2XJLA

Monomeric human cu,zn superoxide dismutase without cu ligands
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
153
structure length
153
Chain Sequence
ATKAVAVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFSVSEEEDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHAIIGRTLVVSEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Folding Catalysis by Transient Coordination of Zn2+ to the Cu Ligands of the Als-Associated Enzyme Cu/Zn Superoxide Dismutase 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords SUPEROXIDE DISMUTASE [CU-ZN]
total genus 34
structure length 153
sequence length 153
ec nomenclature ec 1.15.1.1: Superoxide dismutase.
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00080 Sod_Cu Copper/zinc superoxide dismutase (SODC)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.200 Mainly Beta Sandwich Immunoglobulin-like Superoxide dismutase, copper/zinc binding domain 2xjlA00
1F1AA 3L9YA 1HL4A 4A7QA 2V0AA 4BCZA 1N18A 3KH3A 1SXCA 3GZOA 2Z7WA 1HL5A 1ESOA 1P1VA 2WWOA 4BD4A 1XSOA 1SDYA 1DO5A 2E46A 2AQQA 1QUPA 2GBVA 3KM2A 1PTZA 1U3NA 2ZKXA 3GZPA 2WZ6A 2K4WA 4OH2A 2SODB 1EJ8A 2ZKYA 1TO5A 1COBA 4A7TA 2Q2LA 2WWNA 1JCVA 2ZOWA 3GTTA 1Z9NA 1YSOA 2Z7ZA 2WKOF 2JLPA 3MNDA 4OJAA 2Z7UA 1EQWA 1PZSA 1E9QB 3CE1A 3GQFA 3T5WA 4B3EA 4A7UA 1UXLA 3K91A 2WZ5A 2JCWA 1CB4A 1E9OB 1AZVA 1S4IA 1E9PA 3HOGA 5KBMA 1JK9B 2VR8A 1XTLA 1IBBA 1E9PB 1PU0A 2AQTA 2C9UA 2VR7A 3S0PA 1F1GA 1YAIA 3F7LA 1B4TA 1IBFA 2VR6A 1SXZA 4A7VA 4A7GA 2WKOA 1IB5A 1YAZA 1OEZW 1SXBA 1UXMA 1SXNA 2GBTA 2WYTA 1SOSA 2AF2A 5KBLA 1SDAB 1XTMA 2WZ0A 3H2PA 2NNXA 3GTVA 1TO4A 3CQQA 4N3TA 3ECVA 3KBFA 2R27A 3F7KA 1JK9A 1Z9PA 3MKGA 5CU9A 2AQRA 3QQDA 4L05A 4MCNA 2AQPA 1MFMA 1B4LA 1KMGA 1SXSA 2LU5A 3LTVA 3GZQA 1E9QA 2XJLA 1IBDA 4N3UA 1RK7A 3SODB 1SXAA 2AQSA 1OZUA 1E9OA 1OALA 3HW7A 4U4IA 2AEOA 3QQDB 5KBKA 2GBUA 3HFFA 3CQPA 3KBEA 2E47A 3ECUA 4A7GF 2AQNA 1FUNA 2Z7YA 3H2QA 4MCMA 4A7SA 3ECWA 1SRDA 3L9EA 1F1DA 3KH4A 2WYZA 3PU7A 1L3NA 3KM1A 2C9VA 1Q0EA 1OAJA 1SPDA 1DSWA 1IBHA 1OZTG 1BA9A 2ZKWA 1BZOA 1N19A 3RE0A 1F18A 1CBJA 4FF9A 4BCYA 2APSA 2C9SA 2XJKA
chains in the Genus database with same CATH superfamily
2R0ZL 3MRPB 4JANA 4RGNC 2FK9A 2IVFC 4IS6A 1BD2D 2CHWA 2P1YA 4NWUL 5E6ID 1CIUA 1QEXA 3FFCE 1DUZB 1HKLL 3R0MA 2J72A 2ZX5A 1LO3H 2WWOA 3ZL4H 5GZND 1S5IL 2XFGB 1XH0A 1IQWH 1LQSR 2CDGA 2JIXB 2Z8WC 3HLAB 2IG2H 5DSCA 4BHUI 4XVJH 1K72A 2RALA 4OLZL 4XC3H 3IRPX 2DLFH 4JAMA 1MHHA 5K1NA 4M4RA 3S8WA 1RKRA 3EJRA 3MRCB 2XWTB 3VG0L 4M5YL 4NQXA 5TDOA 4JZJA 1A7PH 1ZA3B 2HVKB 1F42A 1E4WL 4NZRL 5T3ZD 1Z3GL 1IZKA 1BQ5A 3ARYA 3AREC 3O8XB 2G5BA 1CD8A 2DAVA 4WI0A 3VXPB 4FA8A 2XWDA 3QDMD 5CCGE 3P30H 3AG1B 4RFOH 1HU8A 3Q2CA 1BQKA 3C8HA 4JFEE 3B2XA 4AL8H 4IU3A 3BJLA 1U3HB 1AGEB 3H3BC 1H5BA 3OR7B 4Q89A 3QRGL 1YPZE 1DJZA 5EOQH 3WDIA 3IK2A 1DZBA 4X6CF 1U8OA 1Q9WB 1S9XA 1YHPA 2HLFD 2Y7QA 4MCYA 2WBJD 4X4ZA 3FRUB 1WCBB 1R24A 2CXKA 5DGQA 3SO3C 3QIUA 4ZMLA 1HHHA 4FTDA 4I87A 4TSBL 3TIEB 5SWZA 4KDTC 4LLQA 3JV6B 3C5JB 5DZJA 4N26A 4MJIE 2Z92A 3WS6C 2XWXA 2QGCA 2YPVL 1QWNA 1E4KA 3BFQG 4H26B 4QRPE 2CDGB 1NDGB 3FSAA 3NSDA 4Y5VB 4KX7A 4ZFQA 3ARDC 1RLWA 2Q2EB 3FU9A 4NZUH 1UG9A 1DBJL 1MCFA 2BIHA 3UPRB 4NAJA 1EDYA 3U2SA 4B9KC 1R3JB 4ZX5A 3ZKMC 3NN8B 2NZIA 2BJMH 5LCVL 4JFEB 1ILUA 1NTDA 1SZNA 2DQCH 5C0RL 2XV6B 2FB4L 2AKRB 2PO6C 2F2HA 4UV4L 1A6VL 5EA0H 1IC7L 4U7KA 3NRQA 1I53A 3UTQA 1ZA6B 3VXQA 2W38A 4WW1A 5J1AB 3L7FA 3H2QA 1ZMYA 4WENB 4ZUSB 4CSPA 2C1OB 4KI5F 5AOIA 1IAIL 2NX5E 2X4PB 2C4XA 3OTTA 3PWLA 4HISA 5GGTH 4K8RH 1CIDA 5LGJA 2D4DA 1J86A 1SEQL 2JJVA 2VZUA 2J44A 1C9SA 4A6YA 2N1TE 3X12A 4W6YB 3SGJC 4I1PA 3QIUB 2ZYHA 1HK6A 1KB5H 2J8UF 3R06A 4R7VA 2OYLA 4MX7A 1F00I 5AEAA 2X0VA 1R0AL 3AADB 4PG2A 3I6LD 2R1YA 1BDYA 2NNCA 3DUUA 3CIAA 3NJGA 4N20A 4PJAA 3RDTC 1DEDA 5ESVA 1NKOA 3EH2A 1H15A 3V6FB 1U0QA 3AS3A 1AD9B 2VXQL 4YDMA 3TO2A 1T3FA 5ERWA 1PGRB 2WBJA 3HPJB 1ET5A 2NCEA 3Q43A 3S98A 3LH9A 1JBJA 2KS0A 1EUUA 1GTNA 3P3YA 3TCLA 2YRBA 4H20L 4HKXA 3U46B 3LQMA 1P4IH 3IKCB 1C8QA 4KRMB 4AKQA 5KBNC 3FUNA 4GIAA 3TNNB 2FTAA 1YQVL 4F91B 5CEZD 2PKDA 3RY6A 2PABA 4WJ5A 5HYSB 3AVEA 2JWYA 1U8HA 5B3SB 3O6MH 3VWJB 5BJTA 4XCCH 2MQCA 3QAZB 3T2LA 2BRRH 4APQD 5JOEA 1RHHB 3T6QC 1LO2L 3PWPD 3UMNA 4AGPA 5JW5A 4TRPH 3UTQB 3BUBA 3BXNB 4LVNB 1J5HA 1BQRA 1FN4A 4J4PA 2KPNA 2YKKA 1B0WA 2QHLA 3V0VB 4BKTC 3MLTB 1LWHA 4LZKA 4UDUB 3DECA 4L37B 2ZCKH 4Q14A 4XHJD 5TH2A 1WEJH 3E0GA 5AB1A 1H6FA 5CINL 5GZOA 3WNJA 1FL3B 3ZO9A 5BXFA 4JPQA 3U4BL 4RGNE 4YMPA 1NDTA 4H5SB 4GRLA 4XCNB 4F3FA 4Q52A 4PGDA 4BXVA 1CZ8H 3GSXB 4L5FE 3ZRCC 3VFSA 15C8L 2WO2B 3L9RA 4QTIL 4XODA 3S5ZA 4UAOC 4DP2X 5LAPA 3EDEA 5H37G 4QHLA 2VDQL 2IH8A 1O6SB 4B0MB 1JTOA 3U7YL 5KSBE 4IW4C 5D7HA 3TCXA 3NCYS 2PPDA 3VFMA 2XETA 4OIBA 3UZQA 5MERB 1TQUA 2GJZA 5ERWB 4QF1A 3SBWC 4GP4B 1AC0A 3X11A 1MI5D 3OQ3B 5D1ZI 4P3CL 1WP6A 3DJ9A 1A0QL 3L3DA 4N2LA 2R9HC 1M71A 2VMJA 4JFQB 4XN7A 4JFDE 2CRIA 2EDJA 1H19A 2VDRB 2AEPL 2IWGA 1I1FA 1JXDA 4ONGH 3RUGF 3WE6A 3OZLA 3T3PB 5B4MD 2EDEA 4IDJH 3EYVA 3KH3A 4Z7VE 2Q87A 4ZMWA 3N91A 4N2GA 3RBSA 2W92A 1GYAA 2FWLB 4UOJA 5DA0B 3R18A 