2XJPA

X-ray structure of the n-terminal domain of the flocculin flo5 from saccharomyces cerevisiae in complex with calcium and mannose
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
258
structure length
258
Chain Sequence
b'GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLOCCULATION PROTEIN FLO5
publication title Structural Basis of Flocculin-Mediated Social Behavior in Yeast
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell adhesion
total genus 54
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2010-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2xjpA02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2xjpA01
4COZA 2XJUA 4AI3A 4COVA 2XJQA 4LHNA 2XJTA 4D3WA 4AFBA 5A3MA 4COWA 4A3XA 4GQ7A 4AF9A 4LHKA 4AI0A 4AFAA 4AI2A 2XJSA 4COUA 2XJVA 4ASLA 4AHXA 4AHZA 4AI1A 4AFCA 4AHWA 4CP0A 4CP2A 4AHYA 2XJRA 4COYA 4LHLA 4CP1A 5A3LA 2XJPA
chains in the Genus database with same CATH superfamily
4X6RB 5FY0A 1APNA 4F83A 4SLIA 1R0JA 4UW6A 1DBNA 1RUH3 2BDRA 2CGOA 2W5FA 4JX0A 4QX0A 4FCAA 4CU9A 2W91A 1RMU2 1AHSA 3RZMA 1R1A2 1YO8A 2UWAA 4ZU5A 5ISLA 1PGL2 5GZEA 1DYPA 3FZ3A 1N1SA 4RR3A 1GP6A 5FZEA 1KDMA 4LE3A 2CY6A 2ZCWA 1QJY3 3KWVA 1JYCA 4QGNA 3N9MA 3MF6A 2MPFA 1YK5A 1LR5A 4KL1A 1POV0 3E5UA 4BISA 1AJKA 4LOTA 3ZSKA 5FZ7A 2W9XA 3LF7A 4DQAA 4Y24A 3PWFA 5C4WA 3FKIL 1WW6A 2VCAA 4KBBA 3VDBA 4A3EL 3LWPB 1T2XA 3IPVA 4E6YA 2W46A 3W20A 1VAVA 4BDVB 2WAAA 1PMHX 1X50A 1X8MA 4YM2A 2OZ6A 3NV3A 4JAEA 5IUQA 4ZZ5A 3JBG1 2R041 5F39A 4NIAA 4FPGA 4N53B 4MXWB 2ZIXA 3RZDL 1XXNA 1ODHA 3JQXA 3R4UA 4QMAA 2W95A 2D6LX 5C44L 1EPZA 4RQPB 4W50A 5EP9A 3GGLA 1YUXA 2GMGA 1RUG2 2D43A 3ZYFA 5EWSA 5T55A 4CCCA 2RS31 3NSTA 4XACA 5A7NA 5C71A 3DN7A 3B00A 3ILFA 4CEYA 2GU9A 4BIFA 2IC1A 1YUZA 4P9XA 4RS5B 1R0GA 1G9BA 3D6EA 2VQUA 4Q4X3 4UAPA 3I59B 2XL7A 4N9IA 5DN2A 3VDDB 2IXCA 3LWOB 5A6YA 2JDNA 2QQMA 4C90A 1XB9A 5H9QA 1HB4A 4XC9A 3ZMOA 3FBMA 3NNLA 1GZWB 1LOBA 4UF0A 1P7PA 4FPJA 5KHKA 1UMIA 4GMP3 3K48A 1XYPA 2NVXL 2QUOA 4EZ4A 2CDOA 3OPTA 4MOAA 3HOUL 1IS6A 1R082 3I2FA 5KXDA 5FLML 2CR8A 2FD8A 3KYUA 3AXDA 4MZUA 1PZXA 5F3IA 1MQTB 2VBBA 4NIIA 5FPVA 4OI1A 1CD3G 3SMHA 4JAFA 1DIWA 1VR3A 2WC2A 5HV0A 1Y4WA 3JBG2 2R042 2AEYA 4OYUA 1R0FA 1RUC3 1ND2B 4YYOA 2QZ2A 1BCXA 2VUDA 3HNMA 2LTNA 2YC4A 2O5JD 1JTZX 3FUOA 4HMZA 5LY1A 5FOBB 1HKDA 3VN4A 1VZIA 1QJX2 1G8WA 2D5HA 2YMZA 1OPOA 2VC9A 1WD3A 4Y33A 3LPEB 2QQJA 2RS32 3PMEA 5EZWA 3DKQA 4NO4A 4XHXA 3AP4A 4D7SA 3W5NA 5FPAA 5FY9A 1JZ6A 1Q43A 3PU8A 1B35A 2W0XA 3IDBB 1QU0A 1JXNA 3N7KA 3HOXL 1UYPA 4OMCA 1SPPA 1ASJ3 1CONA 3AZWA 2DYCA 3ZO0B 4AI8A 1UY3A 1AVBA 5DUXA 1I5PA 1LNSA 2QQUA 3HVDA 4MX3A 2XVLA 5DG1A 3GF6A 3PVNA 5KHJA 4IL7A 5EV7A 5L7OA 4UW3A 4DUXA 4YPJA 1ND2A 1F4LA 1SDDB 3GALA 3H50A 2ZGTA 2FDJA 4M3CB 5LW9A 4LBQB 3SH5A 4DRVA 1RHI3 2XH6A 5A6QA 2W2IA 2B4KA 2EIEA 2YZ4A 1WMFA 2HEYF 4NE9A 1VMJA 4G6BA 2H0VA 3SKJE 5A1FA 1UN1A 1BK0A 2WYSA 3ZLIA 1MEC3 5LK7B 1LU1A 1ULOA 3IAQA 5LRSA 3D3AA 5D2AA 1OC1A 2C1FA 3POSA 2PQSA 4DS0A 5DZFA 1AYM3 2BUKA 3OGVA 3ZFEA 1Z7S1 4TTGA 2GP3A 1ZREA 4XF4A 3C8XA 1C8M1 3VBSB 1EAH3 3IMMA 1UIKA 2UYBA 4BLJA 4P14A 3OD0A 2VVDA 2WT1A 2YFZA 1NA1A 1ZA7A 3LA7A 1YJLA 5KC6A 3TN93 1XE0A 1K5JA 3KQ4B 3FJSA 4D6SA 1UY2A 2WKKA 1ND3C 4LUMA 2R92L 2DCJA 4MV2A 2UURA 5FYMA 4M3CA 4TXWA 3EB7A 5F7UA 2A6YA 2O0OA 1GKBA 3LSDA 2P4EA 3MW2A 3IBMA 5FXWA 2CTVA 1WWYA 4IV3C 3RZHA 3ZYJB 5FZHA 1XNTA 1H9PA 4LTAA 5BNOA 3FDJA 3CNAA 3LB9A 3RG0A 1D4VB 4JHZA 1UPIA 3J7MA 3I2DA 4G9SB 4QXBA 5T5JA 1ENRA 1PIV1 2NQYA 3C7HA 4XFHA 2MEV1 1RYTA 4AVCA 1Q8VA 3UJQA 2JX9A 2VL4A 2HWF3 3RVHA 3KT1A 2VQTA 1E8JA 4EQVA 4CPBA 4HL0A 1W3XA 4XF0A 1VBB3 5EINC 1NZCA 4NIGA 3PUIA 2GNDA 3RPQA 4QQHA 1YI7A 3I3MA 4LITA 5A6XA 3E5XA 1VP6A 3K4ZA 1JOJA 1HV0A 4XCBA 4C1WA 5HPOA 5FY4A 1CX4A 4YW6A 4PQQA 3UKNA 4B7KA 3KHCA 1O3TA 1AUYA 1VIWB 1QOSA 3O7OA 3VDCA 1CZSA 4ATEA 4A4AA 1DQ5A 1NE4A 3LWRB 1CAVA 1UZ0A 3PJQA 4O9GA 4QXKA 1MS8A 3UGFA 4EYUA 3WF4A 3BTZA 1K42A 3MFCA 4DZGA 3A22A 3N9QA 3C7FA 2WFPA 2DSXA 5F5CA 4L97A 4I0WB 2XKPA 4LHSA 4MLOA 3PNAA 2M6PA 3WG3A 2J1SA 3WW3A 2C5DA 2VO5A 3KYWA 2WWSA 3HAGA 1POQA 3O5SA 3WQ1A 4RSUA 1TME3 2G19A 3FLRA 2AENA 4OHZA 1IQAA 1S0BA 4C1XA 1KITA 1W0PA 3C2UA 1RTVA 2DV9A 3RSJA 3T1LA 2RR13 1LTEA 2K2SA 4NHKA 3WY6A 3MQKB 2VVFA 3AVRA 3IT8A 1CAUA 4TN7A 2IXLA 3KHBA 3USUB 2KN9A 1WA4A 4IGQA 5FP7A 1VZGA 4MGYE 3I7DA 3ZR6A 1M4WA 1C1LA 1GICA 1OA3A 4LBOA 3E1F1 5DAQA 1UY1A 3B9IA 4AEDC 2VECA 3IAPA 4DEVA 1NOVA 5FOJB 4P5YA 3CJXA 1OLQA 2A75A 2RJLA 2VMGA 3MPBA 2X5IC 4YG3A 4UXAA 3SCGA 1NCQB 3GZEA 3JD72 1N3PA 4M0HA 4AL9A 1W39A 3A21A 3H8RA 2BRTA 3AMMA 4LIVA 1BJQA 5JVH1 4LHKA 3DYPA 4JKLA 4YWAA 3Q8AA 5GLTA 1EUUA 3OCPA 2Q5TA 3WCSA 2W87A 3ZYGA 3ZFFA 3VD5A 5F5IA 1QIQA 2HWD3 3DKWA 3CZUA 3C3VA 5FUNA 3IU3I 2P17A 2V09A 1DGLA 2Z69A 4WVZA 5FZOB 4XF3A 2QZ3A 4NHLA 1C09A 1OFNA 4AAXA 4BQYA 4F3JA 5A3LA 5EIOC 1LAJA 3ZXFA 2XOMA 4P9GA 4X8PA 4ATFA 1IPSA 3QOPA 1TQ5A 5CVRA 1UU4A 1WBFA 3AP9A 4E4HA 4AGGA 1GYKA 2CAVA 5FYTA 1DLLA 1V00A 5DM71 1JHJA 2LS6A 3OY8A 2ZEZA 2J1RA 1OD3A 4B4QA 1O91A 2XG3A 3O0XA 2ZX2A 1RUH1 5EPAA 2A6ED 1WCDJ 4QM9A 3WG4A 3H3UA 2XJVA 