2XJQA

X-ray structure of the n-terminal domain of the flocculin flo5 from saccharomyces cerevisiae
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
258
structure length
258
Chain Sequence
GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLOCCULATION PROTEIN FLO5
publication title Structural Basis of Flocculin-Mediated Social Behavior in Yeast
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell adhesion
total genus 61
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2010-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2xjqA02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2xjqA01
4LHNA 4COVA 4A3XA 2XJQA 4GQ7A 4COZA 2XJPA 4AFBA 4CP0A 5A3LA 4AF9A 4CP1A 4COUA 4AI0A 2XJRA 2XJUA 4D3WA 4COYA 4AHYA 5A3MA 4AHXA 4AFCA 2XJSA 4CP2A 4AHWA 4ASLA 4AHZA 4LHKA 4AI2A 4LHLA 4AFAA 4AI1A 4COWA 2XJTA 2XJVA 4AI3A
chains in the Genus database with same CATH superfamily
1RL3A 2HWE3 3NMBA 3JBG3 5KC5A 1MVEA 2WC2A 2Y6HA 2Y6LA 1UOJA 2GAUA 3M8LA 4JDMA 2FZ1A 4XHBA 1TQ5A 4L11A 4CCMA 2VQ0A 3LA3A 1ENXA 2JKXA 1W6OA 4Y22A 1OQ1A 1OBNA 4Q1PA 4ZU5A 5L19A 1ENQA 4KMQA 4A3ZA 3ZIWA 2ORZA 2WYSA 5HV4A 5D8AC 1TMF2 3M70A 3MGUA 3W5MA 5SV5A 1OMIA 4X6RB 1PIV1 1W6OB 2BNNA 3M4FA 4BQWA 4XF0A 1MS8A 3ZPYA 4M4PA 2W52A 3PVEA 1EPWA 4DRVA 4PQQA 2QUOA 4PQ9A 1LKOA 3NNMA 2EA7A 4C3IL 4Y26A 1S2EA 5A1FA 2VUAA 3MIBA 4INDA 4XILA 1VMFA 2A75A 4V2VA 2P5BA 3OBZA 1W28A 1C28A 1AR81 1G86A 3NFPI 1ZRRA 5I8YA 1U5YA 1US2A 3M3OA 4A3IL 5LEKA 4B1MA 5FJHA 4CDQC 2O5JD 5DZGA 3CU7A 3NNJA 4YGDA 4CSWA 1PGL2 3BODA 2A6YA 2A3XA 4DEQA 2PLV2 2XH6A 3L2HA 1EAH2 5CFCC 4AAPA 5DAPA 1GUIA 5IHRA 1REFA 2BGPA 4QGLA 1AYM2 3T0DA 4QXCA 2CHHA 5CFDB 4DO0A 1Z0HA 4AR2A 1O6UA 1WUVA 3V0AA 3ZVXA 1MEC3 2B46X 1Y4WA 5FPZA 4CTEA 1H8VA 4QIWP 2DVGA 2D40A 1RJ7A 3DECA 4NIHA 1R0FA 3AJYA 1QXPA 5KBFA 1NQDA 2YB7A 4LULA 1Z7S2 5AI3A 1IS5A 2UY8A 2YBSA 5HI0A 3GZAA 3WP5A 4CUGA 1NA1C 4Y20A 2NLRA 3S2HL 4PBOA 2HWE2 4AQ2A 4E4DX 2K0GA 3PIGA 3I3QA 4J6GA 2C6AA 1XNTA 1YI7A 2QQPA 2GN3A 2KA3A 2BP6A 3K3NA 2XVKA 3N7LA 3WSOA 3OBTA 3MF6A 1DGWX 1B09A 3K51A 3R4SA 2BYVE 4UWDA 5FLHA 4GALA 2BFUL 5EJ3A 5FO7B 3ZYGA 5BNOA 1CIWA 3CKHA 2P6HA 3OUIA 3O14A 1VBB1 3LKJA 1YO8A 5FFOC 3ZFGB 1YLLA 4COWA 1U5ZA 4Z92B 1KJLA 4XHXA 4JAEA 5DUVA 1SQ4A 3POGA 2JB4A 3ZXLA 3M3QA 3MIDA 4FOQA 4ISRA 2OX0A 3VBUC 2WIIB 1PMIA 2A6VA 1W9FA 1FMD1 1Q8SA 2XUEA 3JUUA 4PIYA 4F7ZA 2OUHA 2ZKLA 1F9KA 1CZSA 2RMU1 2WFF1 3VD9A 1GLHA 2W2IA 4YZ1A 2C6BA 2QDNA 2R49A 2M4YA 1BJQA 2WNEA 4NHXA 1PIV3 4SBVA 2WZR2 2YDEA 3O0WA 3ZXEA 4QPYA 1RUD2 2J1SA 3AKTA 4Q4X1 5FZCA 1AYN2 1FNZA 3WNOA 1WCSA 2L9LA 3FLPA 4L99A 4A7YA 2VZVA 5HPOA 5AVAA 3S57A 5F39A 1AR83 2RS33 2FBEA 2GH8A 5FPAA 3L2YA 5IVBA 2PMZP 1MEC2 4NAMA 1S0EA 1PHMA 1RUNA 4N8MA 4CDUC 2VM9A 5GJ6A 2WNVB 3HQRA 4M3CB 4QXHA 3ZSKA 1JZ2A 1NLSA 1PO12 2CGOA 1RXGA 2VBDA 3LDKA 4FPEA 3WWLA 5FYUA 4CP0A 5C33A 4MG2A 2V73A 5JOWA 3PUSA 2DCTA 4FPGA 2XL9A 4WM7B 5C4WC 5FOJB 3MW3A 4GB31 3UK9A 5KC6A 3TEWA 3ZFEA 3B7MA 1F4LA 4JHZA 1CAWA 4BQ4A 1RMU1 2ARAA 3WZ1A 5GLTA 4HPKA 4NRPA 2VTXA 2JDPA 1QEXA 1PK6C 2ZIXA 3ZFEB 1T9PA 2ZKNA 3D5OA 3EHKA 5GAEc 5A7WB 1NZCA 2QZ3A 1CAWB 2W68A 4JGYB 1ENSA 4TWTA 3TEYA 2CGPA 3MSUA 1DYKA 2ZEYA 2P34A 4QU2A 5KHJA 4MOAA 3DKQA 2W94A 4ASKA 3VUOA 3NJVA 2PPTA 3NSTA 5LA0A 1NE6A 3LE0A 4OI2A 1S30A 2K46A 5LBCA 3K4DA 1XYPA 4FOWA 4FBFA 4HONA 5JSPA 5ISLA 4ARXA 2Q1MA 1W0OA 2PAKA 2VVFA 5ANNA 2BWCA 2ZZJA 5JVVA 1Z92B 2GSYA 3LDRA 3MW2A 1PZ9A 4TLGA 4CDWA 4HKOA 1EUTA 5FXWA 1PIV2 4GXLA 1DQ2A 3VZOA 2C9AA 1POQA 2D6OX 1X82A 4SLIA 3N9QA 2IXKA 3OBAA 1OXCA 1OD5A 2VO5A 1WCQA 5M3ML 1AR91 1QQP1 2DFBA 4GWIA 4D6SA 1QMJA 2B8MA 4KG8A 2W46A 1O8PA 5CYYA 4CDWB 2K2DA 5F5QA 1FMD3 2MPFA 1AR82 5CVRA 1MACA 1MS1A 3ME2A 2RMU3 2Y38A 4LITA 3ILFA 4YVWB 2PHWA 4BJ0A 1TWFL 1HKDA 2YHJA 5A3LA 4JCKA 3HOWL 4GJZA 3H99A 2WWJA 4QB6A 4UW5A 1GP4A 1BVP1 1VRH3 1RDVA 1GFF2 1QDCA 2DCZA 3S1NL 3LF7A 3NNLA 1DQ6A 1RTVA 1NYWA 4D0QA 3S14L 3CEWA 1BBT3 4Q4X3 1GANA 2LRPA 4BQYA 2CV6A 3FZ3A 2V4VA 1REDA 3PU8A 1LR5A 5MFZA 1W2OA 4LO7A 1LESA 1DF0A 2KXLA 2BE5D 3AYEA 4NIAA 1UNBA 4CU8A 3O1PA 4FPJA 2DV9A 1Q8OA 3M3EA 4YWMA 1LEMA 3VDDA 5C8CA 1UD1A 3M7AA 2GC3A 3VBSA 3I3BA 2W1UA 2Q8OA 4RGKA 4A42A 2JDNA 1GNYA 2JG9B 2PAEA 1DYOA 2VOKA 4LHSA 2OYZA 3VV1A 3WR0A 1UKGA 2Z79A 5FZ1A 1A34A 3POYA 4ZXEA 5BYNA 3I59A 1ULDA 2JDHA 1RMU3 1JXNA 1OPOA 1GP6A 2EALA 2VXRA 4EZ4A 1UZYA 1YQCA 1FX5A 1GU3A 3LSEA 4YG0A 2VZTA 3THCA 5FV3A 3JR7A 5J09A 3I59B 1Y43B 5HCFA 2ZHMA 2WN2A 1IPSA 3H42B 4OFGA 3ZXAC 3QH6A 2X5IC 1UQXA 5FLIA 1IROA 4NUBA 4ZS3A 1VBB2 3OSDA 4YARA 1W8ZA 1FYUA 5IAVA 4EN6B 4GQ7A 3CO2A 1FHHA 4MXVA 1SFYA 1VLNA 4QPIA 2D98A 3T0BA 4OYUA 3THDA 4LNVA 1LHUA 4YG6A 2Q8CA 3ZN5A 4OUSA 1Y7BA 1FMD2 1UMZA 2RS51 4XFCA 5H9QA 4QB1A 2RMU2 2WFF2 2X05A 4ZN1B 4QPIB 4BZ4A 5FYZA 1V6KA 3P8BA 2QQIA 4RQPC 5AVPA 1RVF2 3KS7A 3U11A 1BLZA 3DYPA 1N1VA 4Q4X2 3E5XA 1QQP3 1PO22 1DZQA 2OT7A 3FWEA 5I0SA 3KQ4B 2R071 3A22A 3HN1A 4CDXB 1UYPA 1W6MA 2ZEZA 3MIEA 3KV6A 4LO4B 2HYXA 4X6QB 3HN3A 4AI9A 2IZWA 5J96B 4LBKA 1H0BA 4WM8B 1SPPA 2W1SA 3R05A 5IFTA 1WLCA 1X8MA 4JGZC 2W1WA 2VECA 1WCDJ 1RUOA 2WYFA 3VBHC 