2XJMA

Crystal structure of streptococcus suis dpr with cobalt
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
150
structure length
150
Chain Sequence
ADSKAVLNQAVADLSVAHSILHQVHWYMRGRGFMIWHPKMDEYMEEIDGYLDEMSERLITLGGAPFSTLKEFSENSQLKEVLGDYNVTIEEQLARVVEVFRYLAALFQKGFDVSDEEGDSVTNDIFNVAKASIEKHIWMLQAELGQAPKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA PROTECTION DURING STARVATION PROTEIN
publication title Structural and Thermodynamic Characterization of Metal Ion Binding in Streptococcus Suis Dpr.
pubmed doi rcsb
source organism Streptococcus suis
molecule tags Oxidoreductase
total genus 67
structure length 150
sequence length 150
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.-.-:
pdb deposition date 2010-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2xjmA00
4DI0A 2GYDA 4KVQA 1JI4A 2C2JA 2GYQA 1NFVA 1Z4AA 2YJJA 3IS7A 3RBCA 2JD80 3RE7A 4MY7A 5J9VA 3R2SA 3ERZA 4AM4A 4ZKHA 4MN9A 1NF4A 4IWJA 1UVHA 4CYAA 2VXXA 4PG1A 3AF9X 4Y08A 3A68A 3OGHA 4CVRA 4AM5A 1OTKA 5LBHA 3SHXA 1JKVA 4A25A 5D8RA 3KA8A 1J30A 3UNOA 1O9IA 2FZFA 2OC5A 1JTSA 2CLUA 3PZAA 3QD8A 3PW8C 4ERUA 2XJMA 1RCDA 5CZUA 4MKUA 3EZ0A 3QVDA 4IXKA 1MOJA 4ISMA 1BFRA 3WVUA 3ISEA 1BCFA 4TOHA 4ZMCA 4LYXA 1TKPA 3R2OA 4RC6A 4LPNA 3PWFA 2WLAA 2XJNA 5GOUA 1LB3A 3F32A 3O7SA 2BJYA 2JD70 2V2SA 4KVSA 3OJ5A 3RGDA 3E1MA 2V2MA 1F33A 2FL0A 4ETRA 5LG2A 1LKMA 4YKHA 2Z6MA 1R03A 3BVLA 5JKLG 3E1OA 3PVTB 3QHBA 3UOFA 4MJYA 4CMYA 1VJXA 2YW6A 5LG8A 3EZUA 3WVWA 4TOGA 3Q4RA 2Z5PA 2V2PA 1TK6A 1GWGA 4DYYA 2WLUA 4QUWA 5LS9A 3BVEA 4LQHA 4AM2A 4PG0A 4ITTA 4ZLWA 2V2NA 2OH3A 1JIGA 2XJOA 2FHAA 5D8OA 3E1JA 4LQNA 3R2HA 4PGKA 1FHAA 2HTNA 5FFDA 5CMRA 3PW1B 2UX1A 3FSEA 1JI5A 1LKOA 1SOFA 5D8PA 3PWQA 1MFRA 4CVTA 5ERJA 4ZKXA 4XKSA 1SQ3A 4TW3A 4TOAA 3NP2X 1L8HA 1TKOA 1VELA 1NF6A 1ZS3A 5GU0X 2GS4A 2VXIA 2ZG7X 4EVDA 1QGHA 1TJOA 2QF9A 3HIUA 1JGCA 3PW1A 3KX9A 4CYBA 3WVVA 2BK6A 2IU2A 4E6KA 4RC6B 3F37A 1HRSA 1RCCA 5IX6A 4TOCA 5J8SA 4R42A 3E1LA 2ZG8X 1RCEA 5GU3X 1H96A 5D8SA 4LQJA 2Z5QA 1L8IA 5HJFA 3IS8A 1S30A 3KA6A 3QB9A 1DVBA 4CY9A 3KWOA 5FEJA 3QZ3A 1BG7A 1EUMA 5K52A 3BVIA 4XKTA 4XGSA 3SE1A 3F38A 1LKPA 3KA4A 1S2ZA 3BKNA 4M32A 4REUA 1NNQA 1QYBA 1VLGA 3PVRB 4ZL5A 3U90A 4LPMA 4OYNA 2C2FA 2W0OA 3E1NA 4LPJA 1IESA 1AEWA 3R2LA 3E6RA 2G4HA 2V2JA 3ES3A 3QHCA 2F7NA 4KVRA 5GN8A 3O7RA 5JKMA 3F33A 3E1PA 4TOEA 4LQVA 3TA8A 2ZA6A 3UOIA 2IB0A 3FI6A 3MPSA 4ML5A 2CN6A 1XZ3A 4DYUA 1F30A 4EVBA 2PYBA 3PVRA 3RAVA 5JKLA 3F36A 4DYXA 2ZA8A 1YUZA 5I4JA 4DZ0A 4RC7A 5AXSA 1S3QA 2Z5RA 3E1QA 4ZJKA 3SIDA 3F35A 2FG8A 2ITBA 3PVYA 3BVFA 3GE4A 4TO9A 4TOBA 4XKUA 1JYBA 1UMNA 4DE6A 3F39A 1YUXA 5K53A 1KRQA 3H7GA 3A9QA 3Q4QA 5GU2X 3Q4OA 2C6RA 2JD60 1VEQA 2V2IA 1RCGA 1DPSA 5ERKA 2ZA7A 3PW8A 2QQYA 3AK8A 3ISFA 4EVEA 4TODA 2Z90A 4ZTTA 4RC5A 5JACA 3R2RA 4M33A 3BT5A 2CHIA 1VEIA 1DATA 4II4B 4DASA 1XZ1A 4MUDA 2HR5A 5CMQA 3HL1A 3AJQA 5FFAA 1JKUA 1YV1A 4CMYV 3R2MA 1Z6OA 