2XJSA

X-ray structure of the n-terminal domain of the flocculin flo5 from saccharomyces cerevisiae in complex with calcium and a1,2-mannobiose
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
258
structure length
258
Chain Sequence
GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLOCCULATION PROTEIN FLO5
publication title Structural Basis of Flocculin-Mediated Social Behavior in Yeast
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell adhesion
total genus 61
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2010-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2xjsA02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2xjsA01
4LHKA 4CP0A 4COZA 2XJUA 5A3MA 2XJVA 4AFAA 2XJQA 2XJSA 4LHLA 4AHXA 4AI1A 4AI3A 4AHWA 4COUA 4AF9A 2XJRA 5A3LA 4GQ7A 4ASLA 4AHZA 4AHYA 4AFBA 4AI0A 2XJTA 4A3XA 4CP2A 4D3WA 4AI2A 4COWA 4COVA 4LHNA 4COYA 2XJPA 4CP1A 4AFCA
chains in the Genus database with same CATH superfamily
1JS9A 3KS7A 1E5RA 2RDVA 2YV8A 2Z42A 1D7PM 2J7MA 1TMF3 2ZEXA 1VBA1 2F4LA 1UY2A 3SKVA 5DZGA 5FP9A 5KHIA 4XYXA 1AX0A 1U0AA 1YYNA 2K0GA 1UYYA 4FPGA 1EPWA 1WMEA 3OYWA 3L2HA 2BOJA 5DN2A 1CWPA 1CAVA 5A6QA 3GTQL 2YU1A 3RQ0A 3P5BA 3FE5A 3H3ZA 4K21A 2NP0A 5BNPB 2HBTA 1F4HA 4AHYA 4FFHA 1V9U3 5HCFA 3SEEA 3TB0A 1UZVA 2Q4SA 3VZKA 4AFBA 1NYWA 3B01A 3HKZP 1OA3A 2VNVA 5EJ3A 4JKMA 4PBPA 1ZRCA 2ZZQA 4NN0A 3HOUL 1AYM3 1RITA 3I3EA 5FK8A 1TG7A 3NNMA 1PK6C 3IB3A 3J7Z1 3KV5A 5HPOA 4A3DL 2WQZC 3KHBA 1IZ3A 1POV1 5BXXA 2KXLA 5LA2A 4XAEA 3WP6A 2W1WA 4OYUA 1ZBA1 3WVJA 4Z2AA 5C3OA 4L11A 4AQTA 4MSVA 1LOEA 4FPYA 4MGIE 5DUUA 3T0BA 4EV0A 1VBC2 5GALA 4YWMA 2RR11 3SISA 5IK4A 2JDHA 3SNMA 3UJOA 1UY3A 2PAKA 5SV8A 4FFFA 1VBB3 1KFXL 1W9TA 4XVHA 5FYTA 4TWTA 4ASLA 2KKDA 1TQ5A 2J1TA 4TLFA 4WVVA 3VB9A 5FBZA 4OHVA 1W6PA 2QFEA 3I7DA 3H8XA 3NO8A 3H9AA 4KGGA 2VUAA 3NNJA 1JTZX 3LEGA 5A33A 1OWBA 3VDDB 4GKXA 2WS91 1W8WA 1MZ5A 1FV3A 3EXUA 2P3IA 3NJZA 3C7FA 2O14A 5FZIA 2RFKB 2WN3A 4RGAA 3NSTA 2EXHA 5CEHA 1LKMA 4YZ2A 3ZYHA 3O1VA 4XC9A 1JUIA 4IE4A 4LA2A 3VZNA 4AZZA 2EIDA 4D0QA 5LZ6A 