4P9JA 3WDXA 4JTOA 4JHTA 1R1ZA 1YIPA 3RI8A 2WJSA 1RIRA 4FT8A 4XABA 5I0DA 5F1RA 2JI1A 2PHWA 4XFCA 5IYBL 4R9DA 4G4FA 3I49A 1KEXA 2DWRA 3U4XA 1QJY1 4XF1A 3WNPA 4XXBB 5A32B 1PM7A 3WHUA 5K0UA 4MGIE 4BQXA 5FZ1A 4DY3A 5C3RA 1ZRCA 1SDWA 1UWWA 1OKQA 1T6GC 2YU9L 1RUE3 1AR83 1RMU3 1YQ6A 2DFBA 4ASMB 4E2GA 3QBQA 2O8QA 5FZBA 3VBFB 3PMSA 1FV3A 2C9AA 4NAMA 4XTPA 6RXNA 1OHFA 1UKRA 2VOXA 3I2KA 5LA2A 4A3XA 3UV9A 3MEPA 3OPZA 4QPGC 2NVQL 5IVFA 3KQRA 1GZTA 2AZ5A 2ZEWA 1JUHA 5FP9A 2AR6A 1QY4A 2YU1A 3OGGA 4XIKA 4CP9B 1W03A 5FBJA 1A6CA 3DPRA 3MF9A 1JS9A 5E1RA 4PDWC 3EYPA 3RI9A 2JG9C 2LCQA 2M4VA 2GNBA 2ZEXA 2A3WA 4H2AA 2OZJA 3FHAA 1QEXA 3LA3A 3P1IA 2XJPA 1ZZ7A 4YSFA 1PX4A 4QQLA 3VL9A 3BTYA 4Q4X1 2P3JA 1G86A 2XLGA 4N8MA 5IP9L 1YUDA 2A5ZA 2AYHA 4CEWC 1RJ8A 1X7NA 4JZRA 2TBVA 5AFEA 2PMZP 2GC3A 4HKOA 2Q8EA 1JYXA 1CQ9A 2OS2A 4GA9A 2VNRA 1PX3A 1QJY2 5LA1A 2GNTA 2D44A 3M8LA 4XEZA 2P3KA 4MGTA 4BQ2A 2VMFA 4GMP1 1XYOA 1VB2A 5FP4A 4Q29A 5LBBA 4S2DA 3VBOB 1WGPA 3I97A 1UY0A 1G6NA 4BE3A 5JOWA 1ND3B 4CP9A 4Q2FA 2WLQA 2WQZC 3B3QE 5JR2A 2DDUA 3T4HB 1URXA 3HPNA 2DU0A 1BVP1 5DQ0A 3ST7A 5I8YA 4QHOA 4CXXA 4Q8KA 2ID4A 1RUC1 2QQOA 2WO2A 1CAAA 3H7JA 3PUAA 2ARCA 3AVSA 5BNNB 2XKOA 1TMF1 3LIGA 1SMUA 3J7Z1 2PHTA 4FPYA 4I0BA 4QKFA 2ZXQA 4YNIA 4OVEA 1HRI2 4A7YA 2B42B 5K9YA 1H8TC 2C9KA 1R083 1AYN2 1D2QA 3S1RL 2NMOA 2ZGLA 3BVCA 3LKJA 3EXUA 4P08A 4XUOA 3F95A 5FO8B 3WVJA 1K5MC 2ZEYA 1SBFA 2DBNA 4AVBA 2VJXA 2VZUA 1AL22 1C1FA 4AGRA 4CRQA 3JBG3 3LGRA 4PIYA 3NV1A 1OVPA 3DEMA 4Q4X2 4A41A 3FFQA 4IEWA 5FJ8L 2WN3A 3OJBA 1DVBA 1JYBA 2IFWA 4LNVA 5KXEA 3T30A 1IOAA 5J7MA 4QKDA 2ZAAA 2XB6C 1QJX3 1RUI2 3WNXA 1OXCA 4F8AA 2XBO2 4IE6A 1VPHA 2ZGSA 2RS33 4O65A 4TWTA 5DUVA 1GSLA 3VPBE 2X09A 5C6CA 5FZ4A 4FOWA 4A45A 4YZ1A 1BZWA 2ZGQA 2E33A 4IV3A 5FWEA 3ILRA 4LO8A 3GTML 5FY5A 4R4ZA 3U10A 1OF3A 1RHI1 4QT6A 3VZLA 1IS4A 2UYAA 5C4XL 4QX3A 1J3RA 2HVYC 3RZLA 1AF9A 4OMDA 3ZKYA 4IEOA 4EN7B 4D8MA 5JXIA 5IJRA 5A3UA 1BFYA 2RDVA 1L7QA 1TMF2 1S30A 5GLVA 2AH2A 1W9YA 5FAXA 4OUEA 3E6CC 2ZAHA 5C70A 4LEJA 4YW4A 3VKLA 4GH4C 5JLVA 1LRHA 1LOAA 1H6YA 4D0QA 2ZA9A 2Y0IA 1EAH1 4NRQA 5D8AA 4ET7A 4YGDA 2HKXA 3S5QA 3QLQA 2H6CA 2DCKA 2QJVA 3JUUA 3ZIXA 1CJPA 2D7FA 4XETA 4AEDB 3BCWA 3TEWA 4ZY9A 3TN91 3GTLL 2VOWA 2Q0AA 4PBPA 4DXRA 2UWCA 2ZHLA 2X5IB 5ABJA 1W06A 1BE7A 4C3IL 3MV11 4FOYA 1SLIA 3HT2A 4TYSA 3APBA 1FAYA 2FQPA 1NE6A 4MSVA 3UGGA 5C5TA 2VU9A 5I0RA 1BRFA 3M70A 4J25A 1JYTA 1FPN3 1Y7BA 4QDQA 3SNMA 5JVG1 4AOCA 2JIGA 5IK8A 1RHI2 1ENSA 3WX5A 4MADA 1AR91 1RXFA 3RZOL 4ISQA 5DM61 4BQWA 3EBRA 1PFWA 1YNAA 3MIFA 5H9SA 3W58A 3WUCA 5IK5A 2WQ8A 4XMIA 4XQ4A 2FDFA 2MNGA 1W6PA 1LOFC 1VBB1 3BU7A 4P9WA 4ASLA 5FYUA 5GLUA 4MO3M 5FZAA 5SV5A 2CWMA 4XCAA 2ZMNA 4MGZE 5FP8A 3R4DB 2CSGA 3MGUA 4Y20B 3K4AA 3Q8EA 5ACA1 1M06G 1W6MA 1EAH2 2PAKA 4OI2A 4AAPA 1LOCA 1NT0A 4XUPA 4UT5A 1LHOA 4CUAA 1UL9A 4NHXA 1WD4A 3NAPC 4Y1UA 3TN92 2F17A 4OI0A 1TWCL 4XJAA 4E4DX 4A6OA 2ZMLA 1UNBA 3B08B 5FY1A 1TNFA 1TME1 5T52A 1W05A 4LUKA 2D6NA 4OHXA 4COUA 3HN3A 2M6OA 4MH0E 1UO9A 3WW4A 2RR11 3OD4A 5BXXA 1IS5A 1B35C 4W6XA 5LEKA 4LIUA 4YG6A 3TEXA 4CP1A 3ETQA 3KZ4C 1BK1A 1S1AA 1AR92 2A6ZA 1W0NA 1D2SA 3ZR5A 2A6HD 5IT6A 3L2YA 4QPGB 2RS51 4UFJA 5FMOL 4DOUA 1UXZA 4QM8A 1QCVA 1H4HA 5L7OC 1RUF1 3N36A 3MIDA 4QGMA 3WXPA 2WWUA 3KV4A 4LA2A 2JG9B 3B02A 4YZ4A 1BYHA 2PQQA 4XBLA 4CVUA 1OUSA 1C57A 1BXHA 5CKQA 5FKBA 2QQKA 5ACA2 3INAA 1A8DA 2BJSA 3ILNA 4IUGA 3JU9A 1JZ8A 3IDCB 1NXEA 1N1VA 1UU5A 4Y3OA 3WDVA 2WINB 4AXOA 4CEWB 5T5OA 4X6AL 2QQVA 4L8QA 5GM0A 4MHRA 3ZXLA 4S2FA 4YGBA 1WLDA 3GXUA 5DAVA 5HCHA 2A71A 5SV8A 3OYWA 2K9ZA 3JD73 1C5HA 4HBNA 4QPGA 3K2OA 4ARXA 3HJRA 3ZVXA 1NA1C 3NRUA 2W52A 3M7AA 3JQWA 5FXVA 2IUWA 1F31A 2WNVA 1ST8A 1OURA 3CJIA 1TG7A 2YFUA 5H9RA 1H2MA 4PDWA 4YW7A 1W8TA 1PFYA 4Y1VA 5T5LA 5FYSA 4URAA 2RS52 2E51A 2BVBA 2OIIA 1JOPA 3D8CA 4AVSA 1PO23 1RUF2 1N3OA 4QXCA 3BOPA 5AVPA 1DZRA 1O4TA 4JTNA 3ZYIB 1NXMA 1H8TB 5GAHc 1BQ9A 1KD7A 4XIOA 3UNPA 3N3HA 1IQDC 1S0JA 3PKIA 1IPKA 3CLPA 4GMP0 4HK9A 2RHPA 1K5MB 3S7EA 4DMIA 1W2AX 2WBKA 4HPKA 3R4SA 4XFAA 4CDUC 3OBTA 4LULA 3CO2A 4E2QA 2R061 4AEJA 4R4XA 1JU3A 3WP4A 3EHKA 3WNKA 1CGPA 1O7FA 3H8UA 1RUE1 1AR81 1RMU1 3ZSLA 1VBD3 1VRH1 2XVKA 4EZHA 4Y1YA 3L2HA 1J58A 5IFPA 5GZCA 1GNZA 1SCRA 4H7LA 3T1MA 1PGL1 2YPJA 1E5SA 4NOTA 2QBXA 1BHGA 2VQAA 3KT4A 3FFZA 4PF5A 3MICA 2ET1A 4IGPA 4OHWA 1I9RA 4LLOA 1EPWA 3VGIA 5FPUA 2QQIA 4CXWA 4FFIA 5FR3A 1OVSA 3GZUC 4AK3A 1BVVA 1GQHA 1OKOA 4LKDA 4D69A 5A80A 4GXLA 4LO4B 1T9QA 4GB32 1DYOA 2DUOA 4M4RA 4RD7A 1MZEA 4X8NA 4K7JA 2BVVA 3UJOA 5CA6A 5FMDA 1N1TA 1F35A 2WQ4A 4M3CE 4R9BA 1ODMA 1DF0A 1W8UA 1V9U2 2GC1A 3KCXA 1W2NA 4EWEA 5C4WB 2Y38A 2L0ZA 3IPVB 2VMCA 3I4ML 2VL6A 2GMEA 2OVUA 4ZS2A 2R30A 3J9SA 3TEYA 3HMYA 1H2NA 4Q4W3 3WDYA 3O1MA 3BIWE 1F4HA 2JB8A 5L73A 3ASIA 3N9NA 1J83A 3S1ML 4YZ3A 1WMXA 2R062 3DXUA 4GALA 5C8WA 2VNGA 4H14A 3ZOIA 2R49A 1ZX5A 4L11A 2KR2A 1RUE2 1AR82 2A70A 2UU8A 2R16A 4FOQA 4HVOA 1VRH2 3S6PA 1F2NA 1V6KA 1HJGA 3FHQA 4J1XA 1W2TA 2R0FA 3T2QA 4LORA 5JZGA 1YQ2A 2W1SA 4CEYB 2DTYA 1BBT1 2WN2A 1PZ7A 3CDZB 2EA7A 4UFHA 5IAVA 4A3ZA 5JMOA 1ACCA 4SBVA 2H12A 