4TPUA 3MDPA 4Q4Y3 5HCAA 1W6MB 5K0UA 5JIUA 4W6WA 3AYDA 4HVQA 2IXHA 2W39A 4ZY9A 5A1LA 4GB32 1G9DA 3A21A 2HLEA 2B7YA 2XQRA 3NJYA 4R8HA 4S2HA 3ZYJB 5BNOC 3ES1A 1I5PA 1OFNA 1W8OA 2WT0A 4FPYA 2G9FA 2ZJCA 4FFFA 5K0UB 3I2OA 3HNBM 4HMZA 4M00A 4UW4A 3ZDSA 1TWHL 1V9U3 2BUKA 5G05L 3WG1A 3OEAA 4AYBP 5F5AA 5FYVA 2BDRA 4AOCA 5E16A 3TNQA 2VZUA 1SG3A 1QU0A 3IAPA 3I2FA 1AF9A 1VBD3 2WSVA 3HAGA 2EY4E 3LPFA 2JI3A 1C1LA 1JYTA 2B9UA 4ZU4A 2J1AA 2R0HA 2XL7A 1UZWA 2OVUA 2LW8A 2YU2A 5LK5A 3UKTA 1XNKA 4XE9A 5F2WA 1COV1 2R0FA 4KBZA 1TE1B 4H3WA 1I3HA 1WJVA 2AACA 4LBJA 4CP2A 3BALA 1PFUA 2WLQA 2RFKB 3H3UA 1PVXA 3JU9A 1LKMA 1HRI3 2G19A 2I74A 3RJRA 1NX9A 2BTVC 2HWB1 2W9XA 1W8UA 4XW3A 1OF4A 4CCOA 5CADA 4TXWA 2WAQP 1AR92 1QQP2 5F32A 2OA2A 3NJZA 5FMOL 3N4MA 1YYNA 3ZOIA 3D0JA 3S30A 1R1ZA 2RS53 3GBWA 3Q8CA 3SH3A 1YRZA 1SLCA 1XJAA 3IN9A 5GLZA 4XDPA 5LCWL 1H8TA 3VBRA 5F7UA 1OLRA 1FV3A 5CBLA 4B7KA 2LUWA 1V6IA 4ORFA 1HB4A 2BOIA 4RL7A 4YLZA 4DQAA 4RXNA 4XTMA 4XMAA 3RG0A 4MGSA 4XCBA 2RDVA 4DRRA 5BNNB 3TAYA 4I0WB 2R16A 5FO9B 4Y1UA 2R073 2CSGA 5IVYA 2D7FA 3I8TA 4KNCA 4RHV2 5IWFA 1CWPA 3FKIL 4HSLA 3H9CA 4AI1A 4XXBB 2VZPA 1JU3A 2VXJA 1E8JA 1ASJ1 1BEV3 4E4ZA 4N7UA 4LBQD 1YK5A 3CF6E 4BY1L 4ONUA 4OLLA 1LAJA 1Q3EA 1PM7A 3MI8A 1O3SA 2YC4A 4NHYA 2B63L 5JI7A 1GWLA 2VUML 4QKFA 2B45X 5FJ8L 3CL1A 3OPZA 4XFGA 5GLUA 3QH7A 5FZ7A 2AYJA 1W2TA 3KD4A 3NNFA 3RYKA 2EF6A 2J7MA 2RR13 4LBLA 5F3GA 1IU6A 1QJX3 2QQUA 3KVBA 5F6KA 2ZMLA 2APOB 3PVOA 4B4QA 1HX6A 3OGRA 2QNKA 4YNIA 2JENA 3R6SA 4DUWA 2JE9A 2WINB 4Y4RA 5HXMA 1QH7A 3OGJA 2JDMA 4JKLA 4P14A 4DIQA 1MZ5A 4KL1A 1VMHA 4AR6A 1CAVB 1E5HA 2NYDA 4N90A 1DFQA 2VGDA 4DS0A 2FQPA 4L0PA 1GQHA 1HXS1 3FX3A 3IDAA 1AR61 1COV3 2DU0A 3QCWA 3BTXA 4DUXA 1R081 2RS52 3ILNA 3A23A 3IIAA 3LEIA 1UYXA 4QQPA 2YV8A 4K21A 2CDOA 2ZZQA 1MS9A 3LQCA 1KDMA 2DUQA 1JBCA 2EXIA 5IVEA 1W8FA 3RZHA 4FT8A 2WO2A 5J36A 4FTBA 2HWB3 2FDGA 2P3IA 1VBA1 1OF3A 3N36A 1O4YA 1W99A 2ZMNA 4JDNA 5FZ4A 1VZGA 1CADA 2RDQA 4UFIA 3BB6A 3LEKA 3VBSC 2VUDA 4AI8A 5C8CC 3V64A 2GC1A 2NP0A 4DINB 4JQTA 3GTPL 5K7PA 5KXCA 1ZBE2 3B9CA 1YQ2A 3B08B 2Q1FA 2Y6JA 1H30A 1N3PA 3VHOA 1X7NA 2ZX2A 2ZX3A 3OGGA 1K5JA 5BNPB 1V6JA 1JZ4A 4BQ1A 1JI6A 3MPSA 2Q0AA 4KWJA 2UWBA 3K3OA 3NV4A 4BK5A 3J7Z1 5FZOB 2JA6L 3IBMA 1UF2C 4XUQA 5IK8A 5DZFA 3P3PA 5EINC 1V6OA 2GN7A 4BBSL 1ZM1A 2OPKA 1HRV3 1QY4A 1S0CA 3AP4A 4HG6B 4LHKA 4CCCA 2WZ8A 2WQ4A 4HK9A 1GKBA 3WF1A 3ZXKA 5AC91 2PFWA 1SLTA 3WXPA 4XEZA 2JIGA 3MLKA 1JYNA 3HOVL 2IXCA 2WWSA 3APBA 4NWWA 3KYXA 4UOJA 1AL0G 5A6ZA 3UGFA 5KHKA 3WW4A 5JPMB 5DM61 3AZYA 3H9BA 2LROA 3B0AB 2O0OA 1YUDA 3H7JA 5D2AA 4YW5A 2FDKA 1R0JA 3DPRB 5GAHc 4FI9A 2V4AA 2XHNA 2E6VA 2YPJA 4JKKA 3ZYIB 5ANQA 3RSJA 3PKIA 1D4M1 3N9OA 2B5ID 3PTYA 4Q1RA 1FV2A 3H1WA 3FUOA 4Y1XA 5F3IA 4NJ4A 4ATEA 4EJRA 4KU7A 4YFWA 4GMP0 4B1LA 1F8VA 3G6JB 1COV2 3SHRA 3VGIA 2O8OA 3UESA 4XABA 3O1UA 2Y64A 4O65A 3SEEA 3H1YA 3I4ML 1YQ8A 2W47A 4FO9A 2YC2A 2ARCA 1GICA 3I4IA 1TG7A 1OPMA 1V70A 3MIGA 2VMIA 2HWB2 2XONA 3HEIA 3KT1A 3QQCE 1YHFA 5DN2A 2XJPA 2F17A 2R041 3UGHA 4A2UA 4YG3A 4A3DL 4AR3A 3MV11 2A6ED 1AR63 4OCTA 5ACA2 5JOXA 5LK7B 1VAVA 5MGNA 1FI2A 4HL0A 4I3PA 4O9GA 4ZU7A 1DCSA 4NE9A 4F3JA 2J22A 3WEZA 4LQRA 3AZXA 1SEFA 2OZJA 1DLCA 1NKGA 5EPAA 1KQRA 2VR4A 3PDQA 1CX1A 5FZHA 5FMBA 5FZKA 3A0KA 3AKPA 4YGBA 1YV1A 1LHNA 2FZ2A 3AZZA 5LBBA 1B2OA 3KYYA 2QQKA 3N35A 4ATFA 5FTTC 3TRSB 4DZGA 4EN8B 4Q8KA 3ZMOA 1NCQC 1NCRB 3ZYPA 1YFWA 1QCVA 4J25A 1ASJ2 4YM1A 3QACA 5LA2A 1SMVA 3ZYBA 1VIWB 2RM21 3FBYA 4PDWA 5FYBA 1W6PB 1HB2A 2DFCA 4K1ZA 5IFPA 4HZFA 3M4OL 2W08A 2RDRA 1EYBA 3CBNA 2A3YA 4IEUA 5DAXA 4CPBD 3MICA 2M6PA 1W04A 2E9QA 3AXEA 3T2PA 4TN7A 4PDWB 4CCEA 1EY2A 1GOFA 1GNZA 4BQ5A 2B9VA 2PTMA 2H12A 2YG0A 1LU1A 1WD4A 5AC93 4A3BL 2W3JA 3MO4A 4QMAA 1JN2P 3B93A 2A69D 1K83L 2VCBA 4JTOA 1K5MC 1SLIA 2GU9A 2VUCA 2G9GA 3N9PA 1DLLA 4X6AL 3ZDVA 3GBFA 4LO6B 2DUOA 5FUPA 4HVOA 2UU8A 3I2GA 4Y1ZA 5DXDA 1C8M1 1KITA 1H8TC 1GOGA 2YU1A 3VBRC 1LGNA 3JBG1 2YY1A 3ORJA 1GMMA 2GNTA 1ZRPA 3EXUA 4OMCA 4XFAA 1HV1A 1Q56A 2RV9A 1H1MA 2Y33A 4R4ZA 5JMCA 3CMGA 3F2ZA 4E2SA 2VNOA 4AR5A 3M3CA 1HXS2 4UFMA 5G04L 3VDBA 3MF9A 1Q8VA 3W59A 1EUUA 1OOPB 1AR62 3CQOA 1R082 5J3UA 1SFPA 4MO3M 3VN4A 2FDJA 1W8NA 2YMZA 3NL1A 4KGQA 5LA1A 1WLDA 1ND2A 2NMNA 1VR3A 1W9WA 5MLC3 5L7OB 3OEBA 4YM0A 1N1YA 1UY3A 1R0HA 1LU2A 5LB6A 1QNYA 2D43A 3E5QA 1VBA2 3N7MA 4JAAA 1X9TA 2XKOA 1GZWA 1W3VA 2R043 4DUVA 4URAA 3USUB 4CXWA 3H8XA 1ND2B 2FD8A 4XBNA 4IE4A 4AL9A 4QXBA 2IXLA 1F2NA 4PHZA 2XPJA 1I6HL 2G4IA 2QFEA 3EQEA 1MZ6A 4P08A 3WG3A 3WUCA 3MQKB 1GZWB 4D8MA 1VBE3 2H0BA 4IEOA 5C9AC 1W05A 1N47A 5FYSA 3VL9A 4A4AA 5H9PA 4FOVA 1I9RA 1OSGA 1UMIA 1HJGA 4XJZA 5APAA 1JYBA 4LLFA 4LOSA 3VKNA 1NG0A 4A44A 3KV4A 1IPKA 1W03A 3J9SA 2MS3A 4YSFA 4WFN1 2PHFA 2GZWA 2CTVA 3ALQA 1G9CA 2PYTA 2JA7L 3T0AA 5AC92 2RM23 1R9TL 1JHNA 3UGGA 2XDVA 1MS4A 4EWAA 4FTSA 3U0ZA 1NLRA 4YVSA 1ND3B 4Y5Z0 1O91A 3S1RL 1UO9A 4META 4XMIA 2JDYA 5A33A 2XXZA 4NN0A 2ZAHA 2JJ6A 1N1SA 1ZRFA 4BQXA 1OHFA 1O3RA 1QWRA 3LWCA 1IGOA 2V09A 4Q8LA 2RS12 4MH0E 2WL1A 5A80A 3OCPA 2JG8C 3P2AA 2X8KA 1D4M2 1O4TA 2EAKA 2WNOA 3HMYA 4FSJA 