5J93A 3FVBA 5E2DA 3NOZX 2C2UA 3PWQC 2C41A 4DYZA 1B71A 2ZG9X 4PGIA 2CN7A 5GN8B 3VNXA 5FFBA 3GHQA 5J8WA 3SH6A 2XGWA 4P18A 2BW1A 2CF7A 3NP0X 4II4A 3GVYA 4ISPA 2CLBA 3E2CA 4TOFA 3WNWA 1Z6OM 3E6SA 2ZURX 4RC7B 2FG4A 1JREA 4CVPA 2YJKA 2CEIA 2YW7A 2X170 3Q4NA 4M34A 5JKMG 3KA3A 3PVYB 4Z3BA 2IY4A 5FFEA 2V2LA 1RYTA 2V15A 3BVKA 5D8QA 3AF8X 4CVSA 3RD0A 2XKQA 4ZL6A 3AF7X 3AK9A 2CIHA 5D8YA 4M35A 4LYUA 4U3GA 3EGMA 2D5KA 3AJPA 5HJHA 3AJOA 5FFCA 4ITWA 1IERA 3KXUA 5HQOA 3F34A 5C6FA 2Y3QA 3IQ1A 1N1QA 5GU1X 4IWKA 3R2KA 4RC5B 5D8XA 1O9RA 2FFXJ 2FJCA 3T9JA 4EVCA 5E1UA 4Z5SA 4RC8A 1ZUJA 2BKCA 2CHPA 3PVTA 2FKZA 2WTLA 4ZKWA 1RCIA 2V2OA 3KA9A 2VZBA 2RBDA 2V2RA
chains in the Genus database with same CATH superfamily
4DI0A 2GYDA 4KVQA 1JI4A 2C2JA 2GYQA 1NFVA 1Z4AA 2YJJA 2V8TA 3IS7A 3RBCA 2JD80 3RE7A 4MY7A 5J9VA 3R2SA 3ERZA 4AM4A 4ZKHA 3FRSA 4MN9A 5JDOA 1NF4A 4IWJA 1UVHA 4CYAA 2VXXA 4PG1A 3AF9X 4Y08A 3A68A 3OGHA 4CVRA 4AM5A 1OTKA 5LBHA 3SHXA 1JKVA 4A25A 5D8RA 3KA8A 1J30A 3UNOA 1O9IA 2FZFA 2OC5A 1JTSA 2CLUA 3PZAA 3QD8A 3PW8C 4ERUA 2XJMA 1RCDA 5CZUA 4MKUA 3EZ0A 3QVDA 2Y44A 4IXKA 1MOJA 4ISMA 1BFRA 3WVUA 3ISEA 1BCFA 4TOHA 4ZMCA 4LYXA 1TKPA 3R2OA 4RC6A 4LPNA 3PWFA 2WLAA 2XJNA 3GGYA 5GOUA 1LB3A 3F32A 3C1YA 2BJYA 3O7SA 2JD70 2V8UA 2V2SA 4KVSA 5HU6D 3OJ5A 3RGDA 3E1MA 2V2MA 1F33A 2FL0A 4ETRA 5LG2A 1LKMA 4YKHA 2Z6MA 1R03A 3BVLA 5JKLG 3E1OA 3C21A 3PVTB 3QHBA 3UOFA 4MJYA 4CMYA 3VVAA 1VJXA 2YW6A 5LG8A 3EZUA 3WVWA 3KDQA 4TOGA 3Q4RA 2Z5PA 2V2PA 1TK6A 1GWGA 4DYYA 2WLUA 4QUWA 5LS9A 3BVEA 4LQHA 4AM2A 4PG0A 4ITTA 4ZLWA 2V2NA 2OH3A 1JIGA 2XJOA 2FHAA 3C1ZA 5D8OA 3E1JA 4LQNA 3R2HA 4PGKA 1FHAA 2HTNA 5FFDA 5CMRA 3PW1B 2UX1A 3FSEA 1JI5A 4MXPA 4E40A 1LKOA 1SOFA 5D8PA 3PWQA 1MFRA 3FRRA 4CVTA 5ERJA 4ZKXA 4XKSA 1SQ3A 4TW3A 4TOAA 3NP2X 1L8HA 1TKOA 1VELA 1NF6A 1ZS3A 5GU0X 2AR0A 2GS4A 2VXIA 2ZG7X 4EVDA 1QGHA 1TJOA 2QF9A 3HIUA 1JGCA 3PW1A 3KX9A 4CYBA 3WVVA 2BK6A 2IU2A 4E6KA 4YVZA 4RC6B 3F37A 1HRSA 1RCCA 5IX6A 4TOCA 5J8SA 4R42A 3E1LA 2ZG8X 1RCEA 2CWLA 4WJG4 5GU3X 1H96A 5D8SA 4LQJA 2Z5QA 1L8IA 5HJFA 3IS8A 1S30A 3KA6A 3QB9A 1DVBA 3JZ9A 4CY9A 3KWOA 5FEJA 3QZ3A 1BG7A 1EUMA 5K52A 3BVIA 4XKTA 4XGSA 3SE1A 3F38A 1LKPA 3KA4A 1S2ZA 3BKNA 2WWXB 4M32A 4W4KB 3UFBA 4REUA 1NNQA 1QYBA 1VLGA 3PVRB 4ZL5A 3U90A 4LPMA 4OYNA 2C2FA 2W0OA 3E1NA 4LPJA 1IESA 1AEWA 3R2LA 3E6RA 2G4HA 2V2JA 3ES3A 3QHCA 2F7NA 4KVRA 5GN8A 3O7RA 5JKMA 3F33A 3E1PA 3V3KB 4TOEA 4LQVA 3TA8A 3L0MA 2ZA6A 3UOIA 2IB0A 2N02A 2OKCA 3DBYA 3FI6A 3MPSA 4ML5A 2CN6A 1XZ3A 4DYUA 1F30A 4EVBA 2PYBA 3PVRA 3RAVA 5JKLA 3F36A 4DYXA 2ZA8A 2G38B 1YUZA 5I4JA 4DZ0A 4RC7A 5AXSA 1S3QA 2Z5RA 3E1QA 4ZJKA 3SIDA 3F35A 2FG8A 2ITBA 3PVYA 3VV9A 3BVFA 3GE4A 4TO9A 4TOBA 4XKUA 1JYBA 1UMNA 4DE6A 3F39A 1YUXA 5K53A 1KRQA 3H7GA 3A9QA 3Q4QA 5GU2X 4W4LB 3Q4OA 2C6RA 2JD60 1VEQA 2V2IA 1RCGA 1DPSA 5ERKA 2ZA7A 3PW8A 2QQYA 3AK8A 4KXRB 3ISFA 4EVEA 3D19A 2MGYA 4TODA 2Z90A 4YXJA 4ZTTA 4RC5A 5JACA 