3MSUA 2Y60A 4F7ZA 4YW1A 1W8FA 5FREA 1LHVA 3HOWL 4W65A 4XBNA 4EN8B 1QXJA 1R081 4IEZA 4ORFA 1SMMA 5IVBA 2E26A 1G9FA 3ZFFC 3ETPA 4GH4A 4UF0B 4XXAA 4QQPA 1UD1A 4CTEA 3EJKA 1UOFA 1QNYA 4V196 2RS13 3ACGA 4PIXA 4XJ8A 2FMYA 1J84A 4NUBA 4KNCA 4AE2A 3AYAA 4BZ4A 1U5ZA 1F5FA 4D3WA 2YBKA 4XVHA 5IWFA 2LROA 3ZX7A 1YWKA 3OEBA 1HRI3 2M4YA 3LFMA 4GQ7A 4M0NA 1OLME 1AYN3 1QJX1 3MPPG 1UPSA 3AXEA 3USSA 4XJ9A 3K4DA 2V72A 4Q26A 1GZCA 3P3PA 2J22A 1AL23 3J7LA 2ENRA 4G3YC 3NAPB 4NRPA 1COV1 2GDFA 4AR2A 5CFDA 2YROA 4K8RB 4PF1A 1QOOA 2D6PA 2XUMA 2C6AA 3NV2A 4LO7A 5DABA 4IV1A 2OPWA 1RUI3 2EXHA 2W3JA 3BN6A 2XBO3 1BBT2 5KC5A 2B7YA 4AGVA 5K0UC 4HZFA 4IEPA 4NPMA 5I0SA 2XVGA 3VBFC 1B35B 3AKPA 3NQHA 3RJRA 1LOFA 1VMFA 4QKBA 2V0FA 1SPPB 4R8HA 4HK8A 4E9KA 5FMBA 1MZFA 2NVYL 3FN9A 4FFHA 4HN1A 1PNGA 5DDJ2 4Q1RA 1C3HA 4JVAA 2C6BA 2PA7A 2ZBJA 2Y33A 3WDTA 1VBA3 1O3QA 1YV1A 5L7OB 5DAWA 1BQ8A 3AYDA 2HBTA 4BHPA 4LOSA 1Y1VL 2WZEA 4A2UA 3S57A 2YXSA 3ES4A 3MUY1 3Q8CA 1TMF3 1Y9GA 3NAPA 3DPRC 5FIXA 3BU0A 1QGLA 3AMPA 5JSPA 5F2WA 2ZTNA 1HRV1 1Y3TA 4BQ4A 1HN0A 1PVC1 4DXZA 2Z79A 1GOGA 1LKNA 4KWLA 1JU4A 1IKQA 3AP5A 2EXKA 4I30A 5DG2A 2NLRA 3VKFC 4ZPIA 4HG6B 1XSRA 3W5MA 1COV2 5KXBA 1K83L 4FXKB 1FPN1 3NNGA 3FL7A 4AR6A 1OFSA 4KQ7A 4GD4A 1G9DA 4MGKE 1W6OA 4URTA 3ZFEB 3HOZL 4B8EA 4A3FL 3SH4A 2WB1P 4GIQA 1XNBA 1C5IA 3HQRA 1ULPA 1NA1B 3TEZA 3B93A 2W08A 3P2AA 3TRSB 4XJUA 2ET7A 5CG8A 2OQ7A 3MO4A 5FDBA 4QB6A 3I3DA 3M3CA 3CQZL 3J4UH 4XHBA 4K1ZA 1LB2A 1KFXL 3GZTB 5A3MA 2DUPA 1CVNA 5IYYA 4HT1T 4Q1PA 5CAZA 3JXSA 4QPYA 1OWCA 2JICA 1A34A 4BH9A 1WW5A 3HIFA 3M3EA 5BNOB 2DVGA 1H2LA 5JIUA 1R64A 1CIWA 1S0IA 3QQCE 2IFRA 2BOIA 1YCIA 4AQSA 4EROA 2QCSB 1GR3A 1WUVA 4TVMA 1LOEA 3WZ1A 4CCJA 4WBBA 3ZMNA 1HRV2 4CDUB 1UYXA 4Z2AA 2BWCA 3ALQA 1PVC2 2BNMA 4PI2A 4UI9L 5I93A 3W59A 3B69A 4LBJA 1YHFA 3E97A 4AG4A 1LKOA 1IKPA 2WDBA 4FQ4A 3I3BA 2Q1MA 2BV4A 5MFZA 4FXGB 1FPN2 3NJXA 3POYA 3T2PA 3AZZA 4YGCA 2AREA 2XL9A 2PSMC 4D7TA 5JWPA 5FMOS 5JPMB 5FPXA 4BY1L 2HWB2 4BLIA 1IZ3A 3HJWB 3AK0A 5KHHA 4KWKA 4AWDA 1W8OA 1W9WA 1LECA 4C8DA 1HB3A 1WBLA 2XJSA 1YQCA 1S4CA 1CAVB 2CYFA 4HETA 3JZVA 5FMCA 4BK5A 2X10A 2HWC2 2D3RA 4AFCA 1AX2A 4E27A 1VBE1 2YPDA 1NCRC 1N3QA 1PO11 2KKDA 2VZVA 3IB3A 3SEPA 4CCNA 5M0TA 2QTWB 4NHMA 3NVCA 1TWGL 2XGXA 1AR93 4PIZA 3H3VM 5FBZA 2H6BA 3K51A 3GHMA 4CDUA 1D4M2 2PVEA 4AYBP 5J3UA 2C26A 4AI3A 1MACA 1NZIA 2WR9A 2WS92 5C3EL 4Y22A 3RS6A 2R073 5IVYA 1CAUB 1H9WA 4HOOA 1JMUB 4CCKA 3S15L 3PIGA 4B1MA 1D0GA 1KDKA 2BU9A 2VE1A 3QH7A 4UW5A 3JD71 5ACA3 3RZZA 3VBHC 5D8AC 2X29A 5E8AA 1DQ1A 4AHZA 3MLLA 3AJZA 5FZMA 1VCXA 4D6QA 4OQ8A 4FPLA 1F8VA 1MPXA 1GWMA 5LEJA 3A44A 1OOPC 3MIBA 5AFBA 2D3SA 5ABJC 3WNMA 3PKJA 4XOGA 2RG4A 2XPJA 3RWNA 2B5HA 3PTYA 3M2MA 4NR1A 5IVCA 3LOBA 3O0WA 5APAA 4QKNA 2A7AA 1L3JA 3LWCA 3U0ZA 3TWIA 1XE7A 2ARAA 2BWAA 2W68A 3VL8A 5M3ML 1PO21 1YJKA 4KG8A 4XURA 1SHWB 5K8SA 4BMBA 5KWRA 2DURA 4IESA 4BU2A 5GAGc 4YVWC 2GC2A 1VBE2 2R6QA 1PO12 2QQNA 1ZBA3 3FLPA 4GULA 5BPXA 3GJBA 3ZFFB 4D6RA 2L9LA 3H7YA 3H97A 5A70A 1O4ZA 1KS4A 1DHKB 3H0GL 2RS53 4CP0A 3M3YL 2YBSA 1OQEA 1UU6A 2VCBA 2CGNA 2LRPA 2BBAA 3GCWA 1K45A 2XLAA 4GKXA 5FTTC 4A7ZA 5IVVA 1B2JA 4QX2A 5E89A 3KYXA 3PIP1 1RUF3 2J1EA 3HBZA 1VE0A 2VNVA 1VBD1 2BE5D 3VD7A 4XDQA 2VTXJ 3GTKL 2ZJCA 5FZ0A 3H1MA 5FZKA 5L9BA 4B8CD 1LHUA 1QH7A 3OY8B 4KBZA 5HI0A 1RINA 2IXJA 3PVEA 5LASA 3DYMA 4RHV1 3RYRA 1GNHA 2VBPA 2JKXA 3CL1A 5FZ9A 4DB5A 1QH6A 1VRBA 2KM2A 5EHDA 2WZR2 4XAEA 3RFRA 3WP6A 3PIJA 2C4XA 4OHVA 5IVEA 2R1BA 3AB0A 2P1BA 5M3FL 1L7RA 4K6BA 1HB2A 5L19A 2ZGRA 1KJRA 1B13A 4J1WA 5JOZA 2QE3A 2EALA 3DXTA 3T2TA 1DCSA 5K0UB 3ON7A 3A0KA 2VGDA 2A73B 1E57A 4O7XA 3KMHA 5A7PA 3ZKUA 1OD5A 3ABZA 4BK4A 3OG2A 3RZJA 1PO22 2UY9A 1SFNA 2Q4SA 3UGHA 1V6LA 1W6QA 5F2SA 4Q0QA 4X6QB 1JYIA 1TE1B 4GB33 1LHNA 3JB4C 4RN5A 4Q4W1 3VUOA 3PVOA 2ARXA 2YC0A 3CU7A 1YQ5A 3O14A 4BJ0A 1V9U3 1R091 2YHJA 3HOYL 1ONAA 2Q30A 3DPRB 4FO9A 4DXSA 1VBD2 1VAKA 1YYNA 1XQNA 4OHYA 1VLNA 2A1XA 4FQZA 4C0HA 3BTXA 2XWJB 3VBUA 4Y1XA 2NYYA 3B94A 3B0AB 5EJ3A 2ERFA 4RHV2 1X33A 1CWPA 1IROA 2V4VA 4I09A 2YBPA 3THCA 3K3NA 4CDXA 2EVXA 4NPLA 5CNAA 3U4SA 4DUWA 4YARA 2R063 3VBFA 5FZ6A 3P3NA 4LMFA 1W6NA 1UMHA 4BXXL 1QJZA 2VOVA 2UY8A 5C7GA 1VRH3 2GP5A 5FZCA 4HANA 4JGZA 1PNFA 1MS9A 2YC2A 1E5RA 3QD6A 4FPEA 4P5HA 2RS11 3HD8B 3AM2A 3VD4A 1AXYA 4K8FA 4E4ZA 4I2OA 1SLCA 2WNVC 2VUML 1ALYA 1HIXA 4PQ9A 4Z82A 5KXCA 3CJIC 1HRI1 1XC6A 3KT7A 3VB9A 4AR5A 1AYN1 4Y5Z0 4RFT0 3N35A 3LD8A 3TNQA 4Q4W2 1JH5A 4RGGA 3W9AA 4HKLA 2VZRA 5GALA 5IVJA 1GP5A 2WNEA 1AL21 4Q4V3 2R7ZL 2CKCA 1MS1A 1R092 1QKQA 5BY5A 3D5OA 3NKTA 5C3PA 2VD7A 1LKMA 4GAZA 2K46A 1H0BA 5J1XA 2OXBA 4AEMA 3BGAA 3I2JA 3IZOA 1US3A 5FYIA 1RUI1 3J8F1 1RYYA 3AMQA 1H1MA 4AI2A 4B4PA 2XBO1 3F2ZA 1UX7A 1ZA4A 4RXNA 5F5QA 4OULA 1LULA 1S2KA 2ZX1A 3GNEA 3H9AA 2ILMA 4FI9A 2XJRA 3D0JA 2VUAA 4JRAA 4ZXEA 4ES8A 1GOHA 3O1OA 4LHLA 3V0BA 1AXKA 1OA4A 1OPMA 2E7TA 2EAAA 2JA6L 1PGW1 1BKZA 3PDQA 4KG0A 5A3NA 4WM7C 4HVQA 1ZNPA 4YZ5A 5AN9H 3SH3A 1UIJA 4LA3A 1QNWA 5F3GA 1VBA1 2RS12 3NJZA 1F15A 1BBT3 1S0CA 2B9UA 2FDKA 4IV3B 1NXD1 5GLWA 1CADA 1RDVA 1TVGA 2GZWA 2WNUC 