5JAXA 3WP4A 4NR1A 1SFNA 4CCNA 3LD8A 3BN6A 4E9KA 2XJVA 5CU1A 3BU0A 2HWD1 1C8M3 1HQWA 2BERA 2JIJA 4OQ8A 4OHXA 1WA4A 4AEDB 1J1TA 1ZBA1 1DZRA 4JRLA 3HVDA 4LTAA 4P9GA 4W6YA 2B39A 4QGMA 4LK7A 1WBFA 5LATA 4C1XA 2P6CA 4NHMA 3ASIA 1VBC1 1LOFA 4YW4A 3WW1A 1U0AA 2R042 5FZ8A 3KGZA 2R063 1RC6A 1T2XA 1DQ4A 1VB2A 5A6YA 2D6LX 2RG4A 3DXUA 2LS6A 2VCAA 5FLML 1NXD1 3ILRA 4BB3A 5FMOS 1RUF3 4MGYE 2Y0SP 4XJWA 3WNKA 1SCSA 2XKPA 1H1IA 3NAPC 4LEJA 3LIGA 5DG1A 1POV1 2OZ6A 2BZDA 5GZCA 1RUJ1 4V2WA 2A68D 4E27A 2VL6A 5IATA 1Y3TA 3WP3A 1KRIA 1W6NB 5DAVA 2RS31 3RRDA 3HT1A 3H0OA 1CAAA 2QQVA 5CFDA 3ZN6A 5FZ9A 2HYKA 4EROA 4YM2A 1H2KA 1K42A 1Z78A 2HEWF 1LGBA 1A78A 4R9DA 3RZOL 5DDJ3 1ZVFA 3VZLA 4YW6A 5ABJB 3ES4A 1I5ZA 2F4LA 1BYHA 2ZGPA 2B5HA 5GLWA 3J26N 3HAXC 5IVFA 2CKCA 1H2MA 4RN5A 3ZN6B 2QE3A 3RPQA 4C91A 5FK8A 4N53B 3JD72 3FE5A 3QOPA 1IHMA 2FCVA 4QWNA 3GCXA 2JDZA 2VAUA 5C5UA 2D5HA 4IV1C 4AFAA 4C0HA 4PLNA 1A6CA 1EP0A 1OVSA 1Q8QA 2Q8EA 3THTA 3I2HA 5CA6A 4EN7B 3VKOA 3GCWA 1HW5A 4XUNA 3RZKA 2VOVA 4Q4V1 2WS91 3DEMA 1HB3A 1JYCA 5FZDA 3CJIB 3NO8A 4GH4A 1HQLA 1JOPA 1ODNA 2BGOA 3AMPA 4JRAA 4WVWA 1UIJA 4EZHA 3SS2A 1RUI3 2WN3A 5FZ0A 1C8M2 1IRNA 3RYPA 1X9PA 3JBG2 4FCAA 3KVAA 2PHUA 5EV7A 3WCRA 1DBNA 1O59A 4EN0A 4D7SA 1TWCL 5BPXA 1RITA 3ZFGA 1SHWB 4GH4B 3RFRA 3TYJA 5FCCA 2RDSA 1ACCA 1F15A 3DGTA 4UFKA 2QDRA 5KHHA 5CKMA 4LO8A 4AQ6A 3T4HB 1W2UA 5CKQA 2HWD3 4GULA 2EVXA 4K3UA 4NPRA 3IAQA 1ZBA3 2Y60A 2RJKA 5EFUA 1I6XA 2VQAA 3TBDA 4P02B 1LRHA 2Q30A 3DKWA 2WAAA 5FXXA 5T55A 1VBC3 2PN5A 3CIHA 1OFSA 1VALA 3VZJA 1PNGA 1QIQA 1LODA 4OHYA 3IB3A 3TWIA 1S0BA 3PURA 3R4UA 5A1AA 3GF6A 1R093 4LE4A 4LUKA 3S5AA 3AP7A 4ES8A 2XJUA 3OUJA 1DHKB 4M4RA 5GZEA 3VPBE 1AX1A 1VRH1 2D3SA 4PF5A 3O1MA 3ACIA 2A3WA 3H9AA 1FPN1 1POV3 1BBT1 4TYSA 1RUJ3 2CY6A 3O0VA 1H7VA 3ZN4A 3ZKYA 2OW4A 5K8SA 2WNVA 2A73B 4M3CA 3EBRA 4CEWB 2HBTA 2VZ3A 3B00A 4A7KA 4BU2A 3WDVA 2Z42A 4GS7D 3LPGA 1Y9GA 7RXNA 1L7LA 4WM7A 1UIKA 3LEMA 2VOXA 3WY6A 4AE2A 2XBO1 3MIHA 4CUCA 5JPNB 3SKJE 3GTOL 2K9ZA 1LTEA 1GWMA 5DG2A 4FPHA 1IZ3A 1QF3A 2YZ4A 1CJDA 4TLFA 2V72A 4DXSA 5L9BA 4PI0A 3ZO0B 3INAA 1ULEA 4AQSA 5L9VA 2EIEA 1JZ3A 3AL6A 3ZYFA 5C3QA 2A6XA 3RZMA 2JA5L 3OTFA 2BRTA 2VOTA 2PQSA 3EO6A 4GZ9A 5A7WA 5FPUA 1MQTB 3PUHA 2R1DA 4JGYA 3MUY1 4XJ8A 3P6BA 4IGPA 4AEMA 3O1TA 8RXNA 2C9KA 2ORXA 2VZ1A 4LBOA 4HFSA 4LBNA 4XIOA 2ZGNA 4O9EA 2XLAA 4R4XA 4ZPIA 3TOJA 4Z2WA 2HBUA 2VCCA 3WCSA 3GYDA 4CXXA 1JYIA 1TME1 1FATA 4Q4V3 2WS93 1M4WA 2VE1A 2ZX1A 4LOTA 4UAPA 4B29A 2IXIA 3RJ2X 4IV3A 5FXVA 2WAOA 2NVQL 5FLJA 2JICA 2VZSA 4CE8A 2XWJB 3R0RA 1R0GA 1ZBA2 4XXPA 3Q8AA 2D6MA 3HPNA 3A4UA 3GXUA 3S7IA 3TEZA 5A3PA 2DCJA 2QQNA 2XLFA 1SDDB 1S1AA 3O1OA 4U2AA 3BGAA 3PL0A 2FHRA 4AZZA 4IV3B 4LUMA 4D6QA 4MGTA 2DTWA 1H6YA 2VULA 4R9AA 5JCTA 3KM5A 5FP3A 1IQDC 1HIXA 1YJKA 5BUVA 5FYYA 3RZTA 4YVWA 4NIIA 3ACHA 5K9YA 1RUJ2 1SMWA 4YVSC 3TEXA 4CZSA 3RMYA 1ULFA 2JB8A 4BPZA 3OF1A 1ZRDA 1QXRA 2RS32 4P5YA 4MXWA 5JMOA 3U14A 4P9LA 4AW7A 4XBQA 2VW0A 3UL2A 2ZCWA 5DMYA 4A6OA 3FL7A 3VLBB 4C0BA 3U1XA 4Y4YA 1FPN3 4CCDA 1SMMA 3KYVA 2EICA 4Q4Y1 1S55A 4UBGA 2F4PA 4LR4A 4MXWB 3BCWA 4CRQA 4C3HL 1UX6A 1DGLA 2DYCA 1D0GA 4S2GA 4GAZA 2NVXL 3NV1A 4XQWA 2JG9A 4LO5B 3WQ1A 2XBO3 2HEVF 5F3CA 5HBAA 5MFPA 1W90A 3KHCA 2VY0A 1J83A 2VQUA 1SLAA 5HCHA 3BTYA 3VBFB 5DABA 2DSXA 4Q5OA 4RGGA 1B13A 4BY7L 1V9U1 3FFZA 1ZRIA 2W92A 4K8RB 3VD7A 2BW8A 1LNSA 5F6LB 3N9MA 3TNPB 1ZZ6A 2DVDA 2WS92 3PMEA 2OPWA 1GNHA 2ERJA 5C4JL 3PJQA 4Q4V2 4FAHA 2M4VA 3N7KA 1DVBA 2BJSA 1X36A 3SNMA 5FY1A 1VBD1 1DYPA 2Y26A 1PMHX 4CYDA 2E53A 2HWC3 1DIWA 5D21A 1ODHA 2BV4A 3VBOA 4QQ2A 4RFRB 2BPA2 1UZZA 1WMDA 3H8UA 3OD4A 4X8PA 1TME3 3POIA 4HVRA 3RMXA 2AENA 3URFA 1DU3D 4Y7NL 4PCRA 1XRUA 2EXKA 2KD7A 2VU9A 3FJSA 3VBOB 4MGIE 1B35A 2PQQA 1ALYA 1OLMA 1HRI1 5CFDC 4LT5A 1OURA 5FZ6A 5I0UA 4L8QA 1PVC3 2VBBA 1OT5A 1BVVA 4U671 4POGA 1BKZA 4B3NA 4D69A 4DXRA 5FZEA 2IXJA 1B35B 1JOJA 3M3IA 4IEVA 3FDJA 5EQUA 4KU8A 3POSA 1LJ7A 5CB7A 3T1MA 4WZCA 4B8EA 4K8FA 3I49A 1SLBA 1ENRA 3LOIA 3CQZL 4JAFA 2DVFA 2XOMA 1J1LA 3MFAA 4CDXA 3E97A 3GTLL 1VRH2 2PSMC 2J1UA 2ZGTA 1BZWA 3C3VA 3E5UA 3AJZA 1FPN2 4WM8A 5FAXA 4IE5A 1BBT2 5JXHA 1H2NA 4K6BA 1AJKA 1KS5A 3A44A 1NQJA 3EMRA 5T3NA 3WQ7A 3I3MA 2XQXA 4KGGA 4DOUA 5C70A 3WNXA 1NNQA 3GTKL 4HXCA 5LBEA 1VCXA 1HQNA 3IMMA 3IM0A 4COZA 4Q0SA 2XBO2 1JODA 5L9RA 1D2QA 1BEV1 2TUNA 5FIXA 2QQMA 2UURA 4XQ4A 5FPLA 1XYOA 3UYJA 3LZZA 4A3LL 1Y1WL 3HBZA 1UOBA 1CAUB 3VL8A 3ZFGC 4RSUA 2XVLA 4GJYA 2P17A 4YZ4A 4XQDA 4H14A 4NRQA 1R64A 1WW4A 3U10A 1XPWA 4BXSV 2E26A 3FLTA 5DUUA 2ZXQA 1RUC1 1OA3A 1V0AA 2E32A 4BQ2A 3ST7A 5B2GB 5I93A 3PL5A 2VC9A 1RMU2 3P1IA 1T9QA 1V6MA 4LBQB 4XUOA 3I2DA 1TZOA 3POFA 1D0HA 5FUNA 2RR11 3H97A 3I4NL 1QJX1 5FZMA 4YZ2A 5JXIA 1ZZ8A 5J98B 3W58A 5EHDA 4W50A 5JZGA 2NYYA 3K2OA 5AFBA 1TME2 1JZ6A 4LA2A 4BOWA 5T5PA 3NKTA 4O61A 1QH6A 1SZBA 4QGNA 5M0TA 4N43B 4A45A 4A93L 2NVTL 3UJQA 3WF3A 3WQBA 1V00A 1ST8A 5JZGB 1SCRA 5I91A 4M3CF 4HT1T 3V65A 3PTRB 1W8TA 3WP6A 1QKQA 1QYBA 5H9RA 5I0RA 1AX0A 4FPKA 5C3PA 2WNVC 4R9BA 3NKGA 1WZXA 2A7AA 4QPGA 1VMJA 1ZA4A 3M3YL 4XFIA 5T50A 5FREA 1YFYA 2WNUA 4Q4W3 