4LBEB 4LVEA 2EYRA 1RZ7H 5E6YA 3ZE0F 4A38A 2LVEA 3AGWA 3BD5A 3T4AB 4HIXH 3BH4A 3TBSA 4AMKL 2F53B 5AQ0A 1GR7A 4BH8A 2SODB 4GRLB 3HFMH 3CFEA 1BPVA 1TO5A 1G4MA 2AZAA 3KPRA 3QSKB 2HUHA 3U48A 1ASPA 2LU3A 1BGXL 1HNGA 2ZKHL 3TVMC 5C0FB 1YN7A 5C0AD 3FPXA 3VH8A 1FBIL 4NCC2 3CBJB 3QR2A 4GKNA 1Z9LA 3GC3A 1KYUA 1L9RA 4N2BA 4PLNC 2LR4A 1TZGH 3FTXA 4ODBD 5DFAA 2WMPB 3IPBA 5FHAH 3QDMA 3VA2C 4GAJH 3APFA 3MTXA 4M1GH 4DKEH 4FEIA 3V5DB 2X3AA 5BV7L 5FYJD 5FYJL 5I0DA 3L3HB 3D2UB 1ZSDA 2YWYA 2YD0A 3F85A 9CGTA 3I6SA 2XWBB 2G75B 1KDIA 1VPOH 3L2NA 5I1DB 5JMOC 3V6ZA 2BW5A 4X7SL 5F9OL 4WI7A 1CICD 1HKLH 2GUOB 3ISWA 3QXAA 4RQQB 8CGTA 1EJOL 4W9DC 2GFBA 5AVTB 4DK3A 4XC3L 2HA1A 1JTPA 2J8UA 2JH2A 2VSCA 3PAVA 2ITFA 5IBTH 4WEUD 4G6MH 3U9UA 5DVLA 4ZXBD 3A67L 1GZQA 2C4FT 3FYEB 3UTTE 3QFDA 1XCQB 2X05A 3QHZL 3X1GA 4AY0A 3F3HA 1HQRA 3RVTD 1IM3A 4NB7A 4GKOA 4ANUA 3H3PH 4PJ9D 2OTPA 2FSDA 1FJ1B 2QGBA 3Q5OA 3V5KB 5ESQA 3EOAA 1QFUH 2ID5A 3MRGA 5EU5A 4RFOL 1RZKC 5D1QE 2CHXA 4FJYA 2XCMC 5I1LB 5LKNA 1CTNA 2AHIA 2FD6H 2Z91B 4QRRA 3CUPB 1WISA 1DJIA 4R2GC 1INQB 43C9A 3T8VA 2XYCA 1UQSB 2Y5QA 3M7OA 4QRPA 3VXOB 3ZE0B 4KKLD 5FYJE 4F9LC 3IDUA 4I18C 4OF5A 2WYZA 4AZ8B 1AQMA 3HI1A 2XKUA 5FYLE 3CPLB 1UA6L 4ZYKB 4G8EA 4K9EH 3L3JB 3OJ2C 4WW1B 4URKA 2WCGA 1NCOA 1CFBA 3M7FB 4JO1H 1NPJA 2H41A 4RMVA 5CGYC 5D96B 5DJXA 5C2BL 1H3VA 1WA2X 4JPVL 3NIGF 1TJIL 1MF2H 3C2AL 3AU1A 1PL3A 3B2UD 2B2XL 4HG4J 2F5AH 5BRZD 3UCQA 4JMXA 1A6WL 2D8KA 3ARUA 4HJGA 3ZY7A 1RIVL 3LH8A 1HINH 1Z5LB 4KI5D 1HSAA 4AK1A 4GUQA 5B38B 3ZE2F 3BAXA 2FECL 4YHMH 3S8GB 1DBJH 3P2TA 2P5EB 2QPUA 1JCVA 4GRMA 5AL8A 5C0BD 1SOKA 4ZI8A 3GZKA 3K5RA 1VAHA 2NR6A 1D5MB 1AIZA 5G5DB 3FONA 2Y06L 5E1GA 2BP5M 1MDAA 5IMKB 4A7UA 4TNWK 4FFVD 2RD0A 4GSUA 1I8LC 1IC7H 5I28A 5TF1L 4LCWA 4MYWB 2J20A 4P5TA 5HGBB 5TDNA 3FZUD 3G08A 2ERJB 4S10A 5AOKA 1NEPA 1MH5B 2GTQA 1VADB 5FDWB 2Z31D 4IGBD 4KJPD 4JY5H 4U31A 3GJFH 4Y1AA 3ULVH 1W8NA 2NY3B 2WJ5A 1FRGL 1OAZL 3GSVB 3QCUL 2X12A 2C3GA 2I60H 3S5LG 1YEHH 2WNWA 5I75C 2Q86B 4P5KB 4NQEE 2A9AA 4KKPA 4PI0A 1BLNB 1SNRA 3LIZH 1U92B 1E30A 4FQLH 5MENA 3LZFL 4GAAA 4EI5C 3OKKB 3OMZA 4TQEL 7FABL 1AHWA 5C0BA 4FRWA 2LLNA 4F80A 1KTRL 1HXMA 1VF5C 2DQJH 2XWJB 4RGMB 5E8DL 5GGTA 1AIFA 3SCMD 1IT9L 1F6LL 2CCLA 4PP2A 5D6CA 1Z5LA 4HWEH 5E4EB 5FA4B 1IBGL 3FU0A 3O6LL 5AZEL 4IYKA 2AFNA 4MDJA 2ZOLB 4A6YL 1P84K 5T1JA 3C6SA 4JPKL 4IRZH 1OKEA 4ZS7L 3NCYP 1KBBA 1TT6A 4PHXA 2Z8SA 5LDUA 3KGUA 5DTFB 2I9LB 1C08A 3MU3A 2E27H 3BZFA 3WN5B 2CKBB 2CIIA 1JZ6A 5AAPA 3NCBB 4J28A 4PJXB 1PJWA 1N5AA 2PXYB 1NFIA 4WDIB 3MJ9H 4Z3FA 5ACZA 3VB9A 5FFLA 4ODHL 1IFRA 4NQCE 3V7MA 3FCTB 1JD9A 3RWCB 3BC9A 5DDHA 1JWUB 4LCWD 5KTEH 2OL3B 4F15C 3MREB 1S9VB 5I18L 2ETWA 2PP7A 1QRNA 1UUNA 2IFFH 3BD3A 2OP4L 3T3MB 2V7HB 3IM1A 2AXFA 3MV7B 3EBGA 4FQCH 4Y1SA 4JO8A 3TM6A 2NR6D 1KXHA 2NXZC 2PCFB 1GGBH 3VA6A 4H0GA 1TMQA 3PHAA 1A66A 5FA3B 5E6IC 1QBAA 4YHNA 4ZJ9A 1I9JH 3CZLA 4MVBD 3MJGX 1WFJA 2C5DC 2H9GA 4RDQF 4HS3B 2TRHA 1T6WA 2APXA 5C6PB 3HC4H 1TETL 3ZHLA 1UB6B 3VGBA 4QNPE 3P4NA 1D7CA 4XNDA 2WN3A 1KN2H 1SBSL 4U2YA 4DKFH 2JCWA 2DV6A 2X4UB 4FNLL 4UT9H 3RB5A 3VG9C 1AOZA 4J6RL 4NQDB 2EEXA 3VX0A 5I76B 5J11C 4JPIA 1IILE 1TTGA 4BSVB 1WWCA 1KCRL 2BP8B 1GOGA 4Z7VF 5L9DL 4I77L 2WSKA 2ZWYA 5J0BA 1I4FA 2JB6A 2F61A 4DUVA 1P53A 4WI5A 4GW5B 3VD4A 1B4TA 1XR9B 2YLKA 3FN3A 1ZJAA 2XQYA 3INOA 3L81A 4M6MH 1NCHA 3PAUA 3FAWA 4XT1C 3WO4C 1NCDH 4XI5C 5HYEA 1IIIA 2P45B 3PPSA 1C12B 1UZ6E 3KPRD 4AQAB 4J3UA 2VTFA 4QF1B 4WVRA 5CAYB 4EUPA 1DVYA 3G6AB 4NN7C 2J25A 2WP3O 5IT2L 4B9FA 5FW7A 1SYSA 4QHNB 5DRXA 3UP6A 3BQUA 4PJ8A 4E9RA 3DIFB 4LGRB 5LN8A 3HC2A 2OR9H 2ZPKL 3FCBA 4PRIB 3QA3B 4DZBB 2GVYA 4NZ8A 1P4BH 2E9WA 4OGAD 1H6UA 2GAZB 4PCSA 1RULL 4X7TB 1FG2A 2VMFA 5K5YA 4PWJA 3GJFB 4YZFE 1N3NA 5F7FA 2MCG1 4WCYL 3QNXB 1CCZA 1MY5A 1ORSA 2WB1A 3NP3A 3V6OC 1TVHB 2WXPA 4DZ8B 4LCCB 1UJ3B 3BGFB 4Z7AA 3R8BB 2AJUH 5FEBA 4FFYL 1OTUD 1FFNB 2UZYB 3H0TA 3FXIC 4G8FB 2WXKA 1R47A 5GS1A 5BW7C 3NFSH 2VCOA 3TO4D 4URTB 1GL4B 2D7TH 1DVFB 1DL7H 1FF5A 2CO6A 4L3EA 4B6ZA 2CJUL 2HX8A 2NY7H 3VAEA 1HYSD 5E2WL 5HSFA 3MLRH 4LIQE 4GQRA 4JM4L 3AITA 4BK5A 1B9KA 2VDRH 3NIFB 1RUKH 4TSAH 1NFDB 4HAFA 2IAMB 3FU3A 4N90E 4LLMA 1XSOA 1ZLSH 1BJMA 2VL5B 5DFVD 4LEOB 4IRJD 4NI3A 1V7MH 2Y6SC 4OF3A 2DWDB 3OHMB 2Q7AA 4J3VA 1MCWW 3CFBB 3FW6A 3QHTC 1MEXL 1I3VA 1TPXB 1SGKA 1AI1L 2ZOTA 2HH0L 5CFAA 1QP1A 2QDWA 4HK0B 2AVFA 4POUB 2EXYD 3PABB 3SPVA 2E7DA 1JPTH 4XO9A 2OQJA 4GSRA 2H32H 3HS0C 2N56A 1NSNH 1F3JB 4IMLA 3RGVD 3P4OB 4MJ5A 5F7EL 2ZCLH 2O5XL 3AY4C 2K78A 3OXSB 4H8VA 5TK4A 4OD3L 4HGMA 1E67A 3BPNC 1P7KB 2OXHB 1MLBB 3S35X 4HUVB 4WU7A 4OD1L 4M3KB 2X28A 2MKWA 1FVCA 2RCSH 3ZQWA 4WI3A 5EBMB 3PGCA 1IKFH 2YBRB 2QADC 3TN0C 2HUEA 3UG5A 4Y5YC 1SXZA 3NESA 5GGVL 1NC2D 1V3JA 2FT7A 2A9MH 5JDJA 1ZXQA 5DEGA 4UQIM 5BV7C 5J6HA 5IQNA 3T0WA 1J9SA 1TENA 2R39A 12E8L 1UM6H 4JVPA 4O02L 2F54D 4DERA 1D5IL 4R26L 2CNZA 4LP5A 3TLRA 3MBWB 2H2PC 2EE0A 3H2PA 4HHAB 1X5FA 5IMOB 4JO2H 3O45B 5IJDC 3MACH 3UFIA 3T3MF 5CLWA 2D9QB 1B2WH 3KWWB 3VXMD 2D0FA 1XO8A 3MJ6A 5ID1B 4YBHA 4J23A 4Y1AE 4DEWA 4I9WD 3KL3A 3U2JA 4L4TA 4CVZB 2QMJA 4N9OB 3RP1A 2RBLA 1ONQB 3FTVA 4MAYA 