2XJPA

X-ray structure of the n-terminal domain of the flocculin flo5 from saccharomyces cerevisiae in complex with calcium and mannose
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
258
structure length
258
Chain Sequence
GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Flocculin-Mediated Social Behavior in Yeast
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell adhesion
molecule keywords FLOCCULATION PROTEIN FLO5
total genus 54
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2010-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2xjpA02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2xjpA01
2XJVA 4GQ7A 4AHYA 4AI3A 4AI1A 4AI2A 4COYA 2XJTA 4AI0A 4CP0A 4CP2A 2XJRA 4AHZA 4D3WA 4AHWA 2XJPA 4LHLA 4AFCA 4AFBA 4LHKA 5A3MA 2XJQA 4COWA 4CP1A 4A3XA 4ASLA 4COUA 2XJUA 4AFAA 2XJSA 4COZA 4COVA 4LHNA 4AHXA 5A3LA 4AF9A
chains in the Genus database with same CATH superfamily
2Y64A 1R0GA 1R093 3RSJA 1V0AA 4LO6B 5E8AA 1XNDA 2HWC1 4GKYA 2CU5A 3ES1A 4FPEA 2X5IB 2B46X 1AL22 3C3VA 4XZPA 3VZOA 3T1LA 3ZIWA 5AN9H 2PQSA 3R6SA 3ZG6A 2Y6KA 4HVRA 3RG0A 3DKQA 5A6XA 1VBC3 1E8JA 2W39A 4CCNA 5FZ6A 4B1LA 4E4SA 2VL6A 2RJ2A 1X8EA 2FMDA 3GTOL 1IS4A 4PBOA 5IHRA 1TMF3 5A3PA 1Q43A 1VMHA 5EJZB 5GZDA 4P9JA 4C90A 4Q0UA 4V1PA 5BNPC 4C91A 3IBMA 3S6PA 2YROA 3O5SA 4IXLA 3C7EA 2BFUS 1UZVA 1RUNA 1ZVFA 4LLOA 2ARBA 2C6SA 1X36A 4Y52L 4KWLA 4YFWA 2YGMA 2WBKA 1R0HA 1EAH3 1H4HA 1AJKA 5CADA 1ZBE2 1Y9QA 2RS51 2GMEA 1MZ6A 5ACA3 2FHRA 5DAPA 3M4OL 5JLVA 3VUOA 2Y34A 4XEZA 2W92A 2M6OA 5LCWL 4BIFA 1AX2A 3RI8A 1LODA 5IYCL 4A2UA 4QPIA 1PM7A 1ENQA 4CE8A 2ZEXA 1TG7A 3RRDA 1F35A 5DABA 3SHRA 1SLLA 3S1RL 4QB1A 3GZTB 3PUIA 2D6KA 2E26A 5FAXA 1RUG3 4QPWA 4X8NA 1VRH3 1LGNA 3MO4A 1C8M1 1TE1B 2OVUA 2WT2A 3ZXKA 4CCDA 4CVUA 5GLWA 1QQP1 2R0FA 2VZQA 1PIV2 3H0GL 5IY0A 3OY8A 1W8UA 4META 3IDEA 3T4VA 5FOJB 5JMOA 3RZDL 2P2KA 1BVVA 4TXWA 1VBE2 1DGWX 1YHFA 3W9AA 2JEMA 2ADDA 5GLUA 1MQTA 4X8PA 5K7PA 3N4MA 5L9RA 2RR11 5F3EA 3H50A 4NHXA 1RVF1 4JCKA 1GUIA 1S30A 3KT7A 1S0BA 3LEIA 4AGGA 3VD9A 4NOTA 1ODHA 1AX0A 1X50A 2GN3A 3U78A 1UF2C 5HCHA 1JHJA 4BA6A 5BNOB 3TOJA 1RITA 1CZTA 5A7WA 3FFZA 5I8TA 3S14L 5C3EL 1QXJA 3MFAA 5JAXA 1WWYA 3I4IA 1SACA 3W58A 2Q8CA 1XNBA 2NMOA 3J4UH 4YPJA 1OKQA 4AQSA 2NVYL 2LCQA 4CXWA 5JPNB 1JZ5A 4LNVA 4L2NA 3EXUA 2ZGUA 1ULFA 1XE0A 4OHXA 1NNQA 1R081 1UMIA 4IEVA 2A7AA 2XQRA 3O12A 2Z42A 3AMQA 3B3QE 3Q8FA 5A7WB 2P6CA 1UIJA 2YPJA 2ZGNA 5MGNA 2ZXQA 4CYDA 4Y26A 2VCCA 2GMMA 1IG0A 1M4WA 1NX9A 2WAQP 2FCTA 2X8KA 2OYZA 1AR63 2A1XA 1IG3A 5FYZA 3CJIB 5DDJ1 1XU2A 3WDYA 3JQWA 2HWF1 5KHIA 2GALA 4IE0A 4XVHA 2YBSA 2R16A 2Y6HA 2QQVA 2OPKA 2WNUC 4NHLA 4I09A 3HOUL 4QU1A 3CLPA 3ZFEB 1WMEA 1G9FA 5A3TA 3O0WA 1PK6C 1VMJA 3T0BA 2Z4FA 1YUDA 2DTYA 3KCCA 5DAQA 2VQAA 1R64A 4JDNA 1TWFL 4EN7B 1AR62 2V5YA 1COV1 2RR12 2GC3A 4GB32 1HQNA 1O8SA 3IN9A 4OCTA 1H1MA 1O4ZA 2Y6GA 3TEYA 1R1ZA 1WBFA 3WNPA 2YY1A 2YC0A 3KGLA 3LIGA 4J1WA 2IWGB 4A3ML 2XUMA 2DU0A 3AKPA 2YYOA 3H9AA 3ILRA 3OPWA 4YZ3A 3AYDA 4P9GA 1SCRA 4CP1A 1C8M2 2TNFA 4XQ4A 4TVMA 3RYKA 5FP4A 1YQ5A 1KS4A 4ISRA 1CZSA 1VBB1 3VKMA 3VDAA 3ES4A 4AQTA 4PQQA 4A3JL 4B3NA 4ET7A 1H8TA 3WF1A 4YG6A 1RJ7A 2ERSA 5GAHc 1DYPA 2GU9A 2Q5TA 3POBA 4WVWA 3WG3A 5JOXA 3MLJA 2FD8A 2FZ2A 4JC1A 3M70A 5FMOS 1VP6A 4E27A 2JG9A 4IUGA 1HB1A 4CU8A 1S0FA 2AUSB 2AEYA 3LDRA 5JWPA 4UI9L 4N43B 1WBLA 5FPAA 4OFGA 3QACA 5F3GA 3U14A 4H7LA 2VVEA 4OZXA 1IRNA 2XVLA 4KBZA 2Z5WA 5F32A 5EJ3A 3UESA 2XOMA 2ARCA 4NPMA 5FPZA 2EAKA 4GXLA 4LLFA 3VL9A 1GKBA 1W9SA 1GZ9A 3ETPA 4YM0A 1JMUB 1PIV1 1VZGA 1OA3A 4MH0E 1APNA 3KQ4B 4QKNA 5AFBA 4CU7A 3MW4A 1V6LA 4N9IA 3LAGA 4TSVA 4GZ9A 1YQ8A 4LBQD 2Y6FA 4EWEA 1BBT1 3PU8A 5IATA 3ZXJA 1W6NB 4GS7D 3WHTA 1V6IA 2WYSA 1Q5OA 2ZGRA 3WEZA 5BV6A 3PWFA 2IXLA 4XBLA 5JCTA 3NNLA 2WZPP 5HV4A 1MZFA 3MSUA 2JD4A 2K2DA 4FOYA 4W8JA 3VBSC 4Y33A 2GMGA 1R1A3 4Y24A 5JUVA 1XU1A 1Y43B 5A33A 2FCVA 3ZSKA 2B39A 5IFTA 3GTJL 1KITA 3PO2L 4KWJA 2R32A 1DGRA 4Q0QA 3D3AA 5HV0A 2HBTA 2GNMA 2JD9A 2OPWA 3GZAA 4GJYA 1ZM1A 1W3VA 1R091 2A6VA 3RYPA 1JYIA 1G9DA 3MIHA 1RUE3 4V196 3INAA 5C3RA 1UIKA 3WP6A 3AJZA 2X29A 3VBHB 4QKDA 2OS2A 1LU1A 2VMFA 1MEC2 4LO8A 4A6SA 1V9U1 1W2OA 3SH5A 1GQGA 3A22A 3WP4A 3E5XA 5K8SA 1TMF2 5D2AA 3NAPB 1AR91 1QNYA 5BNQA 2VVDA 4UFHA 3S5AA 4YLZA 1TQ5A 1MS1A 3F95A 2A6WA 3VPBE 5CFCA 5F5CA 4ARYA 1W2NA 4JKKA 1SBFA 3VKOA 1HRI3 2AZ5A 3WNLA 1PK6A 1N1YA 2ILMA 4XAEA 1CJDA 1JU4A 3BUCA 2VMHA 4W4ZA 1AUYA 1NE4A 4E6YA 1V6OA 2DWRA 2Y60A 4FT8A 2GH2A 2DSXA 1FI2A 4XHXA 3TN93 5CBLA 5JSOA 4XILA 1LNSA 3ZSMA 3ZXDA 2ZGTA 1GBGA 3RDIA 3ZDVA 4ZU5A 2D5HA 2AEZA 3H1MA 1PFWA 3CL1A 4YW5A 5DUVA 4YG0A 3K48A 4XDPA 1MR5A 4CDWC 4QKBA 3MZHA 1W0PA 2Q1MA 1X82A 1VLNA 3DYMA 4EV0A 1H2KA 1I1EA 4W50A 5DUXA 3S1QL 1ULDA 5C3QA 2VH9A 1YWKA 4P02B 2QQIA 5C70A 1FMD3 5DAWA 3IAPA 3UGFA 1I5PA 1WW7A 4XFAA 3OPTA 2WRAA 1IQAA 2A75A 2K9ZA 2XVGA 2WZ8A 4X6RB 3W59A 4QDRA 3QD6A 4TLFA 2R1BA 2W3JA 1FPN3 2RM22 2BVBA 2R062 1RDVA 5FZAA 4AVCA 4M0HA 5EJ1B 4NE9A 1VBA3 2CY6A 1YIPA 3B01A 3N35A 2ZMNA 3O7OA 5IW0A 1Q8PA 1E5HA 5JI9A 2W1QA 5FYYA 1V9U2 4ZS2A 1NA1A 3I3MA 3KM5A 5H9SA 