2XJPA

X-ray structure of the n-terminal domain of the flocculin flo5 from saccharomyces cerevisiae in complex with calcium and mannose
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
258
structure length
258
Chain Sequence
GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords FLOCCULATION PROTEIN FLO5
publication title Structural Basis of Flocculin-Mediated Social Behavior in Yeast
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 54
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2010-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2xjpA02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2xjpA01
2XJRA 4COZA 4CP2A 4LHKA 4COVA 4AF9A 4AHWA 4AHYA 4AFCA 2XJUA 4GQ7A 4COWA 4CP1A 5A3LA 4AHZA 4AI2A 4LHNA 2XJTA 2XJVA 2XJQA 4CP0A 4COYA 4AI3A 2XJPA 4AI0A 4LHLA 4AFBA 4AHXA 2XJSA 4D3WA 5A3MA 4COUA 4ASLA 4AI1A 4AFAA 4A3XA
chains in the Genus database with same CATH superfamily
5LBEA 3H7YA 3RMYA 4XCBA 1PX3A 3P2AA 1CX4A 1MS9A 3DECA 3NNLA 4KGGA 5C8WA 4LO4B 2WYSA 4FPKA 4N43A 3SCFA 3GTKL 1MR5A 1QQP2 2G9ZA 1F5FA 1H8TC 4QX3A 4ZU5A 4FOVA 3WCRA 3ITQA 3TN93 4CP1A 2GDFA 5JPMB 4UOJA 1ASJ1 2B5HA 3WQ1A 4AAPA 3ZSEA 3M7AA 2HEYF 1VIWB 1D4M3 3GJAA 4KU7A 3SQOA 3ZKUA 1CAWA 1H2MA 1Z7S1 4V2VA 5FP4A 1UYPA 3FKIL 2MS3A 1DYOA 5JXIA 2ZX1A 2VCAA 3TNQA 1D4VB 1X82A 4X8NA 3N7LA 2RR11 3P1IA 1AYN2 1N3PA 2ES3A 1NNQA 1HB2A 3NNJA 5ABJC 3LA2A 5C6CA 5JOWA 1POQA 1XC6A 2VY0A 3PVEA 3VBOB 1O91A 4YM0A 4U2AA 3H50A 4FPLA 4NRQA 2YPJA 3OTFA 5ACA2 5T5JA 4NRMA 1TME3 3Q8EA 1VBA3 3E6CC 4E9KA 1QQTA 3P3NA 1EAH3 2GAUA 1EYBA 4F83A 4YM3A 5K0UC 2R6QA 2VZVA 2O8QA 5FXWA 3UESA 1OXCA 2A6ED 1R081 3AP6A 3KF3A 5FBJA 3ZPYA 4XJWA 5BY5A 5JSRA 1R0HA 2RMU3 2BZDA 3HOZL 1WJVA 3VBHA 5D8AB 2BVBA 2ZOEB 5AI2A 3ILRA 1VBA2 4CEYB 5IWFA 1VJ2A 1VBD3 1V6MA 1Q43A 4MO3M 4XBLA 1RXFA 2DWRA 1BVVA 1HB3A 1MPXA 4XJAA 5RXNA 1OF3A 4BY7L 4JX0A 3L2YA 4R4ZA 2ZHNA 1MQTB 3V65A 5CFDC 1ND2B 4YG0A 2CDPA 3KM5A 2G4IA 4MGKE 3HJYB 1A6CA 5I0UA 4CYDA 1RL3A 5DZFA 2HWC1 3H9BA 4MGZE 5M5YL 1VBD2 1GLHA 4YVSC 2H0VA 4HONA 1NY72 4PQ9A 1RUI3 1FHMA 3VDAA 3KVAA 1AYN1 4XUQA 2Y6GA 3MV11 4XE9A 3IBMA 3IM0A 3O12A 2J22A 4Y1ZA 2A70A 5JUVA 2ZJCA 1FNZA 3PMEA 2A6WA 1AX1A 3IAQA 3ECQA 1DGWX 2GN7A 4KBBA 5CVRA 3SITA 3ZYRA 5ACA1 3NWKA 3CQOA 1OVSA 3VBOA 2NN8A 2VW0A 1QOOA 2LROA 1NCRB 4AI2A 4JDNA 1ACCA 4ZONA 5D1IA 2VOVA 4P5HA 4UFJA 2F4PA 5HCAA 1RUI2 4RGGA 2L0ZA 3OJBA 3ZDVA 2ET1A 2GN3A 1AX2A 3WDTA 2C9AA 4XHBA 2VZPA 4QHBA 5DDJ1 4XQDA 1PO21 4HKWA 4BQ3A 2LALA 1W6PB 2PA7A 4XTMA 3KCCA 2JG9B 1V00A 2J1SA 1N3OA 2OQ6A 1Q56A 2ORZA 1HV0A 4XGHA 4YM2A 2VL6A 2Y6JA 2BEOA 4N9HA 3VKLA 2GZWA 5FZDA 5D8AA 4E4DX 3UGFA 5T54A 3SXWA 1HRV3 4CEYA 2E32A 4BK4A 3VGIA 3RFRA 2VJXA 1F4AA 4QHOA 3J8F2 3PUQA 3HJWB 2XOMA 1ZRCA 4FTBA 4BLIA 2OIIA 3ACIA 5FZIA 5F8PA 1VRBA 3AZXA 5HXVA 1UPIA 1W6NB 2BE5D 3LKJA 2V4AA 4GWIA 1MQTA 3RPQA 1YO8A 1ND2A 2D6KA 1JTZX 5DAVA 4D7YA 2WABA 1FT9A 4EN8B 4FPJA 4OULA 1TWGL 4EJRA 3PDQA 1IPSA 1HRV2 4X6AL 1RINA 4FP3A 3ZYFA 1UY0A 4MGIE 5I0DA 1I6HL 2D44A 4ZKTB 3SS2A 1YFYA 1LB2A 2RDRA 4PT6A 2XDVA 1Q3EA 1WLTA 4Y20B 4JAGA 1H0BA 4HN0A 3ZXKA 4P9YA 2BERA 5T55A 4LEJA 1S55A 3N9PA 1SEFA 1ULGA 1RUC3 1VAVA 3MI8A 3U37A 3W20A 5JI7A 3T30A 2HWF3 2APOB 3I97A 5I8TA 1NCRA 2C6AA 3IMNA 2RE9A 1W2NA 1W8TA 2JEMA 4IESA 4EROA 1VE0A 5I0SA 2O1QA 3ZXLA 3SLIA 2K9ZA 1SCRA 3VDDC 5B2GB 1GZ9A 5FP3A 3K77A 5C44L 1PO13 2VMGA 3ZSJA 1N1VA 3AK0A 1RUD2 1W6PA 2IVIB 5FZMA 4ET7A 4ZHNA 2GH2A 4JDMA 2JG9A 1FPN2 3KMHA 3VBUB 4KU8A 2JECA 1IPJA 3NRUA 4J6GA 3C7OA 2PVXA 4IE0A 3JU9A 3AMMA 3WF3A 1DQ6A 1RUH3 2ZAHA 1ND3B 4AQ2A 3GCWA 2JA7L 2KN9A 1JYWA 5IFPA 1GP6A 2VH9A 5FK7A 4QM9A 2EF6A 4JKLA 1PO12 1L7RA 4KQ7A 4Q4W3 1EP0A 3VKNA 2OXBA 3DCQA 5GALA 3PNAA 3ZR6A 1UF2C 1XSQA 3K3NA 2VGDA 1W6NA 3HQUA 2IC1A 2GMGA 5GAHc 5CFCB 3GZAA 3USUB 3WG4A 3D0JA 2A7AA 3AYAA 1G86A 3K46A 3C7HA 2NVQL 1RUH2 5FKBA 4C0BA 2ZABA 1HXS3 3WNLA 1RHI1 1LULA 4AF9A 1GV9A 2XQRA 3NNMA 1AYM2 3OB8A 3ILNA 2DVAA 1US3A 1VP6A 2XBO2 3MUY1 2OX0A 1UZZA 4Y20A 4DB5A 4XETA 3LPEB 2IXCA 2R1DA 2TEPA 2XVKA 4QQLA 4IV1B 2VO5A 5FLIA 5FYSA 4DOUA 1Z0HA 3VUOA 4HVQA 5F2WA 4K21A 4Y5SA 3RZKA 3I3DA 1PFUA 2DSXA 1AL23 2O8OA 3M4FA 4BQ4A 5L7OB 4AZZA 2P4EA 3FLRA 2R7ZL 2VQAA 1MACA 1ENRA 3JBG3 4TPUA 1GQPA 4AHXA 1UPSA 1QGLA 1ZRIA 2D3SA 2DFCA 1VBE3 2E26A 3DKWA 3J9SA 4LO7A 5FPLA 1RUD1 1H30A 2VNOA 1B2OA 3MYXA 1WCQA 2J42A 3S14L 1QY4A 1R093 2P3KA 3H8UA 5CG9A 2YC2A 4UYBA 3WUCA 4YW4A 2PAMA 4ASMB 1YK5A 1IS4A 3MPSA 3PO2L 1XQNA 3I2KA 3AJZA 1AL22 2VOXA 4CEWC 3VBUA 1W9TA 2ZIXA 3LOIA 4JTNA 3NJZA 2ATFA 2YU9L 5EHDA 1LGBA 3LZZA 5FZLA 4A41A 5FZ4A 1F15A 1LTLA 2M4VA 1ND3A 3KZ4C 4EN0A 2PMZP 5AI3A 3LEMA 4HBNA 1R092 2CAUA 2XJPA 2VZOA 1GBGA 1WD3A 1H2NA 2WO1A 4AI0A 1MS1A 2IUWA 4L11A 1R9TL 1ODHA 4BOWA 1SFPA 4QGLA 3RGBA 1X7NA 1GNHA 1CJDA 4PDWB 3PIJA 1TMF3 4I30A 1BEV1 3ABZA 3NKGA 3H3VM 2LS6A 4F3JA 3JR7A 4P9JA 1JH5A 5A80A 3VDDB 2FBEA 3PUAA 3USUA 5CFCA 4MGSA 1J1TA 5JVH1 1XXNA 4YZ2A 3S1ML 2BNMA 1UWWA 2HYXA 4A3JL 2XBO1 3KV4A 4A42A 4UXAA 5CA6A 3MFAA 2QVSB 3HT1A 3NO8A 4FPHA 5I0RA 5IP9L 3LD8A 1RITA 3D0SA 3B94A 3GJBA 3LSDA 3N7JA 2XJTA 1TMF2 