4FINA 5AQ1A 2GHQA 5DTJA 1DFIA 2XCQA 2R8RA 5CT8A 2HJWA 3HB1A 1NPDA 1PR5A 1ZHOA 1HE4A 4N8SA 2ZCVA 3ROMA 3A6HA 2CB0A 3P27A 3SR4A 7REQB 1CUXA 4KR0A 4QPDA 1KZYC 4QJBA 5KYXB 1QGDA 2EYUA 1ZQ9A 4PCLA 1C0KA 5DHQA 2XUKA 3FH0A 4M8KA 5JSZA 1HYEA 1ACMA 1E60A 1FXWA 2JFUA 1Z4PX 2W00A 4B3MB 5TJHA 4TKVB 3NAGA 1JH9A 1ESMA 2Q6TA 4NBSA 5HMMA 3MD9A 4BU0A 3ESXA 2EKZA 1UK6A 1JWLA 4FNGA 1ML4A 4HFJA 5J5CA 1CQPA 3HR4A 2D1TA 5DYTA 3F73A 2I2CA 2Z2JA 4CM9A 5BURA 3AERB 4R9UC 3IQXA 3ESDA 4UAGA 3NG1A 2EDAA 2J31A 1U3TA 1GY8A 4A3SA 3RFFA 3ZJ4A 4BJ5A 4PHGA 4O4HB 3N1UA 3HWRA 5WRFA 5FTMA 4AF8A 2MYUA 3UENA 2O8CA 1N78A 3ELDA 4WZBE 4FLMA 1WABA 2SECE 2ZSDA 5EUBA 2K2WA 4BUJA 3UK2A 2PA0A 1E2QA 4E2ZA 2W2PA 1HDEA 3NFRA 1LC3A 1ODJA 3RV3A 1Z2CA 3SZRA 1NUHA 1QIFA 3UJ9A 3UWOA 1J2EA 3D0QA 4UNSA 1PQ4A 2HDHA 3HACA 5JTTA 1U9ZA 4NZ9A 2OV2A 4WK2B 1MO2A 2WSBA 3AB3A 3AI3A 4KGZA 4NS1A 1U7ZA 4WA8A 4BBZA 2PEZA 3RYTC 5HHTA 3EF3A 4YECA 5GJWC 2R62A 2VVTA 1H5QA 5IBRA 1STOA 2IW1A 5M2QA 3PCTA 4G1UC 2ACVA 4XIIA 3JATB 5BOSA 3MJTA 2Z9CA 2C92A 2AR0A 3BM5A 3HVUA 3CN7A 4EAQA 4RTPA 3A32A 5SICE 2AMLA 4WVFA 1XVTA 2AOTB 2RB5A 2VHUA 5DLDA 4KAXA 1L4UA 1N8TA 1E99A 2FZ4A 2CHGA 1GO2A 2PRSA 2ZVDA 4X1IB 5MN4A 2WQ7A 2HN9A 4HSGA 1T91A 1YB4A 4W1RA 3C6KA 5DYWA 4D0GA 1WBBA 4JLBA 3WLNA 4DIBA 1REQA 2M9MA 2VSNA 4G84A 1CV2A 1PV4A 2B25A 2BFWA 4HMQA 4U00A 3C4QA 4PR0A 3QK7A 3MEQA 1LZKA 4CUZA 5DGTA 1B76A 5BQPA 2OR3A 3VPSA 3ZE6A 4OPMA 3UWDA 3ZNPA 2XWPA 2GXAA 2G08A 5F3DA 1OJLA 3KO8A 4PNZA 1NU8A 2IODA 3V1YA 6CHYA 4E07A 1ZOLA 2P41A 4IQGA 4U3JA 4Z9FA 3TZLA 4UVHA 3UJ6A 4C89A 4ERXA 4CL2A 4LMRA 3MTAA 1CUIA 3FUWA 3OCJA 2IH4A 3V00A 1ISIA 3B5JA 3EVBA 3RWBA 4EGJA 