2XJPA

X-ray structure of the n-terminal domain of the flocculin flo5 from saccharomyces cerevisiae in complex with calcium and mannose
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
258
structure length
258
Chain Sequence
GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Flocculin-Mediated Social Behavior in Yeast
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell adhesion
molecule keywords FLOCCULATION PROTEIN FLO5
total genus 54
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2010-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2xjpA02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2xjpA01
5A3MA 4COZA 4D3WA 4AHWA 4AI0A 4AI1A 4COVA 4CP1A 2XJSA 4CP2A 4GQ7A 2XJTA 4LHKA 4AHYA 2XJUA 4ASLA 2XJVA 2XJQA 4AHZA 4AF9A 4AFAA 4AI3A 4AFBA 4LHLA 4COWA 4A3XA 2XJRA 2XJPA 4AHXA 4AI2A 4LHNA 4AFCA 4COYA 4CP0A 4COUA 5A3LA
chains in the Genus database with same CATH superfamily
3BPSA 2D3RA 2YC2A 4QX7A 1W6NB 2OQ7A 3S1ML 5CADA 4EN8B 2K46A 2BV4A 1PGL2 3HT2A 2RM22 2RDRA 1C3HA 2GNBA 3RQ0A 3BYWA 5LWBA 3B7MA 3P8BA 5CVRA 3MV11 1TG7A 1RUE2 4XW3A 5F3EA 2E51A 4BHPA 1J3PA 5DAVA 3KYVA 3VGIA 5DUVA 1V00A 4OMDA 1R0IA 3MHZA 1BXHA 1D4VB 5CKMA 1H8TC 2ERFA 4F3JA 2B7YA 3A23A 3WVJA 5IAXA 5AI2A 1RJ7A 1C5HA 1R0HA 4IGQA 3WX5A 5BNQA 3CZJA 5JMOA 1W28A 5FR3A 4MGYE 1S0CA 1W9WA 3VDCA 3HOVL 3P6BA 1PMHX 1OFNA 1YFXA 4HLTA 3ZYRA 3LFIA 1UKRA 2NM1A 2R7ZL 2P37A 5EWSA 2FBEA 3L2HA 3WF4A 5CFCC 4D7TA 3I4NL 2WO2A 1FXZA 3D5OA 3NV2A 4GH4A 1OOPA 2RS31 4Q5OA 2AEZA 1DQ0A 2UY9A 1D2SA 1X9PA 4TXWA 1WMXA 3GF6A 4IETA 1YQ6A 1EUUA 5IY0A 3MI8A 2QQIA 2XJQA 3CLPA 2PMZP 1MZ5A 2GC2A 5D8AB 1RYTA 1YXWA 2ZX1A 1U5IA 3MIHA 4LO5B 4GZ9A 4CDQA 1PFWA 4XBNA 2PHDA 3PIGA 1ASJ3 2P3JA 2ID4A 5L7OC 1J3RA 4GWMA 1QMJA 4H7MA 4Q8KA 4AFDA 1IW7D 4WM7C 2CU5A 4RSUA 3I54A 1QJX2 3H8XA 3VLBB 3C8XA 2AUSB 5EJZB 3WNNA 1H2KA 1YFUA 1SBFA 1VZIA 1GV9A 4UT5A 1XC6A 2WR9A 2Q8DA 1GZ9A 1I6XA 3GTOL 1IS3A 4J25A 5KWRA 2QQKA 3KVBA 1KFUL 5FZFA 1QQP1 1Y4WA 3VD7A 1W2UA 3VDDB 4HMZA 4AFBA 1ZA7A 1JYNA 3HBKA 3AXEA 4FOQA 5HCFA 3TNQA 1EY2A 4Z8BA 1LKOA 2V3BB 3ACFA 1O4YA 3RRDA 2YU9L 3IT8A 3PKIA 2XVLA 4FPLA 4LIUA 1CGPA 3AJZA 3VZLA 4B4PA 4E2QA 2IZWA 1AR93 3OEBA 1AR61 3IIIA 2NVXL 5T54A 3BTYA 1JBCA 3FUOA 4QU2A 4UW3A 2CDOA 3I2GA 5JOXA 2AACA 5F5QA 2FDGA 4RXNA 2DVBA 2GMPA 2D6NA 1N3PA 2W46A 1H2NA 2XB6C 1JYIA 1OLME 1RIRA 1BK1A 2WAAA 2YC0A 4HOOA 5IVEA 4MGKE 2XGXA 3CHXA 1REEA 4LKSA 4ZXKA 4AI8A 3WT3A 4XDPA 2F4LA 1PMIA 5CBLA 3LCPA 5I91A 3O1TA 4BU2A 3I3QA 1RB8G 1PO21 5JVVA 2FMYA 3DL3A 4N43A 1O3QA 1V6IA 1W9YA 2PHUA 3OBRA 1QJU2 3VDDC 1XQNA 3B9CA 1UCXA 2KXLA 3T08A 4CDQC 3TEYA 4N9HA 2YBSA 4G4FA 2WIIB 3A0KA 4WVVA 1KJRA 1QF3A 2VZUA 4PDWC 1DQ6A 3LWCA 5EJ1B 1UZVA 4MXVA 2ARAA 1TEIA 5FYIA 1I3HA 2Q4SA 3QVDA 4CUBA 3R4DB 3AB0A 2A75A 4ISRA 2ZX2A 5FPBA 3KV9A 3M7AA 4LHKA 3AYEA 3IDEA 3NL1A 5FO9B 3LSDA 1NYWA 3RWKX 2JE8A 2PLV3 4ES9A 2P1BA 4QQLA 4DUXA 2P5BA 3OGSA 2OX0A 1AR62 1SEFA 1AL22 2RR11 5FMDA 3ACHA 4NE9A 4UF0A 4YZ5A 5F3CA 3VN4A 1ZRRA 4MXWB 1OT5A 3VBUC 4JVAA 4RR3C 5BUVA 1YI9A 4YZ1A 3PTYA 3U10A 5C4WB 1CIWA 2IFRA 1XNKA 3MPPG 1BQ8A 1HKDA 2K9ZA 5JVH1 2PHXA 4HN1A 1MS3A 4KWUA 3P2AA 2ATFA 4AQ2A 2WABA 5EQUA 4NHLA 4Q1PA 1CD3G 1UPIA 4HT1T 2OZJA 1F9KA 2PYAA 1VRH2 2X29A 5FXZA 1D4M3 2VQ0A 5FZ9A 4AR2A 1QGLA 5F2SA 4BQ4A 5BNPC 5C3QA 3BB6A 4XDQA 4JAFA 5CNAA 5DN2A 4CE8A 1LHUA 1RUH3 3H99A 4HFSA 4QX8A 5JZGA 3ZKUA 2CKAA 5M5WL 4LHSA 1DGRN 2WA4A 4XFBA 1F4AA 3BALA 1E8JA 3G7DA 2DU1A 3MLLA 4LORA 3WW1A 4YWLA 2EAKA 5EXOA 2NVTL 4CVUA 1H9WA 4QQOA 1PZ8A 5GJ6A 1D4M1 2D93A 2VPVA 2YZ4A 3B94A 1NX9A 4K20A 1DF0A 5FPLA 2LTNA 2WN2A 5KHHA 1Q8PA 2Y6JA 1VBA2 2D97A 3UESA 1N1YA 2RFKB 2WNUA 2BBVA 4UW6A 1US3A 2OW4A 3VBRA 1HV0A 1V6JA 4AGGA 4NN0A 3DUIA 4GKYA 2YPDA 4DEQA 4HK9A 3S5QA 5FYSA 1CQ9A 2H0VA 1W6OA 5C3OA 1CZSA 2OPKA 3Q8CA 1D0HA 3MGUA 4HETA 1OOPC 4AQ6A 1W8NA 3WOGA 3AP4A 4PT6A 3WG1A 1C1LA 4XVHA 5FOBB 2JDYA 1PGSA 1O7FA 4UW4A 4YW1A 3BTXA 3WQ1A 3MPBA 4A6OA 1REFA 5ABJA 1OA3A 4XJAA 1WCDJ 4YVWC 4ZU4A 3ECQA 2H6CA 3H3UA 3IU3I 4A3JL 3WNLA 2YPJA 3SS2A 1W39A 1LNSA 4DXZA 3AP9A 1IOAA 1AYN3 1KGYA 3B00A 1VBE1 1OWBA 1XOYA 4AAXA 5K2ME 1QJFA 2QQMA 5F6KA 2PLV2 1KJLA 4LPLA 1W99A 2EXIA 5T52A 4DXTA 4CDUC 1LEMA 1I5ZA 3OD0A 3AKTA 5FZOA 1RGSA 5D2AA 4GS7D 5JI7A 3NSTA 5CZKA 4CDWB 4F7ZA 1UYYA 2XJUA 5FJ8L 3JXSA 5FZAA 2V4AA 2BU9A 5JOZA 2WC2A 2PAKA 4YM1A 5ANQA 3ATGA 1N1VA 4YVWB 5FZ8A 1ULFA 1ONAA 4GH4C 2I74A 1UIKA 2D6LX 5B2GB 2AQCA 3O5SA 4LKFA 2Y6HA 2YU1A 3H3LA 5T5PA 5HCHA 5FXXA 2KKDA 3ZFEC 1SMUA 1VBD2 2YDEA 1N47A 1AR81 5A6YA 4A3LL 4PI0A 2EIEA 3PTRB 5FY8A 1MS1A 1UZWA 2QDRA 3ORJA 4CA9A 4JV4A 4V1PA 5C8CA 2VTFA 4KWLA 4LBJA 1VZGA 3AYDA 3I8TA 1Y7BA 4K21A 1NA1A 3MUY1 1IZ3A 2XBO2 2O8OA 1U5ZA 3DEMA 2NQYA 1WLTA 2K2SA 4HK8A 4AFAA 2UWCA 5C3RA 2YGMA 5JXIA 5LCWL 4XBLA 4GJZA 1HN1A 2A70A 3VBRC 2V5DA 2WA3A 1QDOA 2GAUA 3ZXFA 4ARYA 1OH3A 2JG8C 3OPWA 4URAA 2RS33 1WLCA 5IYCL 4GB32 3AFGA 5GLWA 4R9CA 4XJZA 2WWJA 4PLNA 1B35B 3ZPOA 1CAVA 5JSPA 2OQ6A 4RGGA 2BP6A 4UOJA 3ZYFA 2C9KA 5A32B 4XJWA 4C1WA 1FV3A 2HWD3 5FP9A 1T2XA 1HV1A 1OFSA 2RS11 5FYZA 5F5IA 3UKVA 4NR1A 4QPIA 