1YIFA 4G4FA 3VD5A 4IV1A 3U0ZA 3ALQA 4YFWA 2W46A 4NOTA 1PFYA 4Q0UA 1M4WA 2WFF3 4LHSA 2OPKA 1B13A 5L7OA 5A6YA 3Q8FA 2RS53 3ZR5A 2R93L 1DHKB 1W8FA 5BNPC 3AMPA 1NX9A 2R042 2KXLA 3POGA 5LASA 1RJ7A 1W9SA 1PK6C 4YW7A 3GBWA 2RS13 2B63L 4V2WA 5I93A 3NJVA 4DIQA 2ZGOA 4B29A 3H8OA 3OPTA 2KKDA 1ZZ9A 5FPUA 4QB2A 1AVBA 4XZUG 1QXJA 1H4GA 5C8CC 4U671 2Q4SA 2WFF2 3IKWA 3UETA 1GICA 1IW7D 4Q26A 4RS5C 1I5ZA 3VB9A 5FR3A 1BMV2 3OGSA 4B3NA 2HEWF 2AENA 4META 4YWMA 5AC93 1ZBA3 4BQYA 1MS0A 4NWVA 1L3JA 3SC7X 2K46A 2C24A 4RGKA 1ULOA 4DXZA 4E4ZA 3LEIA 1CWPA 3CHXA 1CD3G 3H3UA 2IXKA 3T1LA 5F3CA 1O5LA 3T4HB 4L0PA 5T50A 4PDWA 4CDXC 1QJEA 1KS4A 2Q8CA 3U10A 3K4DA 5A32B 3MIEA 1J3PA 1DQ5A 3E5QA 3VDDA 1IOAA 2Y6KA 5AC92 4XMIA 4QDQA 3PL5A 5FZAA 5LY1A 1Y9GA 2AYHA 1IU5A 2W68A 1H6YA 3CO2A 4IEYA 5A3TA 2ENRA 2W52A 3R05A 1PGW2 3TB0A 4GB33 3T0BA 1E5SA 2A3XA 2D40A 2Q5TA 4K3UA 5IVEA 4LO6B 2VZSA 1W8HA 1RUG1 2W1QA 3SNMA 1W9YA 1W8ZA 3HQXA 4Q8KA 4TLFA 4UFMA 2JI2A 3LIGA 4F7ZA 3KGLA 3RDIA 3O5SA 3W58A 5FY8A 3S6PA 2ZKNA 4BXSV 3JD72 5CNAA 4OHZA 1GWMA 1TWAL 1C5HA 4KH9A 1GNZA 3WF4A 1VLNA 4OI4A 3ZYPA 4C8DA 5FO9B 3GF6A 5KHKA 5C7GA 1OVPA 7RXNA 4LLFA 3SCGA 3QACA 3VN4A 4Y24A 4FXGB 1MVQA 4K7JA 1JYIA 4LKEA 4RFRB 3H9CA 4FQZA 2ZHKA 3CZJA 1LOFC 4R9CA 4Q4V1 4LPLA 3BTAA 1OOPC 1DGRN 1MS4A 2NVXL 2WT0A 4YG3A 3WQ0A 2CAVA 4AI1A 1LHOA 2DF7A 2VZ3A 4IV3B 1OPMA 1I3QL 4COZA 2K2DA 3PTRB 4QPIB 3U11A 5JSOA 5MLC3 3FC0A 4FO9A 1NXD1 3J4UH 3I3QA 2XG3A 1UMHA 3LIHA 1QNYA 1EUTA 1AR81 1QJU2 2ILMA 3FX3A 3HT2A 3J7HA 4Y26A 3UKTA 4QDRA 4RQPC 5A32A 5J7MA 1LAJA 5C70A 4AGRA 3S5AA 1YLLA 3WW3A 1I50L 1W6OB 4MH0E 3VBRC 1VBB3 3BIWE 3FE5A 3O1VA 2BOJA 5CISA 4Y3OA 2CU5A 1Y43B 1YI9A 3NKTA 1JXNA 3ORJA 4I0BA 4CUGA 4UFLA 1PVC3 1NA1A 2D5HA 2ZX4A 5IYYA 1A34A 1L7LA 3AL6A 1AR62 4K8FA 3EB7A 2WNOA 4QX8A 1ALYA 3HOYL 1WMDA 4PF1A 1GSLA 4C3JL 1ZZ8A 1YV1A 4RN5A 5MFPA 2VECA 1PGL2 4IEPA 4POGA 4SBVA 4XUOA 5M3ML 1GZWB 2LUWA 2C6BA 1W2UA 2R1BA 1OHFA 3PKIA 2AQCA 4LBLA 5FCCA 1OQEA 2WZ8A 3ZFEC 3WY6A 3GTGL 2IZWA 5FYCA 1G8WA 2FD8A 1PVC2 3K3OA 3WP6A 5C4XL 5H9SA 1V6NA 3GTJL 2QQNA 1RVF2 1W6MB 3WNMA 1YQ5A 5J98B 1FOD2 1HV1A 2Z4FA 4UBHA 5F3EA 1BKZA 2RDSA 3KF5A 1QNWA 2PHTA 5LEJA 3I4IA 2NM1A 4URAA 1PIV1 2R7EB 4BQXA 4Q29A 2H6BA 1APNA 1AR73 1DGLA 1MEC3 1OH4A 1XYPA 2XUMA 3M3EA 4S2GA 5FV3A 3VPBE 1YIPA 4CCNA 1MZEA 1CAXB 1XE0A 2CKCA 4IV3A 5FP8A 3LDBA 3QOPA 3MHZA 3TRSB 1QJU1 4P9GA 4BE3A 4QPIA 1DU3D 3OEBA 5CU1A 3JXSA 4DO0A 1YQ6A 1J59A 5J48A 3WUDA 4Q1RA 2VZRA 3JB4C 2XMLA 4B7KA 4XF4A 2QE3A 1CAAA 1WMEA 5FYIA 1ODMA 2AREA 3C8XA 5E8AA 1IZ3A 4BISA 1W6OA 2BDRA 1BVP1 1YFXA 1TE1B 3I3BA 1ULPA 4OI2A 4K9SA 4YW5A 3HNYM 1AR61 2XB6C 3FWEA 3WNOA 2WB1P 4COUA 5B4XA 5FYYA 4R8HA 4HFSA 1BJQA 2WLQA 2O0OA 3SKVA 2D7FA 3AKTA 4FPCA 4XJ8A 3MIFA 2Y34A 4XQ4A 1GU3A 1X33A 3AP9A 4CA9A 2QQKA 1JI6A 4AHYA 4LA3A 4LBNA 4WM7C 1LOBA 5FKCA 5SV8A 4K20A 3IWZA 2ZGMA 3QD6A 3THTA 2VNVA 1GZWA 3RJRA 1PX4A 3QVDA 3AKQA 2AACA 2WA3A 4FTSA 4DRVA 1FOD1 2WYFA 3AXEA 4FOYA 5LBFA 5A6XA 1GWKA 2B8MA 5FUIA 1YXWA 2J9UB 1W6MA 3AKPA 3I2IA 1HRI1 2JD9A 1C28A 3OGGA 3LWPB 2DFBA 2V5DA 2J1VA 3I8TA 3SEPA 2Y0IA 3VLBB 1Q8PA 3AZVA 1DQ1A 1DGRA 3HKZP 1BBT3 2Q1ZB 2SLIA 5FZ7A 5JMCA 1A8MA 3BTXA 1COV2 1LHUA 1YC61 3CQZL 2OPWA 1W04A 3N9NA 3V56A 4Z1VA 3KD4A 4M0NA 2DCYA 1C8M3 4HKLA 1S30A 5FY1A 1CAXA 1U0AA 5J1XA 1W28A 1ZBE2 4UW4A 3UKVA 1TWHL 1RUE1 2P3JA 4TSVA 3S2HL 1GFF2 1PZ7A 5FYUA 3O7OA 2C4XA 3JCIA 3VHRA 1W39A 2R32A 5DAXA 1XNKA 5LBCA 4NWWA 4AFMA 5CG8A 3O1UA 5AFBA 2CGPA 1O4ZA 5BPXA 1WD4A 1Z78A 3MGUA 3RG0A 3ZSLA 5C9AC 3OG2A 1DQ2A 2JA8L 2RJKA 2UURA 4QMAA 3B3QE 4GULA 4NUBA 1O6UA 3I59A 2PMWB 5IFTA 2JG8C 4MZUA 2DUOA 4IE4A 1JMUB 1BYHA 1K5JA 2H6CA 2NYYA 4Y22B 4LHKA 5FIXA 2WNUC 2VUAA 4RXNA 3KV5A 4RFT0 1S0EA 2GMMA 1FI2A 4BZ4A 3OD4A 2H0BA 5FZHA 1AJKA 4ES9A 4Q4X3 3VZJA 1IQDC 2VR4A 1IKPA 1YCIA 5FRAA 1DZQA 3O1SA 5BNNB 4CCEA 2JDKA 3RZ6A 1HB1A 5I8SA 4D7TA 1X36A 3AMNA 1JU4A 4YVWB 2ARAA 2RDNA 4DY3A 2PLV3 3DGTA 4NROA 5EINC 2R072 1YRZA 3PUHA 5DAPA 1I5PA 1SBFA 1DQ4A 1JOPA 1RUF1 1NZIA 2WNVB 3AKRA 1AR92 1WMFA 4AOCA 1E5IA 2VL4A 3SH3A 4PCRA 2A3YA 4Q4Y1 4V196 3GCXA 4ZXEA 1S0CA 5A7NA 1SZBA 5LWBA 1FMD3 3WVJA 2P34A 1BK0A 1EPZA 3CNAA 1PMHX 1H8VA 5FXVA 3HD8B 1W05A 4O9GA 4BPZA 4MXVA 1YWKA 1ZZCA 2ARXA 1MZ5A 2E31A 3MF9A 5GLVA 2JENA 3NSTA 4ISRA 3UK9A 1C57A 3AL5A 5CBLA 4IUGA 4GAZA 3VBSB 3LDRA 4WM7B 1E5RA 3KSCA 5F7UA 1PZ9A 2DTWA 1RUJ3 2WS93 4A3CL 2JDMA 2QQWA 2YFZA 1CPNA 1GZTA 4MXWB 4K6BA 4E27A 3NAPC 1LGNA 1XOYA 4XFAA 5KHIA 5AVAA 3WV6A 2HWB3 2VTXJ 3O1TA 4D94A 3W21A 1TWFL 1VALA 3X29B 3VDCA 4A2UA 5C5UA 4QX7A 4GS7D 1WLDA 3WDYA 2D98A 4DEVA 1V6LA 4AGVA 3A44A 1WCML 2NMOA 3GNEA 2ZCWA 2ZGQA 1PNGA 4AFAA 5L36A 1Z7S3 4POFA 2P6HA 2YU2A 3K4AA 5LCWL 1T9PA 3PU3A 1OA3A 3RYPA 3VZNA 1RIRA 1RJ8A 3OSDA 2G1MA 4Y22A 1DZTA 1O3SA 3FDJA 1VR3A 4QB6A 1SG3A 5CKQA 1HDKA 1HQNA 1UIJA 1US2A 4ES8A 2RR13 2ET7A 2P37A 2XH6A 4AQSA 5A33B 2HWB2 2CSGA 5KXEA 4Y4YA 3SMHA 1QKQA 4HSLA 1UAIA 3T1MA 5BNNA 3EQEA 4GJYA 4YVWA 1JZ8A 2VTXA 1D0HA 3AZWA 5JOXA 3KT4A 5DM71 5JAXA 2Z5WA 5IT6A 2Y26A 4MUVA 2WNVA 3E5XA 2E2JL 3Q8CA 3E6DA 3MW4A 5MF6A 2BJSA 4BIOA 1R1A1 5M3FL 