2D03H 2HTKC 1LP9B 3HZKB 1ZV9A 2XX1A 2E76C 5K9JH 3QIWC 1E43A 2HG5B 4LP4A 2EABA 4PRPB 5C0BE 5BS0A 5J1SC 1N5YL 3QQ4B 3T1FB 1F97A 1J11A 3C08L 1MCSA 4K7PX 5T1MA 4P2QD 5KS9A 4KVCL 4OIIH 4F57H 5ETUA 3ZKSD 3CDZA 2R56H 3NSCA 2I60L 4KO5A 3FF8A 3QG6A 4UDTB 5T1MB 3O4LD 1AQ8A 1D7DA 5F70A 2DH2A 4YSAA 3OJDB 4WWNA 3M6DA 4X6CE 4O4YL 1L9QA 2E7BA 4TVPE 2HRPL 1UWXK 4LSSH 5I6PA 1AR2A 2AMUA 4N2DA 4FQ1L 2C9XA 1DFBL 1L9MA 4KQ3L 3MLUH 3GMOB 1FGNH 1OGPA 4HWEL 5GZNA 4NHCH 3SDCD 1UXWB 2CHZA 1IBGH 2J8HA 2YD9A 1IRAY 5FOBA 3SPCA 5TQ2H 3TYGH 4EJ1C 1CFSA 3WD5H 3MNDA 5IMOA 2NRDA 3SDDB 4PV1C 1EHKB 3PL6D 1R5WB 4B3EA 4HPYH 1NCNA 2Y25A 4JE0A 3K91A 4XC1L 3WNOA 3QIUD 5AKTA 4KKBD 3UGEA 3WSQH 4WWKA 4QI3A 5FUOH 4ELMA 3HJ0A 4A2EA 5C0AB 3D50A 5CD5C 4WHCA 2R1WA 3N55A 2Y3NA 3P0VH 1PDKA 3HBGA 5JW4N 3HVNA 4HX1A 4F8PA 1Q0XL 1ROCA 1PIFA 5AVQB 2P46B 5IHUH 4P9MH 2CR3A 4TVPD 4JFXA 1OP3H 5BQDA 4JFPB 2HFEA 4XMWA 1QLFB 1PSKH 4XB8A 5E95B 3H4FA 4Y9FA 3U9PH 3ASWA 1OPOA 2LT9A 3TBBA 2GC4C 3QDAA 3SQOL 4Z7WA 2EE2A 4XCYB 5CEZH 3HRZB 3VD2A 1YCSA 4P59L 1S46A 4H0HB 3SE4A 4KKRA 4MMXB 3UBHA 1Z6JT 2F74A 5BUPA 1CICC 2VLJE 4AXWA 5DD6A 3ESPA 4WKZA 1NBCA 2VZVA 4X50A 4NENB 2J21A 3KL0A 3BISA 3DXAD 4ISVB 1GW0A 4JDTH 2X1QA 1O7DE 3N5AA 3PIQA 5F88A 2ILLA 5C0ND 2FE0A 3TBCA 3QC6X 4W4OC 5CZRA 5F6HJ 1K6QH 5K39A 2QHRH 1AGDB 3ARTA 3CSPA 4FQ2H 4HIJB 2XLLA 5J9PB 5DHVB 3ARGD 3LRMA 4HGWB 3O41B 3EOYG 4GKZB 4UUJB 3WAKA 1AHMA 1OW0A 2C9QA 4HC1L 3ES6A 2VN5A 3SN6N 2JB5H 1YECL 4HJEA 1TQCC 1W72L 2OMNA 5FB8B 1AGEA 1N0XL 2EDNA 5I26A 4KHTH 4KJQD 2H3XC 2VT0A 3M17B 4Y19A 2PWGA 4JLRA 1H6TA 1VB9A 2NUTA 3QH3B 1JPEA 3BSZA 4XCFH 2HFFB 2DBLL 3EYFB 4TVPL 4BCYA 1WZ1H 5CD3A 2B39A 3ROOA 1T03L 5KYXA 2YQBA 1W16A 2E8YA 4KK9D 1Y18A 1TXKA 2JSFA 3DVNB 3QJFA 1RP8A 2UZXB 3NH7L 1JFQH 3BEVB 4RRPA 5HY9B 5IEHA 1FLTX 2YAPA 1O6TA 5GGSB 1LQBC 5H35B 3UTTD 2GBVA 3IFNL 1JDAA 2ZPKH 2X41A 2BIPA 4GYBA 2NT1A 3FL7A 2K4WA 2YK1H 5C08B 3HR6A 1EO8L 3B8SA 5FYKU 3WKPA 2PXYA 1EBAA 1A3RH 1Y07A 2I7SA 3TJPA 2WAHA 4OAWA 4FULA 5FYKH 3GIZL 3MUJA 3K71A 4NYLA 5AENA 2J1ZA 3KLDA 3VXRD 5C0JB 2ED6A 3BZ4A 4U7MA 4K7PL 4MNQD 3NMEA 4Y4KB 3NG5A 2H2SD 3SDYL 2APVA 3X2QB 4NRYA 1BG9A 3F7VA 3REVA 2AABH 1QKZL 3DNKA 1BZ9B 4NRZB 2CJUH 2EDYA 3LSOA 3VFUB 2BXYA 5C0CB 4H25A 1Q90A 2CJSA 1BEYH 1V3MA 3MJWA 5HGHA 3NTCH 5I17B 2X6UA 1O9WA 2YC1A 4CSZA 1EHLL 5AVSB 5INDA 2AXHA 3QEHA 4YK4C 4QRUB 3FRUA 5KBLA 2I85A 5E5MA 1ZV2A 4JFZH 3VFWB 2WGXA 5E8PB 1EHAA 3AB0C 3LB6C 4XPHH 4PRPE 2I9TB 2VR4A 2AK1H 3K2IA 2AVGA 3C5SA 1DVFA 4L3EB 4TVUA 2BSDA 3UERA 2GITA 2HH0H 3NJVA 2AQPA 3MV8E 4FL4C 4MZRA 3TZVD 4W1TA 5H94B 3R0NA 4FXGC 5IFHL 3GK8L 4AENB 5B4MC 4R84A 3ZX1A 1GGIH 4ZUWB 3CWGA 1Q9LB 3PQYE 2AQSA 5DI8B 3H9HB 4I5BB 2UYLA 1SMOA 3QARA 1JZ5A 2P80D 4UQEA 1HHIB 5FV1L 3K1KC 5KANG 1ZSDB 3WS3B 1DUYB 5FO8B 5FV2A 2ZCLL 3ULSB 1G9NH 3BSHA 5EZOL 5I8CB 4XNYH 1WBXB 4RFNB 2UYLB 3QI9C 4XVTL 5C0IA 1JUFA 5JW4R 4PWFA 4BKLA 3WO3B 2HJLA 4I1NB 5C9KA 4KRLB 2N0KA 4WUUA 5IK3A 3ZT5A 3MRIB 1YNKH 3PJLA 1SRDA 4PJCE 2NNAA 5FFGA 2AKRA 1KGXA 4HJIA 4NO0A 3IRCA 5CJQL 5F9JB 2FCBA 4HKJA 3G5VA 1D9KC 3WTXA 1C5BH 3GO1H 3RPBA 4R4BA 1GXEA 1I1AA 1HHGB 1G6RA 5HYQB 3TGXA 4RAVB 3ZMNA 2E9IA 3P4OA 2YRZA 1V27A 4FTVE 2H6OA 4M93C 3BMWA 4BSWA 3CMOL 1GHFH 5DHEA 2GJJA 1GY2A 2R0WH 4RAHA 1ACCA 3RTQB 5I1AA 2AQQA 4PJHF 5DT1H 1M53A 3RG1C 1YLBB 1E4XH 3EZ8A 4W9FC 3BAEL 4G7QB 4KV5E 3T6ZA 5KN5B 1GYWA 5F0PB 1Q9OA 2H6PB 1OAQH 2UZXA 5CSGA 5ALBL 2OTWB 4LASH 1IC5L 2QVKA 4QRPB 3VXOA 3E6HB 3MA9H 4KXAA 4MNQB 5EPMB 5IVOA 4WW2C 4MVBC 4OKVB 3S35H 3SCMA 4CU8A 1RZIB 5E7BA 5CCJA 1GPOH 3I75A 3MOQA 3KNBA 4M29A 3DPDA 3GINA 5IF0B 4BQBA 1FNEA 4X6CB 3MDJA 4WHYG 3PY9A 4NC2B 2VDPH 4CBZA 4XP9H 5KSVA 3ESNA 3DBSA 3RB7A 3EOTH 4DN4L 3FUDA 2MOVA 3O2DH 1EEYA 4HSQA 4OZIA 4GMSH 1MAKA 4N2EA 1PY0A 4V11A 2PYED 3LV3A 3PNWB 1IM9B 1EAPB 1TPXC 2PF6A 1QAWA 3JWNC 3IMSA 3VI4E 1T4KB 5E8OA 2ODIA 5IVZB 5G5DA 1KENL 4KK5D 2A1WL 2WLJA 1RFDL 2ISDA 4JB9H 3LEXA 3QIBB 5JHDA 1B6DA 4HIEA 4L8SB 4UDUA 3QULB 1MJUH 2QLVB 1PD1A 4Y9EA 3QZWA 4K71B 2WPGA 5I1KH 4D8PA 3ZDYF 4DPBX 1JYVA 3S4SG 3LEVL 5F0LB 3D18B 4QHUA 1MXGA 4RBPK 3SE8H 3WSQL 1OALA 5JXAL 2OZ4L 3EYQC 1NGZB 4DOHB 1FLRL 2Y7SA 3Q13A 3FCSB 4I3SL 3P0VL 3BN9D 4PEEA 4QRQB 4C56D 4PJ5D 2Y5EA 4G8EB 4PCKA 1KIQB 1UASA 5HGAB 1GIGL 2FEEI 3EGXA 2IWKA 1OGTA 2WNKA 3ILQD 4WW2B 5LNGA 4P57A 3ULVF 3DI2B 1KJ2A 5SWSD 1WICA 5IHUL 1B3IA 1BD2B 4WGVB 5K9KB 3WNPA 1WHOA 4QLWA 1R5WA 2X42A 4FKHA 3IGAA 1NBQA 2BWQA 4HH9A 5JOFA 3AACA 4MJID 4BCZA 3RTQD 1DBKL 4ODWB 4PV9B 2WIIA 5D4JA 5IQLA 3TBTA 3ZTNL 2AJXL 4ZQTA 5CLXA 5FM5M 3IETA 5KSVB 3AY4A 1YEKH 2K7QA 3FKUS 2YMTA 2A9DA 2C7FA 3MRBA 1CLYL 4FQXB 2MOQA 4LHJB 4FZEH 1OCWH 4CMMA 4Y4KC 4TYUA 1NUGA 1WAAE 5ICZA 4IRJB 1X7QB 4NNXB 3VXRA 1HEJC 2A74C 1AHKA 1BQHB 2BVOA 3C9NA 5I1JL 4OJAA 4LCWB 4F2FA 5KVGL 5DZNA 1N8OE 1MN4A 2YIHA 1TLMA 4UQ3A 3PHQB 4HC1H 4E0RA 2DD8L 1MHPL 4B9ZA 4ZW6A 1E9OB 1IC4L 1SBBA 4ELKB 3B9KC 4WKZB 4ZMYA 3BAKA 4KU1A 5D4IA 4Z77B 1VFBB 3GSUB 4JFVA 1I3RA 2FBJL 1L9NA 2UY7B 1YDPB 5HJGA 4PWEA 2XU9A 4C4BA 3WMSA 5IW1A 3HN5A 4WW2A 3NSFA 4KXZH 4XTRC 4C83A 3QUXA 4CKVX 3CCHB 4TOYL 1LILA 5L7XL 3WY4A 5LG6A 1UGNA 3SKJL 3GHBH 