5FYZA 5IK7A 5A3PA 1NCRB 3ZN5A 3CHXA 4GJYA 3P8BA 2PXJA 2YU2A 5FV3A 4XE9A 1SFOL 5IP7L 1YFUA 4N7IA 4A6SA 4AYUA 2EY4E 1NNQA 5EJZB 5FLIA 1BLZA 2WABA 1W8NA 2ORXA 1XU1A 2ES3A 2Y0OA 1AR72 3LDRA 4XJWA 5DDJ3 4AFDA 4AHXA 4DINB 5C8CC 4AVAA 3H3LA 3MI8A 3BPZA 3I2IA 4LBMA 2EXIA 2Y6GA 3E6DA 2HH9A 1QXRA 2VUCA 3VLBB 3SS2A 1DZQA 1UZVA 4Y5TA 3OOXA 4WM8C 5FZLA 1Z92B 3LQCA 1AR62 2FCVA 4BQ1A 4ZHNA 4NWVA 4OI4A 4CDWC 2RDNA 3J8F2 5BV6A 4A3IL 5IK4A 1XNDA 3VBHB 3OBAA 5D8AB 3ZM8A 2IXIA 4ARYA 3ORJA 5FO7B 1UYZA 2QDRA 2ZACA 2E2IL 4MUVA 4IETA 1OOPB 4A3JL 3MUZ1 4FP2A 1XRUA 1COV3 4XUQA 4Y26A 4WVVA 3TYJA 5ABJB 2HJIA 5JXJA 2QQPA 3J7HA 1RUD2 2G4IA 1NCRA 4NVPA 1WMEA 2JENA 4Z8BA 1PGW2 4Y4YA 4HKWA 5FYCA 5CFCA 3W21A 1RUJ2 5JZGC 3Q8FA 3LAGA 4META 1V6IA 4FBFA 4XJZA 3JB8A 1VBA2 3ENRA 3UESA 3UL2A 1QJU3 4ZU7A 1XNKA 3UK9A 3WW1A 1PM4A 4WZCA 4YVWB 1QYBA 3QACA 4UFIA 4CXYA 1ZZBA 1PVXA 4XQDA 4LR4A 4MHUA 1N47A 3OEAA 4MVTA 1NQDA 1KXGA 1HN1A 2JDAA 4CUGA 3O1PA 1W6PB 2EICA 2OA2A 3VBHA 1CJDA 3PUHA 4AFAA 3D4KA 4NJ4A 3WF2A 2GN7A 2E2HL 3TBDA 2BOJA 1J3PA 4LKSA 1OOPA 3FC0A 1PFUA 1GMMA 1YI9A 2A6XA 2ADEA 2Z3QB 3BOWA 5HCBA 3O1VA 3S14L 2SLIA 5K7PA 1HRV3 2VPVA 4MGQA 3V0AA 1W6MB 1YC61 2J42A 2OQ6A 3WWLA 1PVC3 1UY4A 3RRDA 4CDQA 4JGYA 1PK6C 2PYTA 2JB4A 1S0FA 4PLMA 3HN1A 3MDPA 4JCKA 4UOJA 1MVEA 1O4YA 1POV1 5JPNB 4N43A 5FYYA 4YGEA 4N7UA 5CFDC 1R0HA 2DVBA 4BA6A 4YVWA 1HB1A 1I6XA 1V6MA 3CBNA 2OPKA 2HWB3 3HOBA 4IV1C 1GQGA 2E63A 5FY7A 2BP6A 4JKMA 2VY0A 4BWOA 3VKNA 5EJ1B 4LJHA 2ZABA 4XDPA 4PCRA 4OQ9A 3T0DA 1SMWA 3OPWA 4XZPA 1FATA 3S2DL 2R071 2HWC3 4OZXA 2LM3A 3M3OA 2E7AA 2VQ0A 1ZBE1 4CDWB 1TEIA 1WJVA 2PAEA 2KA3A 2ZGNA 3PZAA 1YRZA 2D6MA 3J7NA 1DQ4A 4KU8A 1V0AA 5GLZA 5CISA 2PLV1 2WYFA 5E6HA 4NWWA 2BEOA 2B39A 4FFFA 2VCMA 4HN0A 2AYJA 4K21A 2ZX0A 2UWBA 5FXZA 5T50A 4DEQA 1V6JA 5DXDA 4HXCA 1D4M3 5DAPA 3HQXA 1ZRDA 4WV8A 3H1YA 4AVTA 3MLKA 4Z92B 5FZIA 2JE7A 1U5YA 4ZN3B 2WS93 4ES9A 4TSVA 3ZSJA 2WT0A 1Q5OA 2B8MA 3G7DA 2ZGKA 4UBHA 4AFBA 2ZHNA 1N1YA 4BCUA 2ZKNA 2XDVA 5FUPA 5A1AA 2JE9A 2DVDA 1ZZ6A 5FPLA 1X9TA 5C5UA 3N9OA 3CEWA 3ZYRA 3DUIA 1JZ2A 1NLQA 3SISA 3MZHA 3WG2A 1PHMA 4WZFA 4YVSA 2PHXA 3NO8A 1MS5A 3RYGA 1MZ6A 1ZBA1 1IS3A 2XUEA 1TWAL 2GMPA 2VMHA 3E5QA 5JVVA 4CA9A 4LKFA 3BIEA 3OBZA 1NXGA 3E6BA 3OYWB 3PURA 4HONA 4CUBA 5J48A 2BERA 5HXVA 3JR7A 2DBIA 1A8MA 4JDNA 2ERSA 3LDKA 3OB8A 3VV1A 1AX1A 1UOBA 2WNVB 3VZMA 1ZRPA 2JI3A 2R072 3B9CA 3CJIB 4ITCA 4PI0A 1EUTA 1ZBE2 2JDHA 2SBAA 4KWUA 1L7LA 3PL0A 1VBE3 4L92A 2QQWA 4PDWB 1PO13 3OBRA 5FCCA 2JDPA 5FKCA 1DP0A 2A3YA 2CAUA 2PLV2 5AVAA 1GUIA 5T5PA 1OWBA 3CF6E 4QAWA 1W2OA 5C4JL 2Z5WA 4A3DL 3LNLA 1CESA 2XONA 2JA7L 1H7VA 4IE4A 2NN8A 4LBLA 3I4IA 1WZXA 3EQEA 3LWQB 2W92A 4R9CA 2DCYA 2FCUA 4KMQA 3TAYA 2R32A 4XXPA 3T2OA 3PJYA 4CE8A 1ZZ9A 2BNNA 1KQRA 1RUNA 4M4PA 1ULFA 2AGSA 3MW4A 4HPKB 5JMCA 5IATA 3MLJA 4L99A 3GBGA 1QXPA 2IXKA 1SFYA 3N7JA 1OA2A 5CIRA 2E32A 2WO3A 3PHMA 4A3LL 2WZR3 4Y1ZA 1S2BA 4UBGA 3WF1A 1G9CA 1ZBA2 4CPBD 4GB31 2GN3A 4WM7B 2XXZA 1T9OA 3AFKA 4XW3A 4FTSA 2I74A 2DF7A 5FQ0B 1W28A 1XSQA 2G1MA 4YW3A 5J96B 1UKGA 3KD4A 2WNUB 4B4RA 1QJEA 4AQ2A 1V9U1 5LATA 3X29B 2F4PA 4TLFA 2J1AA 2ZGUA 5DZGA 1ZVFA 2G9FA 1A3KA 3NJYA 4YLZA 4EN6B 4XQWA 5A7SA 5I8TA 2BFUL 2ARBA 3PIO1 3ZSMA 3AKRA 2J9UB 1OT5A 4QWNA 3VZKA 2Y64A 2JA5L 3NNMA 3POFA 3QVDA 2ZS6B 1K12A 3AFGA 3CIHA 2APOB 1SLTA 3DL3A 3LZZA 1EP0A 1RJ7A 1UYYA 2VZSA 1LJ7A 4WM8B 2Q1FA 4ZZ8A 1OF4A 2HWE1 2X53S 3NL1A 4U2AA 2OYZA 5GAEc 4FPHA 1QQP3 3AMNA 4KH9A 4V1PA 2YGLA 5JCTA 4HLTA 4WM7A 1NG0A 4Q27A 3RMYA 4WVWA 1NYWA 5FQ0A 3P6BA 3T09A 3ZFGA 1I3HA 4RHV3 1O8SA 1GWKA 1XBFA 1DG6A 4PT6A 4JAAA 5H1Sc 3LEKA 2WNUA 4S2GA 5GZFA 3C7GA 4E2SA 1PMJX 2W47A 3GHNA 2PHUA 2WT2A 1IU5A 2XJQA 5I91A 1NLSA 5JZGB 3RYPA 2JDMA 3C7EA 2WUHA 3GTJL 5FY8A 3VBSC 2VTXA 5IHRA 1BMV1 5MLC3 3U37A 4QPIA 5C8CA 4BQ3A 2RJKA 4ZU4A 2BGCA 1QHDA 2PHDA 3FWEA 4Q4V1 3ZXEA 1RYQA 3L9JT 3D0SA 1SQ4A 3WSOA 4BBSL 1MZ5A 4BB3A 1UOGA 5C9AA 3LSEA 4GH4B 3ACHA 4WM8A 1RVF2 5A33A 2IVIB 3ELNA 5A7WA 4CDWA 1E5HA 1U0AA 2Q8DA 2PYAA 1QDCA 1FXZA 1W3VA 1WLTA 3K75B 5DPNA 3WG1A 4QDRA 2A3XA 3WF0A 4EJRA 3PTRB 1VMHA 1WA6X 1V70A 4B29A 1R093 3OUHA 5FK8A 3AP7A 5CU1A 3H9CA 4O61A 1FI2A 1T9PA 2HWE2 2ZPXA 2ZHMA 1Q3EA 4GZ9A 2PHFA 3WR0A 1W9SA 4UFKA 3WEZA 4P9LA 2XWBB 4R52A 3J7Y1 2QL0A 1FHHA 3GTPL 1JODA 1JUIA 1UZYA 2VZQA 3QH6A 4K3UA 4L2NA 2TUNA 1LGBA 2XHNA 3T3YA 3ZN6A 3LEMA 4BPZA 5CFDB 1JYVA 1KS5A 1X36A 2JIJA 5IW0A 3H9BA 5LRRA 4C2M1 2PTMA 1HQWA 1UOJA 4WVMA 5F9TA 4A3CL 3AZYA 4IV1B 5KHGA 2ETEA 4POFA 4LQRA 2J1TA 2JG8A 5DDJ1 5G04L 1BMV2 2AUSB 4Y52L 2JEMA 4Q4V2 2JDZA 4FVVA 4QQ2A 5JSRA 1B2OA 2WAOA 1UCXA 2QKDA 1RB8G 1WCKA 2Y6FA 3O12A 5B4NA 2GAUA 3S1QL 4Q0UA 3WLUA 3AZXA 2X05A 5F6LB 3WNLA 2WL1A 1AJOA 5FZGA 2ZOEB 2D6OX 2Y26A 5M5XL 3U11A 4FTEA 2VOKA 3AP6A 3OTFA 2OUJA 1LU2A 2WFF3 3WOGA 1DX8A 1AR73 4RYDA 2CWSA 2R93L 5L9RA 3S30A 4DUVA 1TWFL 1PK6A 1AZDA 5CZKA 3FE5A 2AQCA 1JW6A 3KLSA 3LIHA 2O1QA 5DZEA 2RFKB 2VZPA 3POGA 3AMHA 3GTQL 1XJAA 1CAWB 2NYDA 1ZZCA 1O5UA 1LGNA 2Z4FA 1AR63 4O9EA 1IGOA 3FHIB 3VBUC 2RE9A 2QFEA 2W39A 4EN9B 5J09A 3J8F3 4NIDA 2FZ2A 2NMNA 4H55A 4MYEA 1QJU1 4CDXC 