3HJRA 3NVCA 4K9SA 4RD7A 4UAPA 5I0DA 3PUSA 2IXKA 3ABZA 2P37A 3DCQA 2PMZP 5FZ0A 4Z92B 1JYBA 3FX3A 4Q4W2 1REEA 3HBKA 3KT4A 1MS0A 2ZBJA 4G6BA 3DECA 4QAWA 2VCMA 4S2GA 2NM1A 5JXIA 4DUWA 4XHBA 3RYRA 2X09A 4NJ4A 1TWCL 3UKTA 4XBQA 1UNBA 3CIHA 2VNOA 1VBC1 1I50L 1W6OB 4RHV2 4LBQB 2WAOA 3S17L 1IOAA 1VJ2A 2ZHKA 5JSRA 1D4M1 3ORJA 4EQVA 1TMF1 2CGNA 3H8OA 2PSMC 4ES9A 3LWOB 3KYUA 2G1MA 2P3IA 3U0ZA 3OY8B 5GM0A 4QQOA 4EN0A 1QNWA 2QZ2A 1HJGA 3RZOL 3MV01 1FOD3 1Y4WA 3GZUC 3B9CA 3OBAA 4N43A 3VKFC 3BI3A 2VL4A 5EXOA 4D3WA 1NUKA 2ZX3A 2CR8A 2ZOEB 3AMMA 3K2OA 1BYHA 2UY8A 3W20A 3L9JT 5AI3A 2WB1P 1RVF2 1ASJ3 3BYWA 1RUD3 3VBOA 4Z2WA 1CVNA 1OQDA 2H0VA 5F9TA 1EYBA 1SMUA 4UXAA 4XGHA 5IVVA 1FT9A 3VBFB 4QHOA 2BQPA 3FLPA 1PFVA 1PM4A 1IS3A 3R4SA 3N9QA 1WKYA 1VB4A 2KKDA 3H1WA 3T0AA 3KV5A 3VGIA 4AYBP 2P3JA 4RHV3 2VOVA 5FY4A 4FOVA 1F5FA 1MEC3 2RMU2 1X33A 2BP6A 5L7OC 5IYBL 4JZRA 3H99A 3RZLA 4XUNA 3R05A 1NZCA 2W46A 5C4JL 4QX0A 5TSWA 3GBFA 5BNNC 2A6ZA 4HSJA 2HKXA 3MF6A 2GP3A 5CFDA 3ZFGC 4YZ5A 5C33A 3BTXA 1RB8G 2OQ7A 2JIJA 1CAWB 4ME3A 4C3IL 2UY9A 3EJKA 4ZZ8A 1QKQA 1G9CA 5JVH1 2PHWA 1LOEA 4LO7A 1LHUA 2PPTA 1WMDA 1VBD1 4DQAA 1B09A 5FXZA 3HBZA 1PMJX 2WWJA 1WCQA 2LRPA 4A3DL 2YPDA 3MEPA 2VVFA 4YWLA 2VTFA 4RQPC 2HLEA 4WVVA 3IDBB 4E8CA 5AVAA 3ZFFB 1QMJA 3ZKYA 3OBRA 1POQA 1KGYA 2JE8A 3F2ZA 4BK4A 3FFQA 2CKAA 2R49A 4QDQA 1H2MA 1EUTA 1YYNA 1S24A 4UW4A 5LK5A 4YYOA 4G3YC 3P5BA 5A7NA 4HPKA 4JDMA 4CDXB 5B2GB 1H30A 2WJSA 3ILFA 3PURA 1SDWA 1H9WA 3ZDSA 2ZKLA 4LBOA 4A3BL 4AVTA 3HIFA 4COUA 1ALYA 3FHQA 4QB6A 3T2OA 2W1UA 1N1VA 1OFSA 2VQUA 4XFFA 5A7OA 1Y1VL 4QM9A 4QXKA 2ID4A 2K2SA 2IXCA 5FZGA 5B4NA 3ZFFA 2PFWA 4FFHA 1AYN1 2PHTA 2AYJA 1J83A 2ZEYA 3GJBA 4FCAA 4Y5TA 1AR61 2VUJA 4ORFA 2VD7A 4CDQB 3AKSA 4HVQA 3ZVXA 4POGA 4FO9A 5J1XA 5IVCA 1IPSA 2K0GA 2M4VA 4TYSA 5LA9A 1HRI2 3AC0A 4YVSA 4V2VA 3VZNA 1PVC2 3O1TA 4FTBA 1WW4A 4D7YA 1FX5A 2VUCA 5M5YL 5DUUA 1UKGA 2AH2A 4AEJA 3MBWA 3GNEA 1QOOA 2PLV3 1LKPA 2G19A 2WINB 2F6BA 5FWEA 5JOYA 2RJLA 5A3UA 5KHGA 1RUG2 3KV9A 1CAXB 1NLQA 2DVDA 3GJAA 5E1RA 1Q3EA 1QF3A 2VCBA 4S2HA 1RUE2 2Y0SP 4RQPB 1B35B 3RZ6A 2VOKA 4MGIE 4BYYA 3P1IA 1PZXA 1V9U3 2WAAA 4CP9B 3WWNB 5FJHA 1PO21 4F3JA 3E5UA 5JOZA 5FZOA 1LEDA 4CCCA 3LPGA 3ZYPA 4OZOA 5LB6A 2JICA 4QU2A 1TME3 5B4XA 5FP7A 1LENA 4I02A 5IWFA 4AHZA 1H0BA 4C8DA 4CXXA 4Z2AA 1RUJ2 1JZ4A 1RIRA 2WQ8A 4BBRL 4EN6B 3GF6A 4LEJA 1Y7BA 5FY9A 4AOCA 3K75B 2EIBA 4A4AA 1OA4A 2V4VA 2PLV2 3AXEA 2BBAA 3NV1A 4MADA 5A32B 1JYTA 2VZSA 5DAVA 4JQTA 4Z82A 5BYNA 2B9VA 2RMU3 2CHHA 2CSGA 5D8AB 3KS7A 4LA2A 3PZAA 1LHOA 2DCTA 4XUQA 4I0BA 3GHMA 4DB5A 1K42A 4Y1XA 4B29A 1S0DA 5DZFA 1CZVA 3C7OA 1PZ8A 5C3PA 2XJTA 5A7QA 2A6HD 4N53C 4IE4A 4LPLA 4PIXA 4OQ9A 2BGPA 2BBVA 2PHDA 3WY6A 3H3ZA 4DZGA 3BN6A 3VL8A 1CD3G 1PGL1 2VW2A 3M2MA 1V6NA 1ZRIA 2JDKA 5G04L 2BGCA 2Y26A 3CNAA 3WR0A 5CA6A 4BWOA 4UY81 2R042 4QQHA 4AFAA 5L9VA 3PL5A 5CKNA 4LKEA 2J1TA 3G6JB 1VMFA 1ND3A 2R6QA 1WZXA 2Z69A 2WNVB 3ZR6A 4CDUA 5I0TA 1C28A 2GC1A 1ND2B 2FDKA 4UFKA 3SCGA 5DPNA 1O3TA 4Y1YA 1PZ9A 3LA3A 4AAPA 4HSLA 3NKGA 1F5JA 2W68A 4B7EA 5C7GA 3LD8A 2C9AA 1XC6A 3K4AA 1X8MA 3O1RA 4CP2A 1O4YA 2XJRA 1AZDA 4GALA 4K7JA 2LTNA 5J48A 4NRQA 3BU0A 3GTML 1VZIA 1T9PA 1ZZBA 1CAVB 1NAEA 2WZR2 3OPZA 1ZRFA 3CO2A 2OIIA 4H7MA 2PHRA 2JDNA 4RGAA 2M6PA 2QQJA 3ZFGB 4KWKA 3MV11 5ABJB 2XKPA 3EQEA 2YBPA 1W6MB 4EN8B 5ISLA 3A7QA 2X5IC 3SH4A 2WFF1 3M3YL 3I7DA 3JBG3 5D21A 1IKQA 1KJLA 4IV3A 3WNOA 2EXIA 1GNYA 1U5ZA 5F1RA 2N7GA 1GWLA 4I3GA 2Q4SA 4GJZA 4MGYE 1BZWA 3FHAA 2K46A 1R0IA 2V3BB 3I49A 2O5JD 4CZSA 4O9EA 4XUPA 3MFCA 4XJUA 1LOGA 1YNAA 3M8LA 1LR5A 4M01A 3HKZP 2ZMKA 3USSA 1S0EA 1B35A 3HN3A 3WP3A 4CPBD 4P9YA 3T09A 2R071 2AENA 1RUG1 1US3A 2WFF3 3NJVA 5C3OA 3SC7X 2MHFA 1VZHA 1SFOL 1TWHL 4XTMA 3ITQA 1X9PA 3W5NA 4LUMA 1R0JA 3UV9A 4MOAA 3ZM8A 5IP9L 4ZKTB 3OOXA 4RHV1 5FY1A 3TWIA 1BMV2 1RUF2 3JU9A 4I0WB 4ZU4A 1LB2A 1LHNA 2VMIA 3AP9A 4HKOA 2YC4A 4JTOA 4KQ7A 5FZMA 2HWD2 3AP7A 4HPKB 4UW3A 1XXNA 4D6QA 2VZ3A 4JHTA 1NXMA 2DUOA 5IVEA 1WLWA 3LWPB 3LWRB 5GZGA 5IAXA 3WZ1A 3NFPI 4K8RB 5IAVA 3EHKA 1JYNA 3M3OA 4WM7C 4P9IA 3KYYA 1ZRDA 1RGSA 2MEV3 4NIGA 3PO3L 1VBD3 2EY4E 2ZX4A 3M3IA 3N7MA 5IK5A 4NWWA 1CR7A 5FZCA 3FMGA 2WFPA 4HN1A 4HT1T 4DS0A 1W6NA 1QQP3 1PFUA 3DEMA 2P4EA 1BHGA 5IP7L 2D3RA 2NQYA 2VZRA 5HCFA 1OI6A 3AYAA 3BPSA 1BQ8A 4AR4A 1R083 2MEV1 4Q4W3 1YV1A 2NVQL 1OQ1A 3OEAA 4HZFA 1XJAA 2JJ6A 4AL9A 4EROA 5LEJA 2VUDA 3H9BA 4N9HA 4L8QA 2NLRA 4ASKA 4YSFA 3K51A 4ZN3B 4MX3A 4Z8BA 5FWJA 4A3ZA 2FDIA 1LKNA 3KGZA 3RZKA 5E88A 2AUYA 4GQ7A 1W8OA 4BY7L 3I59A 4Y4RA 2QJVA 1EV11 1HB3A 1LOCA 1WCUA 3WQ0A 5BNOC 1W2TA 4I0AA 4P9WA 2R041 4KGGA 1ZA4A 3SXWA 2NP0A 4IV1B 2HJIA 3OUJA 4DFSA 3VBRA 3PIP1 1MS9A 2JI2A 4NAOA 5AI2A 3TEXA 4E4DX 1OLMA 2EIEA 5KHKA 1RINA 1VBD2 4FXKB 4Q4Y1 5FZ3A 5FYMA 3MPSA 8RXNA 4FOWA 4COWA 3DV8A 5GZCA 2ZTNA 2R1DA 3KB5A 4CCKA 2JE9A 5BPXA 2C6BA 5L9BA 2ZGKA 4N53B 4A3GL 4DIQA 1OOPC 3D82A 1AR83 2ZGMA 4XC9A 1BFYA 2R30A 2ZZJA 4BQYA 2ZGLA 4D0QA 2YV8A 3WUCA 2W52A 3ZYFA 5F8PA 3VBFA 2E2IL 5MFZA 5I8YA 2RDRA 3GTGL 1RUF3 4KG0A 1S2KA 1VPHA 1N3PA 3AYEA 5FQ0A 4Q0PA 4IV3B 3B93A 5C8WA 2G4IA 2XLFA 