3R2RA 4M33A 3BT5A 2CHIA 1VEIA 1DATA 4II4B 4DASA 1XZ1A 4MUDA 2HR5A 5CMQA 3HL1A 3AJQA 5FFAA 1JKUA 1YV1A 4CMYV 3R2MA 1Z6OA 5J93A 3FVBA 5E2DA 3NOZX 2C2UA 3PWQC 2C41A 4DYZA 1B71A 2ZG9X 4PGIA 2CN7A 3GGZA 5GN8B 3VNXA 5FFBA 3GHQA 5J8WA 3SH6A 2XGWA 4P18A 2BW1A 2CF7A 3NP0X 4II4A 3GVYA 4ISPA 2CLBA 3E2CA 3N6OA 4TOFA 3WNWA 1Z6OM 3E6SA 2ZURX 4RC7B 2FG4A 1JREA 4CVPA 2YJKA 2CEIA 2YW7A 2X170 3Q4NA 4M34A 5JKMG 3KA3A 3PVYB 4Z3BA 2IY4A 5FFEA 4YXMA 2V2LA 1RYTA 2V15A 3BVKA 5D8QA 3AF8X 4CVSA 3RD0A 2XKQA 4ZL6A 3AF7X 3AK9A 2CIHA 5D8YA 4M35A 3LKDA 4LYUA 4U3GA 3C23A 3EGMA 3KHKA 2D5KA 3AJPA 5HJHA 3AJOA 3JZAB 5FFCA 4ITWA 1IERA 3KXUA 5HQOA 3F34A 5C6FA 2Y3QA 3IQ1A 1N1QA 5GU1X 4IWKA 3R2KA 4RC5B 5D8XA 1O9RA 2FFXJ 2FJCA 3T9JA 4EVCA 5E1UA 4Z5SA 4RC8A 1ZUJA 4X0JA 2BKCA 2CHPA 3PVTA 2FKZA 2WTLA 5JDOB 4ZKWA 1RCIA 2V2OA 3W54A 3KA9A 2VZBA 2RBDA 2V2RA 3M6JA
chains in the Genus database with same CATH topology
4DI0A 2GYDA 4KVQA 1JI4A 2C2JA 2GYQA 1NFVA 1Z4AA 2YJJA 2V8TA 3IS7A 3RBCA 2JD80 3RE7A 4MY7A 5J9VA 3R2SA 3ERZA 4AM4A 4ZKHA 3FRSA 4MN9A 5JDOA 1NF4A 4IWJA 1UVHA 4CYAA 2VXXA 4PG1A 3AF9X 4Y08A 3A68A 3OGHA 4CVRA 4AM5A 1OTKA 5LBHA 3SHXA 1JKVA 4A25A 5D8RA 3KA8A 1J30A 3UNOA 1O9IA 2FZFA 2OC5A 1JTSA 2CLUA 3PZAA 3QD8A 3PW8C 4ERUA 2XJMA 1RCDA 5CZUA 4MKUA 3EZ0A 3QVDA 2Y44A 4IXKA 1MOJA 4ISMA 1BFRA 3WVUA 3ISEA 1BCFA 4TOHA 4ZMCA 4LYXA 1TKPA 3R2OA 4RC6A 4LPNA 3PWFA 2WLAA 2XJNA 3GGYA 5GOUA 1LB3A 3F32A 3C1YA 2BJYA 3O7SA 2JD70 2V8UA 2V2SA 4KVSA 5HU6D 3OJ5A 3RGDA 3E1MA 2V2MA 1F33A 2FL0A 4ETRA 5LG2A 1LKMA 4YKHA 2Z6MA 1R03A 3BVLA 5JKLG 3E1OA 3C21A 3PVTB 3QHBA 3UOFA 4MJYA 4CMYA 3VVAA 1VJXA 2YW6A 5LG8A 3EZUA 3WVWA 3KDQA 4TOGA 3Q4RA 2Z5PA 2V2PA 1TK6A 1GWGA 4DYYA 2WLUA 4QUWA 5LS9A 3BVEA 4LQHA 4AM2A 4PG0A 4ITTA 4ZLWA 2V2NA 2OH3A 1JIGA 2XJOA 2FHAA 3C1ZA 5D8OA 3E1JA 4LQNA 3R2HA 4PGKA 1FHAA 2HTNA 5FFDA 5CMRA 3PW1B 2UX1A 3FSEA 1JI5A 4MXPA 4E40A 1LKOA 1SOFA 5D8PA 3PWQA 1MFRA 3FRRA 4CVTA 5ERJA 4ZKXA 4XKSA 1SQ3A 4TW3A 4TOAA 3NP2X 1L8HA 1TKOA 1VELA 1NF6A 1ZS3A 5GU0X 2AR0A 2GS4A 2VXIA 2ZG7X 4EVDA 1QGHA 1TJOA 2QF9A 3HIUA 1JGCA 3PW1A 3KX9A 4CYBA 3WVVA 2BK6A 2IU2A 4E6KA 4YVZA 4RC6B 3F37A 1HRSA 1RCCA 5IX6A 4TOCA 5J8SA 4R42A 3E1LA 2ZG8X 1RCEA 2CWLA 4WJG4 5GU3X 1H96A 5D8SA 4LQJA 2Z5QA 1L8IA 5HJFA 3IS8A 1S30A 3KA6A 3QB9A 1DVBA 3JZ9A 4CY9A 3KWOA 5FEJA 3QZ3A 1BG7A 1EUMA 5K52A 3BVIA 4XKTA 4XGSA 3SE1A 3F38A 1LKPA 3KA4A 1S2ZA 3BKNA 2WWXB 4M32A 4W4KB 3UFBA 4REUA 1NNQA 1QYBA 1VLGA 3PVRB 4ZL5A 3U90A 4LPMA 4OYNA 2C2FA 2W0OA 3E1NA 4LPJA 1IESA 1AEWA 3R2LA 3E6RA 2G4HA 2V2JA 3ES3A 3QHCA 2F7NA 4KVRA 5GN8A 3O7RA 5JKMA 3F33A 3E1PA 3V3KB 4TOEA 4LQVA 3TA8A 3L0MA 2ZA6A 3UOIA 2IB0A 2N02A 2OKCA 3DBYA 3FI6A 3MPSA 4ML5A 2CN6A 1XZ3A 4DYUA 1F30A 4EVBA 2PYBA 3PVRA 3RAVA 5JKLA 3F36A 4DYXA 2ZA8A 2G38B 1YUZA 5I4JA 4DZ0A 4RC7A 5AXSA 1S3QA 2Z5RA 3E1QA 4ZJKA 3SIDA 3F35A 2FG8A 2ITBA 3PVYA 3VV9A 3BVFA 3GE4A 4TO9A 4TOBA 4XKUA 1JYBA 1UMNA 4DE6A 3F39A 