5CKMA 2I2SA 2DTWA 2VCCA 2DVAA 5B2GB 3O1RA 2BGOA 4JC1A 4QXHA 1W6OB 4UWDA 1Y9MA 1O3RA 2P3IA 4C3HL 4W4ZA 5LB6A 3POWA 4NROA 4D7YA 1LENA 1NCQC 1RUD3 3R6SA 3ZIWA 2ORZA 4W6YA 1DFQA 4FTBA 2AUYA 2JDYA 2IXHA 4JGZC 1RUJ3 3SCHA 5M5YL 2Y0SP 1OQ1A 2VZTA 3GBFA 4YM3A 4AVVA 4DPNA 2XR4A 1LESA 1W8ZA 2Y6LA 1AL0G 4CCDA 1NX9A 1ODNA 3T0AA 4K20A 1J1LA 2VUJA 4P00B 5DUUA 5KHIA 2C6SA 1O8PA 3RYKA 1FHMA 3ZXKA 3KVAA 4XBQA 4I0AA 3ZYPA 2A69D 1OMIA 1J1TA 3LPFA 4IEYA 5EXOA 4RFRB 3EO6A 2HYXA 3B5LB 2RJ2A 4BMEA 2XLFA 1CAWA 3A4UA 4Q0PA 5LA0A 4XFGA 3PLQA 4JDOA 2NVTL 3VD9A 3ES1A 2WRAA 4N53A 4CYDA 1BEV3 3KF3A 4MXWA 2V5DA 2VW1A 2WA3A 1S55A 2HYKA 5FYVA 4AFMA 5LBCA 3SCFA 4RQPA 2EXJA 1SMVA 4Y5SA 4OZOA 3WQ7A 4BIOA 4JDMA 5FJHA 2HWB1 1ULDA 1LKPA 2VZ1A 1ENXA 1Y43B 4V2WA 1H2KA 2VULA 4JV4A 5FPZA 5KBFA 5ERLA 4ASKA 3S2HL 2RM21 1QJU2 2IVJA 3HT1A 4RS5A 4LT5A 3HNYM 3GJAA 3I59A 3VDDA 2HWC1 4I01A 1WLCA 4CZSA 1O5LA 3ZN4A 4IE5A 1SLAA 3SLIA 1QQTA 2B5ID 1GZWA 5K4LA 2GMMA 1S2EA 1D4M1 2N7GA 1W8WA 3LE0A 3POBA 2PHRA 3A23A 3POEA 1UF2C 4JQTA 5JR7B 3WV6A 3SHRA 2WIIB 4Z2WA 2ZX4A 4ME3A 1DU3D 2WS91 1S24A 3VZJA 3GM8A 4NMIA 4AZZA 1DLCA 3KYYA 1MQTA 3KVBA 2ADDA 4A42A 4COYA 3I4NL 1EYBA 3R0RA 3WP3A 1O3SA 1REDA 2OUHA 2RMU3 4YW5A 3UKTA 1XPWA 3WP5A 4BQ5A 4COZA 4Y22B 1NLRA 3HOVL 1GWLA 2AACA 5I0TA 4FPKA 3IWZA 2QVSB 5A3TA 5JIAA 4COVA 4GWIA 3CKHA 1S0EA 5F37A 1W2UA 3MPSA 3LWVB 1Z78A 2CV6A 3LDBA 3POIA 1D0HA 1SLBA 2JD9A 4XUNA 4QB1A 5RXNA 1GANA 1CN1A 4Q4Y3 1UQXA 2P6HA 1S0DA 2HLEA 3I2HA 3ME2A 3MIHA 4CCLA 3CZJA 2RM22 2G9GA 1JHNA 1MS3A 1ULEA 4XUTA 4YRDA 3I2GA 2I45A 2J1VA 4AQTA 2W1QA 1I50L 2JE8A 2P34A 1POV3 4BXSV 1WW7A 3NNJA 2EIGA 3N4MA 1FMD3 1MVQA 2IZWA 1SFPA 1REEA 1B09A 2V0EA 3H1WA 5CFCC 5JAXA 3MYXA 4GWJA 4EWAA 4ONUA 1LODA 4AQ6A 5JXGA 1IPJA 1U12A 3KGLA 3VBOC 5JUVA 2GH2A 1ZYBA 2CNAA 3AC0A 3UKVA 2VXJA 1JZ3A 1WW4A 1NKGA 2YGMA 1LTLA 4Q5OA 4JADA 3DGTA 3HKZP 5FWJA 4LBQA 4FAGA 1ZBE3 5I0UA 1VBC1 2A6VA 3ZXGA 1YFXA 4QX7A 2F4LA 1Q56A 3ZYBA 2YV8A 3I3QA 2DCTA 2PLV3 3CQOA 1RUOA 2R7EB 2ZGOA 3VDAA 4RA0A 1E5IA 4XPVA 5BNNC 2PPTA 3V65A 1HQNA 5FLJA 3H3ZA 2VVEA 3H0OA 3KF5A 2WZR1 5A7QA 1HJFA 3KV9A 1JYNA 4YZ2A 2I07B 3T0BA 5F8PA 3S0MA 1NUKA 3PUQA 2WSUA 5K2ME 1SACA 2B46X 2PMWB 3K3OA 2PAMA 4UFLA 4AEKA 4CCMA 3VBSA 2NM1A 3IKWA 1CPMA 3BODA 1W04A 1FX5A 2BNOA 2PFWA 4JGYC 4CDQC 3I2OA 4A7KA 1DQ2A 2BFUS 3UETA 2Q1ZB 4N43C 1DZTA 4YG0A 1MS0A 3WINE 4INDA 3IDAA 1Z7S2 1TWHL 4NN0A 3H42B 1W99A 5FZ3A 1C8M2 5JI7A 5A7OA 2FDIA 4W6WA 4HFSA 3ACIA 2BYVE 1J3QA 3GBWA 2X8KA 3LEIA 3TNPB 3VBRC 3NW4A 3T08A 3WCRA 2K0GA 5B4XA 1OBNA 5ANNA 3LOIA 4EN0A 2WO7A 2A6WA 4BOWA 1UXXX 1YXWA 5LY2A 4YWMA 1W6QB 3WD5A 3WUDA 8RXNA 3K7AL 2ZGMA 4IXLA 5FZ8A 4NAOA 5A1LA 3THTA 2PN5A 4FPFA 1O6UA 1VBC2 2FDGA 1CAXB 2KD7A 2Z42A 3FMGA 1QQP1 2JECA 5LZ6A 5CG9A 1QMJA 5C3OA 4ZKTB 1RGSA 4EWDA 3O1UA 2YUEA 4KWJA 1QWRA 5CBLA 5GZGA 2WA4A 3AKTA 4XDOA 2ZX3A 1MS4A 2DCZA 1OLMA 2W1WA 4OUSA 4IGOA 4IE7A 4Q8LA 3KYVA 3FX3A 3U1XA 1EV13 1PIV2 3WF3A 3WQ0A 4DO0A 2MEV2 1QF3A 4K9FA 2KXLA 2VG9A 4P9YA 5FYHA 5A6ZA 1OLRA 2HEWF 4HSJA 3MFAA 3VBUB 3I8TA 4YFZA 1GFF2 3N9LA 4H3WA 1VALA 2V5YA 4CDXB 4IDZA 4XYXA 1XNAA 2BQPA 2ERJA 1UX6A 2RDRA 5IYCL 3LPGA 4LO5B 2QQLA 4YVSC 3NMBA 1W6NB 1Q8QA 3U78A 3OSDA 4AR4A 2E9QA 1U5IA 4I02A 4IEVA 5AC93 1X8EA 4JGZB 3N9PA 5EQUA 1DQ6A 2Y6KA 5CADA 5CKNA 5JXHA 1VJ2A 1CAXA 1FV2A 2JXAA 4Z07A 2VMEA 2E31A 2D40A 3B7MA 4A3ML 2R0HA 5I8SA 4LBNA 2VH9A 4COWA 3HEIA 4FPCA 2WNOA 2DVFA 1AXZA 4NIHA 5DAXA 1NAEA 2D93A 1VB4A 4XAAA 4NHYA 4QIWP 1GQPA 3USUA 1UZZA 1J59A 4E4SA 4CSWA 3ZG6A 1F9KA 3S1NL 1QQP2 1SBDA 5L36A 1RVF3 4FPOB 4N90A 5FK7A 1ZZ8A 2OW4A 2CU5A 2QNKA 2VMIA 3GYDA 5FYBA 1I1EA 4Q0VA 3O1TA 2FDHA 1W9TA 2B9VA 4AR3A 1HXS1 3VHOA 3ZXDA 2O8OA 4PLNA 5F5AA 3WDWA 3AKSA 4E8CA 3AL6A 1FOD3 4ZS3A 1JOBA 5L9VA 1NCQA 2HWE3 2O14A 1X9PA 1YEWA 3BTAA 3N7LA 2OT7A 4ZXKA 5GADc 4QX8A 1QOTA 3OF1A 3OUJA 4A93L 4WFN1 4LE4A 2GNMA 2BW8A 4KGQA 2WWJA 3GTGL 5DUWA 2IWGB 1GNYA 2CL2A 2H0BA 3V0BB 5LA9A 1YQ8A 3ROUA 3AYEA 1Y1WL 4JQRA 5E16A 4KGGA 3H8XA 1UZWA 1WCQA 1H1AA 2D5FA 1RL3A 4BY7L 2WFF1 3ACLA 2K2DA 1AR71 5FZOA 1JI6A 1O59A 2V4AA 4C3JL 4CU7A 1R1A3 5FO9B 4LHNA 5FXXA 5BNPC 2BGPA 1DGWX 4A3KL 2PVXA 1H1IA 4K40A 2HR5A 2ZKLA 5LBFA 1V6NA 3SITA 3RZKA 1AR61 4IEUA 3DYOA 4YFWA 2W1UA 3S7IA 3ZDSA 1GBGA 1X82A 2ZGPA 3HAXC 4Q0SA 1YFYA 1TZOA 4NPRA 4A3BL 3KCCA 1HXS2 5JOXA 1C8NA 1R9TL 5IFTA 5FFOC 1QJFA 3ECQA 4Y4RA 3RJ2X 4C91A 2FHRA 2ZMKA 4N9HA 4XTMA 1GV9A 1WCML 1RUD1 4Z1VA 1H8VA 5D1IA 3VZNA 1RXGA 2JDKA 1RUJ1 1UAIA 4LO6B 1RUH2 5FJKA 4DNYA 1YFWA 3UYJA 5A32A 5CEHA 3RGBA 1Z0HA 1ZRRA 3ZFGC 2EIDA 3KGZA 5MF6A 2JD4A 4CUCA 5F3EA 4J6GA 5A3OA 3UT0A 4DY5A 3KS7A 5T54A 1SG3A 2VBDA 1RUG3 3TB0A 3U07A 5CFCB 4XZUG 4JKKA 2GC0A 2P37A 2PHLA 2D3PA 4RGAA 2JWPA 1NY71 1YIFA 2LUWA 2XQRA 2WFF2 3IDEA 3HJYB 3IMNA 4QPIC 3BUCA 7RXNA 1REFA 3SXWA 1DGRN 1IHMA 3ZDVA 1IU6A 5C33A 4AHYA 4DXTA 1Y9QA 1WCUA 1BEV1 5EFUA 2TNFA 3HBKA 1SLLA 3MV01 2P6CA 4DFSA 4QX5A 3FUQA 5CYYA 3WQBA 2QDNA 1H4GA 4RGKA 4RL7A 3K77A 5C3QA 4XMAA 1XYNA 4QD2A 5C9AC 2CHHA 4DRRA 1PFVA 2VM9A 1WKYA 1IRNA 3ZSEA 2CKAA 4GWNA 2RDSA 1S2ZA 3D82A 1CZTA 1KRIA 2GALA 2NPIA 