4LXLA 1DLCA 1NUKA 1GQHA 2PXJA 4NIIA 3IDAA 5JLVA 4EWEA 1LKMA 1YUXA 5A7PA 3VZOA 2Y38A 4X6QB 5C3RA 4QPWA 1JYNA 4FQ4A 2Q8DA 3ACGA 4RGAA 4AHWA 1VRH2 4FFIA 3L2HA 4HN1A 3NL1A 4QKNA 4RL7A 1S0DA 4YZ4A 3U75A 2ZEXA 2A6YA 3A0KA 5H9QA 2VE1A 3ZLIA 4CTEA 1UN1A 2WZEA 4CDUC 4ASKA 3PJQA 2MEV1 2V72A 4ZU4A 2LTNA 5JXHA 3VBSA 4ARXA 4Z07A 2DDUA 4WM7A 1LU1A 2YFUA 3IPVB 2X5IB 1S0GA 4NPLA 3WQ7A 2G9FA 5A3PA 1T2XA 4WBBA 4A3LL 3MF6A 1SDWA 4MXWA 5EIYB 3VZMA 2EIEA 1JN2P 4AW7A 4MGQA 5IVFA 4PI0A 4UW6A 1GOGA 5FY9A 4LKFA 3TN92 1OWBA 2W1UA 2HWC3 3OYWB 3URFA 5FXXA 4ISQA 1QWRA 4CZSA 4N7IA 1PHMA 4OZOA 1D4M2 4LT5A 3A0NA 1VBC1 4O65A 4XF1A 3D82A 4JGZB 1SQ4A 2DVDA 4GKXA 4IEUA 3KCXA 4UW3A 4XF0A 2WZR3 5A33A 5GLWA 4A3ML 3O1RA 3BN6A 3LEKA 1N47A 3ZSKA 1OBNA 4M4RA 3H9AA 5SV5A 2QKDA 1ST8A 1AJOA 5A3MA 2P17A 3DF0A 4YRDA 1ZNPA 2C26A 3H1MA 1DLLA 2WSUA 4GMP3 2RM23 4QXBA 3OF1A 5GM0A 2B42B 4EE2A 5F1RA 1TWCL 3O1OA 4UWDA 2WZR2 3NJYA 4AVTA 1OD5A 1TME2 3I3EA 3ZYIB 1QQP1 4BQWA 3HOXL 2I07B 5JXGA 3FUQA 4YZ3A 1EAH2 4Z92B 2XLGA 5FOJB 4AAXA 1AXKA 4CCDA 1ULEA 4D6SA 5BV6A 2WAAA 2AYJA 4FCAA 1KS5A 2QUOA 2XVLA 4XUTA 3VV1A 5DPNA 3NV3A 4Q27A 5L19A 1LGCA 1U5YA 3WCSA 3TOJA 2RMU2 5FP9A 2W92A 1QH7A 4IEWA 4RR3B 4DUWA 5BYNA 1KRIA 3HOUL 2IXJA 1SDDB 5FYZA 5E89A 3MQKB 3IPVA 5AVPA 2X5IA 3ES4A 3KT1A 5FZ8A 2V3BB 1DQ0A 2PQQA 4Q0PA 1K5MC 2CY6A 5A3WA 1FATA 3WG1A 4N53C 3TWIA 2FZ1A 1EUUA 1TQ5A 2PHUA 3NW4A 2XHNA 5GAEc 4BA6A 3LNLA 4W6WA 3AC0A 3KVBA 3OYWA 3O0XA 3H3LA 4CDWB 1QOTA 5K7PA 4WM8B 1SHWB 4K1YA 4AVSA 2NP0A 5AN9H 1T6GC 5IYCL 3ZX7A 4ORFA 5FUNA 5JVG1 1QJX3 5FY5A 4AG4A 2VW1A 3PTYA 2VXJA 4FPFA 5E88A 3VD4A 3UGHA 1H8TB 2LRPA 3K4ZA 3JQXA 3KYVA 4JGZA 4LUMA 3USSA 4QU1A 4AXOA 1OLRA 4NRPA 4AI3A 5G05L 1O7FA 3PJYA 1GWLA 2HWE3 1UZVA 2E2IL 4CCLA 1XNCA 2ERSA 3ZIXA 1ZA7A 2WAQP 1RYQA 5ERLA 1CESA 3JQWA 1STMA 4LE4A 4R4XA 5EV7A 4DPNA 4LBKA 1OKOA 4KG0A 3KS7A 3WW1A 1TG7A 3HEIA 2WIIB 3EXUA 2UWCA 4CRQA 5J96B 1TME1 3ZVXA 4Y1XA 5FO8B 2FDKA 1VBA1 3BOWA 1K83L 4ME3A 1KEXA 5L9RA 3WF2A 3FMGA 3MLKA 1IROA 1V6KA 4LKDA 5FZEA 1EAH1 2J1AA 2JXAA 1SFYA 2JIJA 4PJYA 5IUQA 2DBNA 1FXZA 2Q8OA 5ABJB 5LK7B 4MG2A 3MSUA 2HWE2 2DCJA 5APAA 4NHXA 1OLMA 1OT5A 1T9OA 3ON7A 5FFOC 3POIA 1QJFA 2IXIA 1HIXA 5L9BA 1JYVA 4GH4C 3WINE 1QIQA 1H2KA 4AEKA 1RUOA 1VBD1 2YV8A 2NMNA 4ZN3B 3MW2A 1NLRA 1UXZA 3AB0A 1NY71 2Y60A 4MGYE 4RR3A 3RZOL 1DFQA 2MHFA 2CYFA 2ZGTA 3RMXA 3DXUA 5K0UB 2BOIA 4QPGC 2GNBA 4WVVA 5EPAA 2A68D 2VZ1A 2EY4E 2WQ4A 4Y1VA 4KNCA 1QYBA 3ZSMA 3AFKA 5FZFA 3BOPA 3N9MA 2OZJA 4UW5A 1XNAA 4YNIA 4CDWA 5T5OA 1RHI3 1WA4A 5LA2A 4WM8A 5JZGC 4B7EA 1RUI1 4W6XA 2XJVA 1CPMA 2CV6A 2ZACA 4COYA 2EXHA 1B35C 1F31A 1H8TA 1OMIA 1B09A 4LITA 2VBBA 3ATGA 2QL0A 1DF0A 3GGLA 5CFDB 5FYTA 2PHFA 2RVAA 3QH7A 4AVBA 5C71A 2WN3A 2ADDA 1OLQA 3MUZ1 1PZXA 2XL7A 2Y33A 2FDGA 4WZCA 4B8CD 1BRFA 3AMQA 1RUC2 3LWOB 3F2ZA 4K1ZA 4YVSB 2D6PA 2HWF2 3RYKA 3PHMA 2NYDA 1Q8QA 1WW6A 2PHLA 1XU1A 2CWSA 5GJ6A 3HOVL 2WO7A 5C4JL 3J8F1 4P00B 2Y8KA 4CCJA 5ABJA 3W59A 4H7LA 3KGZA 5IATA 4I2OA 3K48A 4EN7B 2W91A 3B5LB 2CTVA 3PVNA 1FYUA 3VZKA 2F17A 3PURA 3E97A 4CSWA 4LOSA 2CKAA 1IPKA 1HRV1 1GP5A 5BNOC 5DAWA 1J3RA 1JU3A 2AUSB 1RC6A 1YHFA 2Y6LA 5K8SA 1JZ6A 5JIUA 4CXYA 5K0UA 1DP0A 2B4KA 2QQLA 4PF5A 4Q4W2 2XPJA 4PBOA 2AH2A 4YWAA 3N7KA 3U4XA 1MS3A 2OKXA 5M0TA 4I0AA 4LBQB 4CUCA 1AXYA 4W6YA 1U5XA 2WQ8A 1H9WA 3T2QA 3BPZA 4JGYC 3CJIC 1XPWA 1B71A 1YYNA 1Q8SA 4FOQA 4IW3A 3GHMA 4W4ZA 1CZTA 2W95A 1HXS2 1CONA 3O0VA 5FAXA 1UX7A 2VQUA 3MDPA 3AVRA 1LESA 5F5IA 3UYJA 5IW0A 5IVYA 1O59A 3H0OA 1W0NA 1EV13 3ZO0B 3ACHA 4MOAA 3H97A 4YGEA 3GHNA 3ZYHA 2F4LA 1S1AA 4XXAA 5DZGA 5CFDA 3GDBA 1U5ZA 4GWNA 1Y9QA 2VUML 1CR7A 3VD7A 5HPOA 1FPN1 5GZGA 4MGTA 4XUPA 5MFZA 4OUEA 1BCXA 2PN5A 4QKFA 2D6NA 2VQ0A 3M3QA 4YG6A 3KHBA 1IHMA 2N7GA 4YVSA 3ZXDA 4C0HA 5A6QA 3WXPA 3JBG2 1HX6A 2B5ID 2DBIA 4XEZA 1PO11 4JRAA 1ENQA 3B9IA 1VBE2 5FOBB 1Z92B 2XUEA 4B8EA 2AGSA 5JZGB 1S0FA 3QCWA 4LHLA 2OT7A 4YW1A 4LIUA 2R16A 3POEA 3EO6A 3PIP1 2NZ9A 5F37A 3M3OA 3WW2A 4BMEA 2VNRA 2W47A 4MHUA 1F4LA 1UU5A 1RUH1 3AM2A 2JB8A 4MX3A 4P9LA 2PTMA 1E8JA 5CAZA 4LNVA 2F6BA 2VCCA 3PVBB 2OUJA 3FLTA 3E5UA 4Q4W1 4FAHA 5AFEA 4XFIA 1AYM1 4LULA 1R0IA 4Y4RA 2BNOA 4TYSA 1T6BX 3IAPA 4H14A 5JSPA 1CQ9A 1RDVA 1SLCA 2EVXA 4KI5M 3W5MA 1BZWA 1H1AA 1BK1A 4BQ1A 1WCUA 5KXCA 4LBQA 5KC6A 4LBOA 1HXS1 4PLOA 5EXOA 3CL1A 3POWA 4ATEA 3JZVA 2VBPA 2IFRA 4BJ0A 3BTYA 3PL0A 4HVOA 1H1IA 1LOCA 3MLLA 1G6NA 1ZRPA 4ASLA 1YNAA 2HEVF 2LM3A 3CEWA 3I2JA 3RZMA 3PO3L 4ITCA 2C9KA 4GXLA 5FWEA 4XCAA 3ETQA 1RUG3 3ZXJA 3RYGA 1RYYA 1AL21 3POBA 1GOHA 5LRSA 1O3TA 3GYDA 2ZS6B 5EZWA 4A7KA 4BQ5A 3JBG1 3KHCA 1Y1WL 1O5UA 4S2HA 2E2HL 1F35A 4AYUA 4IERA 1V9U3 4NVPA 2OUHA 2RS52 2RDVA 5LZ6A 4LKSA 1R091 5T5PA 3BKZA 3I3MA 4CU6A 1O8PA 2RS12 1IRNA 1J84A 2OQ7A 2P1BA 4UFHA 3LF7A 1LODA 3OGVA 1EY2A 4JGYB 4SLIA 1IU6A 2LW8A 5FREA 5JZGA 2XHKA 5ISLA 1IGOA 1W2AX 2E51A 4Q0QA 3WF0A 4ZZ5A 5FWJA 3O1PA 4I01A 2E33A 4N9IA 5F3GA 1C4RA 2EICA 1W3VA 4HK9A 1H9PA 3B69A 5FYVA 1BFYA 5FQ0B 4XHXA 1ZBA2 4YW2A 3TEZA 4E4SA 3ACFA 3WHTA 2GP3A 4Z82A 2J1RA 3MPPG 1MVEA 2DVBA 1TMF1 4QKDA 4CEWB 3WDXA 2RFKB 4UT5A 2NVYL 