4HONA 4CPBA 3HIFA 1QCVA 1DGWX 1T6BX 2QUOA 1ND2C 4OUSA 4PDWA 3H9CA 4CDXC 4QXHA 3UNPA 1IHMA 2HWD1 2A3XA 2DCZA 1C28A 4MV2A 1LB2A 3HAGA 3OUIA 3UJOA 5M3ML 1YEWA 5FLIA 1R091 3LPFA 4L92A 4E4ZA 4RHV1 3M3QA 1WUVA 4XACA 5CISA 1UOFA 5KXEA 4B3NA 4JGYB 1E5IA 2WL1A 4LBKA 3SLIA 1S2EA 4PJYA 2AREA 3FZ3A 1XYOA 1UY3A 2EXJA 5DMYA 1W8UA 1SDDB 4IQPA 3GDBA 4L9BA 5IYDL 3EXUA 4WZFA 1ST8A 3ILNA 1C1FA 3VBSA 5GLTA 4FXKB 5FPAA 2WNOA 5GADc 2FMDA 4K8RB 2EF6A 3AJYA 4JC1A 4OI0A 4CCEA 4Q4Y3 2Y38A 3T2TA 1AYM2 4NIGA 1PK6C 3VKNA 4QB6A 1AR83 4OI2A 3C7EA 2ZHNA 4Q0SA 3RWNA 4DZGA 3HNYM 5C4XL 1SMVA 1ZZ6A 3L2YA 4IV1C 4MSVA 4RGAA 4E4HA 5JSRA 4TTGA 3BTAA 1O6UA 1ZZBA 1WW6A 5MF6A 2WLQA 4Y5TA 2ZBJA 5CKQA 4MG2A 1COV1 1A3KA 1EAH3 5GKAC 4KBZA 3EYPA 3RGBA 4XJ8A 1FI2A 1XU2A 2ARBA 2HWB1 2YROA 3KM5A 4N90A 1WMEA 3JD72 1MR5A 2EIGA 5CB7A 2WRAA 4FFFA 4JZRA 3N9LA 4NVPA 4LO4B 5DXDA 2JI3A 4YM3A 2B5ID 1HW5A 2PELA 2DBIA 2Q30A 3AYAA 1BJQA 4S2DA 2KD7A 3J8F1 4C3IL 4Y52L 4GJYA 4XQDA 4OI4A 5C5UA 2ZX3A 4AI3A 1W9FA 2XG3A 1OD3A 4TPUA 1W8WA 3BCWA 4GXLA 4P9LA 3WDVA 3A0NA 4FSJA 2R072 3VD5A 2PHWA 3LA2A 5DABA 1W8ZA 1LOGA 5A33A 1GYKA 1DGWA 4IE4A 1JYXA 2ET7A 1TWCL 3SNMA 1UY4A 2NPIA 2BJSA 5IVFA 3TEZA 5KC5A 4YLZA 1VAMA 5FXWA 1NNQA 2LROA 4AFMA 4R9BA 2IFWA 2AR6A 2VMGA 4QT6A 5F37A 1DHKB 1EV11 1B2OA 4HPKB 4ZXEA 1VAVA 1X9TA 2WZR3 3S1NL 3H42B 1PNFA 1DZTA 1CAWA 2GMMA 1Y9QA 2BWAA 4INDA 5HV0A 2IXCA 1I9RA 4ITCA 4CEWA 4I3PA 1VBB1 1TME2 1BKZA 2PHRA 2A3YA 2X10A 2XVKA 1N1SA 3HKZP 1W04A 1WBFA 3JB4C 3PUAA 3RYKA 2Y6GA 1AUYA 1G9FA 1LOFC 2HWB2 2ZEZA 4JTOA 5HXVA 3LDRA 1LENA 4HSLA 3CJXA 3LEIA 2VBBA 4DEVA 3ZR6A 3P3NA 2VQTA 1W03A 1IKPA 2JA6L 2R061 1G8WA 4XOGA 3PVNA 1STMA 2E9QA 1Y1WL 1HLCA 1S0GA 2JA8L 1OMIA 1JHJA 3MDPA 4P9JA 2HYXA 4L97A 3LDKA 1OD5A 4EZHA 4OI1A 3FC0A 3IDBB 3ZKYA 5AFEA 4BB3A 3IDAA 3IN9A 4LULA 4PIYA 1HXS1 4FTBA 3IZOA 2Y64A 3MLKA 1WLWA 4UBHA 4FCAA 4XQWA 3D3AA 4YGBA 1ULGA 2JDNA 3NAPA 5DAPA 3MIGA 5E1RA 1XE8A 5C8CC 4Y22A 2Z3RB 4KGGA 2CDPA 5IJRA 2Z4FA 2JX9A 4XZUG 4DINB 3LSEA 3JBG2 4BMBA 5DDJ2 3VBHC 3PHMA 4Y22B 2XQRA 2XDVA 2JB8A 4NIHA 2BW8A 1NXGA 1YUXA 2VULA 3K51A 4AWDA 4LK7A 5FP4A 4A3KL 5EP9A 1S2KA 3RPQA 2D5FA 4YW7A 1HRV2 3KHCA 3T2QA 1YHFA 1VBB2 1FPN1 3KT4A 2VZVA 2QJVA 3CDZB 1FMD1 3NMBA 4G3YC 1JI6A 4IEYA 4WM8A 4YWAA 3PIO1 5EJ3A 2VL4A 4FQZA 4F8AA 1GZCA 3M8LA 4DUVA 5A1LA 2Y34A 2PHFA 3W20A 4BJ0A 3H3ZA 1K83L 4YGDA 5CFDA 1H1IA 2WWUA 3W9AA 1H8TA 4YG0A 2JJ6A 5C4JL 2Z79A 4P9YA 4QGMA 4QM9A 4V2VA 3WHUA 3OF1A 3PUQA 4DIQA 4Q4X3 4XF3A 3VHOA 5KHJA 2D3SA 4QIWP 1CPMA 4LBOA 1IU6A 4URTA 1GQHA 1FOD2 1QJU3 4CEWB 1CAXA 1HB4A 1P8JA 2VOKA 4BIFA 3AYCA 3WWLA 1R093 2PYTA 4LO8A 5FXVA 3W58A 4Q0QA 3T1MA 4AE2A 2JI1A 1GWLA 3LGRA 2ZGNA 4LBQA 4A3EL 4AHZA 3SEPA 5DAXA 4GWIA 2V73A 5FKCA 3VZKA 3WP4A 1RUG3 1LTEA 3O1RA 4CPBD 1SFOL 2APOB 5GAGc 4KGQA 4GB31 1NZCA 5FMBA 2VCMA 5FQ0A 1WW7A 2GN3A 5RXNA 2OIIA 3PUSA 3VBOA 4FOYA 1QXJA 2GN7A 4HVQA 3B0AB 2FDJA 4XUPA 5FZ0A 4EN9B 1FNYA 3QBQA 3F2ZA 2CY6A 3HJWB 1FAYA 3A21A 5FV3A 1PFVA 2EA7A 2WLPA 1BQPA 1BBT2 2Q1FA 5FZ3A 3U4XA 2Z3QB 5FPXA 1SLIA 2YBPA 3FHIB 1K5JA 4LO7A 1LOCA 4BLJA 1O8SA 3MSUA 4H7LA 4HZFA 1YV1A 2HWC1 2GC0A 3ACGA 4K7JA 4PCRA 4BM8A 1ULOA 1JUIA 1AYM3 4BZ4A 3HVDA 4QPWA 3OYWB 2D6KA 4H2AA 4AR5A 1IPKA 2RJLA 4I0AA 4Q8LA 4OZOA 5JLVA 1F8VA 3K7AL 1OHFA 1QJY3 2VZTA 1MACA 3LFMA 4C91A 1W3VA 1RXGA 4A3CL 4XCBA 3MPSA 2JG9A 2VUJA 1KITA 3PJYA 3QCWA 3WG2A 4BXFA 3K48A 3R0RA 1I5PA 2IXLA 4XFHA 5AC92 3CNAA 5IAVA 3AC0A 5A6ZA 4IV1A 4YVSA 3N4MA 4BBRL 1DYPA 2Z42A 4QB2A 5ACA2 4JHZA 4MLOA 2XLFA 4EQVA 4QHBA 4Q4W2 1KRIA 4YYOA 4M01A 5GZEA 3TEXA 4NPLA 1RUF2 2CSGA 2RDNA 5I8YA 4JGYA 4JADA 1DZQA 4D0QA 1PVC1 3RYPA 1UKGA 3OBTA 4IEUA 4S2GA 3TBDA 4AYUA 1JTZX 3BODA 4DQAA 1GP5A 2FHRA 3UGHA 3S2HL 3OG2A 1ZYBA 2RV9A 4LLFA 3DPRC 1AYM1 4QAWA 2KA3A 2C1FA 2ZX0A 4IV3C 3JCIA 5HXMA 3WEZA 4LBQB 2VC9A 2BGOA 5M5YL 2WFPA 2ZGMA 3FHAA 2W47A 1RUC1 3IIAA 4MZUA 1WA4A 4AK3A 2BERA 4PF1A 4BISA 2FD8A 4HANA 1DIWA 3DECA 4Q26A 3JU9A 4WVZA 3BOPA 3PUIA 2PQSA 4WM7B 4MGZE 1J1LA 3LNLA 4JCKA 4QGNA 1KS5A 3GZUC 4Q4Y2 3WD5A 1X36A 1XSRA 3KS7A 1YNAA 2DVFA 1H8TB 1DZRA 4KMQA 5I8SA 3NJZA 1POV1 4A3BL 3B3QE 1XNCA 1ZX5A 3CU7A 3J8F2 4CDUB 2FZ2A 2ZGKA 2B9VA 5HCAA 1IG3A 1QQP2 1LODA 2O14A 4M4RA 4K3UA 1QEXA 4WM8B 3E5XA 4RA0A 4XMAA 3P3PA 2BNNA 3IMNA 4HVOA 3PNAA 2QQLA 3THTA 3GJBA 2DCJA 5C8CB 2XUEA 4A3IL 1NUKA 2ZAHA 2XJVA 5DM71 2E26A 5CFCB 3N7KA 4K1YA 4JQRA 5K0UA 4DOUA 4E6YA 1JHNA 2RS53 2QFEA 3GZEA 1WJVA 3SC7X 1Y9MA 4XF4A 4WVWA 5SV8A 2I45A 2NLRA 2VBDA 1HJFA 5A7NA 5BV6A 4XUQA 4YVWA 1RUI2 2ZGSA 1RUJ2 3JQWA 3NAPB 4YW4A 2BNMA 3I7DA 2XMLA 1HB1A 4ZY9A 1RUC2 4QDQA 1OLRA 1VZHA 1GWKA 3B69A 4LBLA 1LHOA 5LK7B 3I4ML 2E7QA 5C44L 2WNVA 5MFZA 1UYXA 1UO9A 2WZ8A 5T3NA 3MW2A 5FZOB 2ZCWA 1UN1A 1VAKA 3FKIL 1FPN3 3KHBA 2WYFA 1EAH2 1CWPA 2CNAA 3GYDA 5T5LA 1SLLA 1UXXX 4C3HL 3I2DA 2GH8A 4H14A 3GTJL 2BVVA 4RS5C 2PAMA 3OB8A 3POWA 4META 1QWRA 3RNSA 3D4KA 2GDFA 5I0RA 1BEV3 1POQA 3C7FA 3O1SA 1VBD1 2WKKA 1F5JA 1YK4A 3LEGA 2QQJA 3CJIA 1VMFA 1VP6A 1RUG2 1O4ZA 2ZGOA 5G05L 5FY1A 2Z5WA 3ZMOA 5KHIA 1RUF3 1BVP1 2OA2A 2A6HD 1HB3A 4YM2A 2VL6A 3KQRA 2JDPA 2Q8EA 