1SXBA 3JWNH 4WNJA 2QQLH 5ENWA 5KAQG 5KSUA 3QO1A 1X6LA 4ZS6D 5I8EB 3MLTA 3TPUA 3LHPH 3MODL 4FAAB 3KWWA 4Q0XL 2BVPB 2CKBL 2VUYA 4GO6B 5D71L 2JCCE 4MA7H 3DX2A 3RZCC 1F2QA 2G5UA 5I19H 3VQ1C 2F53E 3U1PA 1DQMH 1IU1A 3FK3A 5C0AA 4M93B 1KFGA 3ME0A 4JFOB 4RSVA 3BI9X 3CPUA 3VFVB 3ARGA 5BZXA 4NSKA 3RU8H 1TZIA 5IW3A 1IJNA 5EWIL 4O2CA 1S7QA 4XP4H 5I66B 1LL1A 2C8NA 3BP6A 3BVNB 5D72H 1I3UA 4K7PH 4D9LL 4MKTA 1XF4A 2WBWB 1ZIAA 3P30L 3QQ3B 4K5OA 2ARJQ 1MRCL 2A74A 3D9AL 1FO0B 1OF0A 4LMQE 2Y1ZA 5DJ8A 5GRVK 5DHYA 3VQMA 2O26U 4JFQA 4CBPA 5DUML 4KNTA 4LPUA 2CUAA 3PLYA 2CCWA 3MV8A 5DFWH 2OA9A 3FYIB 2K70A 4BM7A 4JHBA 1MPAH 4NO5B 3Q5YA 1JXGA 1MCKA 1IVLA 2PCFA 5IMLA 4NO2A 1L0QA 4NUJB 4G59C 1MJ8L 3SGEH 3KPLA 4S1SL 2X4PA 5HGDB 3PWNA 5C1MB 4X9YA 4NCDA 1P9MC 4KUCF 3REVB 4DEUA 3KYMA 4UANA 3B3IA 3FO1B 4WF7A 3VXQB 1AKJD 4TXVB 1MNUL 4ES9A 3N1GC 2YUZA 4MJ6B 1A14H 1KTJA 1XT5A 2R59A 1HAUA 1LDSA 3FT0A 1UUSA 4I3RL 4YVUA 4QAWA 1BVNT 4ZUVA 1S9WA 4JFWA 2GSGB 3LVTA 5GGSY 3W2DH 1ZGLM 5D8JH 3P0YL 1VFOA 1IFHH 4HFUL 3FO9B 4WSKA 4Z8FL 3N50A 5EO0B 4ZX6A 5D1ZA 4NFBA 4YH6A 3QDJA 3C60A 2FR4A 5JPMB 3IU3A 1CGVA 4XXWC 1DYZA 3PQYD 3PXJA 1UKQA 2W0LA 3UG4A 4O02B 2Y24A 4HWZA 4AUYA 5JR1L 2MNJB 1GRWA 3Q8EA 5D9SB 5C97A 3VH8G 1MUJA 5CZVL 2XG4B 4ERSL 4KTGA 2FLRT 1MCWM 3SJVA 2YXVA 3AS1A 4AGLA 2DQFA 4ZAKD 4AL8C 4MXWL 2Y07L 3IBOA 2Z35A 1XGRA 3BPLB 2B4CH 5CIPA 4OBSA 2X53A 4AH2A 1HH6A 3KR3H 1XH3B 1L0YA 4GO8A 4LFHD 4KX9A 4BA0A 5HYJA 1T1WB 4QXGH 4YPJA 1D2PA 3P73A 1QZNA 4RISH 5F1IA 3TO4C 1KWGA 2GK0A 5C7ZA 1CLOL 3DTXB 5BS0D 3BKJH 3B6SB 5DK3A 2IALB 2XN9E 5CGTA 4OFVA 3Q3GA 2DWEA 4WFFD 2W94A 3ZUCA 3L4VA 3TIDA 4G80A 3KXFB 5DR5L 4HZLA 4YHYC 1K8DB 1LXMA 1TFPA 2VQUA 3AB0B 3D25A 4H25B 4LCCA 3U0TA 4LHUB 2B1AL 4D7BA 4KKLC 3IGKA 3QJUB 5E2UL 4JK0D 2XN0A 1OSZB 1FDLH 1F2XK 4N5ED 2I32A 3Q1EA 4HCRH 2PR4H 3EJTA 2HT4C 3SE6A 2V37A 4PJEE 4R4ND 1TZIB 3QBTB 1CBVH 2Z3FA 4OJDH 3X12B 6FABL 5KVEL 4KKAD 2DKUA 3B1TA 3GBDA 2BNQE 4Q74A 2WWMD 5A43C 4I18A 4D9RD 2DYPA 2EEFA 3MLWL 4I7ZC 1IAOB 1OE3A 3A4DA 4M8RA 35C8H 2CKBA 1MW3A 2BRRL 1C7TA 2EDWA 4RIRB 4TUKL 5CZXC 1IAKB 4MMZB 4TRPL 4B7IA 3CDFA 4P4RB 1E0OB 4K7FA 1WA0X 2EE6A 3CZFA 3CJJA 2LTQB 2V2TB 4PV8A 1KENH 4MMZA 1TQSA 2OMUA 1RFDH 1UWEH 3S5LA 4IOSD 1CXFA 4FLQA 3C5ZD 1TJGL 3L5JA 4OSUH 1PZDA 4ICWA 5DC4B 2GFBB 2YJQA 5H37H 5D2NA 4LOEA 2RJMA 2CHNA 4IOSA 4UIMA 4XO3A 4A1RA 1CZ8L 1WWAX 4N0YL 3LZPA 2RTTA 5DD5L 4X7TA 1MI5E 4OGYL 3WFCL 5DLMH 4PTUB 4XMZA 1OSEA 1W9XA 2VDQH 1C5DB 1T5XA 1IGJA 4JFDB 2BNQB 1WIUA 2FGWH 2Z93B 3IJ8A 4NZTL 3EKCA 4J3XA 4Y7MA 1JF1A 5DJDB 4U1NB 3TFBA 4HLJA 1AH1A 2A6KB 5KBPA 3PDGA 4LP8A 4TLSA 1AO7E 1XGQB 3EFOB 3CLEL 5C7XL 4OW6A 3DETD 4Y1AB 1KIRA 1O7DC 1SY6H 1A0QH 3CFUA 1RZ8B 1BSIA 4N0UB 1EVUA 1NINA 2DH3A 2DQHH 4S1QH 1KV3A 3MYZA 4C47A 3ATFA 3JTTA 4U05A 1ZHBB 1IQDA 1X44A 1TQCB 2JKXA 2NYYD 2OMVA 4NWTL 4PGBB 3VSQA 3CN1A 1KIPB 2Q7NA 1X5IA 4E9WA 3QNZB 5K59F 1XR9A 4PBXA 2APWA 3D51A 2XZAH 3VMPA 4PJHA 4L3ED 4W9HC 1FA4A 4HJSA 3BN3B 3DGDA 2HVKA 3MMEB 3BSZH 2B1OA 3OF6D 4IJTA 1UCTA 1WIPA 1OWRM 2UY6B 4I3GA 2BX5A 1OP9A 4IQHA 5E94A 4FQQA 4FLSA 3EW3B 4WY7H 3FH7A 2WOYA 2VDNH 3Q2LA 2F8OA 5DJ6B 5KVGH 2G3ZA 1BM7A 1QQDA 1LK2B 5EIQA 2GI0A 2O4EA 3V0AC 2IALA 5CZKA 2ZUXA 5AG9A 2UWEB 1Y0LB 4FQJL 1WWWX 5C0DB 2DTMH 3B9VA 4HHWA 2FBJH 1RK1B 2ARJB 5SX4I 4D9QE 5I1EL 2OJ1A 4GNKB 1T0NA 1T83C 1FH5H 1QFHA 2H0PA 4HWNA 3T1WA 1YA5A 2FZ3B 2W80C 2DJUA 3DK2A 4G6KH 2H8PB 3MQIA 3SKJH 2WLNA 4Z7OF 4R9HA 5C07A 4P23C 4Y5XC 3GSWA 1F1AA 5LBGA 1AS8A 2XXFA 1LJMA 3G9AB 4AUUA 3X3GL 3LNGA 3FCTA 1EX0A 4MASA 3UADA 4FG6D 2VM4A 3FH8A 5I1GH 4AJVA 1KGIA 3KYOA 4G5ZH 1I82A 5AKSA 4Z7QF 2IG2L 4PRIE 5EDXA 2CO7B 4BFJA 1BZDA 4ADIA 5D7KD 1QSED 1WIOA 4NQCA 3BKCH 4CVUA 5KSUB 2J6EL 3FB8A 3T6WA 1H3TA 2NUPB 3EHBD 1G7HB 4PJFF 4B60A 4HV8B 3D30A 4J3TA 2WCSA 4ZRGA 4D9LH 1CFNA 1SLWA 1YEGL 5AKRA 1ZTXE 1XGYL 2KC0A 5CKGA 1M7XA 5KW9H 2KL6A 4X9GA 3Q01A 3APDA 1RMFH 2Q8BH 3BCDA 1AIFB 4ZMTA 1NCWH 4OF6A 3RIKA 3OKOA 4U1HA 1FNLA 1RK0A 1PZ5B 4FS0A 2NTFB 1QHQA 4AQZA 1Z5HA 3VSVA 3O6FD 4JG9A 4JX0A 3QUMH 5IQ9B 3HS0B 3S96B 5KWYC 1WVZA 1EEQA 2ICEB 4NHUA 1MOEA 4FZ8L 1F3DJ 1XMWA 2X4OA 5KJRH 2BY3A 3PAZA 3FOLB 4M1CD 2HKFL 5LG1A 3HRZA 2XZCH 4FFZL 4OJFL 3NIFE 1HFUA 3IDJA 4HMEA 3TO2B 2XA8L 2VL4A 1U3YA 3B8YA 4BELD 1G6RL 1CQYA 5SX5K 3WUWB 2G60H 4QJ5B 4WHYH 3IGLA 4U6VL 1M3IA 1DVZA 4Y4FD 4DGWC 3TF4A 1HSBA 4LT7A 5HHNA 1KB3A 1J8HB 4X4MA 2KBGA 2YD4A 3OHXB 1T1XB 2IOMA 4ELMF 3MNVA 1JXKA 2NZ9D 4GW1A 5JIDA 3D4ZA 4M61A 2V7HA 3EH1A 4UI2A 3V4VL 1H5BC 3FTSA 4N5EC 1BBJA 4JREB 4MA8H 4Y4HD 4GUPA 4MQ7A 2NPLX 3VDBA 2HLAB 4NKMB 4ZUTB 5SV4A 1NOLA 3L4UA 1FV1B 4ZNEE 1KC5H 5ABDE 4NUQA 1VEMA 1A6VH 1ZT7A 3H3KA 5DJ0A 5SWSA 2P5WB 1J0HA 3HVDA 3UP1A 5JDSB 3TH2T 2WLMA 3QH3A 3RVWD 2EEBA 3E2HB 3BPCA 5JR1H 4L37A 4YHKH 1Y0LA 2WJ7A 1UWYA 4JKNA 2K45A 4X4KA 4EUPG 3O3DA 4IRZA 3MRBB 1U95B 2VDLH 4OFYD 4XRCA 3EJJX 2YPKB 2J6EA 3BT2L 3I3DA 5GIRB 4LXFA 4BEIA 1V54B 1R3KB 2IANB 5D7SH 1G87A 3QCVL 2BZ7A 1OGAB 4KQ4H 1TLKA 1NIEA 4G72B 1KGJA 2ESVA 3WDHA 2YFOA 3SIKA 2FJFA 1U4EA 4NKIL 4KNUA 1UH2A 3QXUA 3SKNA 3N1MC 4PPTA 4QRRB 1FH2A 2JF1A 5D2LF 1RH8A 3V7AG 3N43B 1IGML 3PCYA 2R15A 