2XKOA 1BQ9A 1H7VA 3WHUA 2K0GA 5JPNB 4XBQA 1I1EA 5FZOB 2PFWA 2ID4A 1XSRA 3N35A 4DINB 4BXFA 2W08A 1Q5OA 2QQVA 2XLAA 5IK7A 1N3QA 4NR1A 3T3YA 2ZMKA 1UCXA 2R041 1O4YA 2PHRA 3M3IA 4C1XA 3BB6A 2M6OA 3D5OA 4IGQA 4LA2A 2TUNA 4OYUA 3RNSA 1G9DA 1UMZA 2BTVC 2G9GA 2VZTA 3AJYA 1UU4A 4XDOA 3B0AB 1FV3A 2VCMA 3D3AA 4GB32 3ZN6B 1KFXL 5H9RA 2WFF1 1YQ8A 1S2ZA 3ASIA 3HWJA 1WWYA 4L92A 1Y9MA 2WO2A 1BMV1 4GMP0 3P8BA 2WNEA 3AYDA 3VHPA 3BUCA 4QQ2A 1PGSA 5LY2A 4BB3A 1JUHA 5FZ3A 2AZ5A 1S24A 4A3DL 1ZM1A 5DAQA 4FVVA 3OD0A 3KWVA 1GQGA 2ADEA 4R9BA 4CUAA 4JGYA 2NQYA 4O9EA 2V5YA 4EZHA 2E7TA 1PIV3 4TN7A 4W50A 3R6SA 4V1PA 4JZRA 2C6SA 4AR4A 3O14A 5BNPB 5FLHA 3D6EA 1PK6B 3J7MA 5AC91 3ENRA 1NG0A 3WOGA 5FYMA 3TEXA 5M5XL 5E16A 1S0IA 3GBGA 5FJKA 5FQ0A 1OQ1A 4Q2FA 4D69A 1MS5A 3VD3A 2I2SA 1PGW1 3A21A 4OMCA 1G9FA 4IEZA 5FLJA 5C8CB 4YGCA 2R92L 3POFA 4IE7A 4CDQC 4CEWA 4RS5B 4A44A 3VDBA 4WV8A 2JB4A 1NE6A 3N3HA 3PLQA 4AR3A 1YJLA 5FZOA 5EJ1B 1SFOL 1ULFA 4XAAA 4JC1A 1UKRA 2EXIA 3S30A 1TNFA 3JD71 1UL9A 3HOWL 3B7MA 1DIWA 3THCA 4F8AA 1VBB2 1VZGA 4RD7A 2HYKA 5IJRA 1VB2A 5E6HA 1K42A 3BI3A 5I8YA 2D6MA 3RZLA 4JHTA 1JW6A 5GLTA 4DXSA 4N90A 4CDXB 3IU3I 4NO4A 2ZEWA 4HLTA 3H0GL 3R4UA 2CNAA 3QBQA 2ZAAA 4A3BL 4E4HA 4CU8A 4EV0A 4LORA 3ZN6A 3VD9A 3PIO1 2JKXA 3ZN5A 2BGPA 5C4WC 4CVUA 3MICA 2W1WA 5GLUA 2VTFA 1UY2A 4AR6A 1QHDA 2A6ZA 4JVAA 3HR9A 1WGPA 1VZIA 2HH9A 2VNGA 4A3IL 4OFGA 5F32A 2VMFA 4M4PA 1IS6A 2ZEYA 3WNKA 3C7EA 1VPHA 4H3WA 1HN0A 4AYBP 2O14A 4WVZA 3GTML 3A7QA 1HRI3 3I2GA 1VMFA 1C1LA 5GZCA 4KMQA 3I49A 2IWGB 4KWJA 2G19A 3K7AL 2IXLA 4RHV3 3T2OA 3H99A 2WR9A 1DYKA 5T5LA 1W9WA 4DMIA 1WLCA 3UJOA 5BNPA 4TZDA 4XFBA 1JYCA 1W8NA 1PK6A 2FCVA 2JX9A 2VPVA 5KC5A 2X10A 1AR72 1MEC2 4FTEA 2YU1A 3PIGA 1RUE3 1UKGA 3C7GA 1OFSA 2P2KA 1AL0G 2QQMA 4YW3A 3QH6A 2R0HA 4INDA 2WJSA 3B01A 4C91A 5C8CA 3ZXAC 2VUCA 4RS5A 4LBQD 3NV4A 1OOPB 1PGL1 2HKXA 2VMCA 1OQDA 1VBB1 1H6XA 3HQRA 4NPRA 1W8WA 1J1LA 3VBFC 3WP4A 3WNPA 2D6OX 2DUQA 3OGRA 3ZYJB 2JDAA 2ETEA 1OLME 4LBJA 2HWD3 1LHNA 2A1XA 4BBSL 5CZKA 3S2DL 2E63A 1PVC1 1AUYA 1HQLA 1NT0A 5F6LB 1VMHA 2DCKA 1OA4A 3HN3A 3SCHA 5KHGA 1WCKA 5C3EL 1RVF1 3FHQA 2WWUA 2X53S 5FPAA 4UI9L 1ZZBA 2YG0A 4CDXA 4CPBA 1QJY3 4RQPB 2GC1A 3OOXA 3P3PA 4FBFA 1GUIA 4N43C 2B45X 5FZ1A 4I3GA 5EWSA 1DBNA 1XNTA 3VBRB 2QQPA 5A7WB 2BWCA 2R063 5F3IA 3FLPA 3N9QA 1SPPB 1E57A 1I6XA 1SMVA 4LO8A 1H4HA 5L9VA 2RS33 3ETPA 1BLZA 4E2GA 4IE5A 4BHPA 1ODNA 1TEIA 4Q4Y3 1OH3A 2WA4A 4L2NA 4CXXA 5A7SA 4E2QA 2YGLA 5C3OA 5DUXA 1CGPA 3CJXA 1RMU3 1XBFA 1QDCA 3THDA 2JI1A 5JR2A 2R062 1AR71 1EPWA 4BU2A 1CIWA 4GKYA 3ZFEB 5DZEA 1BBT2 2JE9A 1YI7A 3WLUA 4WVWA 2RS32 2VVFA 4I0WB 4YPJA 5FMBA 3OCPA 2Z3RB 1UMIA 4S2FA 5IVVA 1OUSA 4X6RB 1C8M2 1DZRA 2UWBA 3SEEA 4YW6A 3DV8A 1QH6A 4KWLA 3A22A 1S2EA 2H12A 1KITA 1RMU2 5M5WL 2XXZA 3C3VA 4QGMA 4BH9A 1LOFA 1IS3A 2BYVE 2EXJA 3AXDA 4FFFA 1KD7A 1K12A 4XFFA 1OOPA 5IHRA 4XF3A 3AVSA 4LBMA 1CX1A 1F2NA 3LWCA 1RWDA 4NMIA 4AFDA 2QZ3A 4PIZA 3KV6A 4QQHA 1JBCA 4LUKA 2ZHMA 1S0JA 5FY0A 2ZA9A 5FZ6A 5EYYA 3VBHC 1ZRDA 2WLPA 3BODA 4XAEA 5KXBA 2QQJA 4Q0VA 3N4MA 3OUJA 3NMBA 3O0WA 4QX0A 4JADA 1UU6A 2QBXA 1H2LA 2X8KA 4GWMA 3H42B 4RQPA 4D3WA 3LGRA 1C5IA 2ZZJA 4CXWA 4Z2AA 5J3UA 3IB3A 1NQJA 1YJKA 4C1WA 1UOJA 3VBRA 4Q4X2 1X9PA 3HOBA 1K45A 4FPEA 3P6BA 4GALA 5A7WA 1COV1 4E8CA 2BBVA 2QDRA 1JZ3A 1SPPA 2PPTA 2QZ2A 1PM4A 1QMJA 1NKGA 1POV3 2EA7A 2GMPA 2PAKA 2YHJA 3AP5A 2PLV2 3H1YA 5HCBA 1R1A3 1ZBE1 4N8MA 3VZLA 3OUHA 2BPA2 2Y6FA 2HLEA 4GA9A 1W3XA 4LOTA 4P9IA 5DUWA 2WUHA 3FBMA 4HOOA 5A70A 1RUNA 1UY1A 3BYWA 5DXDA 3LCPA 3BTZA 4PI2A 1UD1A 3POJA 3FJSA 4WVMB 4QD2A 4IE6A 2J1TA 3I2HA 5FPXA 1FMD2 1UX6A 3IIAA 4BWOA 2OW4A 2R30A 3FFQA 2YYOA 4Q0SA 3AKSA 3ZFEA 3ROUA 2WFPA 1ASJ3 1W2TA 2P6CA 2VOKA 1CZSA 1UZYA 5E1RA 4YYOA 3J26N 4A45A 5TSWA 2YC4A 1VCXA 3N9OA 1NXMA 3S1RL 3P5BA 4FPGA 1GMMA 2GSYA 1RUJ2 2WS92 2UU8A 2XJUA 4NPMA 3ZOIA 3OBAA 3AMHA 5GZFA 1ASJ2 2JDPA 3LOBA 2PELA 1RB9A 4UAPA 5CYYA 2R071 1DYPA 2YBKA 3AX4A 1VBC3 3Q8BA 4HANA 4LMFA 4TXWA 4UBGA 2A6VA 4C3HL 1HB4A 2RG4A 3I2FA 1Z7S2 1AR91 2UWAA 3C7FA 1LNSA 4KG8A 2W9XA 4QM8A 5D8AC 5GZDA 2CWMA 1Y7BA 4IXLA 4AI8A 4D6RA 4CEYC 1MZ6A 3I7DA 4BMBA 5A3NA 1FV2A 2YY1A 3U1XA 2SBAA 5C9AB 2RR12 4M0HA 2WWSA 5KWRA 5T52A 2VM9A 1ZYBA 5H9PA 3M2MA 2VVDA 3S15L 4NE9A 3UGGA 1QCVA 4LQRA 1R083 4BXXL 1MQTC 5IK4A 1ND2C 2JG8B 3HMYA 4OQ9A 2JE8A 2WC2A 1UQXA 3JB8A 4XFGA 5J09A 2WN2A 3GZEA 5K4LA 2WNUB 3FHIB 3H3ZA 5LK5A 3VHNA 2Y0OA 3ZN4A 2J1UA 4PLNA 1FX5A 3C2UA 3AZYA 1AX0A 2BGOA 4P5YA 1FMD1 5FTTC 2A69D 4AL9A 3UV9A 2AC1A 4Z8BA 3ZFFC 4CP0A 2W87A 1KXGA 1GR3A 1REEA 3GTQL 2PAEA 4WVMA 1OI6A 3CBNA 3FBYA 3WEZA 4DXRA 4JQRA 2M4YA 2A71A 3K51A 3M1HA 5ANNA 2BWAA 3ST7A 5LEKA 1O3RA 1R082 1HKDA 1HW5A 3M4OL 2V0EA 3DKQA 4XQWA 2Q1MA 4XUNA 2VU9A 5I0TA 2WDBA 4OLLA 4A3FL 4A3EL 3Q9OA 4FFHA 1Q8OA 4FFGA 4FPOB 4OMDA 4XOGA 4YLZA 3V0BB 4FXKB 3ZFGC 1NCRC 3ZYBA 3BALA 1RUJ1 1NXEA 1CJPA 2WS91 2YROA 3FFZA 2QQOA 3H7JA 4M3CF 1AYN3 4OUMA 3BCWA 1OFNA 2HWB1 1LCLA 4PIXA 4XFHA 3BU0A 3HAXC 3FL7A 3RWKX 4GD4A 2GC3A 3VL9A 3WX5A 5LBBA 5K9YA 5F9TA 1LOGA 2JG9C 1JYTA 1K3IA 2B9UA 2Q0AA 1CAUB 2HWC2 5ACA3 1BE7A 