1SLAA 1PO22 5FZDA 4O9GA 4Y20B 1VBD3 2FCUA 1YO8A 5IW0A 4B4RA 4OHWA 4BH9A 1SLBA 4AHYA 1Q8OA 4NHXA 5DG2A 4TSVA 3AZWA 2BFUL 2D6OX 3HOXL 5FYTA 1WCUA 2LS6A 4E4DX 1BHGA 5F1RA 2VZQA 3RS6A 3C7OA 4LIVA 4OYUA 2WINB 3CL1A 1MEC2 4BQYA 1YLLA 3POGA 4JAAA 4U671 1RUI1 2VOVA 4LBQD 1VB4A 2RM23 1MS9A 4P02B 1OPMA 2UYBA 4DUWA 3KCYA 2BQPA 3EJKA 1S24A 5L73A 5LEKA 1AR91 5JZGB 3H3VM 1FMD2 4IUGA 2ADDA 5ISLA 3SCGA 4JGZA 1QNWA 1QJEA 1G7YA 2GNTA 4IV3B 3WUDA 1WWYA 1FX5A 2HWD2 2IVIB 2WWSA 1VBC2 4Y5SA 2QNKA 4QPIC 3PZAA 2CWSA 5FLML 5JVG1 1VRBA 4N7IA 3RG0A 3UGGA 4C8DA 4B8CD 1QQP3 1URXA 4XJUA 2VM9A 4O61A 2JA7L 4XJ9A 3JBG3 1W3XA 3FFZA 1F35A 1C8M1 5CIRA 2RDSA 5C4WA 1H4HA 3RZOL 3NRUA 4CUAA 1J83A 1W2TA 1QYBA 2FDKA 2R92L 3E97A 3MF9A 5FP8A 3KYXA 1H6XA 2JEMA 4M3CE 3PVEA 1FHMA 2C4XA 5KXBA 4FPFA 2VNVA 3KD4A 4P9XA 1MZ6A 2OUHA 1R9TL 5DAQA 5DUXA 1QQTA 1ULDA 2LUWA 3CJIC 1JZ4A 4I09A 4COVA 1HRI3 5KBFA 4UYBA 4LA2A 4E2SA 3GNEA 4JAGA 1K12A 1ZZ9A 3M3CA 4UW5A 4PIXA 3N7LA 4FTEA 1RMU2 4AGVA 4CU8A 3SISA 1W9TA 2G9ZA 3T3YA 3BUCA 1AVBA 2G19A 1NQJA 1OXCA 3LWOB 5M5XL 2NMNA 2W5FA 3HQXA 2ZIXA 5JIUA 3URFA 4D7SA 5GALA 3GBFA 1WMFA 5AI3A 4F83A 2EIBA 2A6WA 5L36A 1YRZA 4EZ4A 1DGRA 3IKWA 5A6XA 2ZPXA 1UX6A 1OF3A 1TZOA 5E8AA 4CP0A 5J1XA 3TNPB 4LO6B 1PO11 5GLVA 2DCKA 2NMOA 2VMIA 4FPKA 4GWJA 2RMU3 3TN93 4Z92B 1XB9A 1C4RA 4L11A 4MADA 3DV8A 1OC1A 3VZJA 3WF0A 1JOBA 4AVSA 3WCSA 2JDUA 1PVC3 2UWBA 3POFA 4JTNA 1GZTA 2QTWB 4U36A 4HKLA 3LPEB 3M3IA 4AI9A 2JG9C 4Y1YA 4NOTA 5FMOS 4EJRA 1RVF1 1ZRIA 2WFF1 4M0NA 1NXMA 2VZ3A 1R0JA 4UY81 2DVGA 2EICA 3HOBA 2DSXA 1OVPA 2Y6FA 1X8MA 2V4VA 3CIHA 2ZS6B 5T55A 3ZPYA 4BWOA 4COWA 1CX1A 1PO23 1B35A 1SPPA 2VQAA 1MQTA 5D8AC 4JKKA 3T0BA 1JUHA 3X29B 3NV1A 2P3KA 1IU5A 1R083 4XETA 2X09A 5IUQA 3FHQA 1S4CA 2MHFA 5JXGA 3VD3A 3HD8B 4N9IA 3TAYA 1TMF1 3B02A 1QOTA 3ZFEB 1HN0A 1K5MA 1Z7S2 4BA6A 2ZHLA 1W6QB 4A41A 1JYCA 5IYYA 4ZN1B 2ZGLA 1GBGA 2OUJA 4RD7A 4BQ1A 3JD73 1UAIA 1V9U1 5FIXA 1N3QA 3RYGA 1IQDC 1TMF3 2CTVA 2ORZA 3CZUA 3PMSA 1IGOA 2J22A 4FT8A 4GD4A 1DLCA 1S0FA 4XXAA 1IROA 2G4IA 4ME3A 3IDCB 3NJXA 4Y33A 3KT1A 1L3JA 3GBGA 3M4FA 2AYHA 1MQTC 3HMYA 1AL0G 4P14A 3I2JA 2CGNA 1HB2A 1PX3A 1H2MA 2GU9A 3O7OA 3S2DL 3FLTA 3OPTA 5CAZA 2RG4A 4NHYA 2BPA2 3THDA 4IGOA 5LW9A 2ZHKA 4CCOA 1R1A3 3WG4A 1PNGA 3HAXC 5GZGA 3N7MA 1BZWA 4EWEA 4XABA 1JW6A 4O7XA 2HEVF 2QL0A 4JHTA 4GALA 5GLZA 1PVXA 3PMEA 3FN9A 1OLMA 1J84A 4TZDA 3BTZA 2HKXA 1F5FA 3CQOA 1OOPB 1FOD3 5EFUA 1HQNA 1RUH1 3AM2A 3KZ4C 4AEMA 3ZFEA 2ORXA 2RS12 4B1LA 2XHKA 4MHUA 4QHZA 4CCCA 2J1EA 1E5RA 4P5HA 4LBMA 2D98A 3ZOIA 3DYMA 2WNUC 5GAEc 5ABJB 4NRQA 4WVMB 1W6MB 3AZXA 1PO12 1RUD3 1R64A 1GMMA 1MQTB 1YQ5A 4TYSA 4XILA 2ZMKA 2YHJA 5L9RA 2EXKA 4QQ2A 2A5ZA 5MFPA 2BNOA 1H30A 2CHHA 3OUJA 1IPSA 1NLQA 2ZTNA 2PVXA 3I59A 2OKXA 5BNPB 1B09A 1ENRA 5FYVA 1R0FA 2BZDA 1BRFA 3BOWA 1OQEA 2WSUA 3JB8A 1L7QA 5J36A 5JCTA 2VZPA 3BI3A 1V9U2 3AP6A 3WNMA 3GJAA 1RVF2 4NAOA 4XUTA 2VQUA 1UPSA 1E57A 5GZFA 1PGL1 2DBNA 3UYJA 4CCJA 4FAHA 3DN7A 1TNFA 3N9PA 3IWZA 1DX8A 1O8PA 4XDOA 5FK8A 2CYFA 1ZRFA 3ACIA 4LR4A 2GP3A 4O9EA 3QD6A 5A7WB 4LXLA 1Z0HA 2CR8A 1NE4A 5JSOA 3S57A 1X8EA 3U1XA 4JKMA 3ZFGC 2MNGA 3K2OA 2PPTA 3FDJA 4IERA 2A68D 1CAUB 1YYNA 1MPXA 4FOWA 4Y1XA 4B7EA 4COZA 1WA6X 3VBUB 3SEEA 4ZONA 5JI9A 1DFQA 1LU1A 2A71A 2E7TA 3V64A 4Z2AA 4LA3A 1JU3A 2H0BA 4XE9A 5A7QA 4A7ZA 5K9YA 3VHRA 4HL0A 3SMHA 3PKJA 5C70A 3WR0A 4Q4X1 2VU9A 4ZN3B 3F95A 4ES8A 2QZ3A 1B71A 4LKDA 3QQCE 3N9NA 1MS0A 4OUMA 2QQWA 5E6HA 4B29A 2GC3A 3O14A 4A3XA 1TVGA 1Q3EA 2DUPA 4Q0PA 2G1MA 4MXWA 5IVJA 2OVUA 2XPJA 3FJSA 4NAMA 4KU7A 1RUI3 2DVAA 1Q8SA 3CMGA 5H9PA 4KBBA 1NCQB 4N7UA 5LBEA 3UKNA 4PLMA 2WQ8A 1RC6A 3HWJA 4DO0A 1RYYA 4C0HA 1CIYA 1OBNA 1NA1C 4DMIA 4MYEA 3HJYB 1S0IA 2A6YA 3K4ZA 4XXPA 2HH9A 2R6QA 3KV6A 2E2IL 5FZGA 1VBB3 5MLC3 1H7VA 2C26A 1SFNA 4IE7A 5JUVA 4BPZA 3U07A 4N43C 4JGZB 4CEYC 5F9TA 4QQPA 5F3IA 2KM2A 2MS3A 1N1TA 2WZR1 3LA3A 1C57A 5ERLA 2XL9A 3AKRA 3ES4A 4CXYA 4P9WA 1WZXA 3DYOA 4Q0VA 2FDIA 5A7WA 1S0DA 1RXFA 1XRUA 3D8CA 1S0BA 1HXS3 4HG6B 4HXCA 4XFCA 3LZZA 2BBAA 1NCQC 3KCCA 3U4SA 1OA4A 1OURA 4AI0A 3LWRB 3BIWE 4ZHNA 3BKZA 3UK9A 3A7QA 1QIQA 1BLZA 1C8M2 4C0BA 2JIJA 4FP2A 5DAWA 5FZMA 2XWJB 3G6JB 1VMHA 2PAEA 4AQSA 3PIP1 3C2UA 1H9PA 1DU3D 3H8OA 1LR5A 3MV01 3GGLA 1AX0A 1CJPA 4JRAA 3I59B 1H6YA 1RMU3 4SLIA 5BNPA 5JOWA 3JBG1 5CYYA 3D82A 2A69D 2P2KA 3M2MA 5FUNA 1ACCA 1NZIA 2ZEWA 3IB3A 4FPGA 4OMCA 4A3ZA 4LUMA 4A44A 4OHYA 3LWVB 3VDDA 3K35A 2TUNA 1W6MA 4QKFA 2MEV1 4WVMA 3VBSC 5LZ6A 1Y1VL 2ZGQA 2CV6A 1AZDA 2JXAA 2HWB3 1FNZA 4H3WA 4Q27A 4HKWA 1XYNA 2XWBB 1QY4A 3GCWA 3Q8AA 5FMCA 4CP1A 1M06G 1EV13 5EIOC 1O5UA 5BYNA 1VE0A 2JKBA 1UMZA 3IMMA 3WZ1A 5EIYB 2WFF2 4J6GA 3E6DA 2GMGA 2RM21 2RVAA 1D7PM 1GNYA 3WG3A 2M4YA 5K8SA 5D1IA 4AYBP 1RUJ1 3AL5A 3VD9A 3OSDA 3SQOA 2J1SA 4U2AA 1XNBA 1FV2A 2Y60A 2X53S 5A7SA 1OUSA 3O12A 3RSJA 4AHXA 4YGCA 1AR63 3POBA 2WO7A 3I2IA 3LEMA 4Q4V1 4W8JA 4ARXA 3MF6A 5FYCA 5LBFA 5C71A 4CU7A 1NCRA 1QJY2 2AGSA 3MFCA 4D6SA 5FZ6A 3RZJA 2VZOA 3AFKA 2W91A 5K0UB 4LT5A 2A6VA 1AX1A 4PBOA 5FMOL 1YC61 3AL6A 1O3RA 5BNOA 2VW0A 4FPHA 1RUD2 3NAPC 2TBVA 1EP0A 1H4GA 