3LS5L 2FO1A 5TQ0H 5T3ZL 4RFEB 1U9KA 4JQVA 4OF8A 1PNDA 3EH5B 1KT2A 4HS8L 4J3OH 2XPYA 4PIRF 3L17A 3LX9A 4Z7UA 5AW4B 2R69A 1X5GA 2OULB 4JFFD 5AFAA 3ATDA 4ALAL 5F1IB 4DP0X 4GRWH 4WI2A 4BUGA 1K8IB 5HI3D 1UD5A 3QI9A 4EI0A 1AXSB 1ZT7B 5DJ0B 4TUOA 3HHRB 1OCCB 4PJBB 3MROA 2AQTA 2GHWB 4DZ8A 5L4IA 5I1KL 1ZE3C 1KYOJ 2VO8A 1IGJB 1ZDSA 1HQ4A 1ETA1 5TE7H 3BHBB 1YO4A 3T9WA 2TSAA 4XBEH 1QPKA 4K3DL 2JJWA 5KTEL 1X9UA 3KJ4B 2A0LC 3GSRA 3V0IA 3U7AA 1NKGA 2P5EA 3IMVA 2X1OA 4YGVA 1E50A 1KF9B 3Q6FB 3QI9D 2YBRA 4RX4A 1FYTD 4H8UA 1LO0H 4KTDH 3GMQA 3RVUC 4BA8A 2J5WA 4Z7VB 5C0EB 1MKFA 2XN1A 2I5YH 5IB1A 5E8EA 4AVIA 5IBUB 5GS0H 5EORL 2R9HD 5CILH 5AB2A 2DQTL 4W81A 1BCIA 2BO0A 4U1JB 4Y2LA 1C5CL 4BHUA 5HD8D 4GT7A 4N0YH 4U6HB 3VRJA 4GIOA 1J8HA 3KYNB 4TTDC 1BQUA 4EBQH 4F1ZA 1GW6A 4HCRA 4A39A 1QHPA 2YLHA 5DZ9A 5AVUB 3HC4L 4JO3L 5DHVH 4WU5A 3VFOB 1NAML 4ADJA 5J13B 4NJ9H 5JW4M 2AV7A 3F7QA 4PREB 4KKQA 1JZDC 1DEEB 1SF5A 2NY5H 4Z7UF 4AV0A 3HHSB 5DHMC 5K39B 1HIML 2DDQH 2RR3A 1E40A 1MHEB 4D0DB 2EYSA 2NLJA 1S7RB 5C0BB 5AW2B 4WSGA 3OKMA 4OZ4A 3CHPA 4P3CH 4UBDD 4S1QL 2WW8A 1BZ7B 1SPDA 2FUTA 3WIIL 2HG0A 4ZFFB 2EYSB 1IGIL 1BA9A 3N43F 3GS4A 2NDGA 3FQTB 3LRGA 5MI0C 4ICXA 3AFLA 1YN6A 2ALAA 3CFCH 2F08A 4WJKB 6PCYA 3SDAC 5EFIA 2FNWA 4LLWB 3KPPA 3BRGC 1R19A 5F8RC 3WXWH 1HQRB 1DUZA 1Q1JL 1I1CA 3IJEA 1NMBH 1T6VN 4PLKC 2DEXX 5D1ZC 2JFCA 1P69B 3WKYA 4XRCB 2CM5A 3L1FA 1NCCL 1NIFA 4ZMOA 2F7RA 1JD7A 4NQED 1IX2A 1MELA 1R3IL 5KS9E 1Q9KA 4MX7B 4WTWA 3M45A 3IB4A 3WY3A 1F4AA 3D85A 3MVSA 1FL5A 1ZA3A 2FJUB 3QDGE 4LOUD 2CGZA 3KBPA 3VACA 3W57A 2GK2A 2GB2A 4FQJH 1KJ2B 4GS7C 5KOVC 2DTML 2PPEA 4KFZC 3QUMA 5A2JH 2L7JA 1T7VA 2LFGA 3CVBA 4ZFZA 4OQTH 4K3EH 4BFGA 4AVHA 1XF5B 4Q9BA 4E9YA 1KYDA 4PRIA 3OLDA 2VLKD 1HJCA 4PJ9C 4L3CA 4A7VA 3QC5X 4PJ9A 3TTSA 5BV7H 3QUHA 1VKXB 1WS7A 3QI9B 2IGTA 3L4WA 3NK4A 3NFPB 2AJSL 3T2NL 3UTSE 3WKNA 5ID0A 3MLZH 4HWBL 1ZJBA 5HDBF 4FXGA 3B56A 3DROB 3HS0A 3S96A 3X1FA 4ZTEA 2FO4B 1BFTA 1F3JA 1GSKA 4HP5A 4OGQC 5F3FA 1EJOH 5GGQH 5D70L 2CXGA 1DSFH 4ELME 5DRZB 2PPFA 4PWHA 1A6TB 4ONHA 3MC0A 2C1PA 3OJVC 4RBPH 1BD2E 4G6ML 4ISVA 4E0RB 5I2IB 5FR3A 2H6PA 1MFMA 4GRWE 5AG8A 1MJJA 4YE0A 3EOAB 1IE5A 2ENPA 5MEPB 5EOCL 1PLCA 5EN2B 5T5NF 4UINH 1HHJB 1QNIA 4DO6A 2QMKA 2XV0A 2BS71 2Q3XA 4MAZA 2VSKB 5CLZA 2Z4QA 4YDLB 2I07B 5CU5A 1OAUL 4AE1A 1A4KA 4A7GF 1UM5L 1IL1A 2LABA 3G6JF 5ANMA 3IJYB 1HEZB 4HS6B 5AW0B 1BVLA 1LMIA 3UO1H 2AGJH 4DPCX 3FN0L 3MV9A 4LNRB 4TF4A 5GXBB 3OC8A 4ODWA 2ALWA 1E5ZA 5I1HH 4U3XA 4YSTA 2ERJC 4M43H 3L48A 1LD9B 1XEDA 4U2ZA 4D94A 4LRIA 1ADQA 4WWKB 3P3TA 2P8LB 5HVHC 3QJFB 4GAGH 4O02H 1TJIH 2E6PA 2PWDA 3QS2A 3Q9PA 4XZUA 4DEPC 4ZNEA 4NNYB 2HX9A 2XTLA 2NNFA 4IOFD 1MHCA 2ATKA 3SOBL 3L8QA 4NN6C 5MEOB 3IFOB 4Y19E 2DIAA 3SOTA 4LKXB 3WHE1 2CIIB 1B9ZA 5T8IA 5GS0D 5L88L 1MJ7H 4PS4L 3FB7A 3S34H 1AQDA 1E9QB 1ZOXA 3RGBA 2EJ1A 4U1IA 4FYQA 1RUML 2PMZA 5L2KB 3OJMB 1NWPA 4HVBA 2QVFB 4LSPH 1URLA 2COQA 4R7DA 2UY7A 4LSUH 4PSPA 1U21A 5FO9A 1S7TA 2A6DA 4XO8A 4S11A 1IAIM 4NQTA 1JHLH 4XNMB 4DIXA 2PETA 5KVFE 2XIIA 1WZLA 1PZBA 1JSYA 1K4CB 3EYOB 3CX5K 2WQXA 4R5TA 1T0MA 4XNXH 3ULVL 1LP9E 2EZ0C 3JZYA 3LRKA 3QJTB 4B9YA 1OAZH 3ATEA 1VENA 3BT2H 4U1LA 4G2AA 4ZO6A 1KXQE 1CDBA 2BW4A 3HZKA 4OZGF 1NA8A 1HAWA 5DF0A 3P3SA 3IMRA 1TTCA 4LKCB 4FFZA 3RI5F 4XE5B 4FTVD 4J3OD 3TZVC 4KBPA 2FWOB 4I89A 3MCKB 5KOMC 4TNVK 3GSOB 3AG2B 3QFJA 4HUXA 4WJG3 2J5LC 2OI9C 4N2KA 3RY4A 1T0PB 3T71A 3QZNA 1YMMD 4FN0A 4JJ5A 1IGFH 4LEEA 1E3FA 2HVBA 1AFVH 5CUSL 5EO1A 3SGDI 2DLTA 4HG4K 1LMKA 1E6OL 1NC4D 4AYEC 1CG9A 2XKNB 1RJZA 4LSTL 4C54A 1OTTC 2ZAIA 4I13B 1GZHC 3O11A 3ZTJH 2JJTA 4OV6F 1HVXA 5HYJD 3ZR5A 5INCB 3ZOAA 1FL6A 3I84A 4AITA 3US0A 5J6HB 4OD2A 2NQDA 5MHSE 2F19L 3I2CH 3GUFA 1S7TB 2A6DB 2MCMA 1OM9A 5GS2D 5T1LA 3VE0B 1FCGA 1LEGA 5TE7L 2L7UA 5ES4B 2XVKA 3BAWA 1EZLA 3DRQA 3TJHC 5DUJA 4CADA 4R8WH 1CE6A 2ZUQB 5FGSA 2MHAA 2FIRT 3BIAX 5GGRB 5JLZA 1JCKA 1D6EA 2JKSA 4J2QA 4ZSOE 3T0XA 2OP4H 3PQYA 2FHCA 3GZOA 1JV2A 3A6OA 5ITFB 3CPLA 5CXPA 3OG6B 1K2DB 1S5HA 2DYRB 2W95A 3CX2A 3VWKC 3U0PA 2E7CA 1IEBB 4NRXA 3B7TA 2F15A 2P8PB 3MV9D 5EU6A 3IXTB 3DSFL 2GJPA 5FUCE 5T1KA 5T3XH 4DT2A 4X5WA 2AI0H 3IT8D 4L5FH 3UPCA 3US1A 2XIDA 1JGUL 1OSZA 2J3SA 5IFJB 2QFRA 1EJ8A 2YAOA 4OQTA 4H88H 5GSVB 5I8KL 3RZCA 5IJVB 5EUKB 1P5VB 2FYYA 3QUKA 4K94L 1TEYA 3RWDB 3JWDL 1LEKB 2VLLA 3D05A 3EBAA 2OL3L 2OMWA 4FQ2L 2B8OT 2KZWA 4BDVA 4W9IC 3F04A 4EI6B 3UAFA 4B53A 2GSIB 4O00A 3GIVA 3OD3A 5E7FA 4YXLL 1XV8A 3EO0B 3U36B 5J12B 2L7EA 4PR5B 3SYAA 1J0JA 3VXUA 4AT6B 1P84J 3UYRH 3KLLA 4DKAA 4KHXH 2Q7YB 5BZZA 4ZUUB 1VGEH 2DM4A 4C56E 1DBML 1QUNA 4GRWB 3MGTA 3KDMA 3Q8BA 4NXSA 5DHYB 5FUZH 1LEIB 3DJTA 4AYID 1JPST 4TSBH 1F3DH 3BAYA 4O2FA 3B34A 4YXKH 3RGVA 5BO0D 4M6ML 1OSPH 3VD5A 4RFEA 3NBNA 2ADIB 3VXSB 5AZUA 5HHXL 1XB3A 4XOBA 1NMBL 3QXAB 4RQQA 5E2VL 5A6MA 2HWZL 3BEWA 2D0HA 2Y36L 1ZLUH 4JZNA 3X1EA 5KZCD 1XIWC 2J1KA 5AOZA 3QO0A 4HIHA 4C56B 4M8UA 2VDMB 2F9BT 1EIBA 4FLRA 4PRID 1JDDA 4GPVA 3SGKC 4Y4KA 5IT2H 2OYMA 5CU9A 3WGUB 1H0DA 2PTVA 4Y4FB 3MUGB 4IBZA 1N8ZA 5BZWB 1SJHA 1W15A 5E9NA 4LLAA 3D08A 3U4EB 1JYXA 2GY7B 3NEXA 3TL5A 5IVNA 1OK8A 2R7EB 4GS7B 1P7KA 2OXHA 