1LEMA 3NQHA 1UXXX 1WBLA 4LO5B 3PKJA 5JR7B 2IXHA 4XILA 1R0GA 4E2SA 3GZUC 2DUPA 1UYZA 2IFWA 3A23A 4CPBD 4OZXA 4CCMA 4EYUA 1UZ0A 4XVHA 3NAPB 2CR8A 3RYRA 3GTLL 3AFGA 4NAOA 4HSJA 4FP2A 4NIDA 2OVUA 5DDJ3 1VRH1 1PO23 2MNGA 5C9AA 4Y33A 2D5FA 4AEMA 4PHZA 3ES1A 4Y5Z0 2VULA 2D3RA 1L7QA 3LDKA 5D21A 4YFZA 4QQOA 1HJGA 2ZMNA 2JG8A 4XACA 3WR0A 5B4NA 2NLRA 3OPZA 4D0QA 4C3IL 5FLML 1IKQA 1IS5A 2A75A 2WNUA 5JXJA 3B9CA 4K8RB 5FMOS 4OI1A 3H8XA 2RM22 4QX5A 4IDZA 4A93L 4P08A 1WW7A 4XPVA 2CDOA 5DDJ2 1PO22 1UOBA 1GOFA 1JUIA 3CU7A 2ZGUA 2FDFA 4DY5A 5EJZB 1SLBA 5FPZA 4DQAA 2DVFA 3TN91 1OKQA 4X8PA 1RDGA 4IEQA 3RI8A 3VKOA 1UOGA 2E6VA 2GU9A 5K2ME 4H2AA 4JAAA 4W8JA 1VMJA 1GKBA 1D4M1 1IG0A 4AVCA 3V0BA 5FJ8L 2E53A 4CCOA 3MIDA 1BQ8A 1D2QA 2BQPA 3H1WA 2E7QA 5DG1A 5C3PA 5IP7L 3A4UA 3LFMA 5BNQA 5C5TA 4BDVB 1X8MA 3QQCE 2XKPA 1X50A 1LTEA 2ZHLA 5FBZA 3WSOA 1P7PA 3F95A 3INAA 2DU0A 4UFIA 3E1F1 1S2KA 2GALA 2DCZA 3PZAA 4CDUB 2QQUA 1D0GA 3LEGA 3OBRA 4K9FA 3EBRA 3UJQA 4ZZ8A 4NHYA 3VBUC 3ZFFB 3HBKA 1HN1A 1CAUA 5EIOC 4CU9A 5FY4A 2JDYA 4LJHA 2TNFA 5F5QA 5LRRA 2JDUA 3TAYA 3ZXEA 2QFEA 1WW5A 1O8SA 1REFA 4XF9A 2KR2A 3ZG6A 1ND3C 1QJX2 2WZR1 2ZTNA 3R0RA 2FDHA 1RTVA 2MPFA 3NAPA 2FQPA 4MV2A 2UY9A 4AWDA 3SHRA 2DVGA 3U78A 3ZFGB 3AP4A 1XNDA 1G9CA 1LHVA 1SFNA 5FZGA 4UY81 3RZHA 3G7DA 5EJ3A 4GMP1 2XWJB 2RM21 5CFCC 4QPYA 3WQBA 1C3HA 2VUJA 3LPFA 4JCKA 2RMU1 2ZGLA 3WP5A 5JDBA 5JVVA 3RVHA 3ZMOA 4HXCA 3J8F3 2Q8EA 1LOAA 1JOJA 2R49A 1QXRA 2DV9A 4G3YC 1TZOA 4A6SA 2GC0A 1YFUA 3KYYA 2YDEA 4XIOA 4AVVA 4QXCA 4CUBA 1NLQA 1KDKA 1GYKA 2FMDA 2ZZQA 4CP2A 2Z2SB 5FYHA 5FY7A 4XJ9A 2WT2A 4IEVA 1RB8G 4IV1C 3J7Y1 4C2M1 1QDOA 4XJZA 2W39A 3S1NL 1QF3A 3HJRA 3UKNA 4AFCA 4YSFA 1G9AA 4O61A 4XTPA 5GADc 5L7OC 2DU1A 2E9QA 4L99A 4XDPA 4G6BA 3KQRA 1KJLA 5IAXA 3DYOA 5IK5A 4M3CB 4WZFA 3KT7A 3VKFC 1S4CA 1XYOA 2HBUA 3IZOA 4B1MA 2B46X 1LOEA 3KB5A 4YM1A 8RXNA 3MIGA 4B4QA 2KM2A 3S7EA 1SLAA 3RRDA 2JJ6A 2XLFA 4JAFA 3UL2A 5JCTA 2VG9A 5DQ0A 2RJ2A 4CDUA 4DUVA 4N7UA 1YEWA 3DN7A 3HPNA 4A3GL 2VQTA 1QJX1 3ZFFA 4XDQA 4A3KL 1RHI2 1Y3TA 1NAEA 2HR5A 2ZGNA 3WW4A 1VAMA 1K5MB 2HBTA 2A3WA 1I9RA 4N53B 2JDHA 4QX2A 2FCUA 4RA0A 3RS6A 4Q1PA 5I91A 1RUD3 2RHPA 2HWE1 1Y1VL 3I4ML 4AK3A 1LKOA 1FPN3 5A1LA 3K35A 4PIYA 2V0FA 4LK6A 4NHMA 3FZ3A 3ZFGA 4IEOA 4JV4A 2PYTA 4PDWC 3MW3A 4XIKA 1SLTA 4XMAA 4YZ1A 4CE8A 1LR5A 1ENSA 2JA5L 1JODA 4TLGA 3LPGA 4Y5TA 1SMUA 2Z69A 5FO7B 2Z3QB 5C3QA 5FZ9A 3LWVB 2ZX3A 4JKMA 4M01A 3NV2A 4A3XA 4IL7A 5A3UA 5FYBA 2I74A 2WINB 3N9LA 1LECA 1NOVA 4HKOA 4Y1UA 5FMOL 5LA0A 4OQ8A 1QEXA 3T0DA 4JDOA 1UIKA 4AI9A 4EWDA 2W0XA 2W2IA 4GQ7A 1BEV3 4W65A 1IG3A 3RSJA 4COWA 3KYUA 3DEMA 3IDCB 3OGJA 2C5DA 3GZTB 4XFCA 1ULDA 2KA3A 5FPVA 5LA9A 2ZGPA 2X05A 4KBZA 1ZZ6A 3WDUA 1AYM3 2W5FA 2FDJA 4EWAA 1GZCA 2XBO3 4M3CA 1JHNA 2OYZA 3RWNA 4BCUA 1OUXA 3GXUA 5LATA 4NIHA 3V0AB 1QOSA 2LCQA 3EHKA 1BEV2 4GH4B 4QGNA 3E6BA 2WWJA 3LB9A 4IEXA 1V6IA 1RUC1 4QT6A 1ZRRA 4J25A 1CN1A 2P3YA 2YZ4A 3FUOA 3WDVA 4MYEA 1XRUA 2HWF1 3T0AA 5T3NA 5HV0A 1JZ5A 1DX8A 4LE3A 4QPGB 1R0FA 1K5MA 2YB7A 5JOYA 3S57A 4N53A 4AHZA 2B39A 2L9LA 4E8DA 4I09A 1EV12 4B4PA 3FHAA 4I3PA 1TNRA 3TNPB 3MO4A 4ZPIA 3S7IA 3ZMNA 4ZS2A 5JIAA 4TVMA 2BGCA 4NHKA 1POV0 5JOZA 5KXDA 1J3QA 5FMDA 3WG3A 1OD3A 2JKBA 1SCSA 3AYCA 5EP9A 2XR4A 4AGGA 2CL2A 1RYTA 1B35B 1BXHA 4ZXKA 2J1EA 3I54A 5C3SA 5IYDL 2W1SA 3ACLA 3DYMA 3PUSA 5HV4A 1YUZA 5IYBL 2WT1A 2J7MA 4NAMA 1I3HA 2KD7A 3S16L 1NCQC 3POYA 5FZKA 5A1FA 3Q8AA 1NA1C 5FXZA 1Y4WA 4ZS3A 3WP3A 2M6PA 2EALA 2GC2A 4ZY9A 4A3ZA 2V4VA 3WF1A 5DABA 3J7LA 5A3OA 3BPSA 4J1XA 4E6YA 4Y7NL 1F4HA 3NVCA 2XJQA 4GIQA 1W99A 4DNYA 4I02A 2JDZA 4BYYA 3G6JB 5LA1A 4D8MA 1DG6A 2QNKA 1SLLA 3B08B 3R4SA 3VHOA 2ERJA 1KJRA 1ZRFA 2YBPA 3KYXA 5C33A 1UY3A 1WLWA 2B9VA 4Q8LA 3QLQA 3RZTA 3V0AA 2CGNA 2QJVA 4AQ6A 4GH4A 2BV4A 1H1MA 4MADA 1B2JA 1UYXA 1E5HA 5IY0A 1NLSA 3GTOL 2R043 2XONA 5BNOB 4QXHA 1XYNA 1PVXA 4P14A 2PVEA 1NZCA 2JD4A 2Y6HA 4HVRA 2WZPP 2VMEA 2YGMA 3SKJE 4XBNA 1EV11 4QPGA 3EYPA 2QDNA 3RJ2X 4IQPA 1HQWA 1VBE1 5F5CA 1XNBA 1X9TA 4IV3C 4AR5A 1ZVFA 4A7ZA 4DFSA 4CU7A 1CADA 3LWQB 4YARA 2BP6A 1AF9A 5LW9A 1REDA 1S0BA 4QPIC 3WDWA 1XU2A 1RUG2 4AEDC 4R9DA 3BIEA 1W8OA 2QCSB 3CJIB 2OZ6A 2NVTL 2QTWB 2EXKA 1BHGA 1KDMA 2C1FA 5F39A 2VCBA 4Q4V3 5HCFA 1HJFA 1W90A 2OS2A 3WWLA 3D4KA 3LFIA 2PYAA 1PM7A 4UF0B 1N1SA 4COVA 3ZYGA 1B35A 4UFKA 1V9U2 1N1YA 1JYXA 1R0JA 2JICA 4BK5A 2FMYA 3CZUA 3HBZA 5FMCA 2I45A 4GJZA 4ARYA 5EQUA 4PBPA 4Y1YA 4BM8A 1YUDA 3ZKYA 1P8JA 5FPBA 4XC9A 4EN6B 1AR83 1LHWA 2AEYA 3M3YL 4OHXA 2D43A 4Q4V2 5G04L 5A7OA 5BUVA 2GNMA 3LQCA 3PUIA 2XGXA 3UNPA 4RSUA 1C8NA 4Z2WA 2EIGA 5HBAA 5A6ZA 2Y0SP 1X8EA 5DG2A 1KFUL 5FK8A 1WW4A 3T2PA 1F5JA 4QQPA 1URXA 2YC0A 2A6XA 3NFPI 2ARCA 5H1Sc 3RZZA 5J37A 1AR82 4AR2A 4MSVA 2W3JA 3HNMA 2X29A 1O3QA 1DVBA 3S5QA 3JD73 2Z42A 1C1FA 5A3LA 3ZXFA 5FZ0A 1NCQB 5BNOA 1YQ2A 2ZX0A 3PMSA 1W2OA 4L8QA 1JS9A 2XWBB 1NA1B 2JDNA 5IVBA 2RS51 3AZZA 4JAEA 3POSA 4HG6B 2DTYA 4FI9A 3W9AA 4B1LA 2RS11 3ZDSA 4AQTA 3EJKA 4FT8A 1R1ZA 3TEWA 5F6KA 3T08A 2TBVA 4JHZA 4XURA 3HIFA 4DS0A 1CVNA 3NV1A 2ZEZA 1LJ7A 5CB7A 1C09A 3TBDA 1NXGA 4YWLA 4LR4A 3OBZA 3CJIA 