1YUXA 5K53A 1KRQA 3H7GA 3A9QA 3Q4QA 5GU2X 4W4LB 3Q4OA 2C6RA 2JD60 1VEQA 2V2IA 1RCGA 1DPSA 5ERKA 2ZA7A 3PW8A 2QQYA 3AK8A 4KXRB 3ISFA 4EVEA 3D19A 2MGYA 4TODA 2Z90A 4YXJA 4ZTTA 4RC5A 5JACA 3R2RA 4M33A 3BT5A 2CHIA 1VEIA 1DATA 4II4B 4DASA 1XZ1A 4MUDA 2HR5A 5CMQA 3HL1A 3AJQA 5FFAA 1JKUA 1YV1A 4CMYV 3R2MA 1Z6OA 5J93A 3FVBA 5E2DA 3NOZX 2C2UA 3PWQC 2C41A 4DYZA 1B71A 2ZG9X 4PGIA 2CN7A 3GGZA 5GN8B 3VNXA 5FFBA 3GHQA 5J8WA 3SH6A 2XGWA 4P18A 2BW1A 2CF7A 3NP0X 4II4A 3GVYA 4ISPA 2CLBA 3E2CA 3N6OA 4TOFA 3WNWA 1Z6OM 3E6SA 2ZURX 4RC7B 2FG4A 1JREA 4CVPA 2YJKA 2CEIA 2YW7A 2X170 3Q4NA 4M34A 5JKMG 3KA3A 3PVYB 4Z3BA 2IY4A 5FFEA 4YXMA 2V2LA 1RYTA 2V15A 3BVKA 5D8QA 3AF8X 4CVSA 3RD0A 2XKQA 4ZL6A 3AF7X 3AK9A 2CIHA 5D8YA 4M35A 3LKDA 4LYUA 4U3GA 3C23A 3EGMA 3KHKA 2D5KA 3AJPA 5HJHA 3AJOA 3JZAB 5FFCA 4ITWA 1IERA 3KXUA 5HQOA 3F34A 5C6FA 2Y3QA 3IQ1A 1N1QA 5GU1X 4IWKA 3R2KA 4RC5B 5D8XA 1O9RA 2FFXJ 2FJCA 3T9JA 4EVCA 5E1UA 4Z5SA 4RC8A 1ZUJA 4X0JA 2BKCA 2CHPA 3PVTA 2FKZA 2WTLA 5JDOB 4ZKWA 1RCIA 2V2OA 3W54A 3KA9A 2VZBA 2RBDA 2V2RA 3M6JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DI0 A;  2GYD A;  4KVQ A;  1JI4 A;  2C2J A;  2GYQ A;  1NFV A;  1Z4A A;  2YJJ A;  3IS7 A;  3RBC A;  2JD8 0;  3RE7 A;  4MY7 A;  5J9V A;  3R2S A;  3ERZ A;  4AM4 A;  4ZKH A;  4MN9 A;  1NF4 A;  4IWJ A;  1UVH A;  4CYA A;  2VXX A;  4PG1 A;  3AF9 X;  4Y08 A;  3A68 A;  3OGH A;  4CVR A;  4AM5 A;  1OTK A;  5LBH A;  3SHX A;  1JKV A;  4A25 A;  5D8R A;  3KA8 A;  1J30 A;  3UNO A;  1O9I A;  2FZF A;  2OC5 A;  1JTS A;  2CLU A;  3PZA A;  3QD8 A;  3PW8 C;  4ERU A;  2XJM A;  1RCD A;  5CZU A;  4MKU A;  3EZ0 A;  3QVD A;  4IXK A;  1MOJ A;  4ISM A;  1BFR A;  3WVU A;  3ISE A;  1BCF A;  4TOH A;  4ZMC A;  4LYX A;  1TKP A;  3R2O A;  4RC6 A;  4LPN A;  3PWF A;  2WLA A;  2XJN A;  5GOU A;  1LB3 A;  3F32 A;  3O7S A;  2BJY A;  2JD7 0;  2V2S A;  4KVS A;  3OJ5 A;  3RGD A;  3E1M A;  2V2M A;  1F33 A;  2FL0 A;  4ETR A;  5LG2 A;  1LKM A;  4YKH A;  2Z6M A;  1R03 A;  3BVL A;  5JKL G;  3E1O A;  3PVT B;  3QHB A;  3UOF A;  4MJY A;  4CMY A;  1VJX A;  2YW6 A;  5LG8 A;  3EZU A;  3WVW A;  4TOG A;  3Q4R A;  2Z5P A;  2V2P A;  1TK6 A;  1GWG A;  4DYY A;  2WLU A;  4QUW A;  5LS9 A;  3BVE A;  4LQH A;  4AM2 A;  4PG0 A;  4ITT A;  4ZLW A;  2V2N A;  2OH3 A;  1JIG A;  2XJO A;  2FHA A;  5D8O A;  3E1J A;  4LQN A;  3R2H A;  4PGK A;  1FHA A;  2HTN A;  5FFD A;  5CMR A;  3PW1 B;  2UX1 A;  3FSE A;  1JI5 A;  1LKO A;  1SOF A;  5D8P A;  3PWQ A;  1MFR A;  4CVT A;  5ERJ A;  4ZKX A;  4XKS A;  1SQ3 A;  4TW3 A;  4TOA A;  3NP2 X;  1L8H A;  1TKO A;  1VEL A;  1NF6 A;  1ZS3 A;  5GU0 X;  2GS4 A;  2VXI A;  2ZG7 X;  4EVD A;  1QGH A;  1TJO A;  2QF9 A;  3HIU A;  1JGC A;  3PW1 A;  3KX9 A;  4CYB A;  3WVV A;  2BK6 A;  2IU2 A;  4E6K A;  4RC6 B;  3F37 A;  1HRS A;  1RCC A;  5IX6 A;  4TOC A;  5J8S A;  4R42 A;  3E1L A;  2ZG8 X;  1RCE A;  5GU3 X;  1H96 A;  5D8S A;  4LQJ A;  2Z5Q A;  1L8I