4U0RC 3PHSA 4HUNB 1E7UA 1U8IB 4FCHA 2DMGA 4NO3B 4H0LC 4PS8A 2ADGB 1EBPA 1V3LA 3II1A 4XN1A 1GZPB 5L8LB 4PHZA 4WCYH 2J8OA 3WFDL 3G6JB 3Q2WA 2BSEA 4V1DD 1WO2A 1LNUB 1MLCA 4LCIH 4M9OA 3Q0HA 2NCMA 1QMUA 3VI4A 4BK4A 4Y5YB 5KZCB 5K1VA 2YOCA 5C0EA 4XX5A 3FO0H 3L9EA 4N8VA 1N70A 3AREB 5CEZE 3HI1B 1FL6B 5IKCA 4K5NA 1HZKA 4KK6D 2JB6B 1L9PA 3O6KL 3VI3B 5I0XA 3MCYA 4YHLH 1ZLDA 4KRPD 4UZUA 3VTAA 4FFTA 2NDFA 4OFIA 3LMJL 3OKEB 4A7QA 2QDVA 4FLOA 3RGVC 5IREA 3HJEA 1CQKA 4JM4H 2LFEA 3PF2A 1ESOA 4DGYL 5E00B 4EAEA 5EF2A 3BLPX 3L3DB 5DQJB 1NM4A 1CFQB 1RJYA 1M1SA 3FT2A 1UOVA 1A1OB 3WFBL 4EUPB 4NT6B 3L7EA 2ZOOA 4MDIA 4QNPF 4RGNB 1Q0YL 3DTXA 5LAXA 2ZKYA 1PZAA 3QHFL 4BK5C 5CCHE 1ZGLP 2RB8A 2PNDA 5CM1A 2PPCA 3FB6A 5E1HB 1JPTL 4GEIA 4ZX4A 5E9DB 4K3JL 1K5NB 2DW5A 1P4IL 4MXVE 4GG6F 1BZ9A 4NRZA 3D85D 2CLRB 5FWRA 3ROLA 1CF8L 4HJUA 2XN9D 2DQUL 5FM5O 3QYMA 1DVFC 4RMQA 1FIGL 2B5IB 4GINA 3U83A 3HPLB 2G3MA 3RTQA 3V5HB 4DP7X 3T77B 3FNKA 4O51A 4UQ9A 3AREA 3KLHD 3LHAA 1WG3A 4FJ6A 3VWKA 2JK5B 3HNTL 4LCCC 2FR4B 5E2JA 2NXYD 4OLUH 1RPQA 4F9LA 2IH3A 1CGYA 1G0DA 3U1QA 3N04A 3REWB 3HUJB 4PJ7B 4QRSA 4JHAH 4ZO8A 5KSAC 3CMOH 3HG1A 1TQBB 5HI5D 5D7JB 3HB3B 3NK3A 5I6LA 2RH0A 4RDBA 2CDEA 1SOXA 3FUEA 3GSNB 2FYVA 3F7KA 3U1SH 3QXVA 2R4SH 3SQBB 1GKEA 5IHHA 3HNVL 3RPIA 3D5OF 1G7PB 2NY4C 3IJHB 4K9JA 1I8UA 3FRPG 4NFCA 4F9PC 3ULUH 1RK0B 3AM8A 1RU9H 1FZOB 4HZ1A 3LN4A 3U2IA 1YY8B 4RZKA 3WNLA 2UXTA 1E7VA 3K6DA 4JL1A 3VFPB 4KY1H 3IF1A 1T2JA 1CJYA 5D7IB 4RWHA 3STLB 5FIEA 5FGBC 4PRAA 1OTSC 5FGBA 3OSKA 3C6EA 4L2YA 2HPTA 5B7FA 3TIEA 3PGFH 4U1GB 4ZD3L 1JHTA 4P3DB 4TPRH 1D9KA 3WS6A 3SO3B 4P2OD 1MRDL 3MLVH 4HDIA 4YR6B 1GGYA 1KJMA 2NOYA 4IKLA 5CN1A 4YEEA 4ABWA 5ICZB 1I7UA 3J7HA 1OD9A 3WUWA 3OGCA 4ZMVA 2IH9A 2P44B 4OIIL 2P7TA 4YR6A 2IDFA 4S1RH 5IROA 2WWKT 2ZXCA 3DSNB 1FFNA 2UZYA 3OPZL 1A3QA 5TFSH 2NZ1A 3E3QE 3B7UX 1U3HC 4PJ7E 2WTOA 3JWOC 2BLFA 4BFFA 3BZEA 5H8DA 2F0CA 3QNYA 2G5BB 5GGUA 1CT8B 2F7OA 1A3LL 4ZUSA 5TD4A 1EXGA 2ZUTA 1ZT4A 1J7VR 4G6FD 2YA1A 5B1JA 4Y9CA 3IMWA 2VLJD 5EOCJ 1A3ZA 4UIKL 3SDAB 4ZXBC 3LNFA 2EO9A 3EGXB 2FWUA 5JZ7C 1U2CA 1LE5A 4LARL 1HI6A 2VDKB 5F1SA 1R3HB 3P11L 3V4UH 2VSMB 3LEVH 4L4TB 3AAZA 3S3BB 4XAWL 1D7FA 2BVPA 1ZLWH 3D34A 1JZFA 2OJEB 4FTVB 5DJZB 3DI3B 3RWJA 3WEAA 2BSSB 3T0EE 4Y4FC 4WQOA 1S4IA 4HKBA 4F15B 2NX5B 5A2CA 3MRDB 2GJ6E 1S9WB 4W4OA 1J0IA 1MCBA 2QKIB 4QT5B 4JFDD 4PB0H 3BH8A 2BOBB 3MJ8B 1V8HA 2QBWA 1EFQA 4N6RB 1FI8C 5C0NC 4QJ3B 3WN5C 4XI5D 2WKOA 4P2RD 5C6WH 2X4TA 4LHUD 1OEZW 3TEXA 1QSFE 5C07B 3FDWA 1D5BB 1ORQB 2B14A 1WDAA 3HE6D 2R1XB 2HLEB 5TPWH 1WAEA 2VABA 3ZDYE 1LE9B 2X38A 1IQDB 1Z9SA 4O2FB 3RGVB 3LXAA 3Q2NA 5AVVB 1KPUA 3DSNA 4CVXA 3LZLA 4RMRA 4EZJA 5CCKL 3B6SA 4F7TB 3HNSH 3EYUL 3LS4H 3ECBB 4N4YB 4XR8C 2OXGB 4N9GB 1U3HA 1W8EA 1YYLH 4OCWH 4AG4H 3VFTA 1WBZB 3DOSA 4X6DF 3TBVA 5BRZB 2UVEA 3LSOB 1A7NL 5CJOH 4P07A 4AW7A 4W9LC 4C57C 3ECQA 4HIQA 1QSEA 4M7LH 4OB5H 5AKVA 4L1HA 4PGEA 5I1DA 2IPTH 4WI4A 1XXFC 2NY3C 4IKNA 4WEEA 2ZX9A 1JZ7A 3CBKB 3ARGB 3DUHA 5E1QA 1KBVA 4KOCA 4FABL 1BF8A 2GJRA 1ID5I 2OCJA 5B38A 2YKLL 3NFNB 4X99A 2HRGA 2DJSA 4W68A 4L4VD 1MCOL 2VERN 4OIFA 1RK1A 2ARJA 4ZPVA 4DFIA 1BQHG 4Y5YA 2P42B 2XJKA 3LNHA 1MFBL 5DTFA 4AYMC 2YD1A 3OKYA 3DV4B 1MF2L 5EBLB 1W80A 3C8KB 4NS0A 4EOWL 2MCPH 2AK4D 3GD1C 4PWKA 4EI5D 2DS4A 1XBRA 4G6AD 1RIVH 4YS4A 5E08H 4MNHB 4ABVA 5A2FA 4AKOA 2P80A 4JDEA 1O9ZA 1KJ2L 1WSST 4YWGL 3FO2A 2QSQA 2B59A 4XPAL 5ABZA 3BW9B 1QACA 1TZHB 4TQPA 5D7JC 1B4JL 1GYUA 5T1LB 3QJHA 5AW6B 4MHHI 1ZT4B 3C87A 2IFGA 3UJJH 1TJXA 2ITCB 1AGFA 2V5RA 2FJHB 5HJ3B 1NAMB 3ZKND 4XP4L 1UXWA 2WZ5A 3E2HC 3QXWA 4OLYH 4XZ4A 4G82A 2BSBA 1GH7A 2WO3B 1IE4A 4LCIL 2RQEA 3MROB 3D25B 3FB5B 5KBMA 1A5FH 3LAFA 4KJYA 4KDWA 4YO0A 4D2NA 3IE9A 1KIRB 4R7LA 5KVDE 1FRGH 4F20A 5CSBA 2I27N 4DFHA 1FE8L 5D2NE 1JVOA 5I73C 3QEHB 2X9WA 3A5VA 5DA4A 2R69L 1PKQA 2ROXA 3B1UA 5L2JA 4FQLL 1BEYL 2A2QT 4NPKA 4N0UE 2K9FB 1OF2A 2XXGA 3FFCB 5JO5A 4X6FB 4V1DB 1XGPA 2VXVL 3AG4B 1ES0A 1X4XA 1QR1A 1NUDA 1O6SA 2XQ0A 4YIQB 5I6XC 5E99L 3LRHA 4JEGB 4JFZL 4MNQA 2IBGA 1KGCE 1NAKH 4HUUA 4H2AA 3QUZB 3D6GA 5DQ9B 1IGTA 3MKGA 5A2IH 4W93A 3D2UA 1CS6A 2VLME 4OGXH 1WUNT 3MNMA 3DX9A 4G8IA 3HE7D 4EIBA 4Z7WB 2WANA 1M42A 3FO2B 1B4LA 1KBKA 1X5JA 4GLRH 4O02A 2OSXA 3PUUA 4ZPTB 1HNYA 5DYFA 5IBLC 2GBAA 3EYSH 4XN4A 4DESA 3LPPA 1R5IB 5D7JA 5BRPA 4HOZA 3GK8H 3L5WA 5HHME 3FHQA 3ARBB 1YEFL 5EIVA 1JG9A 4ZFGL 3L5XL 2CRMA 3II3A 4HFUH 4QRTA 4HK3J 3BCFA 4Q4IA 5ENWB 4XNYL 4YBQD 1FIGH 1XSIA 1KYFA 1TTBA 2H26A 1ZK5A 2BNRD 3KPSD 1YNKL 1T7WA 1GZHA 3VGGA 4Z7OE 4L8BB 2O6DA 1JGEB 3Q6GL 1V10A 4GBXB 4YPGB 4EUPH 4C4UA 2ZAGA 5G55A 4OZFG 3GSWB 4XP1L 3L6FB 2J6WA 1CC3A 4YUEH 3ZQ9A 4Z5RB 5L8KB 2Q0ZX 1SUJA 3ZIMA 4UT7H 4P5SA 2FZ3A 1XGPB 3T0EB 3JV6A 4U0RB 3GXDA 4XX1E 4TLKA 1DBBL 2A9CA 1U8PB 3HC3L 3IDNB 4PG2C 3WUWG 1FFRA 2Y7OA 4A66A 1YEDA 1I9JL 2WLLB 2NY2B 3VWJD 3IMBA 1IEAA 4ELDA 4LL4A 1OOWA 2Z4QB 1QFWI 5HPMB 2YD3A 3FO9A 3ARVA 4PJBF 3S2CA 1U8KB 3CZFB 3B2MA 3QB7C 2Z1KA 1MFEL 1PF3A 2FGZA 4LPXA 4HMDA 2E9GA 3FMGL 1I1AC 1R5IA 1DN0B 1CXKA 2W9EH 1GJWA 3KLSA 4GLRI 4J4PD 4FNLH 4H8WC 4UT9L 1SOQA 4NAQA 1NJ9A 3SDAA 2FATH 4HALA 4Q9QH 1IC1A 1KCKA 