3TYJA 4YZ5A 4NHLA 1V9U1 3HN1A 5GKAC 4DRRA 4XABA 5GLZA 3WNXA 6RXNA 2BFUS 2VMDA 1WUVA 4MHRA 1UY4A 4UF0A 2GMEA 4XW3A 4WFN1 4FSJA 2Q30A 1ZBA1 2PHWA 1GP4A 1LKNA 4HPKB 2VOWA 1OURA 1AHSA 1OWCA 2YPDA 1QJU3 1FHHA 2X09A 1SACA 3ZM8A 3WZ1A 4QXKA 1JZ4A 1AXZA 2XQXA 2DYCA 1PIV2 1W0PA 2VOTA 2UYAA 3H8RA 1LEDA 1YFWA 1VZHA 4XYXA 4OHVA 5FZBA 3KV9A 5DUUA 2A5ZA 2ZXQA 3T2TA 4AEDB 4ZN1B 4IGOA 1T9QA 1AR63 3SH5A 1LENA 4OHWA 3HVDA 3IT8A 5IK8A 2P3IA 5GZEA 1PMIA 5JMOA 4QX1A 1DCSA 1PMJX 4PQQA 4GB31 2O5JD 1V6OA 3BVCA 5FDBA 4R9AA 5DUVA 4EZ4A 2DCTA 1D7PM 3EMRA 3M70A 4HETA 4NJ4A 2WSVA 1OSGA 2WBKA 1MS8A 5A7QA 3RZDL 3GBFA 1DGWA 1NCQA 3NNGA 4ZU7A 5FP7A 4KL1A 4K40A 4AEJA 3PVOA 4XXBB 3CLPA 1KGYA 1RVF3 3S0MA 3MBWA 1JZ2A 1FOD3 1AZDA 3AP7A 2WKKA 4BQ2A 2BW8A 3W5NA 1SBEA 3KLSA 4LIVA 4BLJA 1CAVB 1FNYA 5CADA 3MIHA 2BRTA 4P02B 3GTPL 4JRLA 3U14A 5BXXA 2C0ZA 1W0OA 1WA6X 3O1MA 4NN0A 4Q5OA 4QWNA 4AVAA 4PLMA 3DPRC 5CEHA 2P5BA 1W6QB 2ZBJA 4HL0A 4YGDA 1WZXA 1WKYA 1YQCA 4JKKA 1TVGA 1G7YA 4HPKA 1BQPA 3U4SA 3MV01 4HZFA 3UT0A 5DMYA 4OHYA 1ENXA 2BVVA 5L73A 4KGQA 1HRI2 4QHZA 1SMMA 2WO3A 4HT1T 3KQ4B 4L9BA 1A78A 4TTGA 3R4DB 1G9BA 3I2DA 2EIBA 4GZ9A 2YMZA 1V0AA 2VZUA 4QU2A 3ME2A 1J83A 2VAUA 4RHV2 1JZ7A 1LU2A 1JHJA 4NIGA 2AR6A 1NE4A 2D3PA 2JWPA 3VKMA 5BNNC 4A7YA 3B00A 4CP9B 1YK4A 3KCYA 2HJIA 1LKPA 1GANA 2UY8A 1J58A 1PZ8A 1V6JA 2VC9A 3BGAA 4YVWC 3MPBA 4MLOA 3T09A 5FJHA 4AEDA 4A4AA 3MZHA 2PQSA 2YUEA 1RUE2 2WNVC 1XE7A 5A1AA 1SLIA 3CF6E 3IDEA 1NYWA 3MEPA 4P9WA 5DN2A 3S1QL 2WL1A 4NIAA 2BBAA 3VL8A 2Q1FA 3WT3A 1UYYA 3I59B 3JUUA 3LAGA 2D6LX 3OBTA 4ONUA 1PNFA 4YGBA 1V70A 2VBDA 4OI0A 1UOFA 2OA2A 5KBFA 4QKBA 3WNNA 1M06G 3TEYA 1NQDA 5D2AA 2HWD2 5FUPA 1UNBA 2XJRA 1RUF3 4CDQB 3LSEA 3GALA 3VBSC 4A6OA 4HMZA 5KR7A 3PU8A 3SH4A 1CAVA 2PHDA 3FN9A 3ZXGA 1QJY2 1COV3 2GNTA 5EFUA 1U5IA 1WMXA 2VW2A 1JOBA 1VAKA 3ELNA 4HK8A 4OUSA 2A73B 3RQ0A 1ZBE3 1MEC1 3BU7A 4IETA 4CCCA 1W06A 1HLCA 3WG2A 4ATFA 1RUF2 1W6QA 4BY1L 5J36A 2FCTA 3U07A 3MFCA 4J1WA 4G9SB 1XB9A 3J7NA 5IVCA 2D93A 4BIFA 1WCDJ 2NPIA 2BFUL 4Q4Y2 3OUIA 1KQRA 3N7MA 3N36A 4XXPA 2FHRA 4H7MA 4RHV1 5C4WB 4R52A 3IN9A 4H55A 4CCKA 4GWJA 4D7SA 4Y52L 4KWUA 2VMIA 4KWKA 3LWRB 1OF4A 1RGSA 5FZCA 3WD5A 4LLOA 5IVJA 1ZA4A 4TWTA 4DUXA 3S17L 3CIHA 4CP9A 1D2SA 2BUKA 2BU9A 1CZVA 1GNYA 4FPYA 3MIBA 3NNFA 2FZ2A 1IQAA 1N1TA 4RYDA 4FAGA 2AUYA 3DPRB 4QIWP 1ZX5A 3ILFA 3WWNB 3CDZB 4AFBA 1SBDA 2VMHA 3LA7A 4IGPA 4U36A 1A3KA 1ZZ7A 2IVJA 2R073 1WCSA 2RJLA 4S2DA 4LTAA 2HWD1 4DEQA 2VZQA 2K2SA 3IIIA 2Y64A 5CKMA 2PSMC 1AR93 3RZGA 2UYBA 3OY8B 2RDQA 5MGNA 3T4VA 5IAVA 2EAKA 4CDQA 1QJY1 2PHXA 2XVGA 2R0FA 3B02A 4P9XA 1MZFA 3MLJA 4D6QA 1DDLA 2EAAA 2B7YA 2X5IC 1QJZA 5KHJA 3VBFB 4M3CE 1PFWA 2R061 4O7XA 3RZJA 2ZX2A 3THPA 3AYEA 2ERFA 1BBT1 1UZWA 2HVYC 1XJAA 2RS31 3K2OA 2VUDA 5CIRA 4B4RA 2DURA 3ZIWA 4EN9B 3NJXA 4M00A 2ORXA 1C8M1 2ZKLA 3CKHA 5HXMA 2MEV3 4QDSA 1R1A2 1OC1A 3VBOC 4N43B 2ZGRA 1RMU1 2CGOA 4JGZC 4MVTA 5HI0A 3SISA 3D8CA 2GH8A 5C4WA 3V64A 2ZGSA 2JIGA 2V09A 1QXPA 4JQTA 3I4NL 3LA3A 3DXTA 5LB6A 2ARBA 1A8DA 3CMGA 2JE7A 2VD7A 3M8LA 5GAGc 4XJUA 4OVEA 4JTOA 3ZPOA 2W94A 4OCTA 1ONAA 3OPWA 2BNNA 3DUIA 4L97A 1CAWB 2MEV2 4XZPA 3I2OA 4LHNA 5JI9A 2ZPXA 1QU0A 4EQVA 2AEZA 4DXTA 3IMMA 3OEAA 2D97A 2RV9A 1OA2A 1PFVA 3GM8A 3IDBB 5DM61 5F2SA 1XE8A 2E7AA 3DL3A 4LK7A 5JWPA 2EIDA 2YXSA 1O4TA 1RXGA 2VVEA 2XJSA 2ZGKA 3DPRA 3L9JT 3B93A 1F9KA 4Q4X1 1JYBA 1CIYA 1F8VA 1U12A 1W8UA 5HCHA 4QAWA 5EYXA 1SMWA 3HAGA 3LE0A 2Z79A 2GNDA 1ZREA 3J7Z1 2PLV1 3K75B 1OPOA 1VB4A 5ANQA 1VBC2 2YBSA 3OY8A 4AE2A 1FAYA 3PWFA 2JI3A 1W03A 2XL9A 1S2BA 1WBFA 3KYWA 2FDIA 4RR3C 3DYPA 2GP5A 1Q8VA 3APBA 4BBRL 1VRH3 5KHHA 4DZGA 2VXRA 4URTA 5CKNA 2WQZC 3RI9A 1QQP3 2JA6L 2WAOA 3VBFA 2WRAA 1W9FA 2A6HD 1LRHA 1UW8A 4QB1A 1UO9A 1POV1 2QQIA 3HNBM 5F5AA 2ZMLA 1R64A 1ULCA 2V73A 3VBHB 4FOWA 4CDWC 2CHHA 4C90A 4WM8C 3M3CA
chains in the Genus database with same CATH topology
3H7YA 3RMYA 3P2AA 1CX4A 1MS9A 5C8WA 4KGGA 5JOXA 4LO4B 4FPKA 4N43A 3SCFA 1MR5A 4ZU5A 1QQP2 1F5FA 1H8TC 4FOVA 3WCRA 3TN93 4CP1A 2GDFA 5JPMB 1ASJ1 2B5HA 3WQ1A 3ZSEA 3M7AA 2HEYF 1VIWB 1D4M3 4KU7A 1CAWA 1H2MA 1Z7S1 2MS3A 2ZX1A 3TNQA 1D4VB 1X82A 4X8NA 3N7LA 2RR11 5C6CA 1AYN2 1N3PA 2ES3A 1NNQA 5ABJC 5JOWA 3LA2A 2VY0A 3PVEA 3VBOB 1O91A 4YM0A 4U2AA 3H50A 4FPLA 2YPJA 3OTFA 5ACA2 5T5JA 1TME3 1VBA3 3E6CC 4E9KA 3P3NA 1EAH3 2GAUA 1EYBA 4F83A 4YM3A 5K0UC 2R6QA 2O8QA 2A6ED 1R081 3AP6A 3ZPYA 4XJWA 5BY5A 5JSRA 1R0HA 2RMU3 1WJVA 3VBHA 5D8AB 2BVBA 2ZOEB 5AI2A 3ILRA 1VBA2 4CEYB 1VJ2A 1VBD3 1V6MA 1Q43A 4XBLA 2DWRA 1BVVA 4XJAA 5RXNA 3L2YA 4R4ZA 2ZHNA 1MQTB 3V65A 5CFDC 1ND2B 4YG0A 3KM5A 2G4IA 4MGKE 1A6CA 5I0UA 4CYDA 1RL3A 5DZFA 2HWC1 4MGZE 1VBD2 1GLHA 4YVSC 2H0VA 1NY72 4PQ9A 1RUI3 1FHMA 1AYN1 4XE9A 3IBMA 3IM0A 3O12A 4Y1ZA 2A70A 2ZJCA 1FNZA 3PMEA 2A6WA 1AX1A 3ECQA 1DGWX 2GN7A 4KBBA 5CVRA 3SITA 3ZYRA 5ACA1 3NWKA 3VBOA 2NN8A 2VW0A 1QOOA 1NCRB 4AI2A 4JDNA 5D1IA 2VOVA 4P5HA 2F4PA 5HCAA 1RUI2 4RGGA 2L0ZA 3OJBA 2ET1A 2GN3A 1AX2A 3WDTA 2C9AA 4XHBA 4QHBA 5DDJ1 4XQDA 1PO21 4HKWA 2LALA 1W6PB 2PA7A 4XTMA 3KCCA 2JG9B 1V00A 1N3OA 1Q56A 1HV0A 4XGHA 4YM2A 