1C5IA 3WINE 3O1MA 2FDFA 3RVHA 5C4WA 1IW7D 4OVEA 3GBGA 4CDUB 2J9UB 2YBKA 2D44A 1LHWA 2QQKA 4JAEA 2ZAHA 5AC91 1W6OA 1HRV1 3IWZA 1AR82 5RXNA 1L3JA 3BCWA 3K3NA 1OH3A 4LBLA 3S5QA 4ASLA 4K3UA 2D97A 2DCKA 3BVCA 1FNZA 2O8OA 1C4RA 5ANNA 4IEWA 3O1UA 1Y3TA 1J59A 1CESA 4QIWP 5FZ4A 3S2HL 3UKNA 1DLCA 1W03A 3ZN6A 4QX2A 1UY4A 3MIDA 1CAAA 4IEXA 3HD8B 3K4ZA 2ORXA 1DFQA 2WZEA 3JB8A 3N9PA 4IESA 4RFRB 1PHMA 4AHYA 3UGGA 4FFIA 1R9TL 1ZX5A 1F8VA 2XXZA 3OSDA 4OMCA 1ND3B 5F3IA 1OD5A 4HMZA 3J7NA 4QDSA 4AWDA 4EE2A 5GADc 3AX4A 1YQ6A 2LM3A 3ZXFA 1VB2A 5J3UA 1OXCA 4A7ZA 4Q4Y2 5HXMA 2OT7A 1YO8A 2EXHA 3RZTA 2W91A 1NA1B 2EA7A 1CGPA 3GCWA 3TB0A 2KM2A 1C1FA 1PGW1 2WKKA 3ZYJB 2C24A 2XJSA 3WDWA 2CDOA 2QQWA 3A0NA 1QJU3 2YXSA 4TZDA 1OOPB 5GLZA 5CKQA 4NIDA 4RFT0 2NVTL 1YQ2A 1OLRA 1XBFA 2B45X 2C26A 2YGLA 2OKXA 2SLIA 3S1NL 2CNAA 4AI9A 5C9AA 2QKDA 2JG8C 5CZKA 1YXWA 3U75A 3ZYHA 5FO7B 1B13A 2HWE1 1W6QA 4ZN1B 4DUVA 3GDBA 2JB8A 1I5ZA 4Q4X3 1H4GA 2APOB 1VE0A 2YU2A 4JQRA 2E53A 4CUCA 2ADEA 1QJU1 2DF7A 2WYFA 1JUIA 3AP5A 3WG2A 5LZ6A 2YMZA 2BTVC 2XR4A 3N7JA 4FFGA 4DY3A 4CTEA 2OQ6A 2VGDA 3WV6A 4OYUA 2GDFA 1NA1C 1SLAA 2GNDA 2OX0A 1KDKA 1BBT3 1CAXA 4X6AL 1VBC2 2A6YA 4XYXA 2CV6A 4LA3A 2XWBB 3PMEA 1H6XA 4JKMA 5CAZA 2I45A 2QTWB 3HOVL 4NO4A 1LRHA 5FY8A 2EICA 1H1AA 4M3CE 5KWRA 2HWC3 2PHFA 3N7KA 4C0BA 4HONA 2ZACA 2RDVA 1AHSA 4ZZ5A 3SMHA 5A1LA 5IVJA 1HX6A 2RG4A 3VBHA 5GZEA 2H6CA 2W08A 3CU7A 4CXYA 3A23A 4HK9A 3ZMNA 5DG1A 3NO8A 4QGLA 4BPZA 1W8FA 1D0GA 1DU3D 3KCYA 2RJKA 2WSUA 3NL1A 5LBCA 3URFA 3WQ7A 3LWVB 5A6ZA 4JAGA 2AGSA 5FY0A 4XTPA 3JBG2 4RR3C 4AW7A 4PF5A 5L7OB 2QUOA 2Y33A 1YFXA 2W1WA 3ZSEA 2QDRA 1DHKB 1K3IA 4OLLA 3HNBM 1RXFA 2EXJA 3QLQA 4CDXA 4UF0B 1DQ2A 3OB8A 3JD72 4FQZA 1SMMA 4U2AA 3U1XA 4QX8A 4R9BA 1URXA 5DMYA 4QT6A 2EIDA 1OPMA 1JBCA 5BUVA 4WM8A 3WNKA 1C1LA 2P6HA 2WSVA 1PGW2 4A3LL 3I54A 2VQ0A 1HV0A 5FKCA 3AKTA 3MUY1 5A33B 1OC1A 5DAXA 2DVAA 5EHDA 5EYXA 4AFMA 4AYUA 2WO3A 4M4RA 5FY7A 2D93A 3LPFA 4WM8B 4RS5B 4B8CD 4NIAA 3V64A 3KYWA 1OUSA 1ZBE3 4QQLA 1MPXA 1RUD2 3U07A 1V00A 4A7YA 2JA5L 1JI6A 1HJFA 2Z2SB 3P3NA 5H9QA 1GYKA 4UF0A 1MZ5A 4MLOA 1H8TC 2ZGQA 1QIQA 3JQXA 4QPGA 1W8HA 2IVJA 2RM21 2WLQA 5FY5A 1VALA 3MLKA 3THTA 1PMIA 2E9QA 2NZ9A 3KCXA 3MIFA 3K35A 3POJA 4A93L 1K5MB 2E33A 3OCPA 3HQXA 1NCRA 3P6BA 2NPIA 1YK4A 5T5PA 3VBSA 3WHUA 2RDNA 2VZ1A 1J58A 3BOWA 1LOFA 1Z7S1 3PUAA 3I2OA 5FZKA 2PELA 4BMEA 2JXAA 1WLCA 5DZGA 1GP6A 3OGGA 4RN5A 2WS92 4IGPA 1F4AA 1S4CA 5T5LA 3WNMA 1RUH2 1I9RA 3T30A 5HI0A 1YCIA 2XBO2 1W9YA 1T9QA 2FZ1A 4HG6B 3B00A 2RVAA 1QJX3 4QPIC 3HPNA 1OURA 1PO11 2RFKB 1W8TA 4A44A 2V09A 2D3PA 4HBNA 2XG3A 4QXCA 4V2WA 5DZEA 3VHRA 1OHFA 5LA2A 4BZ4A 4QD2A 4GH4C 3J7Y1 1RB9A 4XFHA 4E4ZA 3HOXL 3IIIA 3R4DB 5FYUA 4H55A 2RV9A 5FCCA 5J37A 5FXXA 2D6LX 3PMSA 3HJWB 1EAH1 4WM7B 2G9ZA 3AFKA 5F5QA 2DVFA 4BM8A 4JHZA 1IPJA 2DYCA 3GXUA 1C5HA 3H3LA 4FTEA 2E32A 1REDA 3ROUA 2R0HA 4R9CA 4GAZA 5F2WA 4XE9A 2WO7A 2UU8A 4PF1A 4XOGA 5K0UC 2H0BA 1LECA 1PVC3 4MZUA 3I4NL 4B4PA 3ZN5A 4D6SA 2JG9C 4PDWC 2XJVA 4Y7NL 1RXGA 3SNMA 3WVJA 1TNFA 5FJ8L 1HRV3 3J26N 1NKGA 2BERA 3E5QA 1LJ7A 1PGSA 3MW3A 1O3SA 5BY5A 4LHLA 3VD7A 4NIIA 1YQCA 1SMVA 2YFUA 2BDRA 3H8UA 4XJZA 1L7LA 2RDQA 2YU1A 2WT0A 4XF9A 4YZ4A 1MEC1 3VHNA 1RUH1 2Z79A 3VDCA 4PLMA 1HXS3 3THCA 3KSCA 2W5FA 3IZOA 5EV7A 3AYCA 4IEZA 2HEWF 3UYJA 2ENRA 3U4SA 4PQ9A 3ZYBA 3JCIA 4MGSA 4QB2A 1Z7S2 3QBQA 2C1FA 3BB6A 2JA6L 4IGQA 5CVRA 4JDOA 2BNOA 2VOTA 4K40A 4PIYA 4NHYA 5FPVA 3AM2A 3QH7A 1LOFC 3LEMA 5FJKA 4FQ4A 3NV3A 1Q8QA 5FXVA 2NYDA 1S2ZA 1BRFA 5FMBA 3H7YA 2RS52 5C4WB 2QCSB 4AG4A 1JODA 4NMIA 4A6OA 2BE5D 1PVXA 1QWRA 5FPUA 3OEBA 4WVMA 4M4PA 5A7PA 1JU3A 2LW8A 4YWAA 1G8WA 1MQTB 5G05L 2BYVE 4QPIB 3THDA 3H3VM 4LTAA 2R7ZL 4WV8A 3KWVA 3ZSLA 1T6BX 5L19A 1NXGA 1BK1A 3POEA 2H6BA 3DKWA 1DVBA 4N53A 1QJFA 3M3CA 4GB33 4OHVA 5KBFA 5DDJ3 2VZPA 3RFRA 4AGRA 4LULA 5FXWA 4EYUA 4OI2A 1KRIA 3LNLA 2IVIB 4XURA 1AR81 5FYCA 1O91A 3Q8AA 5LY1A 3TEWA 1Q8OA 3WDUA 1BEV2 3J7LA 1O5UA 3P2AA 4ES8A 4AEKA 4L92A 1IROA 2JDZA 3FN9A 3N9LA 3UL2A 1UWWA 5FLJA 1K5MA 2FCUA 3ELNA 3LB9A 1MVEA 4LK6A 2VR4A 4ZY9A 3PIO1 4UT5A 3B02A 5FZFA 1NQJA 1NCRB 3KVAA 4PCRA 3UT0A 4AZZA 2JI1A 2ES3A 2L9LA 1P7PA 1LEMA 3OGJA 1ZBA2 1U5XA 4M0NA 4ZXEA 4KU7A 4MSVA 4XQWA 4UFMA 1H9PA 2PMWB 4FXGB 5T55A 1UOBA 5DM71 2HWF2 3V56A 4BE3A 2L0ZA 4IERA 4JTNA 2NN8A 2C0ZA 4RS5A 3VBSB 2WQZC 1NG0A 5CISA 3WF0A 4AR3A 2DVGA 4XFIA 4ATFA 2XVKA 4URTA 2GN7A 2PYTA 1IHMA 1LHVA 5T3NA 4C3JL 1RUJ1 4OUEA 1POV1 4XF1A 1AYM1 2GH8A 2GSYA 3AL5A 3QCWA 4KNCA 5FIXA 1KEXA 4NPLA 3TN91 1J3RA 2IC1A 4QPYA 5JOWA 1RYTA 1JUHA 4NVPA 4L11A 1BVP1 3SKJE 1JTZX 3ZFEC 5I91A 3S15L 5DDJ2 5CB7A 2B9UA 4POFA 2VXRA 4NIHA 3ENRA 3FJSA 3RPQA 1BQPA 1FYUA 3ZO0B 4EN9B 1O4TA 3HT2A 4CDWA 2CGOA 1NLSA 3CBNA 4PJYA 2BNMA 3GCXA 3PVNA 3AB0A 4AI1A 4Y22A 1VAKA 1VBA2 4LBNA 4TLGA 4A3IL 2QQPA 1GFF2 2WZR3 4Q5OA 1U12A 3T2PA 3ACHA 3VLBB 4S2FA 1LGBA 5FP9A 1XNTA 4EZHA 4LHKA 4D94A 2O14A 4B1MA 1QJX2 3I2FA 3GHNA 4WZFA 4Q0SA 3E6DA 1Z92B 3ECQA 1Q56A 3I3EA 4KG8A 4Y1UA 4E2SA 2BV4A 2JKBA 3ZLIA 5H9PA 2NMNA 3APBA 3S57A 4CPBA 5JXGA 2D40A 4ZU7A 3DYPA 5FO8B 5DUWA 3U11A 