1D6VL 2BSRB 3O3EB 1OIOA 2BZDA 3SBWA 3L3KA 4WTXA 3N2JA 3MGOA 5K59E 4KH2A 4E2OA 1HEHC 3I74A 3KXFE 4GW4B 3RPIB 3PWNB 1NIBA 1ZHNA 4Z95H 2DQIH 4AQ1A 5ICUA 1F4WH 2VUOA 1S9YB 1ZANL 1XF3B 4MXQC 2WVTA 1FSKC 4XN2A 4RMTA 1A7RL 1ODUA 2GBTA 3BKMH 3NQKA 4LSVL 3CFJB 4ADGA 2JELH 4HS3A 4N85A 4QHMB 4TNEA 3VB8A 5B38G 1A4AA 4ANKA 4Z3EA 4MA1B 3STBA 2R29L 3QP3A 4KK8C 4HDIB 1S7XA 4WWKC 5H4ZA 2WZAA 4MAYC 3HC0B 5GSRB 5DVPA 4PRBB 1QR4A 3U79A 5IHLB 1D5ZB 4PGCB 4PJIF 3OAZH 3ARGC 2X9YA 4JG1H 1L7IH 1VFBA 3QNFA 2HXAA 3ARFB 1FL5B 2ZP0T 1NH6A 4HJTA 3WTUA 4LSRH 5M94B 3ZMRA 4PGDB 4JO5A 5DLML 3GXPA 4ZMNA 2X4RA 1F58H 2ZUQC 3DX8B 3QPQD 2Y7LA 4HK3N 3W9EA 1T80A 2K3HA 2ATAA 1JK8B 3QAZC 3L7FB 4FEMA 1CI5A 1IAII 5DWUL 4YDNA 3FU8A 2OMXB 2QVIA 4AQAA 1SEBB 1VEPA 5DMJB 1SLUA 1L9SA 4OLEA 1KCVL 4Z3JA 1IGCL 5ISZA 1J5DA 3TWYA 3RIFF 3ARBC 2QADD 3P73B 1IKNC 4RGOL 2ZOLA 5MERA 3MUHL 1XF3A 4U6XB 1KG0A 4CW1B 5C0GA 1EFXA 1RUQH 4E68A 2WBJC 3B9KA 1DVQA 1VFAA 4G8AC 2NTFA 1YN6B 2E46A 4XO5A 4DK5A 4XNQA 4XOCA 3BSZL 5I15L 2CNYA 5CCKH 5SX4H 2OJZL 4PUBH 4IKIA 5KYYA 3ARWA 4XTRD 4FZEL 2GQHA 3QDJD 5I1LA 4E5XB 5DD6B 1ETB1 2R23B 5CHNA 5EHFA 3NPZB 4DN3H 4A2HA 1ZHBA 4JW3A 3QORD 3TURA 4QOKB 4NQDD 2NY1D 2IV9A 4Q4EA 2FLBT 4V1DE 5C0JA 1U8NB 1MRFH 2WXJA 4M7LL 3APMA 2H32A 4X6EA 5KUKA 2CO7A 4UZSA 3L4CA 3O6FB 2O72A 3JBG7 5A6IA 1XZ0B 3OKNB 3N1PC 2IAND 3M07A 2YD5A 2VR8A 2VRAA 1UCBL 2R0LL 4L1DA 3LXBA 4HBQA 4X0NA 5T3XD 2IWFA 1GJUA 3U7WL 4M7ZB 4P04A 4M6NL 5LQBL 4KMLB 3KNBB 4M5ZL 5IR1B 4DGVL 2EE3A 2FO8A 3RVUD 1A6PA 2YJLA 2F8VA 3QZLA 4J8RA 4UTBA 5L7XH 3DMMD 4OCXH 3QJVB 1CYWA 4G42A 1I9RH 3WXVL 1BZEA 5KYWB 3IU4H 4HAGA 3L3HA 1FFPB 4IBUA 3GBML 5ICXA 4JPWL 3EYVB 2OW6A 4G42B 3ROOB 1DJYA 1JJUA 4F2MA 4NPJA 5IESL 2YSTA 1E90A 2IQ9L 4P4KB 3T3PE 1KJ2H 1GAFL 3LDBC 2NX5A 4QYOA 5DRWB 2HX7A 4MJ5B 4MZ3A 3IDGA 1GOFA 3LQAH 5KSAD 5HI5C 3GWJA 3GRBA 5ESVB 3A24A 4DNLA 4KZEH 1XGTB 1JHTB 4P3DA 2J6EH 4YC2C 1OZUA 1E4WH 4UWQB 3RDTD 2JKJA 5EWIH 4UQCA 2RAMA 3IGUA 3WEOA 1DDHB 1MQKL 2HT3D 2XFXB 3MZGB 4P3WA 4KKBC 5EN2A 1VCBC 1FYTB 5DVNA 3C08H 3CFKA 5FLUA 3IN0A 3PWUB 2R23A 1JVKA 4KVCH 4OU3A 4F57L 5IB4B 1TQVA 2WVUA 3SGEI 1VRSA 3LZOA 5C9JA 7PCYA 4JZNB 4OZ4B 3EDFA 5ACMA 4BQCA 4B50A 1INDL 1LWRA 4A63A 1BMGA 3A6CL 3LKOB 1YY9D 1I75A 5D93C 5KJRL 2NUPA 1TQBC 3AGVA 3CZKA 1MZZA 1J12A 3WFZA 4ODXA 4X4XA 1EZSA 1IEBA 1XH2A 4NRXB 5HGGS 1BEXA 3IVKA 3RIAF 1WFNA 1GS7A 3FUFA 5GS1C 1A9BA 3GLEA 4LRNH 4P0DA 2UWEE 3JT2A 5I8EA 3TPUB 1B4RA 1CDJA 1KPRA 1OW0C 3QUXD 3BXNA 1PW3A 4YO0B 4G8FA 4PCTA 2OMTA 2J7LA 1FGNL 3B9EA 4QUOA 2FWOA 1EV2E 3JT0A 3O9WD 3KJ4C 4XNUH 1NCAL 1KTKE 4I9WE 1MWOA 3IDGB 5TQ2L 3TYGL 3BPCB 3MFFB 2B5IC 3EFDL 5ACLA 5IOKA 4G3YH 3GXFA 3NCXA 1C16A 3B37A 4GQ9L 2WKOF 4H40A 4JFFB 1ZGLA 5I30L 2CHDA 3D07A 2WOBA 4MMYA 2H8PA 3RNKA 1VESA 2PPAA 2F6AA 5ELIA 4LQFH 4CU6A 5IB5B 4I5BA 4F37F 4ANVA 3UGUA 1S9VA 5JHDD 5I24A 4N2OA 4JQVC 3VXTB 4G6JH 2QPSA 1K85A 1Q8MA 4K23H 1WYJA 2QQKH 1JFHA 1QEWA 3BQUB 4PJ8B 5I5RA 1JRHH 3F7RA 4EN3B 3ILDA 1JNLL 1PZ3A 1AP2B 1EHXA 3WMQA 1SOSA 2AEIT 3HG5A 5I9QB 3SQOH 1X5YA 3D39D 4O58H 4JDVA 3PL6B 3CC1A 1JNHA 4ZXBB 4V2CB 2JJSA 4KVNH 3VTTA 2XWJA 2APTA 3FQNB 2BNRB 4QTHB 2XG5A 5C0CA 4YHOH 3QZOA 1T0OA 4JDTL 4QWWC 1AE6L 2UXVA 4LL1A 4Z76A 2QQNL 1IGMH 3QR0A 2IANE 1TZ8A 3GS0A 4NNPH 1CD1A 5CZXD 5EO9B 4KKNA 2W9EL 3EJUA 1KTBA 2ED8A 1AG0A 1S7WB 4APQB 1E8YA 4AC4A 3ZIYA 5AAMC 1BWWA 3BN9C 1O0VA 3B2VH 1RZ8A 2BIMA 3MBEA 4OT1H 4OBRA 5EBWA 5EU7C 1J1PH 4MD4A 3TN0A 2H3NA 2ZCHL 2GITB 2AAVA 2HFEB 5AZ2L 2WLLA 2OMVB 4PGBA 3ZE2E 5JW3H 1C8PA 5ANMB 4ALAH 5GJSH 3G5WA 2W0PA 6FABH 2WTRA 4F93B 5TDNB 4OJCA 1QLEH 2KERA 1OARL 1YZZA 3MBXL 5ID1A 1XF4B 1WK0A 4KO7A 3RTQC 3ATAA 1G5GA 3CLFL 4LLDA 5EG6C 3U30C 3DBXA 2CH8A 3RNQA 4HH9B 1VEOA 3AZUA 2ZSWB 1QLRA 35C8L 2AV1A 1JOIA 2WXNA 4UT6L 9PCYA 4K3DH 2UZIH 2X4NB 3C12A 5JPNC 1JPGA 2NY0D 2XBDA 1M1XB 2EUWA 3L4YA 2R29H 1NIAA 3D52A 5HHOE 1J5CA 5HJDA 2CJTA 5KYUA 4IK7A 4OZHA 3H7BA 4YL4A 1UWEL 2VSDA 2I5YL 1OP3K 5IOPA 3HZVA 2G2PA 5EORH 4WFFE 1K2DA 3U0PB 1KCBA 1F90H 1ZT1B 2CPUA 2BDNL 3BD4A 1O7VA 1QW9A 5FYKL 5K1JA 3GIZH 3FQUA 1K8IA 2R4RL 2DJ4A 3AXHA 5AL0A 5FA4A 2OKMA 2X5PA 1URIA 3BE1L 5MEOA 3MBEB 2E6QA 2WQVA 3RJQB 1EXHA 4Z77A 3D4YA 1QKZH 3ZKNC 2AXGA 4MS8D 1BREA 4M4RB 2H1LM 4F7MB 2YHGA 3NZHH 3JWNG 2YGQA 4PJAF 3BDBA 5L6YL 2BP8A 2P8MA 3GBLA 2LU7A 5BZDB 1PBYA 4AJYV 5SX5H 2IADA 3QT2A 1JGVL 4IDJL 4YSCA 3MGTB 3MLYL 5D5MB 5CFHA 1GA2A 1BP3B 1E5AA 1FGVH 2NW2B 4GI9A 5D2LB 3NRPA 3TA3D 1G7HA 1N7ML 4OLXL 5I15H 3K6FA 3LOWA 3MCKA 3UZQB 1ZHKA 3CXHK 4N3TA 2AEWA 1NCCH 4H44C 4R97C 3ESMA 4J12A 2VR5A 4ZDHB 5CGYD 2BMKA 4H1LB 5EEYA 3AY2A 3GM0A 3O2VH 3VFGL 5EUOB 2FX9H 3RQ3A 2A38A 3ZDZF 1T83A 2DJMA 2VJ0A 2KZ1B 3H7BB 5J3HD 3OAWA 4WHTB 4OZGA 2J1WA 3QEQD 4X5QA 3OKMB 2JIXD 3VD0A 3RWEB 4OFYA 3S36H 2HMID 1UD4A 2C1PB 3VVVA 2PXYD 4X42A 3TNMB 2D3VA 2MH4A 1FG2B 5ADOL 1HCFX 1II4E 2UZPA 5DD3H 4J3OF 3TJHD 4MJ2A 3S37H 3QWOA 4KPHL 2YSSB 5IQ7L 4DUXA 4IMKA 2ADJB 5JZ7D 3MRLB 3G5YA 1C5BL 1FVCB 2EDLA 3GO1L 1Z2KA 4PRBA 1AHWC 1TTUA 3TBYA 1IBHA 5FYJH 2MCAA 3HTLX 2CAKA 3NN8A 1CBJA 5GGRA 1BECA 3TZVB 3KPSB 4Z7WF 5J6GB 3KEDA 2AJSH 2G9HA 3QRBA 3SE9H 2OK0H 5EIIB 