2VL6A 2BEOA 4N9HA 3VKLA 2GZWA 4E4DX 5D8AA 5T54A 3SXWA 1HRV3 4CEYA 3VGIA 1ZRCA 3J8F2 4FTBA 4BLIA 2OIIA 3AZXA 5HXVA 1UPIA 1W6NB 2BE5D 3LKJA 3RPQA 1MQTA 1YO8A 1ND2A 2D6KA 1JTZX 4D7YA 1FT9A 4EN8B 4FPJA 4OULA 4EJRA 1HRV2 4FP3A 1RINA 4MGIE 2D44A 4ZKTB 3SS2A 1YFYA 1LB2A 1Q3EA 1WLTA 4Y20B 4JAGA 1H0BA 4HN0A 3ZXKA 4P9YA 5T55A 4LEJA 1S55A 1SEFA 1ULGA 1RUC3 1VAVA 3MI8A 5JI7A 2HWF3 5I8TA 1NCRA 2C6AA 3IMNA 2RE9A 2JEMA 4IESA 4EROA 5I0SA 2O1QA 3ZXLA 3SLIA 2K9ZA 1SCRA 3VDDC 5B2GB 1GZ9A 1PO13 2VMGA 1N1VA 3AK0A 1RUD2 1W6PA 2GH2A 4JDMA 2JG9A 1FPN2 3KMHA 3VBUB 4KU8A 2JECA 1IPJA 4J6GA 2PVXA 3JU9A 3AMMA 1DQ6A 1RUH3 2ZAHA 1ND3B 4AQ2A 2KN9A 2VH9A 4QM9A 2EF6A 1PO12 4Q4W3 4KQ7A 1EP0A 3VKNA 5GALA 3PNAA 1UF2C 2VGDA 1W6NA 2IC1A 2GMGA 5GAHc 5CFCB 3GZAA 3USUB 3WG4A 3D0JA 2A7AA 3AYAA 1G86A 4C0BA 1RUH2 2ZABA 1HXS3 1RHI1 1LULA 4AF9A 1GV9A 1AYM2 3ILNA 2DVAA 2XBO2 1VP6A 1UZZA 4Y20A 4DB5A 4XETA 3LPEB 2IXCA 2R1DA 2TEPA 2XVKA 4QQLA 4IV1B 5FLIA 4DOUA 3VUOA 1Z0HA 4HVQA 4K21A 2DSXA 1AL23 2O8OA 3M4FA 5L7OB 3FLRA 2VQAA 1MACA 1ENRA 3JBG3 4TPUA 4AHXA 1UPSA 1QGLA 2D3SA 2DFCA 1VBE3 3DKWA 3J9SA 4LO7A 1RUD1 1H30A 2VNOA 1B2OA 3MYXA 1QY4A 1R093 2P3KA 3H8UA 5CG9A 3WUCA 4YW4A 2PAMA 4ASMB 1YK5A 1IS4A 3MPSA 1XQNA 3AJZA 1AL22 2VOXA 4CEWC 3VBUA 2ZIXA 3LOIA 4JTNA 3NJZA 2ATFA 5IT6A 1LGBA 3LZZA 1LTLA 2M4VA 1ND3A 3KZ4C 4EN0A 5AI3A 4HBNA 1R092 2CAUA 2XJPA 1GBGA 1WD3A 1H2NA 4AI0A 1MS1A 4L11A 1ODHA 4BOWA 4QGLA 1X7NA 1GNHA 1CJDA 4PDWB 1TMF3 4I30A 1BEV1 3NKGA 4F3JA 4P9JA 1JH5A 3VDDB 5CFCA 2FBEA 3USUA 1J1TA 5JVH1 1XXNA 4YZ2A 2BNMA 2XBO1 4UXAA 5CA6A 3MFAA 2QVSB 3HT1A 3NO8A 4FPHA 5I0RA 3N7JA 1RITA 3D0SA 3B94A 3LSDA 2XJTA 1TMF2 1YIFA 4G4FA 4IV1A 3U0ZA 3ALQA 4YFWA 4NOTA 4Q0UA 1M4WA 2WFF3 2OPKA 1B13A 5L7OA 2RS53 1DHKB 5BNPC 3AMPA 2R042 2KXLA 1RJ7A 1PK6C 3GBWA 2RS13 5I93A 2ZGOA 4B29A 2KKDA 1ZZ9A 1AVBA 1QXJA 1H4GA 5C8CC 4U671 2Q4SA 2WFF2 3IKWA 1GICA 1IW7D 4Q26A 4RS5C 1I5ZA 1BMV2 4B3NA 2HEWF 2AENA 4META 4YWMA 5AC93 1ZBA3 1MS0A 4NWVA 1L3JA 4E4ZA 4DXZA 1CD3G 3H3UA 2IXKA 3T1LA 1O5LA 5T50A 4PDWA 4CDXC 1KS4A 3U10A 5A32B 3MIEA 1J3PA 1DQ5A 3E5QA 3VDDA 1IOAA 5AC92 4XMIA 2AYHA 1IU5A 2W68A 3CO2A 4IEYA 2ENRA 2W52A 3R05A 1PGW2 3TB0A 4GB33 2A3XA 2D40A 2Q5TA 4K3UA 4LO6B 1RUG1 3SNMA 4Q8KA 3HQXA 4TLFA 2JI2A 4F7ZA 3KGLA 3RDIA 3O5SA 3W58A 3S6PA 2ZKNA 3JD72 5CNAA 4OHZA 1C5HA 4KH9A 1GNZA 5KHKA 1VLNA 4OI4A 3ZYPA 5FO9B 3GF6A 7RXNA 4LLFA 3SCGA 3QACA 3VN4A 4Y24A 4FXGB 1MVQA 4K7JA 1JYIA 4FQZA 2ZHKA 1LOFC 4R9CA 4Q4V1 3BTAA 1OOPC 1DGRN 1MS4A 2WT0A 4YG3A 3WQ0A 2CAVA 4AI1A 1LHOA 2DF7A 4IV3B 1OPMA 4COZA 2K2DA 4QPIB 3U11A 5JSOA 5MLC3 3FC0A 4FO9A 1NXD1 3J4UH 2XG3A 1QNYA 1AR81 1QJU2 2ILMA 3FX3A 3HT2A 4Y26A 3UKTA 5J7MA 4RQPC 5A32A 4AGRA 1YLLA 3WW3A 1W6OB 4MH0E 3VBRC 1VBB3 3BIWE 3FE5A 1Y43B 1YI9A 3NKTA 1JXNA 4I0BA 1PVC3 1NA1A 2D5HA 2ZX4A 1AR62 4K8FA 1ALYA 1WMDA 1GSLA 1ZZ8A 1PGL2 1YV1A 5MFPA 2VECA 4IEPA 4POGA 4SBVA 1GZWB 2LUWA 2C6BA 1W2UA 2R1BA 1OHFA 3PKIA 4LBLA 3ZFEC 5FCCA 1OQEA 3WY6A 2IZWA 1G8WA 1PVC2 3WP6A 5H9SA 1V6NA 1RVF2 1W6MB 5J98B 1FOD2 1HV1A 4UBHA 1BKZA 1QNWA 2PHTA 5LEJA 3I4IA 2NM1A 1PIV1 4Q29A 2H6BA 1APNA 1AR73 1DGLA 1MEC3 1XYPA 2XUMA 3M3EA 4S2GA 3VPBE 1YIPA 1MZEA 1CAXB 2CKCA 4IV3A 3QOPA 3TRSB 1QJU1 4P9GA 4BE3A 4QPIA 1DU3D 5CU1A 1J59A 5J48A 3WUDA 4Q1RA 3JB4C 4B7KA 4XF4A 2QE3A 1CAAA 1WMEA 2AREA 5E8AA 1IZ3A 1W6OA 1BVP1 1YFXA 1TE1B 4OI2A 4K9SA 4YW5A 1AR61 2XB6C 3FWEA 4COUA 4R8HA 4HFSA 1BJQA 2WLQA 2O0OA 2D7FA 3AKTA 4FPCA 4XJ8A 3MIFA 4XQ4A 3AP9A 1X33A 4WM7C 5SV8A 4AHYA 4LA3A 4LBNA 1LOBA 3THTA 4K20A 3IWZA 2ZGMA 3QD6A 1GZWA 3RJRA 3QVDA 3AKQA 2WA3A 4FTSA 4DRVA 1FOD1 3AXEA 4FOYA 2B8MA 1YXWA 2J9UB 1W6MA 3AKPA 1HRI1 3OGGA 1C28A 3I8TA 2DFBA 2Y0IA 3VLBB 1Q8PA 3AZVA 1DQ1A 1DGRA 1BBT3 2Q1ZB 2SLIA 5JMCA 1A8MA 1COV2 1LHUA 3V56A 4Z1VA 3KD4A 4M0NA 2DCYA 1C8M3 4HKLA 1S30A 1CAXA 1U0AA 1ZBE2 4UW4A 3UKVA 1RUE1 2P3JA 4TSVA 1GFF2 1PZ7A 3VHRA 3O7OA 3JCIA 1W39A 2R32A 1XNKA 4NWWA 5CG8A 5AFBA 2CGPA 1O4ZA 5BPXA 1WD4A 1Z78A 3MGUA 3RG0A 3ZSLA 5C9AC 1DQ2A 2RJKA 2UURA 4QMAA 3B3QE 4GULA 3I59A 2JG8C 4MZUA 2DUOA 1BYHA 2H6CA 2NYYA 4Y22B 4LHKA 2WNUC 2VUAA 4RXNA 4RFT0 1S0EA 2GMMA 1FI2A 4BZ4A 3OD4A 2H0BA 1AJKA 4ES9A 4Q4X3 3VZJA 1IKPA 1YCIA 5FRAA 1DZQA 5BNNB 3RZ6A 5I8SA 4D7TA 1X36A 3AMNA 4YVWB 2PLV3 3DGTA 5EINC 2R072 1YRZA 1DQ4A 1SBFA 1RUF1 2WNVB 3AKRA 1AR92 1WMFA 3SH3A 4PCRA 2A3YA 4Q4Y1 4V196 1S0CA 1FMD3 3WVJA 2P34A 1EPZA 3CNAA 1H8VA 3HD8B 4O9GA 4BPZA 4MXVA 1YWKA 1ZZCA 2ARXA 1MZ5A 3MF9A 5GLVA 2JENA 3NSTA 4ISRA 3UK9A 1C57A 5CBLA 3VBSB 4WM7B 3KSCA 1PZ9A 2DTWA 1RUJ3 2WS93 1CPNA 4MXWB 4K6BA 4E27A 3NAPC 1LGNA 4XFAA 5KHIA 5AVAA 3WV6A 2HWB3 4D94A 3X29B 1VALA 4A2UA 4GS7D 1WLDA 3WDYA 2D98A 1V6LA 4AGVA 3A44A 3GNEA 2NMOA 4AFAA 2ZCWA 2ZGQA 1PNGA 5L36A 1Z7S3 4POFA 1T9PA 3RYPA 1OA3A 3VZNA 1RIRA 1RJ8A 4Y22A 1DZTA 1O3SA 1VR3A 1HDKA 1HQNA 1UIJA 4ES8A 5A33B 2RR13 2ET7A 2P37A 2XH6A 4AQSA 5KXEA 2HWB2 4Y4YA 3SMHA 1QKQA 4HSLA 1UAIA 3T1MA 5BNNA 3EQEA 4YVWA 1D0HA 3AZWA 3KT4A 5DM71 5JAXA 2Z5WA 2Y26A 4MUVA 2WNVA 3E5XA 3E6DA 3MW4A 5MF6A 4BIOA 1R1A1 1GQHA 5JLVA 4EWEA 1LKMA 1YUXA 3VZOA 2Y38A 4X6QB 4FQ4A 4RGAA 4AHWA 