4WM7C 3WQ0A 4Q0PA 4AGGA 4LMFA 2IFWA 1AXYA 1ZX5A 1DQ5A 2P3KA 1RUH1 4AFMA 1VRBA 5C7GA 5FJKA 1UMHA 1LCLA 5EYXA 5LA9A 3S2DL 3NQHA 1JTZX 2DCYA 4QPGB 5BNNA 3S5QA 5L36A 2WNUB 4OQ9A 4AVSA 3JQXA 3ZFEC 2ZBJA 5FQ0B 1AL21 4E4SA 4HN1A 1S2BA 4QD2A 1BCXA 1UY1A 4JGYC 4H7LA 1YNAA 5HXVA 2JXAA 5F2SA 4AYUA 4Q0VA 4RD7A 4COYA 3DCQA 5H9SA 2R7ZL 5C8WA 2J1EA 1RYYA 2QTWB 4Y3OA 4Q4Y2 3ZMNA 4Q0QA 4EYUA 1J59A 1UY4A 3SH4A 4NAOA 4KWLA 2YPDA 2A1XA 3U75A 1WMEA 1I3QL 1WMFA 4LE3A 1KJRA 4PIXA 4YM3A 1HRV1 3V0BB 1H6XA 3LOBA 1OQEA 1CESA 4RR3B 4EV0A 1O5LA 4D94A 3ACGA 3K35A 5C44L 4UF0B 4XETA 1NAEA 1F35A 2OUJA 3E6CC 2G9ZA 1CJPA 1V9U2 3ZFFA 1CVNA 1REEA 3WDWA 4U36A 2D97A 4XXAA 3UKNA 2VTFA 2FDHA 2AQCA 3EB7A 1RUC3 3PNAA 5ERLA 5A32A 1OH3A 4EQVA 4ITCA 4MLOA 1YQ5A 4H2AA 4CDWC 1VBD2 1D2SA 5FO8B 5JR2A 2VOWA 5FPBA 2EIBA 4RS5B 3O5SA 3GZEA 4C8DA 1DGRA 4XYXA 3ZFFB 2XJSA 1GQGA 4AHZA 1JH5A 1RHI3 3AMHA 1J3RA 4JQRA 3CNAA 2WA3A 4H55A 4YVWC 4XDOA 3H0GL 2YBPA 3C7GA 1CAVA 4OVEA 2HWF1 4XC9A 5A32B 2ZS6B 1PM4A 3KB5A 4COVA 1D4VB 4BIFA 1QGLA 1V6LA 4BBRL 3VHNA 2DU1A 1HRI2 1C8NA 3IPVB 2D6KA 1ZZBA 1UPIA 5A7SA 4AGVA 2DVBA 2GMMA 2VVDA 3BPSA 3K75B 2DTYA 2ZGUA 5IVVA 4YGEA 2XR4A 3UV9A 3E6BA 3J7Y1 4IGQA 1VE0A 1CZTA 3FN9A 3R4DB 1UL9A 4HANA 2P3JA 3KQRA 5H1Sc 4GKXA 4XJ9A 5FY5A 1A8MA 4DPNA 4KH9A 2JD4A 1RWDA 4CEYB 1W06A 2JG9C 2UYAA 3ENRA 5CAZA 3ETQA 1QNWA 5F1RA 4NRMA 1RDGA 1RUH3 4CCKA 1OA4A 2OQ7A 4UW3A 4V196 3IDEA 3LEGA 5A3NA 5IYCL 2DWRA 5BNPA 3RWKX 4Y33A 2R072 1RUG1 1SLLA 5FDBA 4UY81 4BYYA 4Y52L 1PMJX 3U4SA 4XGHA 4LIUA 1AL23 1PZ8A 1DQ1A 1JMUB 5FZOA 3S1ML 1ULGA 3T4VA 3WNLA 1BEV2 3D8CA 4PJYA 3UETA 3BIWE 1PZXA 1RGSA 4L92A 4DB5A 4C2M1 4HK8A 3POWA 5FZBA 1ZYBA 4A3CL 2Z3RB 1XB9A 2GNMA 2OS2A 4QDSA 2H0VA 1U12A 3GALA 5FMCA 1UY2A 4FPLA 4FQZA 5JSOA 1O5UA 1ULPA 3DYMA 3W20A 2X29A 5FYHA 1W6QA 1UOGA 2ARXA 3RVHA 5C71A 4A3KL 3WF0A 3KT7A 4R52A 3S1QL 4WVMA 1RIRA 5DUWA 3DPRA 4FFHA 3LFIA 2RR12 3MFCA 3NRUA 4QPIC 1DG6A 1QJX2 3HWJA 3AYCA 1VAMA 1H2LA 2E7TA 2R93L 3ZYHA 4IEQA 1UKRA 3PIO1 1W6QB 4P9IA 1MZEA 2JWPA 2KR2A 4W4ZA 3WNMA 3WW3A 1DX8A 2QL0A 4WVMB 1YUZA 5T5OA 2WABA 5C3EL 4NIDA 3VZNA 3U4XA 5L73A 1AJOA 4CDXC 1NE4A 5D8AA 2VCMA 4MHRA 1G9FA 3OB8A 4WM8C 1JYWA 4DFSA 2VW1A 2P1BA 2X09A 4JHTA 3PO3L 2HWF3 4M01A 4K9SA 1OA2A 4AI2A 2PHXA 3N9LA 3GM8A 3A7QA 2QQOA 3KMHA 2E7QA 2P37A 3AKSA 5D8AB 3QD6A 4AK3A 4ZN3B 4QX5A 1BK0A 3B3QE 3D3AA 5C6CA 3NNGA 1BE7A 3HKZP 1UX7A 2XB6C 2E51A 3LWRB 3HJWB 1RUH2 1UCXA 4UT5A 2GNBA 5K0UC 2VJXA 2ZGLA 1HN1A 4AI0A 5FWEA 2XJRA 3KZ4C 2GC2A 2YFZA 3C7OA 3WDUA 2W0XA 1AL22 2WT1A 1RYQA 2R30A 4CDQB 3WUDA 4D7YA 2FDIA 4XZPA 4ZZ5A 3OOXA 4Z8BA 1VBE1 1QOSA 5FP7A 1NCRA 2KN9A 1H9WA 3AFKA 3OPTA 1TNFA 4EN9B 4FFGA 3PO2L 1EV11 1CR7A 2ZA9A 3B94A 4HETA 4N9HA 1IS4A 1LHWA 5CFCB 1W6PA 1RUG3 1WBLA 4CCLA 1I1EA 5M5YL 4B7EA 1CPMA 3USSA 5FPVA 5M5WL 1DZTA 3KT4A 3H8RA 3PJYA 2DCKA 1HRV2 2FCTA 2ZX4A 2Y0IA 3FFQA 3RI9A 2A70A 4NHLA 1O7FA 2VUJA 2LM3A 2VNVA 4GD4A 1LKNA 1CD3G 3I3DA 1ZREA 2VTXJ 3S15L 2O1QA 2FCUA 2MEV1 3SITA 3I54A 2CU5A 1E5RA 2IVJA 3V56A 3S7EA 3IZOA 1SACA 1WWYA 1YQ6A 4Q0UA 3ZX7A 5CG9A 4V1PA 3UNPA 1NA1B 1NT0A 4QPGC 3T2TA 3BPZA 4Q26A 3RNSA 4AWDA 2BQPA 5FZGA 3IMNA 2WT2A 3WV6A 2XUMA 4HKLA 1PX4A 2RE9A 1A3KA 1YI9A 1GZ9A 3J8F3 1PFWA 3H7YA 3JB8A 3CJXA 1PX3A 3K77A 4L9BA 4N7IA 5IVCA 2HWF2 2JDUA 4BLIA 5BNNC 4XACA 5A7QA 1JZ5A 3WF4A 2D3RA 1OOPA 4YW2A 1KDKA 2ZPXA 3WHTA 1BK1A 3WLUA 3FC0A 1TEIA 3L9JT 5SV8A 2CDPA 1LHOA 5CIRA 5L7OA 1SBEA 4BXFA 4UFLA 4QX1A 2R061 2K2SA 3QBQA 3VBUB 5JDBA 1P7PA 3RZZA 1A8DA 4XURA 3OUHA 3USUA 4A7ZA 1RUF1 3JCIA 3LWPB 3BOPA 4LHLA 1YFUA 2Z2SB 3NW4A 4CU7A 4L97A 2VMCA 4BHPA 4QQHA 5IYYA 2V5DA 3WG4A 1AR71 1QOTA 2D5FA 4YPJA 1VZIA 2QJVA 4NROA 1G6NA 2YC0A 1C1FA 4JX0A 5C5TA 1QJZA 1UU4A 3HOYL 3U78A 4BA6A 2GMPA 1I50L 3FHIB 1QJY3 2CWSA 3TB0A 2GH2A 2JKBA 4FP3A 2ZEXA 1TNRA 5DAWA 3JZVA 2WQ8A 4WV8A 3U37A 4CDUB 1TVGA 1XNDA 4KQ7A 1APNA 4IUGA 5DDJ1 2DBIA 4S2FA 1CPNA 1LGCA 2C26A 1EV13 4N9IA 3OJBA 4CUAA 1NOVA 5LWBA 3ZXFA 3BI3A 3BTAA 1FHMA 2QKDA 3OGSA 5EXOA 1SFOL 1ND3A 4E2GA 2NQYA 4G6BA 1Y9QA 3U07A 3O1VA 2YBKA 1C57A 5I0TA 5A3OA 5GADc 2Y6GA 1IKQA 1LULA 2ZGSA 3DXTA 1M06G 3N9NA 4QDQA 3J4UH 4A3XA 3MLLA 4YRDA 4DY5A 2MNGA 1Y1VL 1TMF3 1QOOA 4IXLA 4DXTA 5A6XA 1MR5A 1PK6B 3MEPA 5IP7L 1NXEA 2MEV3 3JXSA 4LKFA 5EJ1B 3GTQL 2PHRA 1QJU1 2R32A 1RUD1 2AZ5A 2YYOA 2DUPA 1S0GA 3UKVA 5DQ0A 3LB9A 1RUI1 4QAWA 4D3WA 4DMIA 1O3QA 2ZACA 1KGYA 1S0JA 3SLIA 1W8HA 3OY8B 4OMDA 1LKPA 5IJRA 5FRAA 3IU3I 3IDCB 3ZSJA 5EP9A 2J42A 3IWZA 5FKBA 3ZXJA 4AEDA 4ZHNA 1LB2A 5GZFA 3RQ0A 2J1RA 3K4AA 4XJUA 2AH2A 5FY0A 1ULCA 5FK7A 6RXNA 1KXGA 4QM8A 4BIOA 5BNPC 2ZABA 3BTZA 2QVSB 1MZFA 2AYHA 1Q8PA 5HV0A 1FT9A 1F5JA 1EAH3 2W5FA 4BMBA 1GWKA 1WGPA 4JC1A 1KEXA 3LPEB 3JQWA 1D7PM 2VBPA 2VZRA 4RA0A 3C2UA 1MS3A 3LWVB 4PI2A 1BQPA 4DXZA 2Z69A 1Q5OA 2PXJA 4LJHA 3KF3A 4LIVA 5KHGA 3KYUA 2V5YA 3ZLIA 1VAKA 2GC0A 5M5XL 1R091 3HJRA 5LASA 3T3YA 3GZUC 3T09A 5C3OA 1WCUA 1W6NA 1YUXA 2DURA 5AN9H 5EZWA 2SLIA 4AEJA 1VBE2 1JUHA 4IGOA 4CA9A 1AR73 2ADEA 3DPRC 1EV12 1YIPA 1YWKA 5EJZB 1LOAA 1LOBA 2W1QA 3AMMA 5ABJA 1N1TA 2IFRA 5C3RA 3B9IA 4GMP1 4ZXKA 