1LULA 1PFYA 1WCKA 4HL0A 3UETA 4AQ2A 1XNKA 4AHXA 3AVSA 5FYTA 4XJ8A 4XJWA 3BTAA 2BW8A 3FWEA 5ABJA 1JOJA 2VNGA 2JDPA 5A1AA 1UZZA 3DN7A 2VW0A 3JBG1 2QBXA 1OT5A 4IEQA 1BJQA 2ZKNA 3TRSB 1DCSA 5LEKA 2DCZA 3RS6A 4AEDB 4A3KL 4WFN1 4PIZA 2XJQA 2FBEA 4Q1RA 4XUOA 3ACLA 3T2QA 4ARXA 3PHMA 2VM9A 4BISA 1T9OA 1T2XA 2VMGA 3I8TA 1LOAA 1SFYA 5FPXA 1GZWA 1JYCA 1W6MA 1RDGA 2R073 1W9WA 2E31A 3IM0A 5I0UA 3WCSA 4D8MA 1B35C 5ACA1 3ZX7A 1J1TA 1RWDA 1BXHA 1CPMA 4R4XA 2Q0AA 4CUAA 2JB4A 3ZFEA 2W9XA 3T1MA 2VMEA 1CAVA 5KHJA 3J9SA 4K20A 2BRTA 3WCRA 4C3HL 3FLRA 4KI5M 5JXHA 1IKPA 1ASJ1 4Q4V1 1RUI3 4YZ1A 2VUML 5FUNA 1ODNA 2I2SA 1H7VA 1AR73 1RYQA 2BJSA 3D8CA 1B71A 5IJRA 3MF9A 5GALA 2UWCA 4BH9A 2AYHA 1AXKA 3LSEA 4W6YA 4KWUA 3PUQA 1W05A 3MI8A 5FYIA 3VBFC 3ZYIB 5FZLA 3KV6A 1A8MA 2ZMLA 2IFWA 2PHUA 5JZGB 5A3OA 1DP0A 1PVC1 5C4WC 1CN1A 2RS33 3ON7A 1EUUA 3BPZA 3P8BA 5J7MA 2V0FA 4RL7A 1TVGA 4COVA 1TWGL 3MQKB 1GMMA 1WCSA 4CCLA 1ZBE1 3LA7A 3T3YA 5GZFA 1JOPA 5GAGc 3L2YA 5GLTA 4XCAA 4YM1A 1K12A 3T08A 4XW3A 5C8CB 2BFUL 2AREA 2GAUA 1QCVA 3N9NA 5FMCA 2PXJA 2V72A 2QQOA 1YJKA 4DRRA 5FZDA 3GTPL 4AAXA 1G9AA 4OMDA 4AE2A 2J1AA 3ZXAC 3WD5A 3KYVA 1ONAA 3IU3I 4GMP1 2BWCA 2JDAA 1Z7S3 4J1XA 3VDDC 2Y0IA 2JENA 5FREA 3ZFFC 1FATA 4YW7A 4AEMA 1SZBA 5F6LB 1W04A 3ZOIA 2D6OX 2BZDA 2J1EA 1UY1A 1XQNA 5JSPA 1VBE1 1DGRN 1WCML 1QU0A 2G9GA 3CHXA 3NV2A 4R52A 2Z3QB 1RVF3 4PBPA 4Y3OA 4GMP3 5ERLA 3VDDA 3OTFA 1D4M3 3NNMA 4P9LA 3JR7A 1QJX1 4B4QA 3HJYB 4Y20A 1H1IA 3RQ0A 2VAUA 2JIGA 3ZKUA 1X9TA 1CWPA 3VBRB 4UFJA 5K9YA 3DGTA 1FOD1 4RXNA 1UAIA 3AZZA 4FPGA 5MLC3 2B42B 3MICA 1VBE3 3AKRA 4IEOA 4CP9A 1HW5A 3C7HA 5FLHA 3V0AB 3I2HA 4FP3A 5DM61 3LQCA 2WFF2 4GB31 4IW3A 3WW3A 3IMNA 5C5TA 4ISQA 2OZ6A 3PJQA 5L7OA 3USUA 1DQ1A 3DL3A 4Y4YA 4IE6A 2QL0A 4K9FA 2WR9A 4LO5B 1NY71 2R061 4QPGB 1XPWA 4MVTA 2KXLA 4Q4Y3 3ETQA 3LE0A 1KJRA 4DRVA 1JYWA 3HAXC 4RGKA 5CYYA 5FMOL 4A45A 1DQ6A 5E6HA 4YVSB 1OLQA 1Z78A 2C4XA 2G9FA 5DN2A 3VKNA 3VV1A 4JAFA 1KS5A 2FMYA 2HWB3 2J42A 3AZXA 5C71A 3H8XA 4FFFA 4MGKE 2WIIB 4CEWC 1OMIA 3CQOA 4IGOA 3MPBA 2R063 3OBZA 4LHSA 1KFUL 3OD4A 2OUHA 4MHUA 3S7IA 5JZGA 1HB2A 3B0AB 1JZ8A 3TNPB 1E5RA 3TEZA 2PAEA 4YZ2A 1FMD2 2X5IA 1O8PA 4COZA 4Q8LA 1ENSA 3A4UA 4YVSC 3SEPA 4ASMB 1TME1 3E1F1 4XZUG 1UOFA 1RJ8A 4P14A 3WWLA 5F39A 4LO4B 2JA7L 2HWC2 4YFZA 1WA6X 1POV3 2DU1A 3AZWA 2YUEA 4E8DA 1AYM3 2EIGA 1VBB3 1UPSA 5KXBA 4E4HA 1C09A 3RI9A 2ZZQA 2D3SA 3NAPC 1BBT2 1UX6A 3FHIB 1JXNA 2JX9A 1HXS2 3I2IA 3UJQA 2ZHLA 4AVSA 4CRQA 4WM8C 2DCYA 2HWE3 4UWDA 5ANQA 2CKCA 4LXLA 4CEYC 3MPPG 3PUHA 4H14A 3CF6E 4S2DA 3K3OA 3WNXA 4JAAA 4MXWA 3SLIA 1QH6A 1GP5A 2RS13 4Y1VA 1BEV1 3IT8A 3A44A 1NCQC 4ZPIA 4YRDA 6RXNA 5HPOA 1GANA 1YFYA 2MNGA 2YB7A 3LCPA 4YWMA 3OGVA 4DEVA 1PMHX 1V6MA 4P00B 2VZUA 2HEYF 1PIV3 4MUVA 3LFMA 3ZXLA 2RS11 1MS3A 4PDWA 4XAAA 3PNAA 3PKJA 3EB7A 1GOFA 4HLTA 2VJXA 2EVXA 3CZJA 3ZYRA 4NR1A 2VZTA 1REFA 1ND2C 1QYBA 3WG4A 2FDGA 1W6PA 3DF0A 1UOGA 3IIAA 1A34A 4E2GA 1RUI2 3OJBA 5M3FL 3AP6A 2F17A 2WNVA 1QGLA 3HT1A 4FPKA 4XPVA 5E16A 1QQP2 2E2HL 1NCRC 3AFGA 3JZVA 3N36A 5A7SA 5A3LA 1QXRA 4YW3A 1C8NA 5FBJA 1EP0A 4FOQA 2PAKA 1W8NA 4YW1A 1FAYA 1AYN2 2OUJA 4UOJA 4QX5A 2VBBA 4YW2A 5T5JA 3GTLL 3VD3A 4K6BA 4QHZA 2XBO3 4NUBA 4Q27A 1ZYBA 1RHI3 5A6YA 1Z0HA 2OA2A 5F7UA 3RZGA 5KR7A 3PKIA 2ET1A 2QFEA 4XXAA 2YFZA 5IVFA 1MS5A 2XHNA 4OQ8A 3O1VA 5A3WA 3D0SA 2TUNA 2V5DA 2UWBA 3HQRA 4YW4A 3HR9A 4CDQC 3WDTA 5MF6A 4JGZB 1OBNA 2YZ4A 3WG1A 4MGTA 3D6EA 1AR93 3OYWB 3Q8EA 1QJY2 3HOZL 3CMGA 2ZGOA 3I97A 3NNGA 3TNQA 1RHI2 1PX4A 1H8VA 1U0AA 4RR3B 3IAQA 4QQ2A 1XE7A 1GLHA 1W39A 4CSWA 4XFBA 1RTVA 5HBAA 1ULEA 4KU8A 1EV12 5SV5A 5FR3A 1YFUA 4M00A 1UZWA 3DYOA 5SV8A 4EZ4A 2CGPA 5FPBA 2ORZA 5JPMB 2QQLA 5CFCC 3DXUA 1OF4A 4QPGC 1I6HL 3WW2A 5FZOB 3VD4A 1RC6A 2VBDA 5EPAA 1ZZ9A 3VBRC 5AFEA 2C5DA 4TTGA 1ODMA 2PN5A 4C2M1 2DUQA 2HWB2 2PA7A 1GZWB 4FPYA 5I0SA 3BU7A 4DUXA 2PVEA 3M3EA 3OD0A 3POSA 5CG9A 3OUIA 3ILNA 4QM8A 1SG3A 2E7AA 1F9KA 4GIQA 1R082 2FDJA 4PDWB 4QHBA 3SCHA 1SLTA 1WA4A 4CEWA 4OI4A 1B2OA 3CZUA 2IZWA 4OULA 2WNVC 2PHXA 2RR13 5GJ6A 1VCXA 2CYFA 2LUWA 1IGOA 1DYOA 5DQ0A 3VDBA 3S30A 2KN9A 2IXIA 4FAHA 1P8JA 3HQUA 3B69A 3K4DA 5BXXA 2DCJA 1IQDC 2MS3A 2XLAA 3EYPA 1ZRCA 5F5AA 3QQCE 5JXJA 3PJYA 1O7FA 3DPRB 1UQXA 4BK5A 4GWJA 4AR6A 4M3CA 1UY3A 5FZ9A 3A0KA 3LWCA 1CPNA 1GP4A 1MVQA 4N90A 1XRUA 4PT6A 1GICA 2D98A 1DLLA 1E57A 1BE7A 5CKMA 4GH4A 2Y38A 4YGCA 3VZJA 4K1YA 1PZ7A 4BCUA 4RYDA 1N1SA 4O7XA 5DG2A 4XETA 4CDQA 3WNNA 3BTZA 4JV4A 2BWAA 1UCXA 3NAPA 1EPZA 2TBVA 1ZRPA 3LOBA 3DUIA 3NV4A 5EYYA 3H7JA 4Y22B 3GTKL 5T50A 4PLNA 1RMU1 4CEYA 5IYDL 2CTVA 1UW8A 1UX7A 1SQ4A 3FUQA 1YRZA 3IKWA 3N9OA 5A3NA 1ND3C 1RUI1 2VE1A 2HWF3 3POYA 1GU3A 3POWA 2VMCA 4ZONA 4XIOA 1D4M2 2JDUA 2XWJB 2ZX0A 3RNSA 3PL0A 4F8AA 1QJY1 1SCSA 1WGPA 2OZJA 5FBZA 1W9TA 1UZ0A 1IPKA 2VC9A 1W99A 1ZBA3 3O0XA 3VN4A 2P1BA 2XDVA 1LOBA 3LEKA 1RMU3 3WX5A 3ZPOA 1CIWA 4PI2A 4OUMA 1SBEA 4KMQA 4XF4A 2J1UA 2RS31 4FP2A 3AMNA 3ATGA 5T5OA 2DDUA 2UYBA 3T0DA 2HWB1 5KC5A 3M7AA 4QX7A 4HK8A 1IS5A 1RL3A 2QQUA 3KD4A 3T2TA 4DPNA 3NMBA 1D2QA 1C8M3 3WW4A 3AVRA 2WNOA 3VKLA 1QJU2 4LBMA 4QQPA 1XYOA 