1D7PM 2WSVA 2YB7A 1YLLA 3P5BA 2VZOA 4U671 1Q8SA 4M00A 4V2VA 3RMXA 3RNSA 3U75A 3VZOA 4K9SA 2VW2A 1PMIA 3PVBB 2WZPP 3MW3A 2VOTA 3V0AB 4QB2A 1KJLA 2VMDA 4I3PA 2FCTA 1W0OA 2V73A 2AC1A 1YK4A 2R043 3OGJA 4JGYB 5J98B 1WMDA 4CDQB 5H9PA 3BKZA 3VBOA 4FP3A 1FNZA 4N43B 4BBRL 1ASJ1 1I5ZA 3A7QA 3HQUA 2JA8L 1ND3A 5GZDA 5HV4A 3FBYA 5GJ6A 3O0VA 2LW8A 3OGRA 3S5AA 1FYUA 1C4RA 1G7YA 2XHKA 2HBUA 4UY81 2Y6JA 3VBRB 1NY72 1V6OA 2J1UA 2JG8C 3U14A 4D94A 4XFIA 2XQXA 5F3CA 4CU6A 5J37A 1P8JA 2RMU1 1SEFA 4XF9A 1BEV2 5BNNA 3AYCA 1OH4A 1F5JA 4Y7NL 5D21A 3HNBM 3Q9OA 4QQOA 4RR3C 5EYYA 2WLPA 4OFGA 2NP0A 3NKGA 1WLWA 1DQ0A 4XFBA 4JAGA 2W94A 3IIIA 4H7MA 5LCWL 3S16L 1F4AA 5FZDA 2Y8KA 3M1HA 1K3IA 1RUC2 3AZVA 3EMRA 1MEC1 4NRMA 2OX0A 1ZRFA 4Q4Y1 5F6KA 2E7QA 3NWKA 5C4WC 1RDGA 3BALA 2B45X 1FT9A 1AYM1 1LCLA 2YDEA 3IIAA 4A3GL 3JCIA 4IEQA 4L9BA 1R0IA 1OQDA 1FMD1 1LGCA 2EAKA 4QPWA 4DIQA 4EE2A 4GJZA 1U5XA 2VTFA 1HLCA 2V3BB 3VHNA 3VBRA 3GDBA 1IG0A 2BBVA 2YY1A 2Q8OA 1H30A 2RVAA 2RM23 2JDUA 2MS3A 2VNOA 3HWJA 1ASJ2 3J26N 3KV6A 3QCWA 4YVSB 3SC7X 3ZYHA 1Q8PA 4ISRA 4B1LA 1DGWA 3VHRA 3SEEA 3VKMA 1GP4A 3TOJA 3K35A 5LK5A 4XFFA 3SKVA 4CEYC 5GKAC 4QHZA 4FFGA 3K46A 2E53A 3KSCA 2RMU2 4LLFA 1HDKA 4HSLA 3KV5A 1T6BX 5LBEA 3WT3A 1TNRA 1S0GA 3WWNB 1OH3A 2OKXA 3T4VA 1AX0A 2VXRA 5BNQA 3ACFA 2FZ1A 2HWF1 3I54A 1PZ8A 1RB9A 1JBCA 2C24A 2GH8A 3MBWA 2RDQA 5TSWA 4AF9A 4MG2A 1MEC2 1GOFA 1W9FA 1JZ4A 5FZFA 4IQPA 4Q4Y2 2HEVF 3H8OA 1XOYA 1IG3A 4N53C 4AEDA 1H6XA 5EYXA 2GSYA 4C0BA 3MIGA 4LBKA 1AYM2 3PUSA 4RQPC 1I3QL 1HW5A 2X5IA 3NJVA 1FMD2 4OLLA 3RZTA 5ANQA 5CB7A 5JSOA 2D97A 5IY0A 1CIYA 2ZZJA 4TLGA 4W8JA 1VAMA 3KB5A 2Y6HA 3BI3A 4QX1A 3M3QA 2XJUA 2NZ9A 3GZAA 3WHTA 4FAHA 1GLHA 4RS5C 3LA2A 5JI9A 3RQ0A 3VDDC 1GZ9A 3HR9A 4CCEA 1XE8A 2E6VA 5F32A 4EV0A 4YW2A 4QGLA 1I6HL 1Z7S3 4M3CF 5FRAA 3URFA 3FLTA 5FUIA 5C3SA 1C8M3 4AI0A 4FSJA 5JOYA 2JJ6A 5AI2A 4IERA 5IYDL 4IW3A 1US2A 2CDPA 4LK7A 3R05A 1ULCA 1HV1A 4QHBA 3A0NA 4CP2A 2D98A 1DYKA 1JYWA 3VD3A 4QU1A 5BNPB 5DMYA 4YWLA 1EV11 3DECA 1JN2P 4FOVA 5FPBA 1UW8A 5BYNA 4LXLA 3OGSA 4XILA 3ZXAC 3PL5A 2HWF2 3GTOL 1MQTC 3VHPA 4Y20A 1VBC3 4M01A 1SZBA 4S2HA 1VBB2 1W90A 3NFPI 3AKQA 3RZ6A 1FNYA 1ND2C 2D6KA 4A44A 1G9AA 3SQOA 3RWKX 2YYOA 2Y34A 3GCXA 5LWBA 2WO1A 4UFMA 2G9ZA 1STMA 2DU1A 4I3GA 1PIV3 4YM0A 3ZPYA 2MEV3 2TEPA 5AC91 3RDIA 4B3NA 1CZVA 1W8HA 4OUMA 4LBQD 4K1YA 2YG0A 1ENQA 5EIYB 2XMLA 3ZFGB 1XU2A 2JKBA 2C0ZA 3ZPOA 4B7EA 5JDBA 3O1SA 1CPNA 4QDSA 4E8DA 2DFCA 5BUVA 2ATFA 3WDUA 4POGA 1UMZA 3LEGA 3BB6A 5T3NA 3C7OA 3AL5A 3DV8A 3ZFEC 2HWD1 4AI9A 4IEXA 5BNPA 1TME2 3CMGA 5FLHA 2B63L 4QPIB 3ATGA 1RVF1 2P3YA 5C8CB 4XGHA 2RR12 2BZDA 3DCQA 1OUXA 4BM8A 1B71A 4KI5M 2Z2SB 1LEDA 2J7MA 2P5BA 1XNCA 1EV12 3AX4A 4R9AA 3OUIA 2JG9A 3S17L 4MXVA 3PO3L 5C9AB 1FOD1 5HCAA 3BYWA 5A33B 5A7WB 1C28A 4LPLA 3ITQA 5J36A 4HVRA 1A78A 1EY2A 2F6BA 4JRLA 4GS7D 2LALA 4IE0A 5BNOC 2FBEA 5HBAA 4CEWA 3RZGA 5E88A 4PJYA 3LFIA 1JZ5A 2Z3RB 2WZ8A 5HXMA 5MFPA 3POJA 1VZHA 1PGSA 4QU2A 2XJTA 5AC92 3I3EA 4ZONA 1HQLA 2PELA 3IN9A 2RV9A 5IAXA 2JI2A 1ZRIA 2DUQA 4LKEA 1IW7D 3Q8BA 3ZN6B 2FMDA 3V56A 4BXFA 1R1A1 3DF0A 2AEZA 2ZHKA 3LCPA 1HX6A 4GWMA 4GKYA 2R1DA 4MGSA 3M4OL 1LEMA 2P2KA 4AI1A 2HWD2 1BQPA 3NNFA 1PZ9A 4U36A 2A68D 1ULGA 1Q8OA 4PLOA 4WVMB 3WW2A 1SCSA 1JZ7A 4TPUA 2JG8B 2MHFA 3KCYA 3N7MA 1RITA 3IM0A 3WNOA 3ZXJA 5KR7A 3G6JB 4LK6A 2EF6A 3PO2L 1CR7A 2VW0A 4AW7A 3THPA 4UW4A 1ZM1A 4RR3B 1KGYA 3VKOA 4BYYA 1LHWA 3B01A 1H8TA 4UYBA 3M4FA 1DDLA 4P9IA 1QDOA 5AI3A 2BTVC 4YM1A 4CCOA 1MR5A 1FOD2 1KFUL 4P02B 1K5MA 3M3IA 1OI6A 1GU3A 5FP3A 2VZ3A 4OCTA 5MGNA 5M5WL 1WCSA 3AJYA 3H99A 1RWDA 1DGRA 3THDA 3WNNA 3NV4A 1PK6B 2Q8CA 1LOGA 2E2JL 2VAUA 1OSGA 4CU8A 4AHWA 3MHZA 4L0PA 4PHZA 1HXS3 1NQJA 5A3WA 4TZDA 5G05L 1RUG1 1SBEA 2EIBA 3KM5A 3PU3A 4PBOA 3BPSA 3MIEA 2VR4A 5HCFA 3V64A 2CGPA 1CX1A 4KU7A 4ZN1B 2ZZQA 2BPA2 1RC6A 2WAQP
chains in the Genus database with same CATH topology
4X6RB 1APNA 4F83A 4SLIA 1R0JA 4UW6A 1DBNA 1RUH3 2CGOA 4FCAA 1RMU2 1AHSA 1R1A2 1YO8A 2UWAA 4ZU5A 1PGL2 5GZEA 1DYPA 3FZ3A 1N1SA 4RR3A 1KDMA 4LE3A 2CY6A 2ZCWA 1QJY3 1JYCA 4QGNA 3MF6A 2MPFA 1YK5A 1LR5A 4KL1A 1POV0 3E5UA 1AJKA 3ZSKA 4DQAA 4Y24A 3PWFA 5C4WA 1WW6A 4KBBA 3IPVA 4E6YA 1VAVA 1X50A 4YM2A 1X8MA 5IUQA 2OZ6A 3NV3A 4JAEA 3JBG1 2R041 4FPGA 4N53B 4MXWB 2ZIXA 3JQXA 1XXNA 1ODHA 3R4UA 4QMAA 2D6LX 1EPZA 4RQPB 1YUXA 2GMGA 1RUG2 2D43A 5EWSA 5T55A 2RS31 3NSTA 3DN7A 3B00A 3ILFA 4CEYA 2GU9A 4BIFA 2IC1A 1YUZA 4P9XA 4RS5B 1R0GA 1G9BA 3D6EA 4Q4X3 3I59B 2XL7A 4N9IA 3VDDB 2IXCA 4C90A 5H9QA 3ZMOA 3FBMA 1GZWB 1LOBA 4FPJA 5KHKA 4GMP3 3K48A 1XYPA 2QUOA 1IS6A 1R082 5KXDA 2CR8A 3KYUA 3AXDA 4MZUA 1MQTB 4OI1A 1CD3G 3SMHA 4JAFA 1DIWA 1VR3A 2WC2A 3JBG2 2R042 1R0FA 1RUC3 1ND2B 4YYOA 2QZ2A 1BCXA 2LTNA 4HMZA 2O5JD 1JTZX 3FUOA 5FOBB 1HKDA 3VN4A 1VZIA 1QJX2 1G8WA 2D5HA 2YMZA 1OPOA 1WD3A 3LPEB 2RS32 3PMEA 5EZWA 4NO4A 4XHXA 3AP4A 4D7SA 1Q43A 1B35A 2W0XA 3IDBB 1QU0A 1JXNA 3N7KA 1ASJ3 1CONA 3AZWA 2DYCA 3ZO0B 4AI8A 1AVBA 5DUXA 4MX3A 2XVLA 5DG1A 3GF6A 3PVNA 5KHJA 4IL7A 5EV7A 5L7OA 4UW3A 1ND2A 3GALA 3H50A 2ZGTA 4M3CB 4LBQB 3SH5A 4DRVA 1RHI3 2XH6A 2YZ4A 