3TN91 3OGVA 1QXJA 2JEMA 4FOYA 4AG4A 4N53A 1FXZA 1MS5A 1UYZA 2VD7A 4XUPA 5LBFA 2VNGA 2RM22 5FZFA 4YZ3A 4A3EL 3HQUA 2MEV2 1PFVA 5FYMA 4Y22B 5E1RA 2XVGA 4E8DA 1IU5A 1DP0A 3ZSEA 5FBJA 2X10A 2YFUA 3FUQA 2R6QA 3GBGA 4FQ4A 3CJIA 3LIHA 3POBA 4G4FA 2Q8DA 3K48A 4AR4A 1OUXA 5GZGA 2BVVA 5BXXA 2X5IA 3D0SA 3PWFA 2WKKA 4IESA 4DNYA 2DF7A 2JI2A 1BQ9A 2WJSA 4EWDA 3HIFA 3AK0A 3W5NA 2WZR3 2ZHNA 2RDNA 5FYTA 5JXJA 3AMQA 1QJU3 1RUD3 5T52A 2CNAA 1AYN3 1CN1A 1HN0A 1OKQA 2X5IB 4LORA 4XIKA 3WF2A 3HOZL 3K4ZA 3NVCA 2WRAA 5J37A 3B69A 2ZEWA 5JXGA 5LY1A 5FR3A 5FZLA 2Z4FA 1PGW1 1NCRC 4O7XA 4RQPA 4D7TA 4JKMA 3RGBA 3SISA 1IG0A 3C7EA 3KCCA 5EIYB 4OHWA 2R062 3AZWA 1LHVA 3KV9A 1S0FA 1YCIA 1S24A 1PO13 3MUZ1 1C5IA 1RUF2 1AXZA 2KKDA 4RYDA 3VZMA 3V0AB 1NXGA 4IQPA 4RQPB 1N3OA 5LRSA 2VL4A 3POJA 4LLOA 5FZAA 5T5JA 1ZRCA 1AR72 1QJEA 1LEDA 4PDWC 4OHVA 3GTJL 3J7NA 1C5HA 3PUIA 2ZGMA 4XOGA 4JGZA 5A3UA 3VD4A 4KI5M 4MX3A 5FY8A 4AVTA 2ATFA 2AGSA 3VBHA 5I8TA 3H8OA 2A6WA 4MHUA 2I07B 4CEWA 5KR7A 3MYXA 4Y20B 2CKAA 1GSLA 1W8WA 2CL2A 3SCFA 1S4CA 1T9OA 2AUYA 2JE8A 3O1RA 1K3IA 4QX8A 5DDJ2 4JGZB 3H3VM 1K45A 2ZHLA 2PVXA 3VBHB 2A6HD 4E8CA 3ITQA 3DL3A 5DM71 4Z07A 5F8PA 4ARYA 1VP6A 1OWCA 3IDBB 4D6RA 3ELNA 2GALA 2ZTNA 2IWGB 2W91A 1VJ2A 3MBWA 4NPLA 5FY4A 4GMP3 2WR9A 3TN93 1J58A 3NV3A 4FPOB 5BNOB 2LCQA 1BFYA 1OOPC 1T6GC 1UWWA 5JR7B 1AX2A 2D6PA 1MQTA 1WW7A 1KFXL 3F95A 3KLSA 3LA7A 4P9WA 4XF3A 1BRFA 3HOUL 2WDBA 3SQOA 4BCUA 5KWRA 2IUWA 5L7OC 1RVF1 4AVAA 1JHJA 3GNEA 5IW0A 4NO4A 1QJU2 1XNAA 1AHSA 1DDLA 3HT2A 1PO21 2CAUA 2WO1A 3ATGA 1RUI2 2NN8A 2B4KA 2GP3A 4M0NA 1ND2C 4LKDA 3AFGA 2HWC1 5F5CA 4ASMB 4C1WA 4JAGA 4XJAA 2JD9A 4H7MA 3VDAA 4FP2A 4YW1A 5IYBL 3NWKA 3IIIA 3WDYA 4NIGA 3KV5A 1W2AX 3DYOA 4QT6A 4I2OA 1WW5A 4Q27A 4AVCA 3VDCA 4EWEA 4NMIA 3T08A 3A0NA 2HWD2 2P4EA 3CDZB 1G7YA 4PLMA 3WW2A 3WX5A 5CISA 1PVC1 5A6QA 1NUKA 5FP8A 2XLGA 5KXEA 1VBC2 4XCAA 3DV8A 1DQ0A 3HJYB 1L3JA 1RJ8A 3PIJA 1FOD1 4OI0A 1W9SA 1IQAA 1XU2A 3RZGA 5AI2A 3AC0A 4AXOA 1CGPA 1GV9A 2VVEA 1ND3C 1R092 3UJOA 2J1VA 4QQLA 2MHFA 4QQOA 5LRRA 1T6BX 3LSDA 1G9BA 1NZIA 4QU1A 4UYBA 4BDVB 4JZRA 3H3ZA 3VDDC 2QQWA 4PBPA 4TVMA 4HPKB 4BMEA 3HNMA 4IEPA 3LFMA 1ZZ7A 3ABZA 4CXYA 4GA9A 1GQPA 5K2ME 4MUVA 4KG0A 3P5BA 4QHOA 2E2HL 2DVAA 2ET1A 2GP5A 1W39A 2JX9A 4IEYA 2ZHKA 3TN92 5FXZA 2CYFA 1E57A 3E6DA 3UT0A 3Q8FA 3W9AA 5FZIA 5GLVA 2Y34A 5EIOC 1XE7A 1AVBA 4AEDC 1US3A 1VBB3 5LEJA 3ZM8A 3HQXA 3VBFA 4CVUA 2YUEA 3OPWA 1VPHA 4I01A 4NVPA 1HB1A 5K4LA 3CZUA 2YXSA 3ZYRA 5C4XL 1W9TA 1OC1A 2ARBA 2IC1A 4LKEA 3VHPA 1IS3A 1L7QA 2QBXA 4P9XA 2WFF3 3BVCA 2WB1P 5GAGc 4YYOA 1LOFC 4E2QA 5FWJA 3SKVA 2JECA 1RVF3 2XWBB 3BUCA 1XSRA 4AVBA 2W87A 1XQNA 1MPXA 2NVYL 5IYDL 2VH9A 1PO23 4YWAA 4G9SB 5GM0A 3RYGA 5HCBA 4ET7A 1JS9A 5M3FL 2O14A 1GYKA 2R1BA 4RHV1 3J7MA 5A70A 1RYTA 3LA2A 1UXXX 5A7PA 4AHWA 1PGW2 1IS6A 2WQZC 5JOZA 1WMXA 4DEVA 3NV2A 1H9PA 4OZOA 3MIFA 3LWQB 3NJXA 3PU3A 4GIQA 5ABJC 1W9YA 1FNYA 3PVNA 3VKMA 1WW6A 1XXNA 4FPCA 4LPLA 4Q4W1 4UW6A 3I3EA 1WCML 3VKLA 4N53C 4GB33 3LGRA 4BH9A 5A3TA 3WINE 4E4HA 4E6YA 3DF0A 3WOGA 4LKSA 4P9YA 5I8SA 3VDDB 4RGAA 4CP1A 3POEA 5C8CB 1FOD3 2ZGKA 3OBRA 4Q29A 3S17L 3PKJA 3KSCA 3VBSB 1HV0A 2Y0OA 4NOTA 4YFZA 1PZ7A 4ZZ8A 4JADA 5J7MA 1ZZCA 3AMNA 5T5LA 4K1YA 2V0EA 5LZ6A 1X33A 2C24A 4JVAA 1O4ZA 3CJIC 5FUIA 2PAMA 1LOCA 1QHDA 2H6BA 2X53S 4S2DA 2QQJA 4QM9A 2BBVA 2VZQA 5KXDA 1H4GA 3T2QA 5JSRA 1UAIA 1E5IA 2O8QA 2VMGA 1CAUA 4QX3A 2Q4SA 4GH4C 2R7EB 2VPVA 4YGCA 2QZ2A 2W95A 3WT3A 2I2SA 1YIFA 2ZMKA 1S2ZA 2Y6KA 4NHKA 3D4KA 5FYCA 5CG8A 2WFPA 1JYVA 1C3HA 4LBQA 4R9CA 1ULOA 2TEPA 4I0AA 4BXXL 4PLOA 4AHYA 2FMDA 4XFFA 4AVVA 4IDZA 1SBDA 1YEWA 2AEZA 2UWCA 3N3HA 5LY2A 1AR93 2TBVA 4MZUA 1UW8A 3AKRA 1CX4A 3DUIA 5IP9L 4J1WA 4MADA 4YZ5A 5IK7A 2HWC2 3PMSA 1XBFA 4PT6A 1J84A 1ZBE1 2EAAA 2EXJA 4N43A 1RHI1 1GOHA 3ZPOA 3LWOB 3Q9OA 4I3GA 2AREA 4IE0A 4FAGA 1W2NA 2YU9L 1CAXA 3AM2A 3H3LA 2DDUA 2OXBA 4A3GL 5IUQA 1F4HA 2E63A 5FBZA 3ROUA 1R0IA 4RFT0 4CEWC 4F8AA 5A3WA 3P3NA 3RYRA 1ODMA 1CAXB 2PA7A 4QKBA 1SPPB 2LALA 3PUAA 4RHV3 5DZEA 3GHNA 3ZR6A 1PVC2 3B5LB 2SBAA 5E6HA 3AZVA 5FOBB 2UYBA 5DAQA 5ACA1 4FTEA 4PF1A 2CR8A 1ONAA 1FOD2 2WSUA 4MVTA 2BEOA 3X29B 1KS4A 4GWNA 3MPBA 1AXKA 3SC7X 1JW6A 1H1AA 5E8AA 1MS0A 3MW4A 2R92L 2CAVA 4OI4A 2HVYC 1STMA 2D6NA 4M3CE 5FQ0A 1NCQA 3AP9A 1W0PA 1MQTC 3AB0A 4LXLA 3T1LA 3ON7A 1OQDA 1XC6A 2VZOA 4CP9A 4IE6A 4QX0A 5FMDA 3T30A 3ZIXA 3BKZA 1O8SA 5F3EA 4AF9A 1UY0A 1OH4A 1N3QA 1TWAL 2HKXA 2LTNA 3J7HA 4P00B 1NCQB 1YJLA 3ETPA 2ERFA 5JUVA 2C1FA 3SXWA 4XZUG 4CP9B 3V0BA 1XNCA 4RR3A 2IVIB 2ID4A 5IK4A 1X8EA 4QKDA 4XTPA 2FMYA 1HLCA 4UF0A 5JIAA 4WBBA 3O7OA 4Z1VA 1K5MA 1WCKA 4AI3A 2P3YA 4Y1VA 2I45A 3AX4A 1EPZA 3KCXA 4IV3C 4ME3A 1AZDA 3WDTA 1RB8G 1AUYA 4W65A 2ZOEB 1QQTA 3WG2A 2BVBA 3GJAA 3MV01 3S0MA 2UY9A 2VMDA 4ZKTB 1BMV1 4RS5A 1R1A1 2Z5WA 1HJFA 3AXDA 5F9TA 1K5MB 1WLWA 2Q1ZB 1W0NA 3RS6A 2E7AA 4W8JA 1C4RA 4MGZE 2AEYA 3J7LA 4FXGB 1XE8A 4Z2AA 3RZ6A 1H8TB 3VBRB 3WVJA 4EE2A 1ZBE3 2ET7A 5T54A 1NY71 5FP4A 1IPJA 1WD3A 3FHAA 3IPVA 1U5IA 2TNFA 4GWMA 4QHBA 4ISQA 4IEWA 3PHMA 3AVSA 4XVHA 2OQ6A 2H6CA 1OI6A 4LHNA 2ERSA 4K20A 2ZGQA 