1AR71 5E16A 4FBFA 2ZX4A 3BGAA 2HWF2 4Q4V3 4OHZA 3THPA 1IG0A 1ZBE3 2PMWB 3J7LA 3K3NA 4EYUA 1X33A 2B39A 1H1AA 4GH4B 5IHRA 1W6QA 1JXNA 5FYYA 1ENQA 4L8QA 1K5MB 4ONUA 1NLRA 2VCBA 1G6NA 1QXRA 2J7MA 2VUCA 2VMHA 2P4EA 2FCVA 1UL9A 3A4UA 2X5IB 3GBWA 1S1AA 5BPXA 4AFCA 2R93L 3J7Y1 1SPPB 1TWAL 4IE6A 1ZBA2 2D7FA 5A3MA 3ZDSA 2VUML 1IS4A 1VRH3 1RUE1 3VPBE 3ETQA 4TLGA 4MOAA 5IFPA 3NNMA 1OKOA 1RDGA 2WNVC 1LU2A 3LEKA 3O1OA 5A7PA 5IATA 5LRRA 4NMIA 2YG0A 4JAEA 4Y1ZA 5FWEA 1DGLA 4IESA 3ZSKA 3WDYA 3NFPI 3AK0A 2HBTA 1W6NA 1AR92 4TLFA 1EUTA 2ZGUA 4J1XA 4EWAA 4I2OA 1KQRA 3ZSMA 3WCRA 3RI8A 3ON7A 3WF2A 1O3SA 2D43A 1IKQA 2JECA 4XURA 2QDNA 1QJY1 1HRI1 1CONA 1V0AA 4GWNA 3ZMNA 4EE2A 2G9FA 3IAPA 2H12A 3ZM8A 4B7KA 5FFOC 2B8MA 4R4XA 4AVBA 2PTMA 1RHI1 4W6YA 2HWC3 2VMDA 1J59A 2WS91 5TSWA 3S16L 2BYVE 1TME3 3V0AA 1FYUA 4M0HA 1DCSA 5FZCA 1R1A1 4IEPA 4AEKA 5AVPA 2R30A 5DZEA 4YVSB 3ROUA 2TEPA 1BE7A 1O5LA 1O3TA 1ODHA 4QXKA 2HWF1 2VGDA 3ALQA 5FK7A 3IAQA 1XE0A 5C6CA 5LA9A 5IVCA 4MGTA 1HRV3 4BE3A 2JG9B 4X6AL 2J1AA 4K1ZA 5C9AC 1YIFA 1CVNA 2OZ6A 2VNGA 1ZBA1 3AMPA 4YW6A 3ENRA 5FZKA 1XXNA 4RS5A 1V6LA 1KXGA 4OVEA 2W9XA 3OYWA 4YW5A 3GM8A 2GNDA 1O59A 3FE5A 1ENSA 1SZBA 3NWKA 3BPZA 1K3IA 2R041 4A4AA 5EV7A 2W1UA 3T2PA 3S5AA 3LE0A 2R7EB 4IEXA 1JMUB 3ACLA 4XEZA 5FO8B 1QNYA 1UU5A 3BIEA 3B01A 3J7HA 3J4UH 1GP4A 3MZHA 2ARXA 4IV3A 3PVOA 5KC6A 3GCXA 4PQQA 5IWFA 4AEDC 2F4PA 1R1ZA 5FP7A 3WY6A 2JG8A 3T1LA 2W52A 3O1MA 5LASA 2ETEA 3CF6E 2ZEXA 3LIGA 1XNDA 1H1MA 1UMHA 5HV4A 1TWGL 3I2KA 1UOJA 1CN1A 1W6PB 4RGKA 4UBGA 3I3DA 3ZXDA 4COYA 1RUF1 4J1WA 1EPWA 4AZZA 1WBLA 2KR2A 1RVF3 1WD3A 3HBZA 2ZABA 2C24A 4Q4X2 4TN7A 4G6BA 4P9GA 2BEOA 1RMU1 1UMIA 3DKQA 1EYBA 1LHNA 2YB7A 4JGYC 3AVRA 1BYHA 4GMP1 2V5YA 3HEIA 4XFAA 3LWQB 4KQ7A 1MS5A 1V6MA 2RMU1 4UWDA 3TN91 4CDXA 1NQDA 1PO13 4QMAA 2EVXA 2HJIA 1U0AA 4Y20A 4XBQA 5A3NA 1SCSA 1P7PA 5CU1A 4QQHA 1UY1A 3I4IA 1JODA 1UWWA 4O65A 4CCKA 2ET1A 4YVSC 2HBUA 1GOGA 5E89A 4KI5M 4FTSA 1CJDA 2W1WA 1I50L 3CJIB 4MO3M 4XTPA 5JAXA 4XHBA 2V0FA 2J42A 2P3YA 5H9SA 4IGPA 1N3OA 3JUUA 1SMWA 2Q0AA 5I8TA 4YARA 4K6BA 3VBHB 2NN8A 2WT1A 3NO8A 4FAGA 5KXCA 3H8RA 3C7HA 2RDVA 3WINE 1UX7A 3U0ZA 4FPCA 1PZXA 3H50A 4P5YA 4S2HA 4XMIA 4CUGA 4NWVA 4CYDA 1BK0A 2BOJA 2WNVB 3R6SA 3VBFC 1MEC3 5FOJB 3RZZA 2CL2A 1CADA 4LBNA 2PQQA 1ZZ7A 5GZDA 1RUG1 1U5YA 2DWRA 4WBBA 1XNAA 5J48A 3B5LB 3ZYPA 4DXSA 1O91A 2ADEA 2GSYA 4MVTA 1TMF2 1ZRPA 1LOFA 3ST7A 4JDOA 4ZPIA 4LUKA 2NVQL 1MEC1 1W8TA 2ZKNA 5LB6A 4BQXA 1DQ2A 3K3OA 3KWVA 4FI9A 1OVSA 2YC4A 3HOYL 1W9SA 5FYHA 1JZ5A 1E5HA 4NRPA 5CG8A 5CFCA 3LF7A 1T6GC 2VO5A 3K4DA 4JDNA 1SBDA 1ND3A 4CRQA 1X7NA 1ZNPA 2XBO3 3RZMA 3PUHA 1CZVA 2D3PA 5CG9A 2XKOA 4ZS3A 4BK5A 1S2BA 2BDRA 3MLJA 3I3BA 4R9DA 5BNNB 5DZFA 1SFYA 4IE5A 3GZTB 1ZA4A 4BCUA 2XVGA 1AJKA 3N9QA 4AVCA 4CDUA 2LCQA 4Q4W3 1QXPA 2Y6KA 2M6OA 5IFTA 5M0TA 1G9AA 2CGPA 1NY72 2YBKA 2CGOA 1OH4A 2V72A 2GH2A 3FLPA 2A6ED 1IPJA 1JZ3A 4XHXA 5LY2A 1FHHA 3SHRA 4WM7A 1JYTA 1Q8QA 2C5DA 1ZBE2 2DFCA 4W6WA 5DZGA 1PVC2 5JWPA 3RZGA 5JPMB 2R32A 3ZDVA 2FDHA 1NLSA 3AP5A 3UETA 3UT0A 3WNXA 5JR7B 4XF9A 1GU3A 3LA7A 2RMU2 3TN92 4ASMB 4D8MA 5I93A 1UYZA 5LRSA 2VR4A 3H0OA 2IXJA 3NV4A 3QH7A 4XUOA 4HPKA 4A93L 5APAA 3DYPA 2J9UB 2EXHA 1UY2A 2A6ZA 3FFQA 3IPVB 1Y3TA 2QCSB 2IXIA 1V6OA 2L9LA 2YFUA 2ZZJA 1D0GA 4XUNA 4IEVA 3HOWL 3ZN6B 2UURA 5FZLA 4FQ4A 1A6CA 2E63A 2VTXJ 3ITQA 2WJSA 2ZHMA 2B45X 3MYXA 1NXD1 1WD4A 1Q5OA 2RJ2A 3GTGL 3ELNA 4A3DL 4R8HA 4ASKA 1XBFA 1EV12 4LMFA 2BE5D 3POJA 2MPFA 4M3CF 4IV1B 2DCTA 1W8OA 3VHPA 1TQ5A 4X8PA 3WNKA 5I0UA 4ASLA 4OHVA 5CFDC 4QX2A 1VBC1 1UD1A 2PVEA 4LITA 4AGRA 4WM8C 2WB1P 3WQ0A 4D69A 3JQXA 2XJRA 1ODMA 4UFLA 4Y1UA 3EBRA 2RDQA 1Q8VA 4BY7L 5FY0A 5LBBA 1R092 2B4KA 3MO4A 3ZSLA 4RQPB 2CAVA 2ZGTA 1SMMA 1A8MA 1LOBA 1RUNA 3S30A 2E33A 3ETPA 3LDBA 1I6HL 2EIDA 2JD9A 1BFYA 4D3WA 1KDKA 2XLAA 4QX1A 4BYYA 4IEQA 1G9BA 2DTYA 3VBFB 5EPAA 2PN5A 4AL9A 2WN3A 3K4AA 3M3OA 5FBJA 5FYMA 5FJKA 3DF0A 1JOPA 2WO1A 3KVAA 4MH0E 1BCXA 4JGZC 4DY5A 5J3UA 2WQ4A 3VZNA 3FL7A 2B9UA 1RDVA 4LOTA 5EZWA 3NKTA 5LA2A 1RWDA 2VNOA 3KMHA 1QJU1 4MUVA 1NT0A 3VBOB 5F39A 3AVSA 5AC93 3TYJA 2HEYF 4R9AA 5FQ0B 3ME2A 3VZMA 3HT1A 3HOZL 4QXBA 3WLUA 2LRPA 5A3WA 4CCDA 4DRVA 5J7MA 5LY1A 2W87A 3ZFGA 1RUOA 5FKBA 5AN9H 3MIBA 1VRH1 3FUQA 5DDJ3 1GQPA 3ZXAC 2LALA 4ZZ8A 4FXGB 2R073 3NV3A 3K75B 3N7JA 4H55A 4PIZA 2VUDA 4QPIB 2BVBA 4XF1A 1YI7A 1CAXB 3DKWA 2GNMA 5F6LB 2OXBA 3ZO0B 2P6CA 1UZYA 3P5BA 3T30A 4RHV2 1LKPA 1Y9GA 3FBMA 4HVRA 4I0BA 4V2WA 1CAVB 4QXCA 2E53A 1F31A 2X05A 4AEDB 4QWNA 2R071 4NHMA 3ZLIA 3RZTA 1QKQA 1QOOA 4EV0A 5FZ1A 5AFBA 5CFDB 3VUOA 3O1VA 3U75A 3MBWA 4XYXA 2AZ5A 4HN0A 2DTWA 1YQCA 2HWE2 1JYWA 3ZIXA 2XOMA 4CUCA 5JMCA 2B63L 4YRDA 3TB0A 1HQWA 3D0SA 3WF3A 4A2UA 4E9KA 1RUH2 3DGTA 4JRLA 4K40A 5AC91 2Y6LA 1B35C 3MICA 4RHV3 5F5AA 2IUWA 2QQPA 5H9QA 2E2JL 3LWPB 1ULCA 4FOVA 4LLOA 5FY7A 1W0OA 3V65A 1PIV3 1BBT1 3WDUA 5FAXA 4XCAA 3P1IA 5GZCA 4PF5A 1WCSA 2VXRA 3ZXJA 3H1YA 5FLHA 4RL7A 4BY1L 4PHZA 4RFT0 1H8VA 4AI2A 2J1TA 4CEYA 3W59A 3DPRA 4UFKA 5T5OA 4RR3A 5FZEA 2H6BA 4Q2FA 2DYCA 1LGBA 4YWMA 2R063 4XQ4A 4BXXL 2DUOA 1YWKA 4QB1A 4QDRA 