2QQNA 3QOPA 1VB4A 5FYHA 3ZYJB 3WUDA 3Q8FA 4E4HA 5FXXA 2AUSB 1RUI3 3MW2A 3UGGA 2R7ZL 4FXGB 1AXYA 2WYSA 5J98B 1BVVA 5IVEA 3HN1A 4LITA 4XXAA 1Y1WL 2J42A 1GUIA 1SG3A 5AVAA 5FPUA 1WUVA 1NUKA 5ABJC 1C1LA 1NG0A 4GH4A 2BBVA 1LKPA 4BLJA 2BWCA 4LJHA 5A7OA 3Q8EA 3U75A 4AR4A 1EP0A 1YRZA 3WT3A 2E7QA 2QTWB 1H2LA 3ZXLA 2JDPA 2XQXA 3VHOA 4YGEA 4AW7A 1IS4A 5E16A 1EV11 2NQYA 2BGPA 2JDMA 1UKGA 4GB32 4RQPC 3GZUC 4MHRA 4Y22B 3I8TA 2C6SA 3ZSMA 5ISLA 1UZZA 3POIA 3M3QA 5EIYB 3AJYA 1DBNA 2DFBA 4CDUB 1ENRA 1G86A 1HXS1 1QJZA 2QQVA 2VPVA 3HEIA 3M3YL 2DCKA 4JZRA 4PJYA 2ZGPA 2BOIA 1PIV1 2J1RA 2VGDA 2VVEA 3VBOC 4AE2A 3PKJA 2VECA 3LB9A 3ZFGA 4MGYE 1W2NA 2XJTA 3AYEA 3HQXA 4EQVA 1F5FA 3ETPA 2JDAA 1O4TA 1JI6A 3WEZA 4LKDA 1H8TB 3K46A 1LHUA 4LA3A 4QPIB 3HOZL 3KGZA 1RUH3 3MBWA 3AK0A 4PF5A 1O91A 4RYDA 3ZLIA 1VBE3 4CUBA 2HWB3 5FOJB 2MEV1 1HB4A 1Z7S1 1PGW1 1LAJA 3PO3L 3MPPG 2E51A 2RE9A 2R071 4JKLA 3VKNA 2E53A 5ANNA 1PO11 4A41A 4IV3A 2XJVA 5T3NA 4OZXA 2DCYA 3E97A 3GTJL 1US3A 2XH6A 5FZ1A 3PJQA 1QOTA 1LOAA 3SC7X 3USSA 3EBRA 1JBCA 2VJXA 2VTXJ 1QY4A 2WC2A 5MF6A 3GTPL 4RFT0 1FOD1 1HN1A 1ND2C 1ULCA 1JOBA 2AQCA 1VCXA 2ERSA 1ULOA 3RYRA 5CA6A 3BN6A 5F7UA 4FPJA 1W2UA 4XPVA 3CIHA 5A7WA 1REDA 3HAGA 4L2NA 5BY5A 2O1QA 4M3CB 5CKQA 3WLUA 4MG2A 1XB9A 4XMAA 2RS52 2DTWA 3POYA 4IEPA 4K8RB 4XACA 3I2KA 5LWBA 3H8RA 4UXAA 4CEWA 4FAHA 1D2SA 5A3OA 2GC1A 1HQLA 3AKSA 5FPZA 2XLFA 2YZ4A 2ZEWA 4QDSA 3ZMOA 1XNCA 2XDVA 2YUEA 2Y33A 3KCCA 3RWKX 3TEXA 2VBDA 4DOUA 3AYDA 4JX0A 2W46A 5IVVA 4FPLA 1VBD1 1RUC3 5FZ9A 4C3IL 1AR83 2BEOA 2C9KA 2RJKA 2XB6C 2XUMA 3URFA 2JENA 1F8VA 5IYCL 3C2UA 4XOGA 1POV0 5IT6A 4M3CF 3BKZA 1W6NB 4LHSA 2XOMA 3W20A 3LGRA 1LR5A 3ES1A 3U78A 2UU8A 4LE3A 2UY9A 2FDIA 1REEA 1UMZA 4Y52L 2Y0OA 1RMU3 5F6KA 5BV6A 3ZO0B 5JZGA 1O8SA 4HN1A 1PFYA 3S14L 2D43A 4X8NA 2ARXA 5FQ0A 1F2NA 1F9KA 2Z5WA 2LRPA 3OY8B 4I2OA 5A70A 3T1MA 5IYYA 1H30A 3KGLA 3ZSKA 2VQUA 4NMIA 3P2AA 4AGGA 1QHDA 3T1LA 4N90A 4QX3A 1AXZA 3JUUA 3UYJA 5JMOA 3MPBA 4GXLA 3WZ1A 4JAEA 2BGOA 1O8PA 3C8XA 4HSLA 5LCWL 1QQP2 3VBHB 4JTNA 2JI3A 5C4XL 4OHZA 2ORZA 