A;  5HJF A;  3IS8 A;  1S30 A;  3KA6 A;  3QB9 A;  1DVB A;  4CY9 A;  3KWO A;  5FEJ A;  3QZ3 A;  1BG7 A;  1EUM A;  5K52 A;  3BVI A;  4XKT A;  4XGS A;  3SE1 A;  3F38 A;  1LKP A;  3KA4 A;  1S2Z A;  3BKN A;  4M32 A;  4REU A;  1NNQ A;  1QYB A;  1VLG A;  3PVR B;  4ZL5 A;  3U90 A;  4LPM A;  4OYN A;  2C2F A;  2W0O A;  3E1N A;  4LPJ A;  1IES A;  1AEW A;  3R2L A;  3E6R A;  2G4H A;  2V2J A;  3ES3 A;  3QHC A;  2F7N A;  4KVR A;  5GN8 A;  3O7R A;  5JKM A;  3F33 A;  3E1P A;  4TOE A;  4LQV A;  3TA8 A;  2ZA6 A;  3UOI A;  2IB0 A;  3FI6 A;  3MPS A;  4ML5 A;  2CN6 A;  1XZ3 A;  4DYU A;  1F30 A;  4EVB A;  2PYB A;  3PVR A;  3RAV A;  5JKL A;  3F36 A;  4DYX A;  2ZA8 A;  1YUZ A;  5I4J A;  4DZ0 A;  4RC7 A;  5AXS A;  1S3Q A;  2Z5R A;  3E1Q A;  4ZJK A;  3SID A;  3F35 A;  2FG8 A;  2ITB A;  3PVY A;  3BVF A;  3GE4 A;  4TO9 A;  4TOB A;  4XKU A;  1JYB A;  1UMN A;  4DE6 A;  3F39 A;  1YUX A;  5K53 A;  1KRQ A;  3H7G A;  3A9Q A;  3Q4Q A;  5GU2 X;  3Q4O A;  2C6R A;  2JD6 0;  1VEQ A;  2V2I A;  1RCG A;  1DPS A;  5ERK A;  2ZA7 A;  3PW8 A;  2QQY A;  3AK8 A;  3ISF A;  4EVE A;  4TOD A;  2Z90 A;  4ZTT A;  4RC5 A;  5JAC A;  3R2R A;  4M33 A;  3BT5 A;  2CHI A;  1VEI A;  1DAT A;  4II4 B;  4DAS A;  1XZ1 A;  4MUD A;  2HR5 A;  5CMQ A;  3HL1 A;  3AJQ A;  5FFA A;  1JKU A;  1YV1 A;  4CMY V;  3R2M A;  1Z6O A;  5J93 A;  3FVB A;  5E2D A;  3NOZ X;  2C2U A;  3PWQ C;  2C41 A;  4DYZ A;  1B71 A;  2ZG9 X;  4PGI A;  2CN7 A;  5GN8 B;  3VNX A;  5FFB A;  3GHQ A;  5J8W A;  3SH6 A;  2XGW A;  4P18 A;  2BW1 A;  2CF7 A;  3NP0 X;  4II4 A;  3GVY A;  4ISP A;  2CLB A;  3E2C A;  4TOF A;  3WNW A;  1Z6O M;  3E6S A;  2ZUR X;  4RC7 B;  2FG4 A;  1JRE A;  4CVP A;  2YJK A;  2CEI A;  2YW7 A;  2X17 0;  3Q4N A;  4M34 A;  5JKM G;  3KA3 A;  3PVY B;  4Z3B A;  2IY4 A;  5FFE A;  2V2L A;  1RYT A;  2V15 A;  3BVK A;  5D8Q A;  3AF8 X;  4CVS A;  3RD0 A;  2XKQ A;  4ZL6 A;  3AF7 X;  3AK9 A;  2CIH A;  5D8Y A;  4M35 A;  4LYU A;  4U3G A;  3EGM A;  2D5K A;  3AJP A;  5HJH A;  3AJO A;  5FFC A;  4ITW A;  1IER A;  3KXU A;  5HQO A;  3F34 A;  5C6F A;  2Y3Q A;  3IQ1 A;  1N1Q A;  5GU1 X;  4IWK A;  3R2K A;  4RC5 B;  5D8X A;  1O9R A;  2FFX J;  2FJC A;  3T9J A;  4EVC A;  5E1U A;  4Z5S A;  4RC8 A;  1ZUJ A;  2BKC A;  2CHP A;  3PVT A;  2FKZ A;  2WTL A;  4ZKW A;  1RCI A;  2V2O A;  3KA9 A;  2VZB A;  2RBD A;  2V2R A; 
#chains in the Genus database with same CATH topology
 4DI0 A;  2GYD A;  4KVQ A;  1JI4 A;  2C2J A;  2GYQ A;  1NFV A;  1Z4A A;  2YJJ A;  2V8T A;  3IS7 A;  3RBC A;  2JD8 0;  3RE7 A;  4MY7 A;  5J9V A;  3R2S A;  3ERZ A;  4AM4 A;  4ZKH A;  3FRS A;  4MN9 A;  5JDO A;  1NF4 A;  4IWJ A;  1UVH A;  4CYA A;  2VXX A;  4PG1 A;  3AF9 X;  4Y08 A;  3A68 A;  3OGH A;  4CVR A;  4AM5 A;  1OTK A;  5LBH A;  3SHX A;  1JKV A;  4A25 A;  5D8R A;  3KA8 A;  1J30 A;  3UNO A;  1O9I A;  2FZF A;  2OC5 A;  1JTS A;  2CLU A;  3PZA A;  3QD8 A;  3PW8 C;  4ERU A;  2XJM A;  1RCD A;  