3AHIA 3ACCA 5I9BA 2HMYB 4HTAA 4KR3A 3PUXA 3PR2B 3ZLJA 4R8MA 1R8SA 2ZS7A 3FHTA 1NONA 2P3SA 2VP2A 4G5OA 4LECA 5EP4A 4H15A 5H80A 1OTHA 3L79A 3VBEA 5BPFA 5FYQA 4FMPA 5K51A 1R27A 4TLMB 2O20A 2WYUA 4BNYA 3H4IA 2AWNA 4B76A 4PS1A 4WBNF 5I3ZA 2E4WA 2GN2A 1NYTA 2H1VA 3HJBA 1RM5A 1C4OA 2P2DA 4F38A 1LSOA 2RGBA 5GVRA 1A9XA 2NOAA 3C85A 4RENA 3EDYA 3VR6A 2G5GX 2I0FA 5JDIC 4H60A 4R2IA 4AN4A 1B3BA 5CH5A 1VKOA 3GAAA 1ORRA 4JJ7A 1C7EA 2RH5A 5AI6A 2GPYA 4RWZA 4G0QA 3HGQA 5G1OA 3COYA 4BMXA 1ZH8A 3M1AA 3FDZA 4X7RA 2V8BA 4X3CA 4OSPA 1E92A 1YULA 3FE2A 2DFKB 3LWZA 3NV9A 4ROTA 1IHDA 1RQPA 4QE3A 4KNYA 3OM8A 3C14C 1Q0LA 4QXAA 5G0VA 1VA4A 1ZWLA 1OXKB 2P2YA 4H16A 2IHTA 4D8TA 3PSHA 1LQUA 4ABTA 3LUPA 3B78A 5AVKA 1WTCA 4OKIA 2A1IA 3CLHA 1FNNA 3D3JA 3M3PA 4QYIA 2ZB3A 1AHPA 2Q8QA 4BB6A 2IP2A 2D5BA 1ZD2P 4F9EA 4YAUA 1OREA 2HHCA 4ZWNA 4RTSA 1G5QA 5BV1A 3ESCA 1TLTA 3CINA 4ZQCB 1RRGA 1RYDA 1OFHA 4O2AF 5CYPA 1U8EA 3JD1A 4N1AA 4C7OA 3HXPA 4HZGA 1YS6A 2REQB 2A0KA 4KV7A 4AECA 3VOTA 1C9MA 3IDSA 3CONA 1W88A 3PLRA 4RH1A 4RTOA 1JPUA 1M1YB 2PSDA 1Q1AA 1TCCA 1PN3A 1BMQA 1H6DA 2X6TA 1P91A 3FMIA 3PDCA 1W85B 5EXTA 1L5LA 3T5MA 3O8RA 5BT8A 4IGIA 1HQKA 2IHJA 1FNSA 4AMGA 5C8YA 4GKJB 1QUEA 2YFKA 1HFKA 2YXDA 3OQOA 3PKIA 2X0DA 2Q3EA 2IP4A 1TZJA 5C4GB 1BA3A 1EJ0A 3ZWYA 3L7BA 5E9JA 1V8OA 4XLTA 1VBFA 3CYFA 4XDZA 2OQVA 5HZHA 4DLXA 4PHTA 2QD1A 1ZUNB 4M9XA 5B30A 2V7WA 2PL1A 4WSOA 1V2GA 3EGEA 3QOXA 1XTVA 2C4NA 2I99A 2C2XA 3FLBA 4JLNA 4EBBA 3GCWA 3OLYA 4RGBA 4B5KA 5L6MB 1JLKA 3RS5A 4I5FA 5J63A 1Q2XA 5HIMA 2HQRA 1WDTA 4DJEC 2O5CA 1JILA 3OICA 1E6EA 1KEZA 1M1NB 4XEHA 2Z5LA 4GGPA 1NZFA 4FLEA 5CDGA 3T3MB 2YR0A 3ORHA 5E4YA 2RGNA 