4TZDA 5FYIA 4DUXA 3R05A 4FOWA 1CAUA 1GMMA 4GH4C 1DQ5A 5FKCA 5A7QA 4RD7A 3K48A 1AXKA 4AFCA 5GZCA 5C6CA 2G9GA 2KR2A 4P9WA 1AJKA 1SMUA 1R0JA 2DSXA 1NLSA 1SMVA 3OYWB 1HIXA 2WO3A 4F8AA 3J7LA 1F35A 4YG3A 2VR4A 1CESA 4BOWA 3WD5A 2VTFA 5CAZA 3GTML 1GKBA 2D44A 4E8CA 1Y3TA 1WLWA 2PMWB 3ENRA 2VZOA 4GULA 4NWWA 4QKDA 1FNYA 3MIEA 1YC61 2W1QA 3S16L 1AHSA 1W8NA 2OA2A 3SS2A 3CJIC 1UY0A 3TEWA 2C5DA 4PF1A 3HD8B 4D3WA 4CCJA 3GGLA 4BISA 2IVIB 4UF0A 4A6SA 2VMFA 1KGYA 3AVSA 1NCRB 3I2JA 4NOTA 4D7SA 1G9DA 3FN9A 1WCDJ 4FBFA 1YEWA 3ZYIB 4GALA 1OBNA 4XILA 4NPMA 1ZZCA 1FPN2 4D7YA 3VKMA 3RRDA 4POFA 2CKAA 5FJ8L 2W2IA 3AYCA 2AZ5A 3WG3A 4YM2A 1R083 2P5BA 4J1WA 3HNBM 4XQ4A 1TMF1 4HOOA 1FHMA 3N9OA 4CEYA 5A33B 1PVC3 3KB5A 4IL7A 2Y6FA 5I0UA 3OCPA 5FO9B 2F17A 3VL8A 4FTBA 2EIEA 5L9VA 1FNZA 1W8HA 2AH2A 1W04A 3FFZA 2HWD2 1RIRA 4H55A 2C6AA 5M0TA 4CDXB 1D0GA 1V9U1 3AL6A 2CGPA 3H99A 1I5ZA 2DDUA 5CFDA 4Q4W3 4QGMA 3ACHA 2ZKNA 1SBEA 2ZMNA 4FO9A 1EV12 4IGPA 4CEWC 2WAAA 1AYM1 5FTTC 1I6XA 2WKKA 1BHGA 2GZWA 1JYIA 5FZOB 4ARYA 1MEC1 4NAMA 5IJRA 1YI7A 4Y24A 3OOXA 2VL6A 4AEDC 3ACFA 3VBSA 1H6XA 1HLCA 2ID4A 1PIV2 4YGDA 1XNKA 3GBWA 1VBB1 4QXCA 5IVYA 5GZGA 2P17A 2I2SA 3ZSJA 3DXUA 1M4WA 1RHI1 2D97A 3U37A 1L7LA 1COV2 1FYUA 1UX7A 4IXLA 1UX6A 4E9KA 1AR72 1LHVA 2Q30A 3VKFC 4IW3A 3UNPA 3T2QA 4Z8BA 1GNZA 2RS12 1VZGA 4BH9A 2JD4A 5JZGC 5EJZB 3TWIA 3PUAA 1RL3A 1AF9A 5JVG1 4XJZA 1J84A 2YXSA 2JA6L 2ARAA 1WW5A 4RHV2 5FZMA 5AN9H 1WCML 3ZSEA 3ZFGB 5LK5A 1UOGA 5FZ0A 2FDHA 4A3EL 2W87A 4FOVA 4NRPA 3S7EA 1NCQB 5C5TA 1QOOA 5I93A 2PYAA 3RNSA 2H0VA 3WF0A 1BE7A 1RUI1 3H0GL 4QKNA 4KI5M 3U10A 4MHUA 1RB8G 1BEV3 1UYXA 3FBYA 2A3XA 4AYBP 1QQTA 3J7NA 4PQQA 5FREA 5GLVA 4XIKA 5FK7A 4IV3B 4GMP0 1YCIA 1SFNA 4IE6A 1WZXA 4Q29A 2ZGUA 3TEYA 5A1LA 2VE1A 3HQRA 2AENA 4LBNA 1S2KA 4W65A 3FMGA 2JG9B 4QT6A 1W9FA 5G05L 5I0TA 5IWFA 1YLLA 3S30A 3WSOA 4URAA 2A7AA 3A22A 1AL22 2VOTA 3IDEA 2VUDA 1Q56A 3LEMA 1CX4A 1EAH2 3PL0A 5C7GA 3GTKL 5BNNB 4TLGA 3THTA 4C0BA 4TVMA 1GICA 2RM23 3OJBA 1YQ6A 2R0HA 2VMIA 2YPJA 2WRAA 1NXD1 2HWE3 4LULA 4P9XA 2R49A 5F5CA 