5T52A 1SDDB 4YGEA 3O1OA 1XNAA 2JG9B 5FOBB 1NXD1 1WCDJ 2XJUA 5FYSA 5FZHA 4EWAA 2A6XA 5M5WL 4WM7A 1QH7A 3QOPA 4SLIA 1LCLA 2ZABA 1H8TB 1JZ3A 1UPIA 4LIVA 2QVSB 2YU9L 1J3PA 3D5OA 1LKMA 1YK5A 1MACA 1OKOA 4XBNA 1TNRA 3CEWA 1CAWA 5EWSA 4Y5SA 2XL7A 2UYAA 3MIBA 5L36A 2CAVA 4OHZA 4Y20B 1RMU2 3U4XA 5K2ME 2QQNA 2VTXJ 2AQCA 2M4YA 3I2GA 3ZFGA 2XGXA 2R072 4AFCA 1KDMA 3AZVA 1EV13 3C7GA 1RYYA 4P5HA 4A3CL 3C2UA 3VBOB 1CAUB 3TBDA 3FLTA 4L97A 3VB9A 4Q2FA 3WQBA 1AR92 1X7NA 1QOTA 5J98B 1NOVA 2ZAAA 3GTQL 3N3HA 1EY2A 5GLVA 1JZ7A 4FSJA 1G86A 2XUEA 3KVBA 3OGSA 4YVWB 1G7YA 1D0HA 3WP5A 2IXHA 3LDKA 2JE7A 2W87A 2HWD1 3RZMA 1H6YA 4MGZE 1AL23 1UO9A 3IPVA 1MQTC 2J22A 1F31A 5JDBA 2W1SA 1LKOA 2JKXA 2Y6JA 4LBQA 1JW6A 2ZCWA 2R93L 2A3YA 1DDLA 4J25A 2W47A 4QXHA 2B7YA 4XJ9A 3O14A 4L0PA 4NHKA 2F4LA 5EINC 1AYN3 4Q0VA 5FUPA 3NWKA 1PO23 3K7AL 5FYHA 1TME2 2ZS6B 4U671 1YFWA 3THPA 1HV1A 2JG8A 1BLZA 1OVPA 1NXEA 4E2QA 1J84A 2O1QA 5M5XL 4K8FA 1L7RA 1R0FA 4DXZA 4LJHA 5IVBA 4QGMA 4XFCA 1NQDA 2JI3A 1UOJA 3GZEA 1GNHA 3FC0A 4MO3M 4ITCA 3OUHA 4AF9A 1VIWB 2PLV1 1YI9A 2XBO1 5DXDA 3MW2A 4AI3A 4OHWA 3HWJA 1NCQB 4CCMA 1DIWA 3PLQA 1COV2 2A73B 3N7LA 5FPLA 3ZPYA 5A32A 3U10A 3EMRA 4CDXC 5FLIA 2EF6A 3NKTA 4AFBA 2A5ZA 2O8QA 3ACGA 4XIKA 3DXTA 4YM3A 4IDZA 1MS4A 5JI7A 2GNBA 4W6WA 1KQRA 2UWAA 3LEGA 3J7Z1 2X53S 4U36A 4BBSL 5F6KA 1PO22 4XACA 4FPOB 5M3ML 2RHPA 4KBBA 2WNUB 4DEQA 1UKRA 1RUC3 4IL7A 4F83A 3WF4A 1PGL2 1K45A 1O3QA 1O59A 1QJEA 4BXFA 5FP3A 3PTYA 2W0XA 3JUUA 2VXJA 3MUZ1 3VHOA 3A21A 4CDWB 3VZLA 4DXTA 3RZZA 5J36A 2DUPA 3H42B 3SCFA 2B4KA 4M3CB 4AI2A 1RUOA 4N7IA 4MYEA 4XXPA 3I3BA 3Q8BA 5CFCB 1ULGA 3BGAA 1RUC1 4UFIA 4BMBA 4H3WA 4QX1A 1I6XA 1NE6A 4Q4X1 2CL2A 1LTLA 5D1IA 5F37A 4GMP0 1FPN1 2E7TA 2VMDA 3VBUA 4N8MA 5FDBA 4OI0A 3H8RA 2WWUA 2R7EB 5JMCA 4Q4V2 2GC2A 1UU6A 1I3QL 3SEEA 4LKFA 2WZR1 3QVDA 1PK6B 3J7HA 5LBFA 1W8ZA 3GALA 3H97A 1A78A 3D0JA 3LZZA 2WWSA 4A41A 3LKJA 4XMIA 3ZSJA 1F2NA 3RYGA 2D6NA 1CX4A 1GWMA 1DG6A 2JDMA 1N3QA 2XH6A 2D5FA 2QNKA 3CJIC 3EBRA 4AVBA 5EFUA 3E6BA 2CAUA 5HCAA 3S1ML 1HLCA 2VW1A 2A6ED 4AVAA 4JGYA 2XHKA 1SLCA 4UW6A 2TEPA 1CJPA 1GR3A 2GNTA 5GKAC 1XSQA 3FE5A 5LASA 3ZXGA 1JYXA 1GZCA 4A7KA 3ASIA 1Y1WL 1US2A 1F4HA 3VZKA 1RHI1 1AR71 2RS53 5EIOC 3PU3A 1GWKA 4MGQA 4YGDA 3E6CC 3FDJA 3OYWA 4MV2A 1UY2A 1YLLA 3KF3A 1KFXL 4F7ZA 2VOXA 3POGA 1MZEA 1OUXA 4Q4V3 1XOYA 4OI1A 1BMV1 2V0EA 3IDCB 5I93A 1HQLA 1W0OA 2Y8KA 4P08A 2XONA 1CX1A 1GOHA 3LOIA 3EO6A 3KV4A 5C3SA 2HH9A 4NPRA 2YG0A 2VOWA 3I3QA 4IV1C 4C1WA 4BXSV 1WD4A 3B5LB 3KMHA 1C57A 1UXXX 2A3XA 3KYXA 2QDNA 2B63L 1U5YA 3AK0A 3B9IA 4NWVA 2Q1ZB 3IPVB 1WLDA 2UURA 2W94A 4J6GA 2IUWA 3UNPA 3RZJA 4E9KA 1OA2A 3JXSA 1SBDA 1HN0A 3KF5A 1T6GC 4JKLA 4Q4X2 4YVWA 3B7MA 2WC2A 4W6XA 1YUXA 4BY1L 3PDQA 4RA0A 1RUC2 1ZZCA 2P34A 1D2SA 2WO1A 3KHBA 4R8HA 3WLUA 5LW9A 3UK9A 5IT6A 1ENXA 5FQ0B 3K46A 2O0OA 5LK7B 3BODA 4H2AA 1B2JA 3NNFA 4YVWC 3ACFA 5H1Sc 4BQ5A 3M4FA 3POIA 3U37A 2D6MA 2ET7A 2KA3A 2PQQA 3NSTA 3MLLA 4ATEA 1HXS1 4I30A 5FP8A 3T4HB 3ZIXA 3MHZA 2WQ4A 1QEXA 1R092 1VRH2 2E6VA 4KL1A 4UFLA 3WF2A 4URAA 1F15A 1MS8A 4A3XA 3ZR5A 2Q8DA 1S0JA 3RJ2X 4AI8A 1OF3A 5CNAA 1GQHA 5EZWA 2BEOA 3FKIL 3TYJA 1ULOA 4LMFA 2B5ID 4LHNA 4MXVA 1VAVA 1XYPA 2Q1FA 2RS32 3I4ML 1AVBA 1ZZ8A 1WW6A 2WUHA 4IEPA 4WVMB 4BJ0A 1HKDA 2PTMA 5CIRA 7RXNA 2LALA 2ZHNA 1UYPA 2YDEA 5LA0A 1QXPA 4JGYC 4GULA 2BUKA 4G4FA 3SITA 4PHZA 1W6QB 4Q4W1 3PIGA 3I2DA 5C9AB 2JECA 3LDBA 3RGBA 1CADA 2Z3RB 2Y6LA 4M3CF 1WUVA 4DMIA 1UYYA 2RE9A 3W5MA 3AL6A 2J1VA 1PNFA 1D7PM 4XF0A 5ACA2 1OOPA 5JIAA 1BKZA 1UD1A 1UL9A 2BNNA 5IFPA 1RUD1 3CJIA 2DFBA 4AGVA 2J1RA 2R043 1UYZA 3LSDA 4FVVA 4JGYB 4JX0A 4NRPA 4HXCA 4CUBA 4KH9A 1OSGA 2JDYA 1LAJA 5HXVA 1STMA 1W90A 1ZBA1 3R4UA 4GWIA 4RS5C 2RDSA 4QKFA 1NY72 5IYYA 3K77A 1AXYA 1N1TA 1OQEA 3HAGA 5CEHA 2DV9A 4Z1VA 5BNOA 5AVPA 4HFSA 4BB3A 5KHHA 4FPFA 3R0RA 5FZ7A 5IK8A 2A3WA 3HNYM 3IDAA 3ZN4A 2VUAA 4FI9A 2BU9A 2GZWA 4LBJA 1TWAL 2E63A 5FZIA 1SLBA 2DTWA 4G9SB 4YM2A 1VBB2 1UU5A 1DZRA 1HQWA 2HEVF 3NNJA 2P17A 4GWNA 1ULPA 1SPPB 2WN3A 4CA9A 3ACIA 5T54A 3MGUA 1EPWA 3O1SA 1C3HA 2YC2A 1COV3 2E2JL 5CFDC 1DZQA 4GH4B 1WJVA 5FFOC 2WABA 2NVXL 2HVYC 2NYYA 3BTYA 4D7SA 2AACA 4LITA 1FHHA 1RUJ3 3MIGA 2KR2A 4BLIA 1IZ3A 2HBUA 1W8WA 4HOOA 4Y5Z0 4CU9A 1GNZA 1LESA 4B4RA 1NZIA 1E5IA 1K83L 3VBUB 4FPLA 3DPRA 5MFPA 3KQRA 2D7FA 3BALA 3WDVA 4IQPA 4XFGA 1OFNA 4HKWA 4A42A 3AMPA 2BOIA 2IXJA 4HN0A 2ZHMA 4XDOA 3D4KA 1WLTA 2GC0A 2OXBA 2WS93 3P3PA 5BNPB 1GZTA 4IETA 4X6QB 5FMDA 5ABJC 4WBBA 1SLIA 2J1SA 2FDHA 1DGWA 1NCQA 4AVVA 2CWSA 2ZEWA 4IV1A 3CJXA 4YGBA 5C9AC 2ZPXA 2I07B 2WNUA 2XKOA 4HVOA 4PLOA 3WUDA 3HOYL 4BDVB 4BQ4A 1DX8A 3HNMA 4CDUC 1XB9A 5FYBA 4BQWA 1S0IA 3I2KA 2ZEZA 3AP4A 3BIEA 3WW1A 1OWCA 1PNGA 2JWPA 3BIWE 3JB4C 3LF7A 5LATA 3SISA 2I74A 2JG8B 4RR3A 2VNVA 4AR5A 3SH3A 4AR2A 1OPOA 2Q8EA 2DVBA 3POFA 3RWNA 4HKLA 4O9GA 1NLRA 2VY0A 3ME2A 1V6KA 3I2JA 3UGHA 4OUSA 5FV3A 1XE8A 5K4LA 1QOSA 4CU6A 4JGZA 1CQ9A 1N3OA 2HR5A 2XB6C 1W06A 3V65A 1QY4A 3QH6A 5JVG1 4YW6A 1IS6A 1R1A1 2WN2A 3GGLA 4LK7A 4BHPA 2ATFA 4C0HA 3MIEA 4GD4A 3GM8A 4PI0A 5D8AC 3LIHA 4DINB 3NW4A 3SQOA 4AEDC 5J96B 