1OA2A 4L0PA 3RI9A 2L0ZA 1AL23 4LTAA 3SKJE 2W92A 3WW2A 3O0WA 2XHNA 3OTFA 3K46A 3WHTA 4CCLA 2XQXA 1LOEA 1GSLA 4B1MA 2WUHA 2XBO1 3OY8B 4ZS2A 3IBMA 5L7OB 1K5MC 1POV0 2PXJA 2WBKA 4ZU7A 2J1UA 2DU0A 1HX6A 2VD7A 1GFF2 2LM3A 1ZM1A 5FUIA 1UNBA 2X5IC 2IXKA 2VE1A 3LKJA 3Q8EA 3THCA 4C90A 2YUEA 3I49A 3NNFA 4I02A 4XAEA 3I2HA 3ZFFC 1O4TA 3WXPA 3SITA 3OUHA 5T5JA 1OKQA 3W5NA 4CP9A 1T9QA 1VBA3 2VXJA 3KSCA 3ZYBA 1VLNA 2WYSA 1YIPA 3S15L 2Z2SB 2SBAA 5IK8A 3U78A 2VOWA 1WCKA 2VOXA 3VZOA 3OGRA 4EN0A 1LHVA 4CP2A 1D2QA 1W6OB 3VDBA 4BQ2A 1YJKA 3V0BA 1CAWB 2JDZA 3NNLA 2ENRA 3KGZA 1MVQA 4L2NA 4AQTA 2C6BA 3VBRB 5LA1A 2VOTA 3ZX7A 1GQGA 1F4LA 1B13A 1RHI2 2JENA 3ZFFB 3E6CC 2HVYC 1AX2A 3POIA 5FZIA 4NRMA 2GALA 1JS9A 1NXEA 3AMQA 3AKPA 3R4UA 4DRRA 1WW5A 1UQXA 2VW2A 1TE1B 4UFMA 3HR9A 2I2SA 2RHPA 3RJRA 1QU0A 3JR7A 3S6PA 2ZGPA 3H1MA 5A33B 3TEWA 2XONA 4NIIA 4E4SA 4R52A 4YZ3A 2BWCA 4CTEA 4Y4RA 2VCCA 4DPNA 1JZ2A 3W5MA 1ZZCA 4K9FA 3E6BA 3USUB 2HLEA 3O0XA 3WNPA 5JPNB 4QKDA 5K7PA 4UXAA 2VW1A 4GQ7A 1UU6A 3RZDL 1JU4A 4YZ2A 1PFUA 3MFAA 4GMP3 3ZR5A 2RE9A 3WV6A 3V0BB 3DXTA 5DPNA 1MZFA 1Z78A 2R1DA 1Z7S1 5EHDA 2WSVA 3MQKB 1C09A 2VY0A 4FFHA 3VKFC 5C5TA 2W95A 3C7GA 4QHOA 5CEHA 5GLUA 1HDKA 2SLIA 3OGJA 5GM0A 1COV2 5HCBA 5DQ0A 4CP9B 2QKDA 3AZVA 3BU7A 2HEWF 4UF0B 1XE7A 4N53A 1AYN2 3RVHA 5A3UA 4D6QA 3FLRA 3MW3A 4LKEA 2JB4A 2PHLA 2JA5L 3T4VA 4A6SA 4D7YA 4AI1A 5LA0A 3S1QL 1U12A 2E32A 3I97A 2KN9A 3AMMA 5DUUA 1JH5A 5L7OA 1KFXL 1S30A 1VALA 1W90A 2HYKA 3OY8A 5A1FA 4Q0UA 3U37A 2VZ1A 4YW3A 2DURA 4UAPA 3S14L 4JKLA 3VBSB 1YFWA 5G04L 3VV1A 1WLDA 4YGEA 4KH9A 4AOCA 3LOBA 2FCTA 5FYUA 3OBAA 3RYRA 4EN6B 1OQ1A 1H2LA 3PU3A 3T09A 4LHNA 1JYBA 1ZBA3 4CEYB 5FTTC 5IP9L 3NJYA 4N43B 4NHKA 1G9DA 4AVVA 2VMEA 5IVYA 4WV8A 1Y43B 3WDWA 4WZCA 3T0DA 4CCNA 5C3EL 5FZBA 2NYDA 3GTLL 4PDWB 2XJTA 5A6QA 1RUC3 1LEDA 1NE6A 2UU8A 3QH6A 4UFHA 5HI0A 5FZHA 1Z92B 1V9U3 3H7YA 1T9OA 3KF5A 3SXWA 2XXZA 4YSFA 3S7IA 5DG1A 4AF9A 1CAAA 1DYKA 2J1VA 5A80A 2GZWA 5A32A 3RZHA 3N9OA 2VZSA 3Q8BA 1JZ8A 1FT9A 1GNZA 4NJ4A 2YU2A 1RL3A 1LTLA 1QOSA 3KYWA 2Y0SP 1LJ7A 5FJHA 1SLCA 5C4WC 2QQOA 1JN2P 1U5XA 1PIV1 4LK6A 3QLQA 3T4HB 3K77A 5A1AA 3WWNB 4FP3A 2VVFA 3N35A 2XJSA 4QX0A 4NPMA 1HIXA 1NA1B 2W1SA 4XIKA 3ZYGA 1YCIA 3FMGA 5M3FL 4KNCA 5FCCA 2XLGA 3I2OA 2Y0IA 3ZSEA 2UYAA 4XZPA 5HBAA 3I2FA 4DS0A 3VD4A 5CKNA 2K2DA 1GWMA 1LKMA 3CKHA 4FPOB 2W94A 2WFF3 3PDQA 4OCTA 4Z07A 3ZFGB 4TWTA 4CEWC 2O5JD 1KDMA 3T2OA 1DG6A 4BQ3A 5A70A 4BQ5A 3LQCA 2ERJA 1QJX1 3A22A 3OCPA 3UKTA 1HJGA 5JR2A 3ZVXA 3AMHA 1MS4A 1ULPA 4YG3A 1VJ2A 1XYPA 2XUMA 5F32A 5KHKA 4SBVA 5AVAA 4GA9A 4Q4Y1 1UW8A 1OF4A 4ZZ5A 2GMEA 2Y8KA 2VG9A 3OPZA 3O1UA 3D6EA 2VNRA 3M70A 3MW4A 4CSWA 1FPN2 1B2JA 2QQUA 4Y7NL 4AG4A 5H1Sc 3PO2L 3HQUA 4CDWA 4I0WB 1WCQA 1LCLA 1OLQA 3ZXLA 1YUDA 2R1BA 2YV8A 3QOPA 3N3HA 4RFRB 4YZ4A 4Q1RA 4YPJA 3VBFA 2O1QA 1EPZA 5F7UA 1AR72 1NCRC 1AF9A 5FUPA 5J37A 4X6RB 2HWE1 4NPRA 3HN3A 1AR82 2AUYA 2WS92 4DNYA 2Q5TA 4N53B 5L9VA 3O1PA 4KG8A 3WW3A 1KEXA 2DCYA 2XKPA 2YYOA 1QJZA 5F2WA 1WCML 5IVBA 3S17L 1SACA 2WO3A 3KF3A 2WZR2 4E2GA 3HPNA 3LB9A 1Q56A 4P08A 1UIJA 2RS13 3A44A 2IC1A 3NVCA 1I3QL 4GKXA 4CDWC 2JE7A 4UI9L 3SH3A 4NWWA 2R042 4OZXA 2WAQP 3HJRA 2DVDA 3ZG6A 4LQRA 1WKYA 3PVBB 3POEA 3USUA 2OYZA 4AW7A 3CO2A 4FO9A 2WNUB 5ABJC 2G9GA 2DF7A 1ENXA 3ZYIB 2VH9A 1UOBA 2YY1A 4XTMA 2C6SA 2ZJCA 3GXUA 2VBPA 2AC1A 2AYJA 2MEV3 1UXZA 4A42A 1DDLA 2WQZC 3ZN6A 1RB9A 5IK5A 2JIGA 1PIV2 3KYUA 5KR7A 4JDMA 2FDFA 3O0VA 2A73B 2WDBA 4PLOA 1PGW1 5IK4A 2ZZQA 4BBSL 3B9IA 3IPVA 3USSA 1SCRA 1AL21 2DUQA 2RR12 4FFGA 4MGIE 3ZFFA 3ASIA 2A6XA 2ERSA 2PA7A 1TWHL 3UV9A 4DY3A 1ZZ8A 4IDZA 5K0UC 2P17A 3LOIA 1NKGA 5IP7L 2W1QA 1BVVA 4YW2A 3FWEA 2ZOEB 1F15A 2W0XA 1TWFL 3KQ4B 4Y5Z0 3EHKA 3PIJA 5JDBA 1XNTA 3GTPL 1R1A2 5FPZA 2WAOA 4CU9A 1K45A 4R4ZA 4M4PA 4E27A 3SCFA 4GMP0 1DQ1A 4Q29A 5H9RA 1OWCA 3FBYA 3IM0A 1XSQA 5A3PA 4C1XA 3VHNA 1X50A 2C9AA 4X8NA 1R0GA 4P00B 3RZKA 1KS4A 1F4HA 1FATA 3AKSA 1ODNA 2PFWA 1PX4A 1RINA 4AHWA 4PBPA 2EY4E 2ARCA 3WUCA 3GALA 3OGGA 3KV5A 2Q8OA 5FDBA 3SCHA 1BQ9A 5BNNA 3H8UA 5C3SA 1EAH1 3RFRA 4RYDA 1VIWB 4NIAA 2A3WA 5EYYA 2GC1A 5FP3A 3KGLA 3S1RL 4N53C 3WP6A 1GNHA 3KT7A 1CX4A 4XPVA 1RUJ3 2WT0A 5A7OA 1XU1A 1D4M2 1W05A 3VBOC 1VBE2 1OPOA 4Y4YA 4RR3B 2E7AA 1LGCA 3ZYJB 5FO7B 8RXNA 1XPWA 2YMZA 3DPRB 3MIFA 4IL7A 4Y1VA 1SDWA 4IEZA 5FWJA 2RS52 4QPGC 2B5HA 1SBEA 4BQWA 5ACA3 3NQHA 4CCMA 1C8NA 2ZEYA 2QVSB 2Z69A 3OEAA 3PURA 1DQ5A 3ZN4A 1PK6B 1MVEA 4BDVB 2Y0OA 2F6BA 3HNMA 5LATA 2Q1MA 3B93A 4QX3A 3POSA 4YFWA 3ZN5A 3OOXA 3AZYA 1G9CA 4IEWA 4POGA 2CAUA 5LK5A 3WP3A 4RQPC 4ORFA 3LD8A 5IK7A 3RZLA 4A3ML 2JICA 2K0GA 4BLIA 3CBNA 2D6PA 4MX3A 2W2IA 4IEOA 4GAZA 5C9AB 1L7LA 4Z2WA 3TOJA 1ALYA 4A7YA 5IT6A 2M4VA 1RHI3 4AEDA 4NROA 2R0FA 2XL7A 1BEV2 3SH5A 4EROA 2ZMLA 2C6AA 1QH7A 4KG0A 3TWIA 3BN6A 1ASJ1 2W68A 2JDKA 2BUKA 2NP0A 2VJXA 2O0OA 2HWE3 1YUZA 3RDIA 1CR7A 2E31A 3H0GL 4I30A 1DBNA 3VKMA 2ZACA 4BMEA 1BMV1 4W65A 4IW3A 1JZ6A 3VKLA 4WFN1 1VBC3 3B08B 2W08A 5L9BA 1ND3C 2A7AA 2RR13 1UYPA 1MZEA 2RS51 4PI2A 1GOHA 4QM8A 1LOAA 1RUE3 2O8QA 2XH6A 4AAPA 1J1TA 1A8DA 1Q43A 1W2OA 2Q1ZB 1H0BA 1COV3 