5CZU A;  4MKU A;  3EZ0 A;  3QVD A;  2Y44 A;  4IXK A;  1MOJ A;  4ISM A;  1BFR A;  3WVU A;  3ISE A;  1BCF A;  4TOH A;  4ZMC A;  4LYX A;  1TKP A;  3R2O A;  4RC6 A;  4LPN A;  3PWF A;  2WLA A;  2XJN A;  3GGY A;  5GOU A;  1LB3 A;  3F32 A;  3C1Y A;  2BJY A;  3O7S A;  2JD7 0;  2V8U A;  2V2S A;  4KVS A;  5HU6 D;  3OJ5 A;  3RGD A;  3E1M A;  2V2M A;  1F33 A;  2FL0 A;  4ETR A;  5LG2 A;  1LKM A;  4YKH A;  2Z6M A;  1R03 A;  3BVL A;  5JKL G;  3E1O A;  3C21 A;  3PVT B;  3QHB A;  3UOF A;  4MJY A;  4CMY A;  3VVA A;  1VJX A;  2YW6 A;  5LG8 A;  3EZU A;  3WVW A;  3KDQ A;  4TOG A;  3Q4R A;  2Z5P A;  2V2P A;  1TK6 A;  1GWG A;  4DYY A;  2WLU A;  4QUW A;  5LS9 A;  3BVE A;  4LQH A;  4AM2 A;  4PG0 A;  4ITT A;  4ZLW A;  2V2N A;  2OH3 A;  1JIG A;  2XJO A;  2FHA A;  3C1Z A;  5D8O A;  3E1J A;  4LQN A;  3R2H A;  4PGK A;  1FHA A;  2HTN A;  5FFD A;  5CMR A;  3PW1 B;  2UX1 A;  3FSE A;  1JI5 A;  4MXP A;  4E40 A;  1LKO A;  1SOF A;  5D8P A;  3PWQ A;  1MFR A;  3FRR A;  4CVT A;  5ERJ A;  4ZKX A;  4XKS A;  1SQ3 A;  4TW3 A;  4TOA A;  3NP2 X;  1L8H A;  1TKO A;  1VEL A;  1NF6 A;  1ZS3 A;  5GU0 X;  2AR0 A;  2GS4 A;  2VXI A;  2ZG7 X;  4EVD A;  1QGH A;  1TJO A;  2QF9 A;  3HIU A;  1JGC A;  3PW1 A;  3KX9 A;  4CYB A;  3WVV A;  2BK6 A;  2IU2 A;  4E6K A;  4YVZ A;  4RC6 B;  3F37 A;  1HRS A;  1RCC A;  5IX6 A;  4TOC A;  5J8S A;  4R42 A;  3E1L A;  2ZG8 X;  1RCE A;  2CWL A;  4WJG 4;  5GU3 X;  1H96 A;  5D8S A;  4LQJ A;  2Z5Q A;  1L8I A;  5HJF A;  3IS8 A;  1S30 A;  3KA6 A;  3QB9 A;  1DVB A;  3JZ9 A;  4CY9 A;  3KWO A;  5FEJ A;  3QZ3 A;  1BG7 A;  1EUM A;  5K52 A;  3BVI A;  4XKT A;  4XGS A;  3SE1 A;  3F38 A;  1LKP A;  3KA4 A;  1S2Z A;  3BKN A;  2WWX B;  4M32 A;  4W4K B;  3UFB A;  4REU A;  1NNQ A;  1QYB A;  1VLG A;  3PVR B;  4ZL5 A;  3U90 A;  4LPM A;  4OYN A;  2C2F A;  2W0O A;  3E1N A;  4LPJ A;  1IES A;  1AEW A;  3R2L A;  3E6R A;  2G4H A;  2V2J A;  3ES3 A;  3QHC A;  2F7N A;  4KVR A;  5GN8 A;  3O7R A;  5JKM A;  3F33 A;  3E1P A;  3V3K B;  4TOE A;  4LQV A;  3TA8 A;  3L0M A;  2ZA6 A;  3UOI A;  2IB0 A;  2N02 A;  2OKC A;  3DBY A;  3FI6 A;  3MPS A;  4ML5 A;  2CN6 A;  1XZ3 A;  4DYU A;  1F30 A;  4EVB A;  2PYB A;  3PVR A;  3RAV A;  5JKL A;  3F36 A;  4DYX A;  2ZA8 A;  2G38 B;  1YUZ A;  5I4J A;  4DZ0 A;  4RC7 A;  5AXS A;  1S3Q A;  2Z5R A;  3E1Q A;  4ZJK A;  3SID A;  3F35 A;  2FG8 A;  2ITB A;  3PVY A;  3VV9 A;  3BVF A;  3GE4 A;  4TO9 A;  4TOB A;  4XKU A;  1JYB A;  1UMN A;  4DE6 A;  3F39 A;  1YUX A;  5K53 A;  1KRQ A;  3H7G A;  3A9Q A;  3Q4Q A;  5GU2 X;  4W4L B;  3Q4O A;  2C6R A;  2JD6 0;  1VEQ A;  2V2I A;  1RCG A;  1DPS A;  5ERK A;  2ZA7 A;  3PW8 A;  2QQY A;  3AK8 A;  4KXR B;  3ISF A;  4EVE A;  3D19 A;  2MGY A;  4TOD A;  2Z90 A;  4YXJ A;  4ZTT A;  4RC5 A;  5JAC A;  3R2R A;  4M33 A;  3BT5 A;  2CHI A;  1VEI A;  1DAT A;  4II4 B;  4DAS A;  1XZ1 A;  4MUD A;  2HR5 A;  5CMQ A;  3HL1 A;  3AJQ A;  5FFA A;  1JKU A;  1YV1 