4JGZC 2ZIXA 3H3UA 4N43C 3ALQA 4DXSA 2ZGPA 2XJPA 4HANA 1DF0A 3SKVA 1OWBA 4XF3A 4IEUA 3W21A 3FBYA 3KT1A 2A71A 1W2AX 1DYKA 5HCBA 4TPUA 4BXXL 3N9MA 5FZBA 4IE5A 1CAUA 3G7DA 2EXKA 2V73A 3J8F3 4CCJA 1GQPA 1OH4A 4DY5A 3V0BB 2HYXA 1VR3A 4D7TA 1S55A 3UJOA 1H2NA 3I3DA 4N7UA 3X29B 4I2OA 1D4VB 2XQXA 4CCEA 5A1FA 2QZ3A 2Q30A 4LKSA 1HRI1 1GV9A 1ZZ7A 3PIJA 3OG2A 2RMU1 4AFDA 4QXBA 3S16L 3HOBA 4ZHNA 4R9DA 1LTEA 2PAMA 1FPN2 2VULA 1V6JA 3J8F1 4JRAA 4O65A 2LS6A 4AHWA 3ST7A 1L7QA 4XABA 3S7EA 5CU1A 2BGOA 4ONUA 2HYKA 2DURA 4DO0A 2B5HA 2W2IA 3AMHA 1ZREA 4D6RA 3C8XA 4YNIA 4ZXKA 1AR72 3LFIA 1ST8A 1TEIA 1OD3A 2AR6A 3H0OA 4AQ6A 1POV0 5C6CA 5FZEA 4K21A 5IUQA 3GBWA 3BOPA 5FK7A 5IK4A 1YEWA 2A69D 1HB4A 2C6AA 3C7FA 1M06G 2BOJA 4LKDA 3GYDA 2C9KA 2PVXA 2QQMA 4TWTA 1KXGA 4R9AA 2WA4A 2P3KA 4LQRA 3NJYA 1FMD1 1H2LA 1ENRA 5F5IA 4XMAA 4JVAA 1S0CA 4BLJA 4MXWB 1YJLA 2EALA 3TN92 1E5SA 4INDA 4LIUA 3WOGA 1W9FA 3J7MA 3MYXA 4LOTA 2XMLA 4WVZA 5JZGC 1HRV2 4P5YA 1ACCA 1ND2A 1VBA1 1UMZA 4MHRA 5E89A 1GSLA 5GAEc 2B8MA 2SBAA 4NHMA 2XLGA 1QDOA 4NAMA 1AXZA 4Q1PA 3L2HA 1CONA 3Q9OA 2AC1A 3HOWL 5FYVA 4CEYB 1KD7A 1Y9MA 3RMXA 1QQTA 2QE3A 1YC61 4MG2A 2D6PA 4Q26A 1XSRA 2ETEA 4GWMA 1FHMA 5C44L 4XQDA 5FRAA 2E51A 1BQ9A 5APAA 2F4PA 2E7QA 2WT1A 1JZ6A 4XUTA 2VNRA 1AX1A 1DQ4A 1N47A 4NROA 2A68D 3S0MA 3PVBB 2VBPA 2W95A 1WW5A 3NJXA 2XL9A 1UU4A 2D43A 5FO9B 1PO13 2ERFA 5D8AA 4AK3A 1SHWB 2ZJCA 5FLML 3ZN6B 3SS2A 1R1A2 1IU5A 1CIYA 2BVVA 3NQHA 4Q29A 4YG3A 5K0UA 3UKVA 4BQ3A 4FBFA 5A6QA 5BNNB 1ZA7A 4L99A 4R4ZA 5BNPA 5KC6A 1J1LA 4IV3C 3J8F2 3USUB 4DNYA 5EIYB 1QDCA 2BPA2 4C1XA 1K5JA 3KLSA 1BK0A 5KXCA 1A6CA 5A80A 4FPCA 1RUH3 3NRUA 1JYVA 3V0AA 1QJY3 5C5UA 1VRH1 1ZZ6A 5AC93 4CEWB 4COYA 3KHCA 1DBNA 3FL7A 5LBBA 1XYNA 1Q8SA 3VZMA 2WNEA 1FNYA 4XXBB 1FV3A 2WO2A 1W2UA 4BIOA 2DBIA 1JZ2A 4RGGA 2RS12 3PTRB 5IVYA 1JN2P 2ERJA 2VCAA 5JR7B 1SFNA 3HN1A 3ZYGA 3RJRA 4RQPA 1LGCA 4WZCA 3RZHA 5J09A 3AJYA 3CDZB 2HWE2 4NN0A 2JDHA 1UXZA 1ASJ2 1OVSA 1VRBA 3H1YA 2YHJA 3FZ3A 5KXEA 1W28A 1AJOA 4LORA 2CDPA 2ZA9A 1W0NA 5FZ8A 4B7KA 2GP5A 1Q8VA 3Q8CA 3VDDB 4BU2A 4I3PA 1SMWA 5LRSA 1JS9A 4LE4A 5C8CA 4IEYA 2JA8L 4UBGA 1HIXA 4LT5A 1AF9A 2ZX2A 1JHNA 1S0GA 3FUOA 3S2DL 4GA9A 2VZVA 4LOSA 3WDXA 5EQUA 1UN1A 5BNNA 4UW5A 4FPJA 3I59B 5F3CA 3LPEB 4LBKA 4QWNA 5JVVA 2ARAA 1W3XA 5LY2A 3TAYA 5A3MA 1BCXA 2VO5A 1XNCA 3O0VA 4OHYA 3DPRC 1F4LA 4UYBA 2VQTA 1NYWA 1U5IA 1BEV3 4AXOA 4D69A 3FBMA 4DXRA 1LU2A 4CUGA 2VPVA 3IB3A 4EWDA 4A3EL 1SPPA 1JH5A 3JD73 4LE3A 2WL1A 2P3YA 5A70A 1DGLA 5K0UB 4I01A 4Z07A 1FXZA 4UBHA 3M1HA 5CG8A 2VU9A 3H9CA 1I3HA 3MDPA 2PHLA 5H9RA 3VBOC 4HETA 1DQ0A 3NJZA 1GOGA 3M3QA 2Y0OA 1V70A 3WXPA 3JD71 1QJZA 3B94A 1SFPA 1O6UA 1RUF1 1PX3A 1S2EA 1O5LA 5EP9A 2Q8OA 4BQ2A 2CWMA 2LROA 2IFRA 4LUKA 3B08B 4XCBA 2HWD3 2XPJA 1AL21 2A70A 4JRLA 2V4AA 1AL0G 1RUE1 3RWKX 3WQ1A 3WSOA 4EJRA 4A3FL 3HMYA 4QGNA 1FOD2 5LBEA 4O61A 3PVOA 4NRMA 1AYM2 3LA2A 3O1PA 2R92L 3LGRA 4SBVA 5I0RA 1JOBA 5FZ1A 1J3QA 2GMPA 1Y9GA 3IMMA 5FTTC 3AXDA 2DBNA 1UY0A 1G9BA 1SEFA 1A8DA 1ZNPA 4IE7A 5CFDB 4XDQA 1ULCA 2WA3A 3BKZA 2ZGSA 4BQXA 1W6PB 4CP0A 3CQZL 4P9XA 4K1ZA 4AEDA 4L9BA 5LRRA 4QMAA 2WLPA 2P5BA 1UYXA 3VD5A 4FAGA 5AC92 5JIUA 2H12A 5F2SA 1UZYA 3PVEA 1WD3A 1HN1A 1K5MC 3E97A 3VBUC 2DFCA 3WT3A 5IK7A 5I8SA 5LA1A 3OBTA 1DZTA 1YIFA 4W65A 2X10A 3AZYA 4FTSA 4BOWA 1NT0A 1YI7A 1S1AA 4ZS3A 3VBHC 1HDKA 4Q8KA 1PO12 1OLME 2EAAA 4FPHA 1A3KA 2J7MA 5FK8A 1O3RA 1FV2A 1UMHA 3OF1A 4RSUA 4XJAA 4GKXA 2WS91 4QX3A 4AI0A 3HVDA 1WMFA 5FKBA 5KXDA 5C4XL 5LWBA 3LWQB 2ARXA 2KD7A 1IU6A 2FQPA 4TN7A 2X05A 5C8CC 3KZ4C 2WDBA 5JR2A 2PYAA 2VG9A 4JADA 2VECA 1G6NA 3OGRA 5L73A 5M0TA 2OW4A 3V0BA 2RM23 1TZOA 2VTXA 4Y1ZA 1QHDA 3ZMOA 1YUZA 1EAH2 4KGQA 3VHPA 4DOUA 3CKHA 4YARA 2VZOA 1S2BA 2MPFA 4LR4A 2MEV2 2ZX1A 1VAMA 3AKQA 1DQ5A 5FUIA 3WF3A 1WMXA 3ZXEA 4B8EA 3HEIA 4BQ1A 4CCOA 1ZRRA 3RMYA
chains in the Genus database with same CATH topology
1R0GA 1R093 3RSJA 5E8AA 4LO6B 1XNDA 2HWC1 4GKYA 3ES1A 4FPEA 2X5IB 2B46X 1AL22 3C3VA 4XZPA 3VZOA 3T1LA 3ZIWA 5AN9H 3R6SA 3ZG6A 4HVRA 3RG0A 1VBC3 1E8JA 2W39A 4E4SA 2VL6A 1X8EA 2FMDA 1IS4A 4PBOA 1TMF3 5BNPC 1Q43A 5GZDA 4C90A 4P9JA 4Q0UA 4V1PA 4C91A 3IBMA 3S6PA 2YROA 3O5SA 4IXLA 1RUNA 2BFUS 1ZVFA 4LLOA 2ARBA 1X36A 4KWLA 4YFWA 2YGMA 1R0HA 1EAH3 1H4HA 1AJKA 5CADA 1ZBE2 1Y9QA 2RS51 2GMEA 1MZ6A 5ACA3 2FHRA 5JLVA 3VUOA 4XEZA 2M6OA 4BIFA 1AX2A 3RI8A 1LODA 4A2UA 4QPIA 1PM7A 1ENQA 3RRDA 3SHRA 1SLLA 3GZTB 2D6KA 5FAXA 1RUG3 4X8NA 1VRH3 1LGNA 1C8M1 1TE1B 2OVUA 2WT2A 3ZXKA 5GLWA 1QQP1 2R0FA 1PIV2 5IY0A 3OY8A 4META 3IDEA 5FOJB 2P2KA 1BVVA 1VBE2 1DGWX 1YHFA 3W9AA 2JEMA 5GLUA 3N4MA 1MQTA 4X8PA 5K7PA 2RR11 3H50A 1RVF1 4JCKA 1S30A 3KT7A 1S0BA 4AGGA 4NOTA 1ODHA 1AX0A 1X50A 2GN3A 1UF2C 4BA6A 5BNOB 3TOJA 1RITA 3FFZA 5I8TA 1QXJA 5JAXA 3MFAA 3I4IA 1SACA 3W58A 1XNBA 2NMOA 3J4UH 1OKQA 4AQSA 2LCQA 5JPNB 4LNVA 4L2NA 3EXUA 2ZGUA 1ULFA 4OHXA 1NNQA 1R081 4IEVA 2A7AA 3O12A 2Z42A 3AMQA 3B3QE 1UIJA 2YPJA 2ZGNA 5MGNA 4CYDA 4Y26A 2GMMA 1M4WA 2X8KA 2OYZA 1AR63 3CJIB 5DDJ1 1XU2A 3WDYA 3JQWA 2HWF1 5KHIA 2GALA 2R16A 2OPKA 2WNUC 4NHLA 4I09A 3CLPA 3ZFEB 1WMEA 