1WMFA 2HEYF 4G6BA 2H0VA 1UN1A 1MEC3 5LK7B 1LU1A 5LRSA 2C1FA 3POSA 4DS0A 5DZFA 1AYM3 2BUKA 3ZFEA 1Z7S1 1ZREA 4XF4A 1C8M1 3VBSB 1EAH3 1UIKA 2UYBA 4BLJA 4P14A 3OD0A 2VVDA 2WT1A 1NA1A 3LA7A 1YJLA 5KC6A 3TN93 3FJSA 2WKKA 1ND3C 4LUMA 2DCJA 4MV2A 2UURA 4M3CA 2A6YA 2O0OA 1GKBA 3LSDA 3MW2A 3IBMA 2CTVA 4IV3C 3ZYJB 1H9PA 4LTAA 5BNOA 3CNAA 3LB9A 3RG0A 1D4VB 1UPIA 4G9SB 3I2DA 5T5JA 1ENRA 1PIV1 2NQYA 4XFHA 2MEV1 1RYTA 4AVCA 1Q8VA 3UJQA 2JX9A 2HWF3 3KT1A 1E8JA 4HL0A 4XF0A 1VBB3 5EINC 1NZCA 2GNDA 3RPQA 4QQHA 1YI7A 3E5XA 1VP6A 1JOJA 1HV0A 4C1WA 1CX4A 3UKNA 4B7KA 1AUYA 1VIWB 1QOSA 3O7OA 4ATEA 1DQ5A 1NE4A 3PJQA 1CAVA 4O9GA 4QXKA 1MS8A 3MFCA 4DZGA 2WFPA 2DSXA 4L97A 4I0WB 2XKPA 3WG3A 4MLOA 3PNAA 2M6PA 3WW3A 2C5DA 3HAGA 3KYWA 2WWSA 3O5SA 3WQ1A 4RSUA 1TME3 3FLRA 4OHZA 2AENA 4C1XA 1IQAA 1S0BA 1KITA 1W0PA 3C2UA 1RTVA 2DV9A 3RSJA 3T1LA 2RR13 1LTEA 2K2SA 4NHKA 3WY6A 2VVFA 3IT8A 1CAUA 2IXLA 3USUB 2KN9A 1WA4A 1VZGA 4MGYE 3I7DA 1M4WA 1C1LA 1GICA 1OA3A 4LBOA 3B9IA 4AEDC 2VECA 1NOVA 5FOJB 3CJXA 1OLQA 2A75A 2RJLA 2VMGA 3MPBA 2X5IC 4YG3A 4UXAA 3SCGA 1NCQB 3JD72 1N3PA 4M0HA 1W39A 3AMMA 1BJQA 5JVH1 4LHKA 5GLTA 3OCPA 2Q5TA 3WCSA 3ZYGA 3ZFFA 2HWD3 3DKWA 3C3VA 3IU3I 2P17A 2V09A 1DGLA 2Z69A 4WVZA 4XF3A 2QZ3A 4NHLA 1C09A 1OFNA 4F3JA 5A3LA 5EIOC 3ZXFA 4P9GA 4X8PA 4ATFA 3QOPA 1TQ5A 5CVRA 1UU4A 1WBFA 3AP9A 4AGGA 1GYKA 2CAVA 1DLLA 1V00A 5DM71 3OY8A 4B4QA 1O91A 2XG3A 3O0XA 2ZX2A 1RUH1 2A6ED 1WCDJ 4QM9A 3WG4A 3H3UA 2XJVA 4P9JA 3WDXA 4JTOA 1R1ZA 1YIPA 3RI8A 2WJSA 1RIRA 4FT8A 5F1RA 2JI1A 2PHWA 4XFCA 4R9DA 4G4FA 2DWRA 3U4XA 1QJY1 4XF1A 4XXBB 5A32B 1PM7A 3WHUA 5K0UA 4MGIE 4DY3A 1ZRCA 1SDWA 1OKQA 1T6GC 4E2GA 2DFBA 1AR83 1RMU3 1RUE3 4ASMB 3QBQA 2O8QA 3PMSA 1FV3A 2C9AA 4XTPA 6RXNA 1OHFA 1UKRA 2VOXA 4A3XA 3UV9A 3MEPA 3OPZA 4QPGC 3KQRA 2AZ5A 1JUHA 2AR6A 1QY4A 3OGGA 4XIKA 1A6CA 3DPRA 3MF9A 5E1RA 4PDWC 3RI9A 2JG9C 2LCQA 2M4VA 2GNBA 2A3WA 2OZJA 3LA3A 2XJPA 1ZZ7A 4YSFA 4QQLA 3VL9A 4Q4X1 2P3JA 1G86A 2XLGA 4CEWC 2AYHA 1YUDA 2A5ZA 1RJ8A 1X7NA 2TBVA 5AFEA 4HKOA 2GC3A 1CQ9A 4GA9A 2VNRA 1QJY2 2GNTA 2D44A 3M8LA 4XEZA 2P3KA 4GMP1 1XYOA 1VB2A 4Q29A 3VBOB 4S2DA 1WGPA 1G6NA 4BE3A 5JOWA 1ND3B 4Q2FA 2WLQA 2WQZC 3B3QE 1URXA 2DU0A 1BVP1 3ST7A 5I8YA 4Q8KA 1RUC1 3H7JA 1CAAA 5BNNB 2XKOA 1TMF1 1SMUA 3J7Z1 2PHTA 4FPYA 4I0BA 4YNIA 4A7YA 4OVEA 1HRI2 2B42B 5K9YA 1H8TC 2NMOA 1R083 1AYN2 1D2QA 2ZGLA 5FO8B 3LKJA 3EXUA 3WVJA 1K5MC 1SBFA 4AVBA 1AL22 1C1FA 4AGRA 4CRQA 3JBG3 3LGRA 4PIYA 3NV1A 4Q4X2 3FFQA 4IEWA 3OJBA 1DVBA 1JYBA 2IFWA 4LNVA 5KXEA 1IOAA 5J7MA 2ZAAA 2XB6C 1QJX3 1RUI2 3WNXA 4F8AA 2XBO2 2ZGSA 2RS33 4TWTA 5DUVA 1GSLA 3VPBE 5C6CA 4FOWA 4YZ1A 1BZWA 2ZGQA 4IV3A 3ILRA 4LO8A 4R4ZA 3U10A 1RHI1 4QT6A 3VZLA 1IS4A 2UYAA 1J3RA 1AF9A 4EN7B 4IEOA 1BFYA 2RDVA 1TMF2 5GLVA 1S30A 2AH2A 5FAXA 3E6CC 2ZAHA 4LEJA 4YW4A 3VKLA 4GH4C 5JLVA 1LRHA 1LOAA 2ZA9A 2Y0IA 1EAH1 5D8AA 4YGDA 2HKXA 3QLQA 2H6CA 2DCKA 2QJVA 3JUUA 3ZIXA 1CJPA 2D7FA 4XETA 4AEDB 3BCWA 3TN91 2VOWA 2Q0AA 4PBPA 2UWCA 2ZHLA 2X5IB 5ABJA 1BE7A 4TYSA 4FOYA 1SLIA 3HT2A 3APBA 1FAYA 2FQPA 1NE6A 4MSVA 2VU9A 5I0RA 1BRFA 3M70A 1FPN3 1Y7BA 3SNMA 5JVG1 5IK8A 1RHI2 1ENSA 3WX5A 1AR91 4ISQA 5DM61 3EBRA 1YNAA 3MIFA 5H9SA 3W58A 3WUCA 5IK5A 4XMIA 4XQ4A 2MNGA 1W6PA 1LOFC 1VBB1 3BU7A 4P9WA 4ASLA 5GLUA 5SV5A 2CWMA 2ZMNA 4MGZE 3R4DB 3MGUA 4Y20B 5ACA1 1W6MA 1EAH2 2PAKA 4OI2A 1LOCA 1LHOA 1UL9A 1WD4A 3NAPC 4Y1UA 3TN92 4OI0A 4XJAA 4E4DX 2ZMLA 3B08B 1TNFA 1TME1 5T52A 4LUKA 2D6NA 4OHXA 4COUA 2M6OA 4MH0E 3WW4A 2RR11 3OD4A 5BXXA 1IS5A 1B35C 4W6XA 5LEKA 4YG6A 4CP1A 3ETQA 3KZ4C 1BK1A 1S1AA 1AR92 2A6ZA 1D2SA 2A6HD 5IT6A 3L2YA 4QPGB 2RS51 5FMOL 4DOUA 4QM8A 1QCVA 1H4HA 5L7OC 1RUF1 3N36A 3MIDA 4QGMA 3WXPA 4LA2A 2JG9B 3B02A 4YZ4A 1BYHA 2PQQA 4XBLA 1C57A 1BXHA 5ACA2 3INAA 1A8DA 3ILNA 3JU9A 3IDCB 1NXEA 1N1VA 1UU5A 4AXOA 3WDVA 2WINB 4CEWB 5T5OA 4L8QA 5GM0A 3ZXLA 4S2FA 4YGBA 1WLDA 2A71A 5SV8A 3OYWA 2K9ZA 3JD73 1C5HA 4HBNA 4QPGA 3ZVXA 1NA1C 2W52A 3M7AA 3JQWA 1F31A 2WNVA 3CJIA 5H9RA 1H2MA 4PDWA 5T5LA 4Y1VA 2RS52 2E51A 2BVBA 2OIIA 3D8CA 4AVSA 1PO23 1RUF2 1N3OA 3BOPA 5AVPA 1DZRA 1O4TA 4JTNA 3ZYIB 1NXMA 1H8TB 5GAHc 1BQ9A 1KD7A 4XIOA 3N3HA 3S7EA 1S0JA 3PKIA 1IPKA 3CLPA 4GMP0 4HK9A 2RHPA 1K5MB 4DMIA 4HPKA 3R4SA 4XFAA 4CDUC 3OBTA 4LULA 3CO2A 4E2QA 2R061 4AEJA 4R4XA 3WP4A 3EHKA 1CGPA 1O7FA 3H8UA 1RUE1 1AR81 1RMU1 3ZSLA 1VBD3 1VRH1 2XVKA 4Y1YA 3L2HA 1J58A 5GZCA 1GNZA 1SCRA 4H7LA 3T1MA 1PGL1 2YPJA 4NOTA 2VQAA 3KT4A 3FFZA 4PF5A 3MICA 2ET1A 4OHWA 3VGIA 1I9RA 4LLOA 1EPWA 3GZUC 4AK3A 4D69A 1BVVA 1GQHA 4GXLA 4LO4B 1T9QA 4GB32 4RD7A 2DUOA 4X8NA 1MZEA 4K7JA 2BVVA 3UJOA 5CA6A 1N1TA 2WQ4A 4M3CE 4R9BA 1DF0A 1V9U2 2GC1A 3KCXA 4EWEA 5C4WB 2Y38A 2L0ZA 3IPVB 2VL6A 2GMEA 2OVUA 2R30A 3J9SA 3HMYA 1H2NA 4Q4W3 3WDYA 3BIWE 5L73A 3ASIA 4YZ3A 2R062 4GALA 5C8WA 2VNGA 4H14A 2R49A 1ZX5A 4L11A 1RUE2 1AR82 2A70A 2UU8A 2R16A 4FOQA 4HVOA 1VRH2 3S6PA 1F2NA 1V6KA 4J1XA 2R0FA 5JZGA 4CEYB 2DTYA 1BBT1 1PZ7A 2EA7A 4SBVA 2H12A 3MSUA 4F7ZA 4YW1A 5FREA 1LHVA 4W65A 4XBNA 4EN8B 1QXJA 1R081 4IEZA 4ORFA 1SMMA 1G9FA 3ZFFC 4GH4A 4XXAA 4QQPA 1UD1A 4CTEA 3EJKA 1QNYA 4V196 2RS13 