1LHWA 3DXUA 4MGSA 3AP7A 3KCXA 2DFBA 3I3MA 2DDUA 3PL0A 4FPJA 3WQ7A 2JG8B 4CDQB 1ZREA 1GICA 5FRAA 3NJVA 1LRHA 5D8AA 4IE0A 1L7RA 4AR3A 1NOVA 1NY71 3CEWA 3GZAA 3EMRA 4LE3A 4W4ZA 4ATEA 4AXOA 4RN5A 4JX0A 2Q8CA 1QJX3 5FPUA 1V6KA 4QPYA 4QKBA 4Y24A 1X82A 4GIQA 4QPGB 2NVYL 4QD2A 4NIDA 5FLJA 1IRNA 3ZYHA 5LEJA 2AH2A 4ATFA 4HSJA 3PWFA 1G86A 3T0AA 4AVTA 1ZBE1 4CXXA 1W0NA 4PQ9A 1E5SA 2AENA 5DDJ1 3W21A 5FREA 3J9SA 5JZGC 2VTXA 4E8DA 1UZ0A 2QQNA 4DFSA 2W39A 3POYA 2XJPA 2E2HL 4RQPA 4FVVA 4OLLA 3BU0A 4RS5B 3L9JT 5JXJA 1S2ZA 3UJQA 2E6VA 3ZXGA 5F3GA 3TRSB 2YXSA 1YJLA 1K42A 4I01A 3FX3A 1SFPA 1VBE3 3GHMA 3GTKL 1ZVFA 2D40A 5IYBL 3M3YL 4XC9A 3S0MA 3KV4A 5BNOC 1ZRCA 4LOSA 1AXZA 3MEPA 4XFGA 3SKVA 3E5QA 2WZEA 2BGCA 3E1F1 1ASJ2 3RZ6A 5FZ4A 3V56A 3V0AB 1UY0A 3SH4A 2RS32 4GULA 4KU8A 4KWKA 2NZ9A 2FQPA 2VCAA 1PM7A 1VR3A 2N7GA 3D0JA 4BK4A 3WW4A 5KHGA 1A78A 1CESA 3MIEA 3VKOA 5I0SA 4LJHA 4XFIA 4M3CA 3VL9A 1OQDA 2JD4A 4M3CB 4OQ9A 1TNRA 1LULA 2HWF3 4COUA 2DV9A 3LAGA 4QX5A 4C3JL 2JI2A 2ILMA 4AVAA 3ZIWA 3PU8A 4EWDA 5EINC 4FPYA 5C33A 1TME1 1RUD1 4FFIA 1GLHA 5SV5A 1BMV2 2ZAAA 3J7MA 3ZSJA 3H1WA 1YQ8A 4Y3OA 1VPHA 4E8CA 3HN1A 3DCQA 4OULA 5C7GA 4ZU5A 3ILRA 4M00A 6RXNA 3N9MA 1A34A 1S55A 4OUEA 2ZMNA 5A3TA 3RMYA 4QDSA 4YM0A 5FY4A 1SQ4A 4LEJA 4EN7B 2X5IA 3EQEA 4XXBB 4W50A 4K9SA 3NNGA 2MEV2 5DUWA 2QZ2A 4XGHA 3GTQL 1YQ2A 1AHSA 3MIDA 5FPVA 3KB5A 3WP5A 5IVVA 3MUZ1 3INAA 3WNOA 3KLSA 4AEJA 1CPNA 4C2M1 2BGPA 2JKXA 3J7NA 1QDCA 1HQLA 1PZ9A 1SG3A 2HWC2 4UFJA 3H97A 5F8PA 3WQBA 5JOYA 4QPGA 4CU6A 1LECA 2BOIA 3EB7A 5FZ7A 1ND3B 5J98B 4XAAA 3U14A 2V09A 4D94A 2WZPP 1GR3A 2J1RA 4DB5A 2R062 5BNOB 2VMFA 4LHLA 1PGW2 1AYN1 2PLV1 4A7KA 2FZ1A 2V0EA 1NCRB 2VMCA 4GB33 1J3QA 2AEYA 3APBA 4Z82A 2M6PA 3KYYA 2UWAA 3OJBA 4ET7A 4BOWA 5BNNC 1HRI2 2ZGRA 3JZVA 4JQTA 4NUBA 2YGLA 4AR6A 1IS5A 1PM4A 5FBZA 1C8M3 4S2FA 4LE4A 2ZXQA 3WDTA 2A1XA 4POFA 4Q4W1 2P34A 3WF1A 2X8KA 1AR73 1XJAA 1AXKA 4FPEA 4HBNA 3ZXEA 1S0EA 3BVCA 4CZSA 1W8HA 1GZWA 4N8MA 2JDAA 1W06A 1YFYA 4MHRA 4XFFA 4L99A 4V196 3J7Z1 4D6RA 4BXSV 1R081 1ND2A 3S7EA 3LIHA 3Q9OA 1VMJA 2QBXA 2BTVC 4YNIA 5EYXA 1DQ4A 3VBHA 4A45A 1WGPA 5I0DA 3AKQA 1W2NA 3HOUL 1RJ8A 1KD7A 3NNJA 5A3OA 2QQVA 1ZRDA 3CQZL 2UY8A 2ZKLA 3OD4A 2VVEA 2B46X 5F5CA 1PZ7A 5GAHc 4TVMA 2W3JA 5L19A 2F17A 1Z7S3 4XIOA 5C9AA 3OGVA 1UOGA 4HKOA 1FMD3 1GUIA 3EO6A 3H7JA 3QACA 1DLLA 3M1HA 4UFIA 4X6QB 3UGFA 3VL8A 1JOJA 1W0PA 5C3PA 1V6NA 2ZA9A 2XR4A 3PJQA 1WMDA 4QGLA 1HXS2 1UU4A 1LESA 1UZZA 1WW4A 2CKCA 3M3EA 4KL1A 4CDXB 1F2NA 1RITA 1ND2B 1REDA 4B8EA 2JWPA 3GTML 3AZZA 1DVBA 2GP5A 2IXHA 1PK6A 1GZWB 5J09A 1OUXA 4IXLA 1AXYA 1HRV1 3UL2A 1MS8A 1GP6A 5KXDA 4W6XA 1ULEA 2WNEA 2EAAA 1W2AX 5MGNA 1RYQA 1T9PA 3E5UA 5LBCA 3RMXA 5D21A 1RTVA 5E88A 4ZKTB 2EALA 2D6MA 2I07B 2D5HA 3GHNA 5FYBA 1W6PA 1DYOA 1C5IA 1BEV1 1V70A 4NO4A 1I1EA 3VB9A 5BY5A 3U11A 5FY9A 5B4NA 5A3LA 1PMJX 4XF0A 2D44A 5FY5A 1VB2A 1JZ7A 5JIAA 1US2A 2R49A 2WS93 3I3EA 2ES3A 3M4OL 1LKNA 2JDMA 2TNFA 2BFUS 1M4WA 2VAUA 4DXRA 2P3IA 3LPGA 2HR5A 2PHTA 1JYVA 4P9IA 2JDHA 1GKBA 1OI6A 3R05A 3AMNA 2OPWA 4QU1A 1IS6A 1VBA1 1FOD1 3PO3L 5ANNA 4G9SB 1BBT3 1IQAA 1CZTA 1VCXA 2JE9A 1QH6A 4YFZA 5J96B 1AJOA 5JXHA 1NAEA 2CWMA 5DM61 2C0ZA 3H9BA 1W8FA 2BRTA 5C8WA 1SLTA 4LNVA 1NCQA 1UF2C 3WSOA 3PLQA 1LGNA 2QE3A 1APNA 1PHMA 3ILFA 3NKGA 1NG0A 1QHDA 3OBZA 3H9AA 4QKNA 5BXXA 3AXDA 5B4XA 3ZXKA 3C3VA 1LAJA 4Q4V2 4AR4A 2VECA 2Y33A 2RJKA 4ISQA 3ES1A 1GANA 4K8FA 4YG6A 5ACA1 3Q8FA 4KWJA 2Y26A 4Z1VA 3NW4A 2OS2A 4Y26A 3VDAA 3ABZA 3WDXA 1R082 2LW8A 2R16A 3N36A 4CXWA 3AX4A 7RXNA 3HNBM 5CA6A 3J26N 2VUAA 5HPOA 2NYYA 1PFYA 4OFGA 3JD71 3RJ2X 1SHWB 4BIOA 3VBUA 1DP0A 1GOFA 2VVDA 4I3GA 3R4SA 1J58A 4A3FL 2R043 1POV3 2YFZA 5K4LA 4B4QA 2OT7A 2PSMC 4A3GL 1CAUA 2B42B 1YK5A 5I0TA 3HQRA 4MGQA 2R0HA 1S0JA 2IWGB 2WT2A 4OQ8A 3PL5A 1OSGA 2VZRA 2IVJA 4OHXA 5T50A 3J8F3 2P6HA
chains in the Genus database with same CATH topology
2D3RA 1W6NB 5CADA 4EN8B 1PGL2 3HT2A 2RM22 1C3HA 2GNBA 3RQ0A 3B7MA 3P8BA 5CVRA 4XW3A 1RUE2 2E51A 4BHPA 1J3PA 3VGIA 3KYVA 5DUVA 1V00A 1R0IA 1BXHA 1D4VB 1H8TC 2ERFA 4F3JA 2B7YA 3WVJA 5AI2A 1RJ7A 1C5HA 1R0HA 3WX5A 5BNQA 4MGYE 1S0CA 1OFNA 1YFXA 4HLTA 3ZYRA 1UKRA 2NM1A 5EWSA 2P37A 2FBEA 3L2HA 5CFCC 4D7TA 3NV2A 4GH4A 1FXZA 3D5OA 1OOPA 2RS31 1DQ0A 2UY9A 1D2SA 3GF6A 4IETA 5IY0A 3MI8A 2XJQA 3CLPA 1MZ5A 2GC2A 5D8AB 1RYTA 1YXWA 2ZX1A 1U5IA 3MIHA 4LO5B 4CDQA 4XBNA 2PHDA 1ASJ3 2P3JA 5L7OC 1J3RA 4GWMA 1QMJA 4H7MA 4Q8KA 4AFDA 1IW7D 4WM7C 4RSUA 3I54A 1QJX2 3VLBB 1H2KA 1YFUA 1SBFA 1VZIA 1GV9A 1GZ9A 1I6XA 1IS3A 5KWRA 1KFUL 1QQP1 1W2UA 4HMZA 4AFBA 3AXEA 4FOQA 5HCFA 3TNQA 1EY2A 4Z8BA 1LKOA 2V3BB 3RRDA 1O4YA 3IT8A 3PKIA 2XVLA 4FPLA 1CGPA 3AJZA 3VZLA 4B4PA 4E2QA 2IZWA 1AR93 1AR61 5T54A 1JBCA 3FUOA 4QU2A 4UW3A 5JOXA 5F5QA 4RXNA 2DVBA 2GMPA 2D6NA 1N3PA 1H2NA 2XB6C 1JYIA 1RIRA 1BK1A 2YC0A 4MGKE 2XGXA 1REEA 4ZXKA 4AI8A 3WT3A 1PMIA 5CBLA 3LCPA 5I91A 1RB8G 1PO21 5JVVA 2FMYA 3DL3A 4N43A 1O3QA 1V6IA 2PHUA 3OBRA 3VDDC 1QJU2 3S0MA 1XQNA 3B9CA 1UCXA 2KXLA 4CDQC 4N9HA 4G4FA 2WIIB 3A0KA 4WVVA 1KJRA 1QF3A 4PDWC 1DQ6A 3LWCA 4MXVA 1TEIA 1I3HA 2Q4SA 3QVDA 