3SCGA 2AR6A 4A3FL 2XJQA 3RZJA 3GTGL 4A6SA 4OHZA 3LDBA 3ZSMA 4Q4W2 3CLPA 4MV2A 4W6XA 2VMEA 5FPXA 3O12A 4XAAA 3IKWA 2P2KA 3BOWA 3SMHA 4CEYA 3OD0A 4MSVA 3PVBB 5A7OA 4AFDA 2WWUA 3GJBA 5ACA3 2PMWB 4CU9A 2A5ZA 2ADDA 3I2IA 5C9AA 2BWAA 3BU7A 3HBKA 4OUEA 3VBFC 4IETA 1DGRN 2RJLA 4HBNA 1IG3A 3AP5A 1OD3A 4AFCA 5J1XA 1BXHA 1JZ8A 5KXBA 4NWVA 3ZG6A 2G1MA 2VG9A 4B4PA 2JDKA 2L0ZA 5GALA 4FVVA 4QXKA 1YC61 5FP9A 3H1MA 3I7DA 5C9AB 5GKAC 1S0IA 1P8JA 3FHQA 3SCHA 4BK4A 5BNQA 5JWPA 1WKYA 2BFUS 2HR5A 1KD7A 3AVRA 1JZ7A 4QB2A 4Q2FA 2OIIA 2PVEA 1GR3A 5DPNA 1Q43A 3SEPA 4Y1YA 5E88A 4BWOA 3KGLA 2A6ZA 5FYIA 3W21A 4L2NA 3VBOC 2PELA 1RUE1 4QX7A 2KM2A 3WNNA 3QLQA 5CKNA 2HH9A 2QCSB 4F83A 3ZKUA 2JG8A 4ASLA 3CHXA 2VQTA 4AGRA 1RUC2 4CPBA 2WUHA 3CZJA 4FFIA 1XNBA 2NPIA 4WZFA 3JB4C 3ZXDA 3RZDL 1B35C 1JOBA 2YGLA 3D6EA 3EJKA 4C3JL 4IEZA 4JDOA 4KWKA 4X8NA 3GHMA 1RHI2 2JG8B 1GP5A 2JE7A 3J8F1 4Y5SA 1R1A3 2RJ2A 1WLTA 1WA6X 5JVH1 1OLME 1YFXA 2AC1A 4IE7A 2WA4A 4HOOA 4J1XA 4MGKE 4BE3A 1VB4A 2ENRA 3THPA 3WDXA 3MZHA 3KYWA 2JA8L 2BOJA 2EIGA 2YROA 2ZAAA 3S16L 3RWNA 2HJIA 1SMUA 5IK5A 1BHGA 1CQ9A 2EIDA 3I2JA 4AEKA 3RZLA 4OULA 1ASJ3 1S2KA 2V3BB 3NAPA 3WD5A 4DY3A 1GZTA 3LAGA 2XJTA 1C09A 2RVAA 3LCPA 2VW2A 1OWBA 3ACFA 2DBNA 3B01A 5EYYA 4I30A 1TWGL 2VMHA 3N7JA 3PUQA 1XYNA 4LBMA 3Q8BA 5IAXA 3FLRA 4IEXA 3NAPB 4QPWA 1U5XA 2CWMA 5RXNA 2A71A 4CDQA 2QQLA 1POV0 1Y9MA 2RS11 4YW3A 4BISA 1ZA7A 4HKWA 2Y8KA 4IL7A 1OKOA 1QJY1 4C90A 5CFCA 4HN0A 3HOBA 4BM8A 1UPSA 4ZONA 1J3PA 3AYAA 1J3QA 3ZSLA 1XOYA 3VD3A 3HNYM 3I2KA 4XFHA 4N43C 2PYAA 4A3ML 1G9AA 4IV1A 5JZGC 4P9JA 1LOGA 1L7RA 4A41A 3WWNB 2BU9A 4Y24A 2PHLA 5FY9A 1B71A 2GNDA 2ES3A 3ZXGA 2B42B 2NZ9A 4POFA 1HXS3 1V6NA 2NMOA 4NPMA 4AQTA 2D44A 1CONA 3SH5A 4B4RA 3C7HA 1R083 1NA1A 1ZZ9A 4IV1B 4B8CD 1TMF1 5F5IA 4BLJA 3M1HA 1RUE3 4XF9A 3VD5A 5IT6A 1BMV2 1R1A2 3GTML 4UI9L 2Y6FA 2D93A 2BNMA 2YGMA 2V0FA 2EXHA 4I02A 4XDQA 1F4AA 2BGCA 1DGWA 1VBA3 1OUSA 4XF4A 3GZTB 5B4XA 5BY5A 1UOFA 5C3SA 1UZ0A 2WNUC 3H50A 1RINA 3C7FA 4K9FA 1NY72 4K7JA 2UWAA 5BV6A 3KHBA 3E1F1 1URXA 2VMFA 1PGL1 4MYEA 1JYXA 3KWVA 5FKCA 4GWJA 2PLV1 1EAH1 1S0DA 4XPVA 3VBUA 2WO3A 3LNLA 1FAYA 5D1IA 1AYM1 1HDKA 4CU6A 5JLVA 3JD71 4M0HA 2E2JL 4WVVA 4P5HA 2N7GA 3I97A 4WVZA 4A3JL 5A3MA 5AFEA 4RR3C 3ZR5A 4I09A 2HEYF 4URTA 5A7NA 1PGSA 2OKXA 1BQ8A 1X50A 3AP6A 4BQ3A 1OLQA 4XUTA 3HR9A 1SBFA 4FXKB 4OZXA 5FZ3A 1Z7S1 3OYWA 5F37A 3PZAA 3HD8B 3VHRA 2RHPA 2ZGOA 2F6BA 2HWE1 2RS13 3AKQA 4CDUA 4RS5C 4TZDA 3ZFFC 5I0DA 3KF5A 1K12A 4UFJA 1RUG2 5JOYA 3OYWB 1YK4A 1D4M3 1GZCA 5J48A 1B2JA 2FDFA 4QKNA 1SDWA 4UFHA 3VZKA 2XG3A 4IW3A 4YW7A 1QDOA 5C4WA 1UXZA 1JU4A 2CGNA 2Z3QB 4HLTA 3QVDA 3KCYA 5E89A 1H4HA 4GKYA 1LTLA 2E33A 5TSWA 3T2OA 2M6OA 1RUE2 2WZEA 1NXMA 3BYWA 5EWSA 4HSJA 2ILMA 5MF6A 3BIEA 1IKPA 1PNFA 1UU5A 2C5DA 2ZX0A 2XMLA 5C4WB 1PK6A 2GMGA 1GBGA 3D82A 1CIYA 5CEHA 1XU1A 1E5SA 2NM1A 1F31A 4JV4A 5KHIA 4G3YC 2C0ZA 2BBAA 4YWLA 3S6PA 4CCJA 1RXFA 1OVPA 3WHUA 4CUBA 1W3XA 4AFBA 4UXAA 3PIP1 2ETEA 3J8F2 3OY8A 1ZNPA 4CEYC 1UYYA 4ZS2A 3RI8A 2WO7A 2WZR1 1G8WA 2C6SA 1QJFA 3K7AL 4QDRA 2J9UB 3ACLA 3EYPA 3VB9A 1UN1A 1AYN1 2VNRA 3ECQA 4JTNA 3IT8A 4LK6A 4K40A 4XFBA 5DUXA 3O0XA 4I0BA 1VZHA 1LENA 2GMEA 2WBKA 4ES9A 5FY7A 1UU6A 1IW7D 3HOXL 4AAXA 3DN7A 2JDAA 1MVQA 1RB9A 1MEC1 2JI1A 4XBLA 3MHZA 3Q8EA 2C4XA 4XF1A 4IERA 3O1SA 4QHZA 3FBMA 4FPFA 5IY0A 4OI1A 2WZPP 3G7DA 2BNOA 4TSVA 2E2IL 3GGLA 4OUMA 3WNPA 5B4NA 1PO11 1UZVA 1PFYA 1F5FA 3GDBA 2PLV3 3MLJA 2ZGRA 4Z82A 1IOAA 1AYM3 5JVG1 1XE0A 2D3PA 3M2MA 4Y5TA 1YXWA 3JD73 5CNAA 4COUA 5GZDA 4TTGA 1CZVA 5IVJA 5JI9A 3PLQA 1O3TA 2PHDA 3AL5A 5LW9A 1XSQA 1LOEA 4YVSB 3C8XA 4KBBA 4MGQA 4XAEA 3OG2A 4KWUA 1QJY2 2XHKA 4AHXA 2GDFA 5A33B 2PHTA 4LA3A 4UBHA 4QX2A 3MPPG 1KFUL 1LECA 3VKFC 4PIZA 1Z7S3 1NLQA 5CZKA 2E31A 2AUSB 3B02A 2XGXA 3RDIA 2Q5TA 1JUIA 2J1TA 2WLPA 3FMGA 3K46A
chains in the Genus database with same CATH topology
1RL3A 2HWE3 5KC5A 3JBG3 1MVEA 2WC2A 4JDMA 2GAUA 3M8LA 4XHBA 2FZ1A 1TQ5A 4L11A 2VQ0A 3LA3A 1ENXA 1W6OA 4Y22A 1OQ1A 4Q1PA 4ZU5A 5L19A 1ENQA 3ZIWA 5D8AC 1TMF2 3M70A 3MGUA 5SV5A 1OMIA 4X6RB 1PIV1 1W6OB 2BNNA 3M4FA 4XF0A 1MS8A 3ZPYA 2W52A 3PVEA 1EPWA 4DRVA 2QUOA 4PQ9A 1LKOA 2EA7A 4Y26A 2VUAA 3MIBA 4INDA 4XILA 2A75A 1C28A 1AR81 1G86A 3NFPI 1ZRRA 5I8YA 1U5YA 3M3OA 5LEKA 4CDQC 2O5JD 5DZGA 3CU7A 4YGDA 1PGL2 3BODA 2A6YA 2A3XA 2PLV2 2XH6A 3L2HA 1EAH2 5CFCC 1REFA 4QGLA 1AYM2 5CFDB 1Z0HA 1WUVA 3V0AA 3ZVXA 1MEC3 2B46X 5FPZA 4CTEA 1H8VA 2DVGA 2D40A 1RJ7A 1R0FA 3AJYA 1QXPA 5KBFA 1NQDA 5HI0A 4LULA 1Z7S2 5AI3A 1IS5A 2UY8A 3GZAA 3WP5A 1NA1C 4Y20A 2NLRA 4PBOA 2HWE2 4AQ2A 4E4DX 2K0GA 4J6GA 2C6AA 1YI7A 2QQPA 2GN3A 2KA3A 2XVKA 3N7LA 3OBTA 3MF6A 1DGWX 1B09A 3K51A 3R4SA 2BYVE 5FLHA 4GALA 2BFUL 5EJ3A 5FO7B 3ZYGA 5BNOA 1CIWA 3O14A 1VBB1 3LKJA 1YO8A 5FFOC 3ZFGB 1YLLA 4COWA 1U5ZA 4Z92B 1KJLA 4XHXA 4JAEA 5DUVA 1SQ4A 3ZXLA 3M3QA 3MIDA 4FOQA 4ISRA 3VBUC 2WIIB 1PMIA 2A6VA 1FMD1 1Q8SA 3JUUA 4PIYA 4F7ZA 2OUHA 2ZKLA 1F9KA 2RMU1 2WFF1 1GLHA 4YZ1A 2C6BA 2QDNA 2R49A 2M4YA 1BJQA 2WNEA 4SBVA 1PIV3 2WZR2 2YDEA 3O0WA 3ZXEA 4QPYA 1RUD2 4Q4X1 3AKTA 1AYN2 1FNZA 4A7YA 