3K2EA 2C2BA 2ZTHA 1PNTA 1R0ZA 2VTDA 4P80A 3FPBA 1O9GA 1RE1A 3I2GA 4M3NA 2F7SA 1E4VA 2VH2A 4R54A 5F4ZA 3RVLA 4AY4A 3EAFA 3CRNA 3F97A 1TYCA 4ZVQA 5KYWB 2PGDA 3H9EO 3EIOA 3WGUA 3UAZA 1DI0A 3VVMA 3CWZA 2QR3A 2WKSA 2YTZA 4WK4B 5DDIP 1B43A 3V4PB 1MG0A 2QHXA 1RDFA 2VYNA 4XM2A 1Z4IA 4J3FA 4OQ4A 5AW2A 1EX1A 2WINI 4WA7A 4GQBA 1AOXA 1U5BB 1CT9A 3K6KA 1WSAA 4UOEA 2WI8A 1P3JA 2Z04A 2X5JO 3D43A 1NZJA 3IIMA 3ZE0B 4A92A 3U16A 4FGZA 5JI2E 4QT0A 4DR3B 4GQAA 4K9RA 4HLDA 1M0SA 1N32B 1U1IA 5IDYA 3K0SA 1P7ZA 2OLJA 5LA6A 2ET6A 3S5UA 1V5WA 4Y2QA 1ULAA 1C9JA 2PKXA 4DBZA 1XPOA 3SE7A 1KPHA 2R84A 4ZMRA 4A8HA 5JFOA 2FW8A 2WB2A 1IRIA 1S1MA 1R37A 1M2EA 5KWJA 3AVQA 4WZBA 4Y6GB 4HNRA 4P81A 3LCMA 1U8FO 4KIFA 1I7NA 2V7TA 3FR8A 2YN2A 4TTRA 3KJQA 2WD9A 4JP8A 5AKLA 1SHTX 1NVWQ 2C8LA 3ROQA 1F2TB 3AM4A 4B0PA 2B5VA 3KETA 3HJHA 1FDUA 4NK4A 1GNLA 4QLOA 3HA3A 4GOJA 4UOZA 4JLWA 5M7EA 5JH7B 1FTGA 1U02A 4F45A 2Q27A 3CCCA 1WCIB 1YACA 1E7MA 2ZTLA 3BQNB 4NBTA 4NG5A 4NYMQ 4ZZ1A 1F4PA 2ZM6B 4I7EA 2OCKA 5E2BA 4Y2JA 4H6XA 5GV7A 3G0HA 4X44A 3VJLA 5EE3A 2GM9A 3U4AA 4AYXA 4F4JA 3PWKA 3H2IA 1QZXA 1Y3DE 2CJYA 3E7XA 1UPAA 1YA6A 2N1BA 2J6HA 4P4TA 1Z5OA 4DA9A 3IX7A 4I1VA 2CUZA 1E59A 1M7BA 1T1IA 2XOXA 3VDXA 2XD4A 3T94A 3QEBZ 3IEIA 3H75A 4NY1A 5L9AA 4M0UA 1NX9A 2A1UB 2XT6A 3KNZA 1Z5WA 3HMQA 5EFOA 3PRHA 1D5WA 1FDVA 2OM6A 3ITEA 2YV2A 2Z95A 1E3EA 4DA4A 4RDXA 9ABPA 3FF4A 1D6NA 2CDCA 1H1LB 3OF5A 2XDQA 3T7SA 2Y4OA 4NU5A 4WBNB 4ZT4A 3IAFA 2PBZA 2CLSA 1D2AA 4DYHA 3RRYA 2CVQA 1GCOA 2XKAA 1G20A 2PSSA 5TQ2B 3MMPA 1J5EB 4XLZA 3NDBB 2YJTD 1P2DA 1I7SB 3GRVA 4ITRC 2LUOA 4FSXA 1N8NA 4JBHA 4I55F 4R9NA 4Q48A 2OBLA 2B4AA 4BFXA 2TMYA 4PZEA