4P2OA 2NY2D 1AGCA 5DVMA 2Y4SA 1PZ2A 2BWIA 2FQDA 2E86A 1VERA 3INUH 5D70H 2YUXA 3D69A 4AGQA 3GDBA 2YFNA 4UV7H 1LE5B 4XVJL 3LQAL 2WXLA 4ZOCA 1AY1L 3JWOL 5D6DC 1ETZB 1QSVA 2P8LA 3D87B 5T1DL 4LEOA 3LKRA 5DC0A 1OVZA 3KPOB 3DHJA 2Y0SA 2PO6A 4Q58C 1GPOL 1U3ZA 2YAMA 3I85A 4ONOA 5EO1B 4N28A 4ZSOA 3DROA 1EEUA 2AZUA 2YWZA 2B0SL 5KW9L 3QFJB 4MWFA 1GS8A 1FFOB 3B7YA 2V7NB 3OL2A 4P48A 4LQ1A 4F7CB 2O93L 3O9WA 2VE6B 2Z0BA 3IN2A 4QXTA 5FK9B 4MQSB 5K9OA 4HA1A 1U8JA 1D5BA 4Q8BA 1JGDA 2YQ3A 3LZRA 1IB5A 1RJCA 5DURD 3VX1A 1TTAA 1WZMA 4KDTA 1UHVA 4FL4B 2VABB 1LE9A 3GRWL 4JDZB 2JJTC 2HKFH 4P2QE 2RACA 4AYGA 3CHSA 2X4SB 3CG8A 4FI8A 4LLYA 4X9BA 4BYHA 4EIUA 4N2FA 2W91A 2BS9A 2B2XH 3F7VB 3GTVA 4ZFOL 3ZTJG 4U6VH 2YGOA 2EDMA 1G7LA 4GY4A 4MMZC 4NJAL 4N90D 4R7XA 4TLTA 5FPIA 4O2EA 2QSVA 4LLMB 3SOBH 1NC4B 5DO8A 1XBDA 4L05A 3KGSA 4JDVB 3DX7B 4LNRA 4X98B 3KHQA 4Q6YA 4XPGH 5DZVA 2FQGA 1TSRA 3EF4A 1QYGL 1VFUA 1RUAL 1AXSA 3E80A 2OMYA 4AIZA 1IL1B 2JI3A 1FZMA 4POYA 1MJ7L 3ES6B 1B0IA 3VD1A 3FSOA 3GBNH 4YOKA 3T3PF 1A8JH 2YD6A 1JZHA 1G7QB 3RPKA 4Y5XB 1TITA 3EJSA 1BM3L 3K2UH 3CFDA 2QSCL 4LSUL 1L9OA 4KRPC 1KTCA 2Z7YA 4LOFA 1CPUA 4WGKA 4X5RA 4G7VH 3OKLA 1KJ3H 1A6ZB 5C0CE 5GJTL 1F4HA 3GMQB 2DYPB 4Y2DA 3RFZC 1T21A 1SHWA 4OM0L 1AKPA 1J88A 1M6UA 2ZKWA 4M8VA 1ZGLB 3H9HA 3T1FA 4LLVA 4Q9RH 4DVRL 3TO4B 2IAMD 3UTOA 1CU4L 2W65B 5DJ2B 5A16A 2XVGA 3RWHB 2LW3A 5H2BA 3LIZL 1KB5L 2P7TB 4H1LG 4UQ3B 1YG9A 8FABB 4PS3A 1QI5A 1SMAA 4ZT1A 1OCRB 5HPOA 4AT6A 1R0AH 1IBYA 4ANWA 4YHOL 3HZYA 1A1OA 5JMRA 1WFUA 5HHNB 3H42L 5F3HA 5E0FA 1MVUB 4JZOA 1D3CA 1QEWB 2DWSA 4CSTA 3IPEA 3QIWB 3O8XD 3NEOA 3W11D 3MNZA 2A0LD 1OB0A 3W81A 5LWYH 5IWLA 3ULUD 3CZNA 2OQJB 4Y1TA 3W0WA 4L18A 3FUJA 1TJHH 5AVXB 2X1WL 2O6EA 3ABMB 4TSCL 4OT1L 5EOTA 3PPEA 1BZ7A 1P7HL 3J07A 3AC0A 4LSDA 1IC4H 1ZRUA 4MB1A 4NKMA 4MJIB 4ZUTA 4X5XA 2UX6A 1KFAH 2BY2A 3GJFA 4JGMA 3B5HA 4HJJH 4JQIA 2ZJSH 1OARH 2LE9A 3BWSA 3MBXH 2DQ6A 3F12B 1KBPA 3IFLH 3PGCB 5DURB 4PJDA 3ARPA 4Y2DB 5JQIB 4LB8A 6TAAA 4GT0A 2EDBA 5M7QA 1X5XA 3V4PL 1PMYA 2F5BH 3QCTH 1LO2H 5D1ZB 3LHPL 2HKHL 1U8KA 3WMPA 1UURA 2HYMA 3P3RA 4MBOA 2PTTA 3FRPB 2Z0UA 4JHWH 4MNGB 1VA9A 2UXGA 3NAAH 1IAKA 5KVDL 1DR9A 2C7UB 2ZCKL 3VNYA 1PZCA 2L7QA 2NXZD 2NY4D 5H35A 3ECVA 3ZTDC 2XN9B 1NBVH 4U6YB 1Z0NA 1JUFB 1Z9PA 1G7IA 4ELKA 2XRAL 2X4SA 3LKSA 4LLYB 3T4YA 4DEPB 1JGUH 5T5NG 3VQ2C 4UAHA 1HILA 4HEPA 3WLWD 2ZX8A 3FSZA 4F8NA 1X4YA 2FHFA 4Y2DD 3GYRA 5FUCC 1D2OA 1U3JA 15C8H 2QTVA 1NBZB 3TT1L 3CSTA 2GIXA 3CMGA 3LQZB 3TBWA 4IRJC 4LPTA 5KJ4A 5DCCA 3MRHB 5H4YA 2WUCL 4YEFA 5JA9A 5TDPB 2OL3H 3IS1X 4MJ4A 4NERA 1KN2L 4NQSA 5FO7B 2H26B 3FB6B 4H8WH 4NT6A 3BIBX 3D9AH 3H9ZA 3VXMA 4P9HL 2VYRE 3QDHA 4PRDB 1MFCH 3TIDB 2ZKMX 3VQLA 2JVUA 1EAOA 4I77H 4GKZA 1ODAA 1QTPA 3QXDB 5FUZL 4N2HA 2XWZA 2AS5M 2V3DA 4JBSA 4TKWA 1UJ3A 4I0CC 4G7SB 2L3BA 5EO9A 4YXKL 4M7LT 3VDCA 2EC9U 1M7IB 4BDVB 2AQ1A 4RMBA 4OKVA 1UWGH 5KN5A 3G5XA 4M1DH 4K07A 3TO4A 4P99A 4GAYB 3MYJA 2ZF8A 4IIQA 1A6AA 1RJLB 1JV5B 3KW8A 4LFHG 1LNUA 1MLCB 4X7FC 4U7SA 3FPYA 3GI9L 1R17A 3MLPA 2Y72A 1WC7B 4P2OB 4LF3A 3IMTA 1MI5B 1I8MA 2ZUYA 4Y16B 3B5TA 3UBXB 3KYAA 4KMTH 2VJ8A 2Y1VA 3FH5A 1S7SA 3SE3C 1SYVA 1WLHA 2K7PA 2ZXGA 4PJ7A 4QRSB 5E5UB 1KY6A 2BSSA 2VLMD 2F58L 4Y88A 1UACH 4RSYA 4YHIB 4KK5C 3WL9B 3S9DB 1DBAL 1WD9A 1RD6A 2H45A 4BSJA 1JK9B 1RURL 3V2AR 2CA3A 1BOGA 4HW6A 3BQUD 3C60C 3DTUB 4PJ8D 2XDHA 4FFYH 1OTUC 1V7NH 2HJKA 3CDGA 4GMTL 4OQTL 4ODUA 5HDWA 5T33H 5IQ9A 3RVTC 3VWJA 2WQ8A 1M6OA 5BJTB 5I1IL 5EU3A 3CXHJ 3VM5A 5JHDB 3U25A 4ERSH 4EXKA 1ZLVK 3OG4B 5I0ZA 3QYCA 5AUMB 1VPOL 5GRJH 2IOIA 3MLRL 3L3GB 4AWJC 4S2SA 4QPEA 1M7IA 5B8CC 1RSFA 5E9DA 1SVZA 3GHEH 4DGYH 4KUCD 2QZ5A 3INUL 4XP6H 5DRNB 1ZEAL 5L2JB 4QXGL 2OSLA 1ZLSL 3V0EA 3UCRA 5GGQL 2BZCA 5FCUH 1CLOH 3C5ZC 1MVYA 4YDKL 4F7TA 5T1DH 4BZYA 3DGGB 4S1DC 5BVJA 3PJNA 3V6FA 1UZGA 3VGHA 4AJWA 5DR5H 2K9UA 4PR5A 4JN1H 1XWVA 3ETSA 1BFVH 4NPYB 1FNEB 4X6CA 3PREA 3DXAB 1UD3A 4O9HL 5FLVA 5F7BA 1QSFA 3JV4A 4XGZA 3MRCA 5B1JC 1M7DA 1T0MB 1MWAH 2QKSA 3NCFB 4PV9A 4NP9A 1OAKL 3CBRA 2YAEA 5ANHA 2YPLD 4NN5B 1ZCRA 2XWBA 3WLBA 2XN2A 4KI5C 1E42A 5DQDL 1QPXA 5BOJA 5HXMA 1F1DA 1E3ZA 3D1MC 3PL6C 3PU7A 2X2HA 1BVKA 5D2NB 3VCLB 4DW2H 4E9TA 3FN0H 4PIBA 2AEQL 2RCSL 5F9WC 5HHQB 5JHBA 3M1BA 3ISYA 3BP4A 4JPSA 1RZFL 5F9AC 2IGLA 3WFHA 4Z23A 1NCBH 2G2NA 1BQLH 1USQA 3K8LA 3M88A 4M48L 4PVBA 4JFHD 3G6DH 4OLUL 3GMPB 3DURB 3MUY1 1R33A 1ZLWK 1LK3L 5F9JA 4JN2A 4N6QA 4QY8A 3ETBF 1ZT1A 3C2AH 1P1VA 5F7AA 2DMKA 1U8IA 2CLVB 1T66D 3LPOA 3FQUB 5J7CC 2OSLB 4J3OG 3QJSB 5HGBA 3CHQA 3DUSA 5KEZA 4BGDA 1YUKB 3JQOB 3PJSA 2ZUVA 2ED9A 2YA2A 5F7UA 4UQAA 4XXDB 1GOHA 1NDGA 1FO0H 2R2BA 3LKQB 4RZCA 5L2KD 4NOBA 1A6AB 1RJLA 1W0VA 2VISA 5EBGA 1G1CA 5DEGB 4CN4A 1S7UA 1OT2A 2N1KA 4XMPH 5C09B 5L0QC 4HC1A 2P52A 5EMYA 1J0YA 1P1ZB 3QJZA 4Z7WE 5I8OH 4FQHA 2YPLE 3T8XA 4OJEH 4W9GC 3MX0A 1BM3H 3HI6L 3UO8B 5DK0A 5E1IA 1VGKB 3QQ9C 4NO5A 3SCMC 3W0WB 4TUJA 4NOFA 1J05A 1IBBA 2WP3T 2H9GB 3F62A 1RZPA 1SY6L 5K93A 2EQDA 2OJEA 5DJZA 5HHPA 2AJVL 5D7IE 2PYFB 4DVRH 1J0KA 1VACA 4LEXH 4CJ0A 4L8SC 3FUKA 5DJ6A 5F7KC 1J1OH 2WO4A 4TNFA 3WHXB 1HI6B 1ZLUK 4YN3A 3EOBA 3EJPA 4HIPA 5AYTA