1WCSA 3FLPA 4L99A 5AVAA 1AR83 2RS33 2FBEA 2GH8A 3L2YA 1MEC2 1S0EA 1PHMA 1RUNA 4CDUC 5GJ6A 2WNVB 4M3CB 3ZSKA 1NLSA 1PO12 2CGOA 4FPEA 3WWLA 4CP0A 5C33A 2V73A 5JOWA 2DCTA 4FPGA 2XL9A 4WM7B 5C4WC 5FOJB 3MW3A 4GB31 3UK9A 5KC6A 3ZFEA 3B7MA 1CAWA 1RMU1 3WZ1A 5GLTA 4HPKA 1PK6C 2ZIXA 3ZFEB 1T9PA 2ZKNA 3D5OA 3EHKA 5GAEc 1NZCA 2QZ3A 1CAWB 2W68A 4JGYB 1ENSA 4TWTA 2CGPA 3MSUA 1DYKA 2P34A 4QU2A 5KHJA 3VUOA 2PPTA 3NSTA 1NE6A 4OI2A 1S30A 1XYPA 4FOWA 4FBFA 5JSPA 2Q1MA 1W0OA 2PAKA 2VVFA 2BWCA 2ZZJA 5JVVA 1Z92B 2GSYA 3MW2A 1PZ9A 4CDWA 4HKOA 1PIV2 4GXLA 1DQ2A 3VZOA 2C9AA 2D6OX 1X82A 4SLIA 2IXKA 1OD5A 1AR91 1QQP1 2DFBA 1QMJA 2B8MA 4KG8A 4CDWB 2K2DA 5F5QA 1FMD3 2MPFA 1AR82 5CVRA 1MACA 1MS1A 3ME2A 2RMU3 2Y38A 3ILFA 4YVWB 2PHWA 1HKDA 2YHJA 5A3LA 4JCKA 4UW5A 1VRH3 1BVP1 3WP3A 1RDVA 1GFF2 2DCZA 1QDCA 4E4ZA 1DQ6A 1RTVA 1NYWA 4Q4X3 3CEWA 1BBT3 1GANA 2CV6A 3FZ3A 1REDA 1LR5A 5MFZA 4LO7A 1LESA 1DF0A 2KXLA 2BE5D 3AYEA 4FPJA 2DV9A 1Q8OA 3M3EA 4YWMA 1LEMA 3VDDA 5C8CA 1UD1A 3M7AA 2GC3A 3VBSA 2Q8OA 3VV1A 2PAEA 2JG9B 2VOKA 2OYZA 3WR0A 1UKGA 2Z79A 3POYA 5BYNA 3I59A 1ULDA 1RMU3 1JXNA 1OPOA 2EALA 2VXRA 1UZYA 1FX5A 3LSEA 4YG0A 5J09A 3I59B 1Y43B 5HCFA 2ZHMA 3ZXAC 4OFGA 3QH6A 2X5IC 5FLIA 1IROA 1VBB2 4YARA 1FYUA 4GQ7A 3CO2A 1FHHA 4MXVA 1SFYA 1VLNA 4QPIA 2D98A 4LNVA 1LHUA 4YG6A 3ZN5A 4OUSA 1Y7BA 1FMD2 1UMZA 2RS51 4XFCA 5H9QA 2RMU2 2WFF2 4ZN1B 4QPIB 4BZ4A 1V6KA 3P8BA 4RQPC 5AVPA 1RVF2 3KS7A 3U11A 1N1VA 4Q4X2 3E5XA 1QQP3 1PO22 1DZQA 3FWEA 5I0SA 2R071 3HN1A 4CDXB 1W6MA 3MIEA 4LO4B 4X6QB 5J96B 2IZWA 4LBKA 1H0BA 4WM8B 3R05A 1WLCA 1X8MA 4JGZC 2VECA 1WCDJ 1RUOA 3VBHC 4TPUA 3MDPA 4Q4Y3 5HCAA 1W6MB 5K0UA 5JIUA 4W6WA 3AYDA 4HVQA 2IXHA 2W39A 4GB32 1G9DA 4R8HA 2B7YA 3ZYJB 4S2HA 5BNOC 3ES1A 1OFNA 2WT0A 4FPYA 2G9FA 2ZJCA 5K0UB 4HMZA 4M00A 4UW4A 3ZDSA 1V9U3 3WG1A 2BUKA 5E16A 3TNQA 1QU0A 1AF9A 1VBD3 2WSVA 3HAGA 2JI3A 1C1LA 2B9UA 4ZU4A 2R0HA 2XL7A 2OVUA 5LK5A 3UKTA 1XNKA 4XE9A 1COV1 2R0FA 1TE1B 4H3WA 1I3HA 1WJVA 4LBJA 4CP2A 3BALA 2WLQA 3H3UA 1PVXA 3JU9A 1LKMA 1HRI3 3RJRA 2I74A 2BTVC 2HWB1 5CADA 4XW3A 1AR92 1QQP2 2OA2A 3NJZA 5FMOL 3N4MA 1YYNA 3D0JA 3S30A 1R1ZA 2RS53 3GBWA 3SH3A 1YRZA 1SLCA 3IN9A 5GLZA 1H8TA 3VBRA 1OLRA 1FV3A 5CBLA 4B7KA 2LUWA 1V6IA 4ORFA 4RL7A 4YLZA 4DQAA 4RXNA 4XTMA 4XMAA 3RG0A 5BNNB 4DRRA 2RDVA 3TAYA 4I0WB 2R16A 5FO9B 4Y1UA 2R073 2D7FA 3I8TA 4KNCA 4RHV2 4HSLA 4AI1A 4XXBB 1E8JA 1ASJ1 1BEV3 4N7UA 4LBQD 1YK5A 3CF6E 4ONUA 4OLLA 1Q3EA 1PM7A 3MI8A 1O3SA 5JI7A 2B45X 4XFGA 3CL1A 3OPZA 5GLUA 3QH7A 2AYJA 3KD4A 3RYKA 2EF6A 2RR13 4LBLA 1IU6A 1QJX3 5F6KA 2ZMLA 3PVOA 4B4QA 1HX6A 2QNKA 4YNIA 2JENA 3R6SA 2JE9A 2WINB 1QH7A 3OGJA 4P14A 1MZ5A 4KL1A 4AR6A 1CAVB 4N90A 2NYDA 1DFQA 2VGDA 4DS0A 2FQPA 1GQHA 1HXS1 3FX3A 3QCWA 1AR61 1COV3 2DU0A 1R081 2RS52 3ILNA 3IIAA 4QQPA 2YV8A 4K21A 2ZZQA 1MS9A 1KDMA 2DUQA 1JBCA 2EXIA 4FTBA 4FT8A 2HWB3 2P3IA 1VBA1 3N36A 4JDNA 1O4YA 2ZMNA 3VDDC 5J36A 4BMBA 1VZGA 1CADA 5C8CC 3BB6A 4AI8A 3VBSC 3V64A 2GC1A 2NP0A 4DINB 5KXCA 5K7PA 1ZBE2 3B9CA 3B08B 1H30A 1N3PA 3VHOA 1X7NA 2ZX2A 2ZX3A 3OGGA 5BNPB 1V6JA 4BQ1A 2Q0AA 3MPSA 4KWJA 2UWBA 3NV4A 3J7Z1 3IBMA 1UF2C 5IK8A 5DZFA 3P3PA 5EINC 1V6OA 2GN7A 5ACA2 1ZM1A 2OPKA 1HRV3 1QY4A 1S0CA 3AP4A 4LHKA 4HK9A 2WQ4A 3ZXKA 1GKBA 5AC91 2PFWA 1SLTA 3WXPA 4XEZA 3MLKA 2IXCA 2WWSA 3APBA 4NWWA 3KYXA 1AL0G 5KHKA 3WW4A 5JPMB 5DM61 3AZYA 2O0OA 3B0AB 3H7JA 1YUDA 4YW5A 1R0JA 3DPRB 5GAHc 2E6VA 2YPJA 3ZYIB 3RSJA 3PKIA 1D4M1 4Q1RA 2B5ID 3PTYA 4Y1XA 1FV2A 3H1WA 3FUOA 4ATEA 4EJRA 5KWRA 1F8VA 4KU7A 4YFWA 4GMP0 3G6JB 1COV2 3SHRA 3VGIA 2O8OA 3H1YA 4FO9A 1GICA 3I4IA 1OPMA 1V70A 3MIGA 2VMIA 2HWB2 3KT1A 3QQCE 1YHFA 2XJPA 2R041 4A2UA 4YG3A 4AR3A 5JOXA 2A6ED 1AR63 5LK7B 1VAVA 5MGNA 1FI2A 4HL0A 4I3PA 4O9GA 4ZU7A 4F3JA 3AZXA 1SEFA 2OZJA 1KQRA 3A0KA 3AKPA 4YGBA 1YV1A 1LHNA 2FZ2A 3AZZA 1B2OA 3KYYA 4ATFA 3N35A 4DZGA 5FTTC 3TRSB 4Q8KA 4EN8B 3ZMOA 1NCQC 1NCRB 3ZYPA 1YFWA 1QCVA 1ASJ2 4YM1A 3QACA 1SMVA 1VIWB 2RM21 3FBYA 4PDWA 1W6PB 2DFCA 4K1ZA 4HZFA 2W08A 4IEUA 1EYBA 2A3YA 3MICA 2M6PA 2E9QA 3AXEA 4PDWB 1EY2A 1GNZA 2PTMA 2H12A 1LU1A 1WD4A 5AC93 4QMAA 1JN2P 3B93A 2A69D 4JTOA 1K5MC 1SLIA 2GU9A 2G9GA 1DLLA 3GBFA 4LO6B 2DUOA 4HVOA 2UU8A 4Y1ZA 5DXDA 1C8M1 1KITA 1H8TC 3VBRC 1LGNA 3JBG1 2YY1A 2GNTA 4XFAA 1ZRPA 3EXUA 1HV1A 1Q56A 1H1MA 4R4ZA 5JMCA 4E2SA 2VNOA 4AR5A 3M3CA 1HXS2 3MF9A 1Q8VA 3W59A 1OOPB 1AR62 5J3UA 1R082 3VN4A 4KGQA 2YMZA 3NL1A 1WLDA 1ND2A 2NMNA 1VR3A 5MLC3 5L7OB 4YM0A 1N1YA 1R0HA 1LU2A 1QNYA 2D43A 3E5QA 1VBA2 3N7MA 4JAAA 2XKOA 1GZWA 2R043 3USUB 1ND2B 4XBNA 2IXLA 1F2NA 2XPJA 2G4IA 2QFEA 3EQEA 1MZ6A 3WG3A 3WUCA 1GZWB 1VBE3 2H0BA 4IEOA 5C9AC 1N47A 3VL9A 5H9PA 4FOVA 1I9RA 1OSGA 4XJZA 1JYBA 4LLFA 3VKNA 1NG0A 1IPKA 3J9SA 2MS3A 4YSFA 4WFN1 2PHFA 2GZWA 2CTVA 3ALQA 2PYTA 5AC92 2RM23 1JHNA 1MS4A 4EWAA 4FTSA 3U0ZA 1NLRA 4YVSA 1ND3B 4Y5Z0 1O91A 4META 4XMIA 5A33A 4NN0A 2ZAHA 2JJ6A 1N1SA 1ZRFA 1OHFA 1O3RA 1QWRA 3LWCA 1IGOA 2V09A 4Q8LA 2RS12 4MH0E 2WL1A 3OCPA 2JG8C 3P2AA 2X8KA 1D4M2 1O4TA 2EAKA 4FSJA 3HMYA 5JAXA 3WP4A 4NR1A 1SFNA 4E9KA 2XJVA 5CU1A 2HWD1 1C8M3 1HQWA 4OHXA 1WA4A 4AEDB 1J1TA 1ZBA1 