4PIXA 4XJ8A 2FMYA 4KNCA 4AE2A 3AYAA 4BZ4A 1U5ZA 1F5FA 4D3WA 1YWKA 1HRI3 2M4YA 4GQ7A 4M0NA 1AYN3 1QJX1 3MPPG 1UPSA 3AXEA 3USSA 4XJ9A 4Q26A 1GZCA 3P3PA 1AL23 2ENRA 4G3YC 3NAPB 1COV1 2GDFA 5CFDA 2YROA 1QOOA 2D6PA 2XUMA 2C6AA 3NV2A 4LO7A 4IV1A 1RUI3 2EXHA 2XBO3 1BBT2 5KC5A 2B7YA 4AGVA 5K0UC 4HZFA 4IEPA 5I0SA 2XVGA 3VBFC 1B35B 3AKPA 3RJRA 1LOFA 2V0FA 4R8HA 4HK8A 4E9KA 1MZFA 5DDJ2 4HN1A 1PNGA 4Q1RA 1C3HA 4JVAA 2C6BA 2PA7A 2ZBJA 3WDTA 1VBA3 1O3QA 1YV1A 5L7OB 1BQ8A 3AYDA 4BHPA 4A2UA 2YXSA 3ES4A 1TMF3 3NAPA 3DPRC 1QGLA 3AMPA 5JSPA 2ZTNA 1HRV1 1Y3TA 1PVC1 4DXZA 2Z79A 1LKNA 4KWLA 1IKQA 3AP5A 2EXKA 4I30A 5DG2A 2NLRA 3VKFC 1COV2 5KXBA 4FXKB 1FPN1 4AR6A 1OFSA 4KQ7A 1G9DA 4MGKE 1W6OA 4URTA 3ZFEB 4B8EA 3SH4A 4GIQA 1XNBA 1C5IA 1NA1B 3B93A 2W08A 3P2AA 3TRSB 4XJUA 2ET7A 5CG8A 5FDBA 3M3CA 3J4UH 4XHBA 4K1ZA 1LB2A 1KFXL 3GZTB 5A3MA 2DUPA 1CVNA 4HT1T 4Q1PA 5CAZA 4QPYA 1OWCA 2JICA 4BH9A 1WW5A 3HIFA 3M3EA 5BNOB 2DVGA 1H2LA 5JIUA 1CIWA 1S0IA 3QQCE 2IFRA 1YCIA 4AQSA 4EROA 2QCSB 1GR3A 1WUVA 4TVMA 1LOEA 3WZ1A 4WBBA 3ZMNA 1HRV2 4CDUB 2BWCA 3ALQA 1PVC2 2BNMA 5I93A 3W59A 3B69A 4LBJA 1YHFA 3E97A 4AG4A 1LKOA 1IKPA 4FQ4A 2Q1MA 5MFZA 4FXGB 1FPN2 3POYA 3AZZA 4YGCA 2AREA 2XL9A 2PSMC 4D7TA 5JWPA 5FMOS 5JPMB 5FPXA 2HWB2 4BLIA 1IZ3A 3AK0A 5KHHA 4KWKA 4AWDA 1LECA 1WBLA 2XJSA 1CAVB 2CYFA 4HETA 3JZVA 2HWC2 2D3RA 4AFCA 1AX2A 4E27A 1VBE1 1NCRC 1N3QA 1PO11 2KKDA 4NHMA 3NVCA 2XGXA 1AR93 4PIZA 5FBZA 2H6BA 3K51A 3GHMA 4CDUA 1D4M2 2PVEA 5J3UA 4AI3A 1MACA 2WS92 4Y22A 3RS6A 2R073 1CAUB 1H9WA 1D0GA 1KDKA 3QH7A 4UW5A 3JD71 5ACA3 3RZZA 3VBHC 5D8AC 2X29A 5E8AA 1DQ1A 4AHZA 3MLLA 3AJZA 1F8VA 1VCXA 4FPLA 5LEJA 3A44A 1OOPC 3MIBA 5AFBA 2D3SA 5ABJC 3PKJA 4XOGA 2XPJA 3RWNA 2B5HA 3PTYA 3M2MA 4NR1A 3LOBA 3O0WA 2A7AA 1L3JA 3LWCA 3U0ZA 3TWIA 1XE7A 2BWAA 2W68A 3VL8A 1PO21 1YJKA 4KG8A 5K8SA 5KWRA 4BMBA 2DURA 4IESA 5GAGc 4YVWC 2GC2A 1VBE2 2R6QA 1PO12 3FLPA 1ZBA3 4GULA 5BPXA 3ZFFB 3H7YA 1O4ZA 1KS4A 1DHKB 2RS53 4CP0A 1OQEA 1UU6A 5FTTC 2CGNA 4GKXA 4A7ZA 2XLAA 1B2JA 5E89A 3KYXA 3PIP1 1RUF3 3HBZA 1VBD1 2BE5D 4XDQA 2ZJCA 3H1MA 4B8CD 1LHUA 1QH7A 3OY8B 5HI0A 1RINA 2IXJA 3PVEA 4RHV1 3RYRA 4DB5A 1GNHA 3CL1A 1QH6A 2KM2A 2WZR2 3WP6A 4OHVA 2R1BA 3AB0A 4K6BA 5L19A 2ZGRA 1KJRA 1B13A 4J1WA 5JOZA 2QE3A 2EALA 3T2TA 5K0UB 3A0KA 2VGDA 2A73B 1E57A 3KMHA 1OD5A 1PO22 2UY9A 1SFNA 2Q4SA 1V6LA 1W6QA 4Q0QA 4X6QB 1JYIA 1TE1B 4GB33 1LHNA 3JB4C 4Q4W1 3VUOA 3PVOA 2ARXA 2YC0A 3CU7A 3O14A 1V9U3 1R091 2YHJA 1ONAA 2Q30A 3DPRB 4FO9A 1VBD2 1VAKA 1YYNA 1XQNA 4OHYA 1VLNA 4FQZA 4C0HA 2XWJB 3VBUA 4Y1XA 2NYYA 3B94A 3B0AB 5EJ3A 2ERFA 4RHV2 1X33A 1IROA 4I09A 4CDXA 4YARA 2EVXA 5CNAA 2R063 3VBFA 3P3NA 1W6NA 2VOVA 1QJZA 2UY8A 1VRH3 4HANA 4JGZA 1PNFA 1MS9A 3QD6A 4P5HA 4FPEA 2RS11 3HD8B 3AM2A 1AXYA 4K8FA 4E4ZA 4I2OA 1SLCA 2WNVC 1ALYA 1HIXA 4PQ9A 4Z82A 5KXCA 3CJIC 1HRI1 3KT7A 4AR5A 1AYN1 4Y5Z0 4RFT0 3N35A 3TNQA 4Q4W2 1JH5A 4RGGA 3W9AA 4HKLA 5GALA 2WNEA 1AL21 4Q4V3 2CKCA 1MS1A 1R092 1QKQA 5BY5A 3D5OA 3NKTA 1LKMA 1H0BA 4AEMA 1RUI1 3J8F1 4B4PA 3AMQA 1H1MA 4AI2A 2XBO1 1ZA4A 4RXNA 5F5QA 4OULA 1LULA 1S2KA 2ZX1A 3GNEA 3H9AA 2ILMA 2XJRA 3D0JA 2VUAA 4JRAA 4ES8A 4LHLA 3V0BA 1AXKA 1OA4A 1OPMA 2E7TA 2EAAA 1PGW1 1BKZA 4KG0A 4WM7C 4HVQA 1ZNPA 4YZ5A 5AN9H 3SH3A 1UIJA 4LA3A 1QNWA 1VBA1 2RS12 3NJZA 2B9UA 1BBT3 1S0CA 4IV3B 1NXD1 5GLWA 1CADA 1RDVA 2GZWA 2WNUC 5IK7A 1NCRB 3ZN5A 3P8BA 5KBFA 4XE9A 1YFUA 4N7IA 4AYUA 1NNQA 5FLIA 2Y0OA 1XU1A 2ES3A 4XJWA 1AR72 5DDJ3 4AFDA 4DINB 5C8CC 4AHXA 4AVAA 3MI8A 3BPZA 4LBMA 2EXIA 3VLBB 3E6DA 1QXRA 3SS2A 1DZQA 4WM8C 1Z92B 1AR62 4BQ1A 4NWVA 4OI4A 4CDWC 5IK4A 3J8F2 5BV6A 1XNDA 3VBHB 5D8AB 2IXIA 5FO7B 2QDRA 2ZACA 4MUVA 4IETA 1OOPB 4FP2A 1XRUA 1COV3 4Y26A 4WVVA 3TYJA 5ABJB 2HJIA 2QQPA 4NVPA 1RUD2 2G4IA 1NCRA 4Z8BA 1WMEA 2JENA 1PGW2 4Y4YA 4HKWA 5CFCA 1RUJ2 5JZGC 3LAGA 4META 1V6IA 4FBFA 4XJZA 3JB8A 1VBA2 3ENRA 3UL2A 1QJU3 4ZU7A 1XNKA 3UK9A 3WW1A 4WZCA 4YVWB 1QYBA 3QACA 1ZZBA 1PVXA 4XQDA 4LR4A 1N47A 4MVTA 1NQDA 1KXGA 1W6PB 2OA2A 3VBHA 1CJDA 4AFAA 3D4KA 2GN7A 3TBDA 1J3PA 1OOPA 3FC0A 1YI9A 2A6XA 5HCBA 2Z3QB 3BOWA 2SLIA 5K7PA 3V0AA 1HRV3 2VPVA 1W6MB 3WWLA 1PVC3 3RRDA 4CDQA 4JGYA 1PK6C 2PYTA 1S0FA 4PLMA 3HN1A 3MDPA 4JCKA 5JPNB 1MVEA 1O4YA 1POV1 4N43A 4YGEA 4N7UA 5CFDC 1R0HA 2DVBA 4BA6A 4YVWA 1I6XA 1V6MA 2OPKA 2HWB3 4IV1C 1GQGA 2E63A 4BWOA 2VY0A 3VKNA 2ZABA 4PCRA 1SMWA 4XZPA 1FATA 2R071 2HWC3 4OZXA 2LM3A 3M3OA 2E7AA 2VQ0A 1ZBE1 1TEIA 1WJVA 2PAEA 2KA3A 2ZGNA 3PZAA 1YRZA 2D6MA 4KU8A 1DQ4A 4OLLA 5GLZA 2PLV1 4NWWA 2BEOA 2B39A 4HN0A 4K21A 2AYJA 2ZX0A 2UWBA 5T50A 1V6JA 5DXDA 1D4M3 3HQXA 1ZRDA 4WV8A 3H1YA 4AVTA 3MLKA 4Z92B 2JE7A 1U5YA 4ZN3B 2WS93 4ES9A 4TSVA 3ZSJA 2WT0A 1Q5OA 2B8MA 3G7DA 2ZGKA 4UBHA 4AFBA 2ZHNA 1N1YA 4BCUA 2ZKNA 2JE9A 2DVDA 1ZZ6A 3CEWA 3ZYRA 3DUIA 3SISA 3MZHA 3WG2A 1PHMA 4WZFA 4YVSA 2PHXA 3NO8A 1MS5A 3RYGA 1MZ6A 1ZBA1 1IS3A 2GMPA 3E5QA 2VMHA 5JVVA 1NXGA 3E6BA 3OYWB 5J48A 5HXVA 1A8MA 4JDNA 2ERSA 3VV1A 1AX1A 2WNVB 3VZMA 1ZRPA 2JI3A 2R072 3B9CA 3CJIB 4ITCA 1ZBE2 2SBAA 4L92A 1VBE3 4PDWB 5FCCA 1PO13 3OBRA 2A3YA 2CAUA 2PLV2 5AVAA 5T5PA 1OWBA 3CF6E 2Z5WA 3LNLA