1G9FA 3O0WA 1PK6C 1YUDA 2DTYA 3KCCA 2VQAA 4JDNA 4EN7B 1AR62 2V5YA 1COV1 2RR12 2GC3A 4GB32 1HQNA 3IN9A 1H1MA 1O4ZA 1R1ZA 1WBFA 2YY1A 2YC0A 3KGLA 4J1WA 2IWGB 2XUMA 3AKPA 2DU0A 3H9AA 2YYOA 3ILRA 4YZ3A 4CP1A 3AYDA 4P9GA 1SCRA 1C8M2 2TNFA 4XQ4A 4TVMA 3RYKA 4ISRA 1KS4A 1VBB1 3VKMA 3ES4A 4AQTA 4B3NA 1H8TA 4YG6A 1RJ7A 2ERSA 5GAHc 1DYPA 2GU9A 2Q5TA 3WG3A 4WVWA 5JOXA 3MLJA 2FZ2A 4JC1A 3M70A 5FMOS 1VP6A 4E27A 2JG9A 1S0FA 5JWPA 4N43B 1WBLA 4OFGA 3QACA 4H7LA 2VVEA 4OZXA 1IRNA 2XVLA 2Z5WA 5EJ3A 5FPZA 2EAKA 4GXLA 4LLFA 3VL9A 1GKBA 1GZ9A 4YM0A 1PIV1 1VZGA 1OA3A 4MH0E 1APNA 5AFBA 3MW4A 1V6LA 4N9IA 3LAGA 4TSVA 4LBQD 4EWEA 1BBT1 3ZXJA 1W6NB 4GS7D 3WHTA 1V6IA 2ZGRA 1Q5OA 5BV6A 3PWFA 2IXLA 4XBLA 5JCTA 2WZPP 1MZFA 3MSUA 2JD4A 2K2DA 4FOYA 3VBSC 2GMGA 1R1A3 4Y24A 1XU1A 1Y43B 5A33A 3ZSKA 2B39A 1KITA 4KWJA 2R32A 1DGRA 4Q0QA 2GNMA 3GZAA 1ZM1A 2A6VA 1R091 3RYPA 1JYIA 1G9DA 3MIHA 1RUE3 4V196 3INAA 1UIKA 3WP6A 3AJZA 2X29A 3VBHB 1LU1A 1MEC2 4LO8A 1V9U1 3SH5A 1GQGA 3WP4A 3E5XA 5K8SA 1TMF2 3NAPB 1AR91 1QNYA 5BNQA 2VVDA 4YLZA 1TQ5A 1MS1A 2A6WA 3VPBE 5CFCA 3VKOA 1SBFA 1HRI3 2AZ5A 1PK6A 1N1YA 2ILMA 1CJDA 2VMHA 1AUYA 1NE4A 4E6YA 1V6OA 2DWRA 4FT8A 4XHXA 2GH2A 2DSXA 1FI2A 3TN93 5CBLA 5JSOA 4XILA 3ZSMA 3ZXDA 2ZGTA 1GBGA 3RDIA 4ZU5A 2D5HA 3H1MA 3CL1A 4YW5A 5DUVA 4YG0A 3K48A 4CDWC 1MR5A 3MZHA 1W0PA 2Q1MA 1X82A 1VLNA 4EV0A 1H2KA 1I1EA 5DUXA 1ULDA 2VH9A 1YWKA 1FMD3 1WW7A 4XFAA 1IQAA 2A75A 2K9ZA 2XVGA 4X6RB 3W59A 3QD6A 4TLFA 2R1BA 1FPN3 2RM22 2BVBA 2R062 1RDVA 4AVCA 4M0HA 1VBA3 2CY6A 1YIPA 3B01A 3N35A 2ZMNA 3O7OA 5JI9A 1Q8PA 1V9U2 1NA1A 3KM5A 5H9SA 3NVCA 4K9SA 4RD7A 2IXKA 2P37A 4Z92B 1JYBA 3FX3A 4Q4W2 1REEA 3KT4A 1MS0A 2ZBJA 4G6BA 4S2GA 2NM1A 4XHBA 3RYRA 3UKTA 4XBQA 2VNOA 1VBC1 1W6OB 4RHV2 4LBQB 1IOAA 2ZHKA 1VJ2A 5JSRA 1D4M1 1TMF1 2CGNA 2PSMC 4ES9A 3KYUA 3U0ZA 2P3IA 3OY8B 5GM0A 4QQOA 4EN0A 1QNWA 2QZ2A 4N43A 1FOD3 3GZUC 3VKFC 3B9CA 5EXOA 4D3WA 2ZX3A 2CR8A 2ZOEB 3AMMA 1BYHA 2UY8A 3L9JT 5AI3A 1RVF2 1ASJ3 3VBOA 1RUD3 4Z2WA 1CVNA 1OQDA 2H0VA 5F9TA 1EYBA 1SMUA 4UXAA 4XGHA 1FT9A 3VBFB 2BQPA 3FLPA 1IS3A 3R4SA 1VB4A 2KKDA 3H1WA 3VGIA 2P3JA 4RHV3 2VOVA 4FOVA 1F5FA 1MEC3 2RMU2 1X33A 5L7OC 3R05A 1NZCA 5TSWA 3GBFA 5BNNC 2A6ZA 4HSJA 2HKXA 3MF6A 5CFDA 3ZFGC 4YZ5A 5C33A 1RB8G 2UY9A 1CAWB 4ME3A 3EJKA 1G9CA 1QKQA 5JVH1 2PHWA 1LOEA 4LO7A 1LHUA 2PPTA 1WMDA 1VBD1 4DQAA 1B09A 3HBZA 3MEPA 2VVFA 4YWLA 4RQPC 4WVVA 3IDBB 5AVAA 3ZFFB 1QMJA 3OBRA 3FFQA 2CKAA 2R49A 1H2MA 1YYNA 1S24A 4UW4A 5LK5A 4YYOA 4G3YC 4HPKA 4JDMA 4CDXB 5B2GB 1H30A 2WJSA 3ILFA 1SDWA 1H9WA 3ZDSA 2ZKLA 4LBOA 4AVTA 3HIFA 4COUA 1ALYA 4XFFA 1N1VA 1OFSA 4QM9A 4QXKA 2K2SA 2IXCA 3ZFFA 2PFWA 1AYN1 2PHTA 2AYJA 4FCAA 1AR61 2VUJA 4ORFA 4CDQB 4HVQA 3AKSA 3ZVXA 4POGA 4FO9A 2K0GA 2M4VA 4TYSA 1HRI2 4YVSA 3VZNA 1PVC2 4FTBA 1WW4A 4D7YA 1FX5A 5DUUA 4AEJA 1UKGA 2AH2A 3GNEA 1QOOA 2PLV3 1LKPA 2WINB 5JOYA 2F6BA 2RJLA 5KHGA 1RUG2 1CAXB 2DVDA 5E1RA 1Q3EA 1QF3A 4S2HA 1RUE2 4RQPB 1B35B 3RZ6A 2VOKA 4MGIE 4BYYA 1V9U3 3WWNB 1PO21 4F3JA 3E5UA 5JOZA 1LEDA 3ZYPA 2JICA 4QU2A 1TME3 1LENA 4I02A 4AHZA 1H0BA 1RUJ2 1RIRA 4EN6B 3GF6A 4LEJA 1Y7BA 1OA4A 3NV1A 2PLV2 3AXEA 5A32B 4Z82A 5BYNA 2RMU3 5D8AB 3KS7A 4LA2A 3PZAA 1LHOA 2DCTA 4I0BA 3GHMA 4DB5A 4Y1XA 4B29A 1S0DA 5DZFA 1PZ8A 2XJTA 2A6HD 4N53C 4PIXA 2BBVA 2PHDA 3WY6A 3H3ZA 4DZGA 3VL8A 1CD3G 1PGL1 2VW2A 3M2MA 1V6NA 5CA6A 2BGCA 2Y26A 3CNAA 3WR0A 4BWOA 4UY81 2R042 4QQHA 4AFAA 3G6JB 1ND3A 2R6QA 2Z69A 2WNVB 4CDUA 5I0TA 1C28A 2GC1A 1ND2B 3SCGA 1O3TA 4Y1YA 1PZ9A 3LA3A 4HSLA 3NKGA 1F5JA 2W68A 4B7EA 2C9AA 1X8MA 4CP2A 1O4YA 2XJRA 1AZDA 4GALA 4K7JA 2LTNA 5J48A 1VZIA 1T9PA 1ZZBA 1CAVB 2WZR2 3OPZA 1ZRFA 3CO2A 2OIIA 4H7MA 2PHRA 4RGAA 2M6PA 3ZFGB 5ABJB 4KWKA 2XKPA 3EQEA 1W6MB 4EN8B 2X5IC 3SH4A 2WFF1 3I7DA 3JBG3 1IKQA 1KJLA 4IV3A 2EXIA 1U5ZA 5F1RA 2N7GA 4I3GA 2Q4SA 4MGYE 1BZWA 1R0IA 2V3BB 2O5JD 4CZSA 4O9EA 3MFCA 4XJUA 1LOGA 1YNAA 3M8LA 1LR5A 4M01A 3WP3A 2ZMKA 3USSA 1S0EA 1B35A 4P9YA 2R071 2AENA 1RUG1 2WFF3 2MHFA 1VZHA 4XTMA 4LUMA 1R0JA 3UV9A 4ZKTB 4RHV1 3TWIA 1BMV2 1RUF2 3JU9A 4I0WB 4ZU4A 1LB2A 1LHNA 2VMIA 3AP9A 4HKOA 4JTOA 4KQ7A 2HWD2 3AP7A 4HPKB 4UW3A 1XXNA 1NXMA 2DUOA 1WLWA 5GZGA 3WZ1A 3NFPI 3EHKA 3M3OA 4WM7C 4P9IA 3KYYA 1ZRDA 1RGSA 2MEV3 1VBD3 2ZX4A 3M3IA 3N7MA 5IK5A 4NWWA 1CR7A 3FMGA 2WFPA 4HN1A 4HT1T 4DS0A 1W6NA 1QQP3 2D3RA 2NQYA 5HCFA 1OI6A 3AYAA 4Q4W3 1BQ8A 4AR4A 1R083 2MEV1 1YV1A 4HZFA 1OQ1A 5LEJA 2JJ6A 4EROA 4N9HA 4YSFA 4L8QA 2NLRA 4Z8BA 3K51A 4ZN3B 4MX3A 1LKNA 3KGZA 5E88A 2AUYA 4GQ7A 3I59A 2QJVA 1EV11 1LOCA 3WQ0A 5BNOC 4I0AA 4P9WA 2R041 4KGGA 1ZA4A 3SXWA 2NP0A 4IV1B 2HJIA 4DFSA 3VBRA 3PIP1 1MS9A 2JI2A 5AI2A 4E4DX 5KHKA 1RINA 1VBD2 4FXKB 4Q4Y1 4COWA 5GZCA 3MPSA 8RXNA 4FOWA 3DV8A 2ZTNA 2R1DA 3KB5A 2JE9A 5BPXA 2C6BA 2ZGKA 4N53B 1OOPC 3D82A 1AR83 2ZGMA 1BFYA 2R30A 2ZZJA 2ZGLA 2YV8A 3WUCA 2W52A 3VBFA 5MFZA 5I8YA 1RUF3 4KG0A 1S2KA 1N3PA 3AYEA 5FQ0A 4Q0PA 4IV3B 3B93A 5C8WA 2G4IA 2XLFA 1C5IA 3WINE 5C4WA 1IW7D 4OVEA 3GBGA 4CDUB 2J9UB 2D44A 1LHWA 5AC91 4JAEA 2ZAHA 1W6OA 1HRV1 3IWZA 1AR82 5RXNA 1L3JA 3BCWA 4ASLA 4LBLA 4K3UA 2D97A 2DCKA 1FNZA 2O8OA 1C4RA 