1DZRA 4JRLA 4LTAA 4P9GA 4W6YA 2B39A 4QGMA 1WBFA 4C1XA 4NHMA 3ASIA 1VBC1 1LOFA 4YW4A 3WW1A 1U0AA 2R042 3KGZA 2R063 1RC6A 1DQ4A 1VB2A 2D6LX 1NXD1 3ILRA 5FMOS 1RUF3 4MGYE 4XJWA 1SCSA 2XKPA 1H1IA 3NAPC 4LEJA 5DG1A 1POV1 2OZ6A 5GZCA 1RUJ1 2A68D 4E27A 2VL6A 1Y3TA 1KRIA 1W6NB 2RS31 3RRDA 3HT1A 3H0OA 1CAAA 3ZN6A 5CFDA 4EROA 2HYKA 4YM2A 1H2KA 1Z78A 2HEWF 1LGBA 1A78A 4R9DA 5DDJ3 1ZVFA 3VZLA 5ABJB 3ES4A 1I5ZA 1BYHA 2ZGPA 2B5HA 5GLWA 3J26N 2CKCA 1H2MA 3ZN6B 4C91A 2QE3A 3RPQA 4N53B 3JD72 3FE5A 3QOPA 1IHMA 2JDZA 2D5HA 4IV1C 4AFAA 4C0HA 4PLNA 1A6CA 1EP0A 1Q8QA 3THTA 5CA6A 4EN7B 3VKOA 1HW5A 2VOVA 4Q4V1 2WS91 1JYCA 3CJIB 3NO8A 4GH4A 1HQLA 3AMPA 4WVWA 4JRAA 1UIJA 3SS2A 1RUI3 1C8M2 1IRNA 3RYPA 3JBG2 4FCAA 2PHUA 5EV7A 3WCRA 1DBNA 4EN0A 4D7SA 5BPXA 1RITA 3ZFGA 4GH4B 3TYJA 5FCCA 3DGTA 2QDRA 5KHHA 4LO8A 4AQ6A 1W2UA 2HWD3 4GULA 2EVXA 4K3UA 4NPRA 1ZBA3 2RJKA 5EFUA 1I6XA 2VQAA 3TBDA 1LRHA 2Q30A 3DKWA 5T55A 1VBC3 2PN5A 1OFSA 1VALA 3VZJA 1PNGA 1LODA 4OHYA 3TWIA 1S0BA 3R4UA 3GF6A 1R093 4LE4A 4LUKA 3AP7A 4ES8A 2XJUA 1DHKB 5GZEA 3VPBE 1AX1A 1VRH1 2D3SA 4PF5A 2A3WA 3H9AA 1FPN1 1POV3 1BBT1 4TYSA 1RUJ3 2CY6A 3O0VA 1H7VA 3ZN4A 5K8SA 2OW4A 2WNVA 2A73B 4M3CA 3EBRA 4CEWB 4A7KA 3B00A 3WDVA 2Z42A 4GS7D 7RXNA 4WM7A 1UIKA 4AE2A 2VOXA 3WY6A 2XBO1 3MIHA 5JPNB 2K9ZA 1LTEA 5DG2A 4FPHA 1IZ3A 1QF3A 2YZ4A 1CJDA 4TLFA 4AQSA 3ZO0B 3INAA 1ULEA 2A6XA 3OTFA 3EO6A 1MQTB 4JGYA 2R1DA 4XJ8A 4AEMA 8RXNA 4LBOA 4HFSA 4LBNA 4XIOA 2ZGNA 4O9EA 2XLAA 4R4XA 4Z2WA 3TOJA 1JYIA 3WCSA 3GYDA 1TME1 1FATA 4Q4V3 2WS93 1M4WA 2ZX1A 4B29A 2IXIA 3RJ2X 4IV3A 5FLJA 2JICA 2XWJB 3R0RA 1R0GA 1ZBA2 4XXPA 2D6MA 3A4UA 3S7IA 2DCJA 2XLFA 1S1AA 4U2AA 2FHRA 4IV3B 4LUMA 2DTWA 2VULA 4R9AA 5JCTA 3KM5A 1HIXA 1YJKA 5BUVA 3RZTA 4YVWA 5K9YA 1RUJ2 1SMWA 4YVSC 4CZSA 3RMYA 1ULFA 4BPZA 3OF1A 1ZRDA 1QXRA 2RS32 4MXWA 4P9LA 4AW7A 4XBQA 2VW0A 2ZCWA 3VLBB 4C0BA 4Y4YA 1FPN3 1SMMA 3KYVA 4Q4Y1 1S55A 4UBGA 2F4PA 4LR4A 4MXWB 3BCWA 4CRQA 1UX6A 2DYCA 1DGLA 1D0GA 4S2GA 3NV1A 4XQWA 2JG9A 4LO5B 3WQ1A 2XBO3 2HEVF 5HBAA 5MFPA 2VY0A 1SLAA 3VBFB 2DSXA 4RGGA 1B13A 1V9U1 3FFZA 2BW8A 5F6LB 3TNPB 1ZZ6A 2DVDA 2WS92 3PMEA 3PJQA 1GNHA 2ERJA 4Q4V2 4FAHA 2M4VA 3N7KA 1DVBA 1X36A 3SNMA 4CYDA 1VBD1 1DYPA 2Y26A 2E53A 2HWC3 1DIWA 1ODHA 3VBOA 4QQ2A 2BPA2 1UZZA 1WMDA 3H8UA 3OD4A 4X8PA 1TME3 3RMXA 4HVRA 2AENA 3URFA 1DU3D 4PCRA 1XRUA 2EXKA 2VU9A 3FJSA 3VBOB 4MGIE 1B35A 2PQQA 1ALYA 4LT5A 1HRI1 5CFDC 5I0UA 4L8QA 1PVC3 1BVVA 4U671 4POGA 1BKZA 4B3NA 4D69A 2IXJA 1B35B 1JOJA 3M3IA 4IEVA 3T1MA 4KU8A 3POSA 1LJ7A 5CB7A 4B8EA 4WZCA 4K8FA 1SLBA 1ENRA 3LOIA 4JAFA 2DVFA 1J1LA 3MFAA 4CDXA 3E97A 1VRH2 2PSMC 2ZGTA 3E5UA 1BZWA 3C3VA 5FAXA 3AJZA 1FPN2 4WM8A 1BBT2 1H2NA 4K6BA 1AJKA 1KS5A 3A44A 1NQJA 5T3NA 3WQ7A 4KGGA 4DOUA 3WNXA 1NNQA 1VCXA 1HQNA 3IM0A 4COZA 4Q0SA 2XBO2 1D2QA 1BEV1 2TUNA 2UURA 4XQ4A 1XYOA 3LZZA 3HBZA 1CAUB 3VL8A 3ZFGC 4RSUA 2XVLA 2P17A 4YZ4A 4XQDA 4H14A 1WW4A 3U10A 3FLTA 5DUUA 1RUC1 1OA3A 5B2GB 5I93A 3ST7A 1RMU2 4LBQB 1T9QA 1V6MA 3I2DA 1D0HA 2RR11 1QJX1 4YZ2A 1ZZ8A 5J98B 3W58A 5JZGA 2NYYA 5AFBA 1TME2 4LA2A 4BOWA 5T5PA 3NKTA 1QH6A 4QGNA 4N43B 3UJQA 1V00A 5JZGB 1SCRA 5I91A 4M3CF 4HT1T 3V65A 3WP6A 1QKQA 1QYBA 5H9RA 5I0RA 1AX0A 4FPKA 2WNVC 4R9BA 3NKGA 2A7AA 4QPGA 1ZA4A 4XFIA 5T50A 5FREA 1YFYA 2WNUA 4Q4W3 4WM7C 3WQ0A 4Q0PA 4AGGA 2IFWA 1ZX5A 1AXYA 1DQ5A 2P3KA 1RUH1 4AFMA 1LCLA 5EYXA 1JTZX 2DCYA 4QPGB 5BNNA 5L36A 2WNUB 4AVSA 3JQXA 3ZFEC 2ZBJA 5FQ0B 1AL21 4E4SA 4HN1A 1S2BA 4QD2A 1BCXA 4JGYC 4H7LA 1YNAA 5HXVA 2JXAA 4AYUA 4Q0VA 4RD7A 4COYA 5H9SA 5C8WA 4Q4Y2 3ZMNA 4Q0QA 1J59A 3SH4A 4KWLA 1WMEA 1WMFA 4LE3A 1KJRA 4PIXA 4YM3A 1HRV1 3V0BB 3LOBA 1OQEA 1CESA 4RR3B 4EV0A 1O5LA 3K35A 4XETA 2OUJA 3E6CC 1CJPA 1V9U2 3ZFFA 1CVNA 1REEA 3WDWA 4U36A 2D97A 4XXAA 3UKNA 1RUC3 3PNAA 5A32A 5FO8B 4ITCA 4MLOA 4CDWC 1VBD2 1D2SA 2VOWA 4D94A 4RS5B 3O5SA 1DGRA 4XYXA 3ZFFB 2XJSA 1GQGA 4AHZA 1JH5A 1RHI3 3AMHA 1J3RA 4JQRA 3CNAA 2WA3A 4H55A 4YVWC 4OVEA 5A32B 1CAVA 2HWF1 2ZS6B 3KB5A 4COVA 1D4VB 4BIFA 1QGLA 1V6LA 3VHNA 2DU1A 1HRI2 1C8NA 3IPVB 2D6KA 1ZZBA 1UPIA 4AGVA 2DVBA 2GMMA 2VVDA 2DTYA 2ZGUA 4YGEA 3UV9A 3E6BA 3J7Y1 3R4DB 4HANA 4XJ9A 5IK5A 1UL9A 2P3JA 3KQRA 5H1Sc 4GKXA 4DPNA 1A8MA 4KH9A 2JD4A 1RWDA 4CEYB 2JG9C 2UYAA 3ENRA 5CAZA 3ETQA 1QNWA 5F1RA 1RDGA 1RUH3 1OA4A 4UW3A 4V196 3IDEA 5BNPA 2DWRA 2R072 1RUG1 1SLLA 5FDBA 4UY81 4BYYA 4XGHA 1AL23 1PZ8A 1DQ1A 1ULGA 1BEV2 3D8CA 4PJYA 3BIWE 1RGSA 4L92A 4DB5A 4HK8A 3POWA 1ZYBA 2GNMA 2Z3RB 2H0VA 1U12A 3GALA 4FPLA 4FQZA 5JSOA 1O5UA 2X29A 1W6QA 2ARXA 3KT7A 4R52A 4WVMA 1RIRA 5DUWA 3DPRA 4YW2A 3MFCA 2RR12 4QPIC 1DG6A 1QJX2 3HWJA 3AYCA 1VAMA 1H2LA 2E7TA 4IEQA 1UKRA 3PIO1 1W6QB 4P9IA 1MZEA 3WW3A 1DX8A 2QL0A 4WVMB 1YUZA 5T5OA 3VZNA 3U4XA 5L73A 1AJOA 4CDXC 1NE4A 5D8AA 1G9FA 4WM8C 4DFSA 2VW1A 2HWF3 4M01A 4K9SA 1OA2A 4AI2A 2PHXA 3KMHA 2E7QA 2P37A 3AKSA 5D8AB 3QD6A 4AK3A 4ZN3B 4QX5A 3B3QE 5C6CA 1BE7A 2XB6C 2E51A 1RUH2 1UCXA 2GNBA 5K0UC 2ZGLA 4AI0A 2XJRA 3KZ4C 2GC2A 3WDUA 2W0XA 1AL22 2WT1A 1RYQA 2R30A 4CDQB 3WUDA 4D7YA 4XZPA 4Z8BA 1VBE1 1QOSA 1NCRA 2KN9A 1H9WA 3AFKA 1TNFA 4EN9B 4HETA 1EV11