3R4DB 3AB0A 2A75A 4ISRA 2ZX2A 3M7AA 4LHKA 3AYEA 3IDEA 3NL1A 5FO9B 3LSDA 1NYWA 2PLV3 4ES9A 4QQLA 1AR62 1SEFA 1AL22 2RR11 4YZ5A 3VN4A 1ZRRA 4MXWB 5BUVA 3VBUC 4JVAA 4RR3C 1YI9A 4YZ1A 3PTYA 3U10A 5C4WB 1CIWA 2IFRA 1XNKA 3MPPG 1BQ8A 1HKDA 2K9ZA 5JVH1 2PHXA 4HN1A 1MS3A 3P2AA 2ATFA 4AQ2A 4NHLA 4Q1PA 1CD3G 1UPIA 4HT1T 2OZJA 1F9KA 2PYAA 1VRH2 2X29A 1D4M3 2VQ0A 1QGLA 5BNPC 3BB6A 4XDQA 4JAFA 5CNAA 1LHUA 1RUH3 4HFSA 5JZGA 2CKAA 1DGRN 2WA4A 4XFBA 3BALA 1E8JA 3G7DA 2DU1A 3MLLA 4Z1VA 3WW1A 4YWLA 2EAKA 5EXOA 1H9WA 4QQOA 1PZ8A 5GJ6A 1D4M1 2D93A 2VPVA 2YZ4A 3B94A 4K20A 5KHHA 1DF0A 2LTNA 1Q8PA 1VBA2 2D97A 1N1YA 2WNUA 2BBVA 4UW6A 2OW4A 3VBRA 1HV0A 1V6JA 4AGGA 4NN0A 3DUIA 4GKYA 4HK9A 1CQ9A 2H0VA 1W6OA 2OPKA 1D0HA 3MGUA 4HETA 1OOPC 4AQ6A 3WOGA 3AP4A 5FOBB 3WG1A 1C1LA 1PGSA 1O7FA 4UW4A 4YW1A 3WQ1A 3MPBA 1REFA 5ABJA 1OA3A 4XJAA 1WCDJ 4YVWC 4ZU4A 3ECQA 2H6CA 3H3UA 3IU3I 2YPJA 3SS2A 1W39A 4DXZA 3AP9A 1IOAA 1AYN3 3B00A 1VBE1 1OWBA 5K2ME 5F6KA 2PLV2 1KJLA 2EXIA 5T52A 4CDUC 1LEMA 1I5ZA 3OD0A 3AKTA 1RGSA 5JI7A 4GS7D 3NSTA 4F7ZA 4CDWB 2XJUA 5JOZA 2WC2A 2PAKA 4YM1A 3ATGA 1N1VA 4YVWB 1ULFA 1ONAA 4GH4C 2I74A 1UIKA 2D6LX 5B2GB 3O5SA 5T5PA 3ZFEC 2KKDA 1SMUA 1VBD2 2YDEA 1N47A 1AR81 1MS1A 2QDRA 5C8CA 4JV4A 4V1PA 4KWLA 4LBJA 1VZGA 3AYDA 3I8TA 1Y7BA 4K21A 1NA1A 1IZ3A 2XBO2 2O8OA 1U5ZA 2NQYA 1WLTA 2K2SA 4HK8A 4AFAA 2UWCA 2YGMA 4XBLA 2A70A 3ZXFA 2WA3A 1QDOA 2GAUA 2JG8C 2RS33 1WLCA 4GB32 3AFGA 5GLWA 4R9CA 4XJZA 4PLNA 1B35B 5JSPA 1CAVA 4RGGA 5A32B 4XJWA 4C1WA 1FV3A 2HWD3 1HV1A 1OFSA 2RS11 3UKVA 4NR1A 4QPIA 3HIFA 1QCVA 1DGWX 2QUOA 1ND2C 4OUSA 4PDWA 4CDXC 1IHMA 2HWD1 2A3XA 2DCZA 1C28A 4MV2A 1LB2A 3HAGA 3UJOA 5FLIA 1R091 4L92A 4E4ZA 4RHV1 3M3QA 1WUVA 5KXEA 4B3NA 4JGYB 2WL1A 4LBKA 3SLIA 4PJYA 2AREA 3FZ3A 1XYOA 2EXJA 4IQPA 4L9BA 3VBSA 3EXUA 4WZFA 3ILNA 1C1FA 5GLTA 4FXKB 5GADc 2FMDA 2EF6A 3AJYA 4JC1A 4OI0A 4Q4Y3 2Y38A 3T2TA 1AYM2 1PK6C 3VKNA 1AR83 4OI2A 4Q0SA 2ZHNA 3RWNA 4DZGA 1SMVA 1ZZ6A 3L2YA 4IV1C 4MSVA 4RGAA 5JSRA 3BTAA 2WLQA 1ZZBA 1WW6A 5MF6A 2ZBJA 1COV1 1A3KA 1EAH3 5GKAC 4XJ8A 1FI2A 1XU2A 2ARBA 2HWB1 2YROA 3KM5A 4N90A 1WMEA 3JD72 1MR5A 2EIGA 5CB7A 4NVPA 4LO4B 5DXDA 2JI3A 4YM3A 2B5ID 1HW5A 2PELA 2Q30A 3AYAA 1BJQA 4S2DA 3J8F1 4XQDA 4OI4A 2ZX3A 4AI3A 2XG3A 3BCWA 4GXLA 4TPUA 4P9LA 3WDVA 3A0NA 4FSJA 2R072 2PHWA 3LA2A 5A33A 1LOGA 1GYKA 1DGWA 2ET7A 3SNMA 2NPIA 5KC5A 4YLZA 1VAMA 1NNQA 4AFMA 4R9BA 2IFWA 2AR6A 2VMGA 4QT6A 1DHKB 1EV11 1B2OA 4HPKB 1VAVA 2WZR3 1PNFA 1DZTA 1CAWA 2GMMA 1Y9QA 2BWAA 4INDA 2IXCA 1I9RA 4ITCA 4CEWA 4I3PA 1VBB1 1TME2 1BKZA 2PHRA 2A3YA 2XVKA 1N1SA 1WBFA 3JB4C 3RYKA 1AUYA 1G9FA 1LOFC 2HWB2 4JTOA 5HXVA 1LENA 4HSLA 3CJXA 3P3NA 2R061 1IKPA 1G8WA 4XOGA 3PVNA 2E9QA 1HLCA 1S0GA 1OMIA 4P9JA 3MDPA 4L97A 1OD5A 4OI1A 3FC0A 3IDBB 5AFEA 3IN9A 4LULA 4PIYA 1HXS1 4FTBA 3MLKA 1WLWA 4UBHA 4FCAA 4XQWA 4YGBA 1ULGA 3NAPA 3MIGA 5E1RA 1XE8A 5C8CC 4Y22A 2Z3RB 4KGGA 2JX9A 4DINB 3LSEA 3JBG2 4BMBA 5DDJ2 3VBHC 3PHMA 4Y22B 2BW8A 1NXGA 2VULA 1YUXA 3K51A 4AWDA 1S2KA 3RPQA 2D5FA 1HRV2 1YHFA 1VBB2 1FPN1 3KT4A 2QJVA 4G3YC 1FMD1 4IEYA 4WM8A 5EJ3A 3PIO1 4FQZA 4F8AA 1GZCA 3M8LA 2PHFA 3H3ZA 4YGDA 5CFDA 1H1IA 3W9AA 1H8TA 4YG0A 2JJ6A 2Z79A 4P9YA 4QGMA 3WHUA 4QM9A 3OF1A 4Q4X3 4XF3A 3VHOA 5KHJA 2D3SA 1CPMA 4LBOA 1IU6A 4URTA 1GQHA 1FOD2 1QJU3 4CEWB 1CAXA 2VOKA 4BIFA 3AYCA 3WWLA 1R093 2PYTA 4LO8A 3W58A 4Q0QA 3T1MA 4AE2A 2JI1A 3LGRA 2ZGNA 4LBQA 4AHZA 3VZKA 2V73A 3WP4A 1RUG3 1LTEA 5GAGc 4KGQA 4GB31 1NZCA 5FQ0A 1WW7A 2GN3A 5RXNA 2OIIA 3VBOA 4FOYA 1QXJA 2GN7A 4HVQA 3B0AB 4EN9B 1FNYA 3QBQA 2CY6A 1FAYA 2EA7A 2WLPA 1BQPA 1BBT2 3U4XA 2Z3QB 5FPXA 1SLIA 3FHIB 4LO7A 1LOCA 4BLJA 3MSUA 4H7LA 4HZFA 1YV1A 2HWC1 2GC0A 4K7JA 4PCRA 4BM8A 1JUIA 1AYM3 4BZ4A 3OYWB 2D6KA 5JLVA 4AR5A 1IPKA 2RJLA 4I0AA 4Q8LA 1F8VA 1OHFA 1QJY3 1MACA 4C91A 3MPSA 2JG9A 2VUJA 1KITA 3PJYA 3QCWA 3WG2A 3K48A 3R0RA 2IXLA 4XFHA 5AC92 3CNAA 4IV1A 4YVSA 3N4MA 1DYPA 2Z42A 5ACA2 4MLOA 2XLFA 4QHBA 4Q4W2 1KRIA 4YYOA 4M01A 5GZEA 1RUF2 5I8YA 4JGYA 4JADA 1DZQA 1PVC1 3RYPA 1UKGA 3OBTA 4IEUA 4S2GA 3TBDA 4AYUA 1JTZX 3BODA 4DQAA 2FHRA 1ZYBA 4LLFA 3DPRC 1AYM1 2KA3A 2C1FA 2ZX0A 4IV3C 3JCIA 4LBQB 2WFPA 2ZGMA 1RUC1 3IIAA 4MZUA 1WA4A 4AK3A 4HANA 1DIWA 4Q26A 4WVZA 3JU9A 3BOPA 4WM7B 4MGZE 1J1LA 3LNLA 4JCKA 4QGNA 1KS5A 3GZUC 4Q4Y2 3WD5A 1X36A 3KS7A 1YNAA 2DVFA 1H8TB 1DZRA 5I8SA 3NJZA 1POV1 3B3QE 3CU7A 1XNCA 1ZX5A 3J8F2 4CDUB 2FZ2A 2ZGKA 5HCAA 1QQP2 1LODA 4K3UA 4WM8B 3E5XA 4RA0A 4XMAA 3P3PA 2BNNA 3IMNA 4HVOA 3PNAA 3THTA 2DCJA 5C8CB 2ZAHA 2XJVA 5DM71 5CFCB 3N7KA 4K1YA 4JQRA 5K0UA 4DOUA 4E6YA 1JHNA 2RS53 2QFEA 1WJVA 4XF4A 4WVWA 5SV8A 2I45A 2NLRA 5BV6A 4YVWA 1RUI2 2ZGSA 1RUJ2 3JQWA 3NAPB 4YW4A 2BNMA 3I7DA 1RUC2 1OLRA 1VZHA 3B69A 4LBLA 1LHOA 5LK7B 2E7QA 2WNVA 5MFZA 5T3NA 3MW2A 2ZCWA 1UN1A 1VAKA 1FPN3 1EAH2 2CNAA 3GYDA 5T5LA 1SLLA 3I2DA 2GH8A 4H14A 2BVVA 4RS5C 2PAMA 3POWA 4META 1QWRA 3RNSA 3D4KA 2GDFA 5I0RA 1BEV3 1VBD1 2WKKA 1F5JA 1YK4A 3CJIA 1VP6A 1RUG2 1O4ZA 2ZGOA 3ZMOA 5KHIA 2Z5WA 1RUF3 1BVP1 2OA2A 2A6HD 4YM2A 2VL6A 3KQRA 1SLAA 1PO22 4O9GA 4Y20B 1VBD3 1YO8A 4B4RA 4BH9A 4OHWA 1SLBA 4AHYA 1Q8OA 