A;  4CMY V;  3R2M A;  1Z6O A;  5J93 A;  3FVB A;  5E2D A;  3NOZ X;  2C2U A;  3PWQ C;  2C41 A;  4DYZ A;  1B71 A;  2ZG9 X;  4PGI A;  2CN7 A;  3GGZ A;  5GN8 B;  3VNX A;  5FFB A;  3GHQ A;  5J8W A;  3SH6 A;  2XGW A;  4P18 A;  2BW1 A;  2CF7 A;  3NP0 X;  4II4 A;  3GVY A;  4ISP A;  2CLB A;  3E2C A;  3N6O A;  4TOF A;  3WNW A;  1Z6O M;  3E6S A;  2ZUR X;  4RC7 B;  2FG4 A;  1JRE A;  4CVP A;  2YJK A;  2CEI A;  2YW7 A;  2X17 0;  3Q4N A;  4M34 A;  5JKM G;  3KA3 A;  3PVY B;  4Z3B A;  2IY4 A;  5FFE A;  4YXM A;  2V2L A;  1RYT A;  2V15 A;  3BVK A;  5D8Q A;  3AF8 X;  4CVS A;  3RD0 A;  2XKQ A;  4ZL6 A;  3AF7 X;  3AK9 A;  2CIH A;  5D8Y A;  4M35 A;  3LKD A;  4LYU A;  4U3G A;  3C23 A;  3EGM A;  3KHK A;  2D5K A;  3AJP A;  5HJH A;  3AJO A;  3JZA B;  5FFC A;  4ITW A;  1IER A;  3KXU A;  5HQO A;  3F34 A;  5C6F A;  2Y3Q A;  3IQ1 A;  1N1Q A;  5GU1 X;  4IWK A;  3R2K A;  4RC5 B;  5D8X A;  1O9R A;  2FFX J;  2FJC A;  3T9J A;  4EVC A;  5E1U A;  4Z5S A;  4RC8 A;  1ZUJ A;  4X0J A;  2BKC A;  2CHP A;  3PVT A;  2FKZ A;  2WTL A;  5JDO B;  4ZKW A;  1RCI A;  2V2O A;  3W54 A;  3KA9 A;  2VZB A;  2RBD A;  2V2R A;  3M6J A; 
#chains in the Genus database with same CATH homology
 4DI0 A;  2GYD A;  4KVQ A;  1JI4 A;  2C2J A;  2GYQ A;  1NFV A;  1Z4A A;  2YJJ A;  2V8T A;  3IS7 A;  3RBC A;  2JD8 0;  3RE7 A;  4MY7 A;  5J9V A;  3R2S A;  3ERZ A;  4AM4 A;  4ZKH A;  3FRS A;  4MN9 A;  5JDO A;  1NF4 A;  4IWJ A;  1UVH A;  4CYA A;  2VXX A;  4PG1 A;  3AF9 X;  4Y08 A;  3A68 A;  3OGH A;  4CVR A;  4AM5 A;  1OTK A;  5LBH A;  3SHX A;  1JKV A;  4A25 A;  5D8R A;  3KA8 A;  1J30 A;  3UNO A;  1O9I A;  2FZF A;  2OC5 A;  1JTS A;  2CLU A;  3PZA A;  3QD8 A;  3PW8 C;  4ERU A;  2XJM A;  1RCD A;  5CZU A;  4MKU A;  3EZ0 A;  3QVD A;  2Y44 A;  4IXK A;  1MOJ A;  4ISM A;  1BFR A;  3WVU A;  3ISE A;  1BCF A;  4TOH A;  4ZMC A;  4LYX A;  1TKP A;  3R2O A;  4RC6 A;  4LPN A;  3PWF A;  2WLA A;  2XJN A;  3GGY A;  5GOU A;  1LB3 A;  3F32 A;  3C1Y A;  2BJY A;  3O7S A;  2JD7 0;  2V8U A;  2V2S A;  4KVS A;  5HU6 D;  3OJ5 A;  3RGD A;  3E1M A;  2V2M A;  1F33 A;  2FL0 A;  4ETR A;  5LG2 A;  1LKM A;  4YKH A;  2Z6M A;  1R03 A;  3BVL A;  5JKL G;  3E1O A;  3C21 A;  3PVT B;  3QHB A;  3UOF A;  4MJY A;  4CMY A;  3VVA A;  1VJX A;  2YW6 A;  5LG8 A;  3EZU A;  3WVW A;  3KDQ A;  4TOG A;  3Q4R A;  2Z5P A;  2V2P A;  1TK6 A;  1GWG A;  4DYY A;  2WLU A;  4QUW A;  5LS9 A;  3BVE A;  4LQH A;  4AM2 A;  4PG0 A;  4ITT A;  4ZLW A;  2V2N A;  2OH3 A;  1JIG A;  2XJO A;  2FHA A;  3C1Z A;  5D8O A;  3E1J A;  4LQN A;  3R2H A;  4PGK A;  1FHA A;  2HTN A;  5FFD A;  5CMR A;  3PW1 B;  2UX1 A;  3FSE A;  1JI5 A;  4MXP A;  4E40 A;  1LKO A;  1SOF A;  5D8P A;  3PWQ A;  1MFR A;  3FRR A;  4CVT A;  5ERJ A;  4ZKX A;  4XKS A;  1SQ3 A;  4TW3 A;  4TOA A;  3NP2 X;  1L8H A;  1TKO A;  1VEL A;  1NF6 A;  1ZS3 A;  5GU0 X;  2AR0 A;  2GS4 A;  2VXI A;  2ZG7 X;  4EVD A;  1QGH A;  1TJO A;  2QF9 A;  