1VRH2 3L2HA 4HN1A 3NL1A 4RL7A 4YZ4A 1S0DA 3A0KA 2A6YA 5H9QA 4CTEA 1UN1A 4CDUC 3PJQA 2MEV1 4ZU4A 2LTNA 3VBSA 4Z07A 4WM7A 1LU1A 3IPVB 2X5IB 1S0GA 3WQ7A 2G9FA 4WBBA 3MF6A 1SDWA 4MXWA 3VZMA 1JN2P 4AW7A 4UW6A 3TN92 1OWBA 2HWC3 3OYWB 3URFA 4ISQA 1QWRA 4CZSA 4N7IA 1PHMA 1D4M2 4LT5A 3A0NA 1VBC1 4XF1A 3D82A 4JGZB 1SQ4A 2DVDA 4GKXA 4IEUA 3KCXA 4UW3A 4XF0A 2WZR3 5A33A 5GLWA 1N47A 3ZSKA 3H9AA 5SV5A 2QKDA 1AJOA 5A3MA 2P17A 3DF0A 4YRDA 1ZNPA 3H1MA 1DLLA 2WSUA 4GMP3 2RM23 5GM0A 3OF1A 2B42B 5F1RA 2WZR2 4AVTA 1OD5A 1TME2 3ZYIB 1QQP1 2I07B 3FUQA 4YZ3A 1EAH2 4Z92B 2XLGA 5FOJB 1AXKA 1ULEA 5BV6A 2AYJA 4FCAA 1KS5A 2QUOA 2XVLA 3VV1A 3NV3A 4Q27A 5L19A 1LGCA 1U5YA 3WCSA 3TOJA 2RMU2 1QH7A 4IEWA 4RR3B 5BYNA 1KRIA 2IXJA 5E89A 3IPVA 5AVPA 2X5IA 3ES4A 3KT1A 2V3BB 1DQ0A 2PQQA 4Q0PA 1K5MC 2CY6A 3WG1A 1FATA 4N53C 3TWIA 2FZ1A 1TQ5A 2PHUA 3NW4A 5GAEc 4BA6A 3LNLA 4W6WA 3OYWA 3O0XA 4CDWB 1QOTA 5K7PA 4WM8B 4K1YA 2NP0A 4AVSA 5AN9H 1T6GC 3ZX7A 4ORFA 5JVG1 1QJX3 4AG4A 2VW1A 3PTYA 4FPFA 5E88A 1H8TB 4JGZA 4LUMA 3JQXA 3KYVA 3USSA 4AXOA 1OLRA 4AI3A 1O7FA 3PJYA 2HWE3 1XNCA 2ERSA 3ZIXA 1RYQA 4DPNA 1CESA 3JQWA 4LE4A 4R4XA 5EV7A 4LBKA 4CRQA 4KG0A 3KS7A 3WW1A 5J96B 2WIIB 3EXUA 2UWCA 1TME1 3ZVXA 4Y1XA 5FO8B 1VBA1 3BOWA 4ME3A 3FMGA 3MLKA 1IROA 1V6KA 1EAH1 2JXAA 1SFYA 4PJYA 5IUQA 2Q8OA 5LK7B 1FXZA 5ABJB 3MSUA 2HWE2 2DCJA 1T9OA 5FFOC 2IXIA 1HIXA 4GH4C 3WINE 1H2KA 4AEKA 1RUOA 1VBD1 2YV8A 2NMNA 4ZN3B 3MW2A 1NLRA 4MGYE 3AB0A 1NY71 4RR3A 1DFQA 2MHFA 2CYFA 2ZGTA 3RMXA 5K0UB 4QPGC 2GNBA 4WVVA 2A68D 2WQ4A 4Y1VA 4KNCA 1QYBA 3ZSMA 3AFKA 3BOPA 4UW5A 2OZJA 4YNIA 4CDWA 5T5OA 1RHI3 1WA4A 5JZGC 4WM8A 4B7EA 1RUI1 4W6XA 2XJVA 1CPMA 2CV6A 2ZACA 4COYA 2EXHA 1B35C 1F31A 1H8TA 1OMIA 1B09A 3ATGA 2QL0A 1DF0A 5CFDB 2PHFA 3QH7A 4AVBA 1OLQA 2XL7A 4WZCA 4B8CD 1BRFA 3AMQA 1RUC2 4K1ZA 4YVSB 2D6PA 2HWF2 3RYKA 3PHMA 2NYDA 1Q8QA 1WW6A 2PHLA 1XU1A 2CWSA 5GJ6A 3J8F1 5ABJA 3W59A 4H7LA 3KGZA 4I2OA 3K48A 4EN7B 3B5LB 2CTVA 3PVNA 1FYUA 3VZKA 3E97A 2CKAA 1IPKA 1HRV1 5BNOC 1J3RA 1RC6A 1YHFA 5K8SA 5JIUA 5K0UA 4PF5A 4Q4W2 2XPJA 4PBOA 2AH2A 3N7KA 3U4XA 1MS3A 4I0AA 4LBQB 1AXYA 4W6YA 1U5XA 1H9WA 3BPZA 4JGYC 3CJIC 1B71A 1YYNA 1Q8SA 4FOQA 3GHMA 1HXS2 1CONA 3O0VA 5FAXA 3MDPA 1LESA 3H0OA 1EV13 3ZO0B 4YGEA 3GHNA 5CFDA 1S1AA 4XXAA 5DZGA 1U5ZA 4GWNA 1Y9QA 1CR7A 1FPN1 5GZGA 5MFZA 1BCXA 2PN5A 2D6NA 2VQ0A 3M3QA 4YG6A 1IHMA 2N7GA 4YVSA 3ZXDA 4C0HA 3WXPA 3JBG2 1HX6A 2B5ID 4XEZA 1PO11 4JRAA 1ENQA 3B9IA 1VBE2 5FOBB 1Z92B 4B8EA 2AGSA 5JZGB 1S0FA 3QCWA 4LHLA 4YW1A 2R16A 3EO6A 3PIP1 2NZ9A 3M3OA 3WW2A 4BMEA 2VNRA 1UU5A 3AM2A 1RUH1 4MX3A 4P9LA 2PTMA 1E8JA 5CAZA 4LNVA 2F6BA 3PVBB 2OUJA 3FLTA 3E5UA 4Q4W1 4FAHA 5AFEA 4XFIA 1AYM1 4LULA 1R0IA 2BNOA 4TYSA 4H14A 5JSPA 1CQ9A 1RDVA 1SLCA 2EVXA 1BZWA 1H1AA 1BK1A 4BQ1A 5KXCA 4LBQA 5KC6A 4LBOA 1HXS1 4PLOA 5EXOA 3CL1A 3POWA 4ATEA 3JZVA 2IFRA 4ASLA 4HVOA 1H1IA 1LOCA 3MLLA 1G6NA 1ZRPA 1ZRDA 1YNAA 2HEVF 2LM3A 3CEWA 4ITCA 4GXLA 3ETQA 1RUG3 3ZXJA 3RYGA 1AL21 5LRSA 1O3TA 3GYDA 2ZS6B 5EZWA 4A7KA 3JBG1 1O5UA 4S2HA 4AYUA 4IERA 1V9U3 4NVPA 2OUHA 2RS52 2RDVA 1R091 5T5PA 2RS12 1IRNA 1LODA 4SLIA 1EY2A 4JGYB 5FREA 1IU6A 5JZGA 2XHKA 1IGOA 2E51A 4Q0QA 4I01A 4N9IA 1C4RA 4HK9A 1H9PA 3B69A 1BFYA 5FQ0B 4XHXA 1ZBA2 4YW2A 4E4SA 3WHTA 4Z82A 3MPPG 1MVEA 2DVBA 1TMF1 4CEWB 3WDXA 2XKOA 1BQ9A 1H7VA 3WHUA 2K0GA 5JPNB 4XBQA 1I1EA 2PFWA 4DINB 3N35A 2W08A 1Q5OA 2XLAA 5IK7A 1N3QA 4NR1A 2ZMKA 1UCXA 2R041 1O4YA 2PHRA 3M3IA 4C1XA 3BB6A 2M6OA 3D5OA 4LA2A 2TUNA 3RNSA 1G9DA 1UMZA 2BTVC 2G9GA 3AJYA 1UU4A 3B0AB 1FV3A 4GB32 3ZN6B 1KFXL 5H9RA 2WFF1 3ASIA 1S2ZA 3HWJA 4L92A 1BMV1 4GMP0 3P8BA 2WNEA 3AYDA 3VHPA 4QQ2A 1PGSA 1JUHA 2AZ5A 1S24A 1ZM1A 4FVVA 3OD0A 1GQGA 4R9BA 4JGYA 2NQYA 4O9EA 2V5YA 2E7TA 1PIV3 3R6SA 4V1PA 4AR4A 3O14A 5BNPB 5FLHA 3D6EA 1PK6B 5AC91 3ENRA 1NG0A 3WOGA 5E16A 1S0IA 3GBGA 5FQ0A 1OQ1A 4Q2FA 4D69A 1MS5A 2I2SA 1PGW1 1G9FA 4IEZA 5FLJA 5C8CB 4YGCA 4CDQC 4CEWA 4RS5B 4WV8A 1NE6A 3N3HA 3PLQA 4AR3A 1YJLA 1ULFA 4JC1A 1UKRA 2EXIA 3S30A 1TNFA 3JD71 1UL9A 3B7MA 1DIWA 4F8AA 1VBB2 1VZGA 4RD7A 2HYKA 1VB2A 5I8YA 2D6MA 5GLTA 1JW6A 4N90A 4CDXB 3IU3I 4NO4A 4HLTA 3R4UA 2CNAA 3QBQA 2ZAAA 4EV0A 3ZN6A 3PIO1 3ZN5A 5C4WC 3MICA 5GLUA 4AR6A 1QHDA 2A6ZA 4JVAA 3HR9A 1WGPA 1VZIA 2VNGA 3ZSJA 4OFGA 1IS6A 4H3WA 4WVZA 1HRI3 1C1LA 5GZCA 2IWGB 4KWJA 2IXLA 4RHV3 1DYKA 5T5LA 4DMIA 1WLCA 3UJOA 5BNPA 4TZDA 4XFBA 1JYCA 2JX9A 1PK6A 2VPVA 5KC5A 1AR72 1MEC2 4FTEA 1RUE3 1UKGA 1OFSA 2P2KA 1AL0G 4YW3A 3QH6A 2R0HA 4INDA 2WJSA 3B01A 4C91A 5C8CA 3ZXAC 4RS5A 4LBQD 3NV4A 1OOPB 1PGL1 2HKXA 1OQDA 1VBB1 4NPRA 3WP4A 3VBFC 1J1LA 2D6OX 2DUQA 3ZYJB 2ETEA 4LBJA 2HWD3 1LHNA 2E63A 1PVC1 1AUYA 1HQLA 5F6LB 2DCKA 1OA4A 3SCHA 5KHGA 1WCKA 1RVF1 2X53S 4CDXA 1ZZBA 1QJY3 4RQPB 2GC1A 3P3PA 4FBFA 4N43C 2B45X 4I3GA 5EWSA 1DBNA 3VBRB 2QQPA 2BWCA 2R063 3FLPA 1E57A 1I6XA 1SMVA 4LO8A 1H4HA 2RS33 4E2GA 4BHPA 1TEIA 4Q4Y3 2WA4A 4L2NA 4E2QA 2YGLA 5DUXA 1CGPA 3CJXA 1RMU3 1QDCA 2JI1A 2R062 1AR71 1EPWA 1CIWA 4GKYA 3ZFEB 5DZEA 1BBT2 2JE9A 1YI7A 3WLUA 4WVWA 2RS32 2VVFA 4I0WB 3OCPA 2Z3RB 4S2FA 4X6RB 1C8M2 1DZRA 2UWBA 3DV8A 1QH6A 4KWLA