5DG2A 4TSVA 3AZWA 2BFUL 2D6OX 4E4DX 5F1RA 3RS6A 2WINB 3CL1A 1MEC2 1YLLA 4JAAA 4U671 1RUI1 2VOVA 4LBQD 1VB4A 2RM23 1MS9A 1OPMA 2UYBA 3KCYA 2BQPA 3EJKA 1S24A 5L73A 5LEKA 1AR91 5JZGB 1FMD2 3SCGA 4JGZA 1QNWA 1G7YA 2GNTA 4IV3B 3WUDA 1FX5A 2HWD2 2WWSA 1VBC2 2QNKA 4QPIC 3PZAA 2CWSA 4N7IA 5JVG1 3RG0A 4B8CD 1QQP3 1URXA 4XJUA 4XJ9A 3JBG3 3FFZA 1C8M1 5CIRA 5C4WA 1H4HA 1QYBA 3E97A 3MF9A 3KYXA 2JEMA 4M3CE 3PVEA 1FHMA 5KXBA 4FPFA 4P9XA 3KD4A 1MZ6A 2OUHA 5DUXA 1ULDA 2LUWA 3CJIC 4I09A 4COVA 1HRI3 5KBFA 4LA2A 4E2SA 3GNEA 4JAGA 1ZZ9A 3M3CA 4UW5A 4PIXA 3N7LA 4FTEA 1RMU2 4AGVA 3SISA 1AVBA 1NQJA 2NMNA 3HQXA 2ZIXA 5JIUA 3URFA 4D7SA 5GALA 3GBFA 1WMFA 5AI3A 4F83A 5L36A 2A6WA 1YRZA 1DGRA 3IKWA 2ZPXA 1UX6A 5E8AA 4CP0A 3TNPB 4LO6B 1PO11 5GLVA 2DCKA 2NMOA 2VMIA 4FPKA 2RMU3 3TN93 4Z92B 1C4RA 4L11A 3DV8A 3VZJA 4AVSA 3WCSA 1PVC3 2UWBA 4JTNA 4U36A 4HKLA 3LPEB 3M3IA 2JG9C 4Y1YA 4NOTA 5FMOS 4EJRA 1RVF1 2WFF1 4M0NA 1NXMA 1R0JA 4UY81 2DVGA 2DSXA 1X8MA 2ZS6B 5T55A 3ZPYA 4BWOA 4COWA 1PO23 1B35A 2VQAA 1MQTA 5D8AC 3X29B 1JUHA 3NV1A 2P3KA 1IU5A 1R083 4XETA 5IUQA 2MHFA 3HD8B 4N9IA 1TMF1 3B02A 1QOTA 3ZFEB 1Z7S2 1K5MA 4BA6A 2ZHLA 1W6QB 1JYCA 4ZN1B 2ZGLA 1GBGA 2OUJA 4RD7A 4BQ1A 3JD73 1UAIA 1V9U1 3VBRC 1N3QA 3RYGA 1TMF3 2CTVA 3PMSA 1IGOA 4FT8A 3TAYA 4XXAA 1S0FA 1IROA 2G4IA 4ME3A 3IDCB 3KT1A 1L3JA 3GBGA 3M4FA 2AYHA 1MQTC 3HMYA 1AL0G 4P14A 2CGNA 1H2MA 2GU9A 3O7OA 3FLTA 5CAZA 2BPA2 2ZHKA 1R1A3 3WG4A 1PNGA 5GZGA 3N7MA 1BZWA 4EWEA 1JW6A 2HEVF 2QL0A 5GLZA 4GALA 1PVXA 3PMEA 4TZDA 2HKXA 1F5FA 1OOPB 1FOD3 5EFUA 1HQNA 1RUH1 3AM2A 3KZ4C 4AEMA 3ZFEA 2RS12 2XHKA 4P5HA 4LBMA 2D98A 2WNUC 5GAEc 5ABJB 4WVMB 1W6MB 3AZXA 1PO12 1RUD3 4TYSA 1MQTB 4XILA 2ZMKA 2YHJA 2EXKA 4QQ2A 2A5ZA 5MFPA 2BNOA 1H30A 2ZTNA 2PVXA 3I59A 5BNPB 1B09A 1ENRA 1R0FA 1BRFA 3BOWA 1OQEA 2WSUA 3JB8A 5J36A 5JCTA 1V9U2 3AP6A 1RVF2 1UPSA 1E57A 5GZFA 1PGL1 4FAHA 3DN7A 1TNFA 3IWZA 1DX8A 1ZRFA 2CYFA 4LR4A 4O9EA 3QD6A 1Z0HA 2CR8A 1NE4A 5JSOA 1X8EA 3ZFGC 2MNGA 2PPTA 4IERA 2A68D 1CAUB 1YYNA 4Y1XA 4FOWA 4B7EA 4COZA 3VBUB 5JI9A 1DFQA 1LU1A 2A71A 2E7TA 3V64A 4LA3A 2H0BA 4XE9A 4A7ZA 5K9YA 3VHRA 4HL0A 3SMHA 3PKJA 3WR0A 4Q4X1 2VU9A 4ZN3B 4ES8A 2QZ3A 1B71A 3QQCE 4OUMA 1MS0A 4B29A 2GC3A 3O14A 4A3XA 1Q3EA 2DUPA 4Q0PA 4MXWA 2OVUA 2XPJA 3FJSA 4KU7A 1RUI3 2DVAA 1Q8SA 5H9PA 4KBBA 1NCQB 4N7UA 3UKNA 4PLMA 1RC6A 3HWJA 4C0HA 1NA1C 4DMIA 4MYEA 1S0IA 2A6YA 4XXPA 2R6QA 1VBB3 5MLC3 1H7VA 1SFNA 4BPZA 3U07A 4N43C 4JGZB 4CEYC 5F9TA 4QQPA 2KM2A 2MS3A 1N1TA 2WZR1 3LA3A 1C57A 2XL9A 3AKRA 3ES4A 4P9WA 4Q0VA 1S0DA 1XRUA 3D8CA 4XFCA 1S0BA 1HXS3 3LZZA 1NCQC 3KCCA 1OA4A 4AI0A 3BIWE 3UK9A 1C8M2 4C0BA 4FP2A 4AQSA 2XWJB 3G6JB 2PAEA 3PIP1 3C2UA 1H9PA 1DU3D 1LR5A 1AX0A 1CJPA 4JRAA 3I59B 1RMU3 4SLIA 5BNPA 5JOWA 3JBG1 3D82A 2A69D 2P2KA 3M2MA 4FPGA 4LUMA 4OHYA 3VDDA 2TUNA 3K35A 1W6MA 2MEV1 4WVMA 3VBSC 2ZGQA 2CV6A 1AZDA 2JXAA 2HWB3 1FNZA 4H3WA 4Q27A 4HKWA 1XYNA 2XWBB 1QY4A 4CP1A 1M06G 1EV13 5EIOC 1O5UA 5BYNA 2JKBA 1UMZA 3WZ1A 2WFF2 4J6GA 3E6DA 2GMGA 2RM21 3WG3A 2M4YA 5K8SA 5D1IA 1RUJ1 4U2AA 1XNBA 1FV2A 2X53S 3RSJA 3O12A 4AHXA 4YGCA 1AR63 4Q4V1 3MF6A 1NCRA 1QJY2 2AGSA 3MFCA 3AFKA 5K0UB 4LT5A 2A6VA 1AX1A 4PBOA 5FMOL 1O3RA 5BNOA 2VW0A 4FPHA 1RUD2 3NAPC 2TBVA 1EP0A 1H4GA 1AR71 5E16A 4FBFA 2ZX4A 2HWF2 4Q4V3 4OHZA 3THPA 1ZBE3 1X33A 2B39A 1H1AA 4GH4B 1W6QA 1JXNA 1ENQA 4L8QA 1K5MB 4ONUA 1NLRA 1G6NA 1QXRA 2VMHA 1UL9A 3A4UA 2X5IB 3GBWA 1S1AA 5BPXA 4AFCA 3J7Y1 1ZBA2 2D7FA 5A3MA 3ZDSA 1IS4A 1VRH3 1RUE1 3VPBE 3ETQA 2WNVC 1RDGA 1LU2A 5LRRA 4JAEA 4Y1ZA 1DGLA 4IESA 3ZSKA 3WDYA 3NFPI 3AK0A 1W6NA 1AR92 4TLFA 4J1XA 2ZGUA 4EWAA 4I2OA 1KQRA 3ZSMA 3WCRA 3RI8A 1O3SA 2D43A 1IKQA 2JECA 2QDNA 1QJY1 1HRI1 1CONA 4GWNA 3ZMNA 2G9FA 2H12A 4B7KA 5FFOC 2B8MA 4R4XA 4AVBA 2PTMA 1RHI1 4W6YA 2HWC3 1J59A 2WS91 5TSWA 2BYVE 1TME3 3V0AA 1FYUA 4M0HA 1R1A1 4IEPA 4AEKA 5AVPA 2R30A 5DZEA 4YVSB 3ROUA 2TEPA 1BE7A 1O5LA 1O3TA 1ODHA 4QXKA 2HWF1 2VGDA 3ALQA 5C6CA 1HRV3 4BE3A 2JG9B 4K1ZA 5C9AC 1YIFA 1CVNA 2OZ6A 2VNGA 1ZBA1 3AMPA 3ENRA 1XXNA 4RS5A 1V6LA 1KXGA 4OVEA 3OYWA 4YW5A 2GNDA 3FE5A 1ENSA 3NWKA 3BPZA 2R041 5EV7A 4IEXA 3ACLA 4XEZA 5FO8B 1QNYA 1UU5A 3B01A 3J4UH 3MZHA 2ARXA 4IV3A 3PVOA 5KC6A 4AEDC 2F4PA 1R1ZA 3WY6A 2JG8A 3T1LA 2W52A 2ETEA 3CF6E 1XNDA 1H1MA 1W6PB 1CN1A 4UBGA 3ZXDA 4COYA 1RUF1 4J1WA 1EPWA 1WBLA 1RVF3 1WD3A 3HBZA 2ZABA 4Q4X2 4G6BA 4P9GA 2BEOA 1RMU1 1EYBA 1LHNA 4JGYC 4GMP1 1BYHA 2V5YA 4XFAA 4KQ7A 1MS5A 1V6MA 2RMU1 3TN91 4CDXA 1NQDA 1PO13 4QMAA 2EVXA 2HJIA 1U0AA 4Y20A 4XBQA 1SCSA 5CU1A 4QQHA 3I4IA 2ET1A 4YVSC 5E89A 4FTSA 1CJDA 3CJIB 4XTPA 5JAXA 4XHBA 2V0FA 5H9SA 1N3OA 3JUUA 1SMWA 2Q0AA 5I8TA 4YARA 4K6BA 3VBHB 2NN8A 2WT1A 3NO8A 4FAGA 5KXCA 2RDVA 3WINE 3U0ZA 4FPCA 3H50A 4S2HA 4XMIA 4NWVA 4CYDA 2WNVB 3R6SA 3VBFC 1MEC3 3RZZA 2CL2A 1CADA 4LBNA 2PQQA 1ZZ7A 5GZDA 1RUG1 1U5YA 2DWRA 4WBBA 5J48A 3B5LB 3ZYPA 1O91A 2GSYA 4MVTA 1TMF2 1ZRPA 1LOFA 3ST7A 4JDOA 4LUKA 1MEC1 2ZKNA 1DQ2A 5CG8A 5CFCA 1T6GC 4JDNA 1SBDA 1ND3A 4CRQA 1X7NA 1ZNPA 2XBO3 2D3PA 5CG9A 2XKOA 1S2BA 3MLJA 4R9DA 5BNNB 5DZFA 1SFYA 3GZTB 1ZA4A 4BCUA 2XVGA 1AJKA 4AVCA 4CDUA 2LCQA