4IEWA 1Y3TA 1J59A 1CESA 3UKNA 3ZN6A 3MIDA 1CAAA 4IEXA 3HD8B 3JB8A 1DFQA 4IESA 1PHMA 4AHYA 1ZX5A 1F8VA 1ND3B 1OD5A 4HMZA 4AWDA 5GADc 3AX4A 2LM3A 3ZXFA 1VB2A 5J3UA 4A7ZA 4Q4Y2 1YO8A 2EXHA 3RZTA 1NA1B 2EA7A 1CGPA 3TB0A 2KM2A 1C1FA 1PGW1 2WKKA 3ZYJB 2XJSA 3WDWA 3A0NA 1QJU3 2YXSA 4TZDA 1OOPB 5GLZA 4RFT0 1OLRA 2B45X 2YGLA 2SLIA 2CNAA 5C9AA 2QKDA 2JG8C 1YXWA 5FO7B 1B13A 2HWE1 1W6QA 4ZN1B 1I5ZA 4Q4X3 1H4GA 4JQRA 2E53A 1QJU1 2DF7A 1JUIA 3AP5A 3WG2A 2YMZA 2BTVC 3N7JA 4DY3A 4CTEA 2VGDA 3WV6A 2GDFA 1NA1C 1SLAA 2GNDA 1KDKA 1BBT3 1CAXA 1VBC2 2A6YA 4XYXA 2CV6A 4LA3A 2XWBB 3PMEA 5CAZA 2I45A 4NO4A 1LRHA 1H1AA 4M3CE 5KWRA 2HWC3 2PHFA 3N7KA 4C0BA 2ZACA 2RDVA 1AHSA 3SMHA 1HX6A 3VBHA 5GZEA 2H6CA 2W08A 3CU7A 4HK9A 3ZMNA 5DG1A 3NO8A 4QGLA 4BPZA 3NL1A 1D0GA 1DU3D 3KCYA 2RJKA 2WSUA 3URFA 3WQ7A 4JAGA 2AGSA 4XTPA 3JBG2 4RR3C 4AW7A 4PF5A 5L7OB 2QUOA 1YFXA 3ZSEA 2QDRA 1DHKB 4OLLA 3QLQA 2EXJA 4CDXA 1DQ2A 3JD72 4FQZA 1SMMA 4U2AA 4R9BA 1URXA 4QT6A 1OPMA 1JBCA 5BUVA 4WM8A 1C1LA 2WSVA 1PGW2 3I54A 2VQ0A 1HV0A 3AKTA 5A33B 4AYUA 5EYXA 2DVAA 4AFMA 2D93A 4WM8B 4RS5B 4B8CD 3V64A 3KYWA 1ZBE3 4QQLA 1RUD2 3U07A 1V00A 4A7YA 2Z2SB 3P3NA 5H9QA 1GYKA 1MZ5A 4MLOA 1H8TC 2ZGQA 3JQXA 4QPGA 2RM21 2WLQA 1VALA 3MLKA 3THTA 1PMIA 2E9QA 2NZ9A 3KCXA 3MIFA 3K35A 1K5MB 3OCPA 3HQXA 1NCRA 2NPIA 1YK4A 5T5PA 3VBSA 3WHUA 1J58A 3BOWA 1LOFA 1Z7S1 4BMEA 2PELA 2JXAA 1WLCA 5DZGA 3OGGA 2WS92 5T5LA 1RUH2 1I9RA 5HI0A 1YCIA 2XBO2 1T9QA 2FZ1A 3B00A 1QJX3 4QPIC 1PO11 2V09A 2D3PA 4HBNA 2XG3A 5DZEA 3VHRA 1OHFA 4BZ4A 4QD2A 4GH4C 3J7Y1 1RB9A 4XFHA 4E4ZA 3R4DB 4H55A 5FCCA 5J37A 2D6LX 3PMSA 1EAH1 4WM7B 3AFKA 5F5QA 2DVFA 4BM8A 1IPJA 2DYCA 1C5HA 4FTEA 1REDA 3ROUA 2R0HA 4R9CA 4XE9A 2UU8A 4XOGA 5K0UC 2H0BA 1LECA 1PVC3 4MZUA 4B4PA 3ZN5A 2JG9C 4PDWC 2XJVA 3SNMA 3WVJA 1TNFA 1HRV3 3J26N 3E5QA 1LJ7A 1PGSA 3MW3A 1O3SA 5BY5A 4LHLA 1SMVA 3H8UA 4XJZA 4YZ4A 2WT0A 4XF9A 1MEC1 3VHNA 1RUH1 2Z79A 4PLMA 1HXS3 3KSCA 5EV7A 3AYCA 4IEZA 2HEWF 2ENRA 4PQ9A 3JCIA 1Z7S2 3QBQA 2C1FA 3BB6A 5CVRA 4JDOA 2BNOA 4K40A 4PIYA 3AM2A 3QH7A 1LOFC 4FQ4A 3NV3A 1Q8QA 2NYDA 1S2ZA 1BRFA 3H7YA 2RS52 5C4WB 2QCSB 4AG4A 2BE5D 1PVXA 1QWRA 4WVMA 1G8WA 1MQTB 2BYVE 4QPIB 4LTAA 4WV8A 3ZSLA 5L19A 1NXGA 1BK1A 2H6BA 3DKWA 1DVBA 4N53A 3M3CA 4GB33 4OHVA 5KBFA 5DDJ3 4AGRA 4LULA 1KRIA 4OI2A 3LNLA 1AR81 1O91A 1Q8OA 3WDUA 1BEV2 1O5UA 3P2AA 4ES8A 4AEKA 4L92A 1IROA 2JDZA 3UL2A 5FLJA 1K5MA 3ELNA 3LB9A 1MVEA 3PIO1 3B02A 1NQJA 1NCRB 4PCRA 2JI1A 2ES3A 1LEMA 3OGJA 1ZBA2 1U5XA 4M0NA 4KU7A 4MSVA 4XQWA 1H9PA 4FXGB 5T55A 3V56A 5DM71 2HWF2 4BE3A 2L0ZA 4IERA 4JTNA 2NN8A 2C0ZA 4RS5A 3VBSB 2WQZC 1NG0A 4AR3A 2DVGA 4XFIA 4ATFA 2XVKA 4URTA 2GN7A 2PYTA 1IHMA 1LHVA 5T3NA 1RUJ1 1POV1 4XF1A 1AYM1 2GH8A 2GSYA 3QCWA 4KNCA 3TN91 1J3RA 2IC1A 4QPYA 5JOWA 1RYTA 1JUHA 4NVPA 4L11A 1BVP1 3ZFEC 1JTZX 5I91A 5DDJ2 5CB7A 2B9UA 4POFA 2VXRA 3ENRA 3FJSA 3RPQA 1BQPA 1FYUA 3ZO0B 4EN9B 1O4TA 3HT2A 4CDWA 2CGOA 1NLSA 4PJYA 2BNMA 3PVNA 3AB0A 4AI1A 4Y22A 1VAKA 1VBA2 4LBNA 2QQPA 1GFF2 2WZR3 1U12A 3VLBB 4S2FA 1LGBA 4D94A 4LHKA 1QJX2 3GHNA 4WZFA 4Q0SA 3E6DA 1Z92B 3ECQA 1Q56A 4KG8A 4Y1UA 4E2SA 2JKBA 5H9PA 2NMNA 3APBA 2D40A 4ZU7A 5FO8B 5DUWA 3U11A 1LULA 1WCKA 4HL0A 4AQ2A 1XNKA 4AHXA 4XJ8A 4XJWA 3BTAA 2BW8A 3FWEA 5ABJA 1JOJA 2VNGA 1UZZA 3DN7A 2VW0A 3JBG1 4IEQA 1BJQA 2ZKNA 3TRSB 5LEKA 2DCZA 3RS6A 4AEDB 4WFN1 4PIZA 2XJQA 2FBEA 4Q1RA 3ACLA 3PHMA 1T9OA 2VMGA 3I8TA 1LOAA 1SFYA 5FPXA 1GZWA 1JYCA 1W6MA 1RDGA 2R073 5I0UA 3WCSA 3IM0A 5ACA1 1B35C 3ZX7A 1J1TA 1RWDA 1BXHA 1CPMA 4R4XA 2Q0AA 3ZFEA 3T1MA 1CAVA 5KHJA 3J9SA 4K20A 3WCRA 3FLRA 1IKPA 1ASJ1 1RUI3 4YZ1A 2I2SA 1H7VA 1AR73 1RYQA 3D8CA 1B71A 3MF9A 5GALA 2UWCA 4BH9A 2AYHA 1AXKA 3LSEA 4W6YA 3MI8A 3ZYIB 3VBFC 1A8MA 2ZMLA 2IFWA 2PHUA 5JZGB 1PVC1 5C4WC 1CN1A 2RS33 3BPZA 5J7MA 3P8BA 2V0FA 4RL7A 4COVA 1WCSA 1ZBE1 3LA7A 5GZFA 5GAGc 3L2YA 5GLTA 4YM1A 4XW3A 5C8CB 2BFUL 2AREA 2GAUA 1QCVA 1YJKA 4DRRA 1G9AA 4AE2A 3ZXAC 3WD5A 3KYVA 1ONAA 3IU3I 4GMP1 2BWCA 1Z7S3 4J1XA 3VDDC 2Y0IA 2JENA 5FREA 3ZFFC 1FATA 4AEMA 5F6LB 2D6OX 1XQNA 5JSPA 1VBE1 1DGRN 1QU0A 2G9GA 3NV2A 4R52A 3VDDA 2Z3QB 1RVF3 4PBPA 4GMP3 3OTFA 1D4M3 4P9LA 4B4QA 1QJX1 4Y20A 1H1IA 3RQ0A 3VBRB 5K9YA 3DGTA 1FOD1 4RXNA 1UAIA 3AZZA 4FPGA 5MLC3 2B42B 3MICA 1VBE3 3AKRA 4IEOA 1HW5A 5FLHA 3V0AB 4FP3A 5DM61 2WFF2 4GB31 3WW3A 3IMNA 4ISQA 2OZ6A 3PJQA 3USUA 1DQ1A 3DL3A 4Y4YA 2QL0A 4K9FA 4LO5B 1NY71 2R061 4QPGB 4MVTA 4Q4Y3 2KXLA 3ETQA 1KJRA 4DRVA 5FMOL 1DQ6A 4YVSB 1OLQA 1Z78A 2G9FA 3VKNA 3VV1A 4JAFA 2HWB3 1KS5A 2FMYA 3AZXA 4MGKE 2WIIB 4CEWC 1OMIA 3MPBA 2R063 1KFUL 3OD4A 2OUHA 3S7IA 5JZGA 3B0AB 3TNPB 2PAEA 4YZ2A 1FMD2 2X5IA 4COZA 4Q8LA 1ENSA 3A4UA 4YVSC 4ASMB 1TME1 1RJ8A 4P14A 3WWLA 4LO4B 2HWC2 4YFZA 1POV3 2DU1A 3AZWA 2YUEA 1AYM3 2EIGA 1VBB3 1UPSA 5KXBA 1C09A 3RI9A 2ZZQA 2D3SA 3NAPC 1BBT2 1UX6A 3FHIB 1JXNA 2JX9A 1HXS2 3UJQA 4AVSA 2ZHLA 4CRQA 4WM8C 2DCYA 2HWE3 2CKCA 4CEYC 3MPPG 4H14A 3CF6E 4S2DA 3WNXA 4JAAA 4MXWA 3SLIA 1QH6A 2RS13 4Y1VA 1BEV1 3IT8A 3A44A 1NCQC 4YRDA 6RXNA 1GANA 1YFYA 2MNGA 3LCPA 4YWMA 1V6MA 2HEYF 1PIV3 4MUVA 3ZXLA 2RS11 1MS3A 4PDWA 3PNAA 3PKJA 4HLTA