3HIU A;  1JGC A;  3PW1 A;  3KX9 A;  4CYB A;  3WVV A;  2BK6 A;  2IU2 A;  4E6K A;  4YVZ A;  4RC6 B;  3F37 A;  1HRS A;  1RCC A;  5IX6 A;  4TOC A;  5J8S A;  4R42 A;  3E1L A;  2ZG8 X;  1RCE A;  2CWL A;  4WJG 4;  5GU3 X;  1H96 A;  5D8S A;  4LQJ A;  2Z5Q A;  1L8I A;  5HJF A;  3IS8 A;  1S30 A;  3KA6 A;  3QB9 A;  1DVB A;  3JZ9 A;  4CY9 A;  3KWO A;  5FEJ A;  3QZ3 A;  1BG7 A;  1EUM A;  5K52 A;  3BVI A;  4XKT A;  4XGS A;  3SE1 A;  3F38 A;  1LKP A;  3KA4 A;  1S2Z A;  3BKN A;  2WWX B;  4M32 A;  4W4K B;  3UFB A;  4REU A;  1NNQ A;  1QYB A;  1VLG A;  3PVR B;  4ZL5 A;  3U90 A;  4LPM A;  4OYN A;  2C2F A;  2W0O A;  3E1N A;  4LPJ A;  1IES A;  1AEW A;  3R2L A;  3E6R A;  2G4H A;  2V2J A;  3ES3 A;  3QHC A;  2F7N A;  4KVR A;  5GN8 A;  3O7R A;  5JKM A;  3F33 A;  3E1P A;  3V3K B;  4TOE A;  4LQV A;  3TA8 A;  3L0M A;  2ZA6 A;  3UOI A;  2IB0 A;  2N02 A;  2OKC A;  3DBY A;  3FI6 A;  3MPS A;  4ML5 A;  2CN6 A;  1XZ3 A;  4DYU A;  1F30 A;  4EVB A;  2PYB A;  3PVR A;  3RAV A;  5JKL A;  3F36 A;  4DYX A;  2ZA8 A;  2G38 B;  1YUZ A;  5I4J A;  4DZ0 A;  4RC7 A;  5AXS A;  1S3Q A;  2Z5R A;  3E1Q A;  4ZJK A;  3SID A;  3F35 A;  2FG8 A;  2ITB A;  3PVY A;  3VV9 A;  3BVF A;  3GE4 A;  4TO9 A;  4TOB A;  4XKU A;  1JYB A;  1UMN A;  4DE6 A;  3F39 A;  1YUX A;  5K53 A;  1KRQ A;  3H7G A;  3A9Q A;  3Q4Q A;  5GU2 X;  4W4L B;  3Q4O A;  2C6R A;  2JD6 0;  1VEQ A;  2V2I A;  1RCG A;  1DPS A;  5ERK A;  2ZA7 A;  3PW8 A;  2QQY A;  3AK8 A;  4KXR B;  3ISF A;  4EVE A;  3D19 A;  2MGY A;  4TOD A;  2Z90 A;  4YXJ A;  4ZTT A;  4RC5 A;  5JAC A;  3R2R A;  4M33 A;  3BT5 A;  2CHI A;  1VEI A;  1DAT A;  4II4 B;  4DAS A;  1XZ1 A;  4MUD A;  2HR5 A;  5CMQ A;  3HL1 A;  3AJQ A;  5FFA A;  1JKU A;  1YV1 A;  4CMY V;  3R2M A;  1Z6O A;  5J93 A;  3FVB A;  5E2D A;  3NOZ X;  2C2U A;  3PWQ C;  2C41 A;  4DYZ A;  1B71 A;  2ZG9 X;  4PGI A;  2CN7 A;  3GGZ A;  5GN8 B;  3VNX A;  5FFB A;  3GHQ A;  5J8W A;  3SH6 A;  2XGW A;  4P18 A;  2BW1 A;  2CF7 A;  3NP0 X;  4II4 A;  3GVY A;  4ISP A;  2CLB A;  3E2C A;  3N6O A;  4TOF A;  3WNW A;  1Z6O M;  3E6S A;  2ZUR X;  4RC7 B;  2FG4 A;  1JRE A;  4CVP A;  2YJK A;  2CEI A;  2YW7 A;  2X17 0;  3Q4N A;  4M34 A;  5JKM G;  3KA3 A;  3PVY B;  4Z3B A;  2IY4 A;  5FFE A;  4YXM A;  2V2L A;  1RYT A;  2V15 A;  3BVK A;  5D8Q A;  3AF8 X;  4CVS A;  3RD0 A;  2XKQ A;  4ZL6 A;  3AF7 X;  3AK9 A;  2CIH A;  5D8Y A;  4M35 A;  3LKD A;  4LYU A;  4U3G A;  3C23 A;  3EGM A;  3KHK A;  2D5K A;  3AJP A;  5HJH A;  3AJO A;  3JZA B;  5FFC A;  4ITW A;  1IER A;  3KXU A;  5HQO A;  3F34 A;  5C6F A;  2Y3Q A;  3IQ1 A;  1N1Q A;  5GU1 X;  4IWK A;  3R2K A;  4RC5 B;  5D8X A;  1O9R A;  2FFX J;  2FJC A;  3T9J A;  4EVC A;  5E1U A;  4Z5S A;  4RC8 A;  1ZUJ A;  4X0J A;  2BKC A;  2CHP A;  3PVT A;  2FKZ A;  2WTL A;  5JDO B;  4ZKW A;  1RCI A;  2V2O A;  3W54 A;  3KA9 A;  2VZB A;  2RBD A;  2V2R A;  3M6J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...