5EYYA 4Q1RA 3MFCA 2XMLA 4M0NA 4YG6A 5FO8B 1KS4A 1YQ5A 2VOVA 2P6HA 2KN9A 5JXJA 1K5MA 5LRRA 1J83A 2A5ZA 4M4PA 2CAUA 3O1SA 2D3RA 3O1OA 1D4VB 3ZYBA 1BJQA 1TNRA 1WCKA 2CSGA 4CCLA 2B8MA 2XONA 1NY71 4XF9A 3LPGA 4LEJA 4PT6A 5DZEA 4FAGA 1YFWA 1W8ZA 1VZIA 1RUH1 1XC6A 4QB1A 3RPQA 1AR93 2HWB1 4XF0A 1H2KA 1TEIA 3JXSA 4D6SA 5CFCB 3TAYA 4HONA 3PL5A 4QGLA 2Z2SB 4WM7A 1FAYA 2G1MA 3V64A 3A4UA 1B35A 3I2DA 5FZDA 1AVBA 2ZGMA 3BTAA 1U5ZA 2C0ZA 4OI1A 4CEYC 5B2GB 5C3RA 3FC0A 2WFF3 1HKDA 3NFPI 1ACCA 4JGYA 4BBSL 2WT1A 5LBBA 4XBLA 1UYPA 2PXJA 3KV9A 4HK8A 2GP3A 3VL9A 2IWGB 1ULFA 5FQ0B 1S0DA 1V6NA 4N8MA 1HRI3 2VZTA 2OPKA 3N7JA 2ZACA 2JDUA 4PDWC 5FZFA 1LU1A 4A3BL 2B46X 3CKHA 3OUHA 4D69A 5CFDC 2GNDA 4RL7A 1DLCA 4OQ9A 4AVBA 2FDJA 4IERA 4D6QA 1JZ5A 5JI9A 3WQ1A 1ND3B 4E4DX 1JW6A 4UYBA 2VH9A 2XHNA 1OOPB 1OD5A 1X9PA 3MV01 5M5YL 3WINE 1BRFA 1WCQA 4B29A 2ILMA 5FYVA 1BK0A 2AYHA 2X5IA 4XF1A 3B3QE 3BB6A 1B13A 3AZYA 4U2AA 5L36A 1XU1A 3VBSC 4JQTA 5LEJA 5FCCA 3MLLA 3FHIB 1RB9A 1BBT3 3KF5A 3JB4C 3LDRA 4L8QA 2BNOA 4ASMB 4E4SA 4OULA 1WLTA 1GZCA 2CWSA 3WQBA 3ZFFA 4AQ6A 5F3IA 4B4PA 5T52A 3N36A 4Q4V1 3GZEA 3K75B 3SLIA 3NNFA 1JU4A 4BQYA 2E2JL 2OUHA 4KL1A 3AVRA 3UKNA 4BK4A 3AJZA 5FDBA 1YUDA 1GOFA 1PMJX 1RMU1 2PHDA 3BYWA 1R092 3IU3I 2VZSA 2QNKA 1VRBA 1IKPA 1CAWB 5FMBA 3VN4A 5C3SA 3WW3A 4JQRA 1KRIA 4HN0A 2W3JA 4TYSA 3PIGA 5BUVA 3CO2A 4XQDA 4EN9B 4QGNA 3ZYFA 4AI8A 3BU0A 1Z92B 3OGGA 4UY81 4JDOA 1QJEA 3POEA 4WV8A 3HPNA 4HG6B 2D6PA 1O3SA 3RYPA 3AX4A 1JOJA 2G9FA 1FMD2 2A3YA 2CGOA 1FPN3 2AEZA 2J9UB 2WDBA 4HLTA 5F8PA 4AAXA 4QQHA 3C3VA 4ASKA 2P2KA 5JOXA 3EYPA 2RG4A 2ZMKA 1WD4A 2IXJA 2ZAHA 2ZGRA 5F32A 3R4UA 5GAHc 2NZ9A 4OMDA 4Y1VA 4G4FA 1O59A 1YFUA 3DECA 5LK7B 2WB1P 3SQOA 5IAVA 1QOSA 3GTGL 3J8F3 1UW8A 5DPNA 2XBO2 4XFCA 1QYBA 1V6KA 5FUNA 4LKFA 1ULEA 2UYAA 2ZHKA 3LWOB 3AKQA 4LO7A 4OLLA 4Q4X3 4UW3A 1J1LA 5EXOA 3RG0A 2NVTL 1W6MB 1I1EA 4COZA 1VRH2 1S30A 3ZOIA 2RV9A 2HWD3 4I0BA 1KDMA 2SLIA 1SLTA 1PNFA 1K5MC 1K45A 2WSVA 1E5IA 4OHYA 1MS1A 5CNAA 3O1PA 4LHLA 1G7YA 2VMEA 3RZKA 3CLPA 2PLV2 1OKOA 5D2AA 4HKLA 4BQ4A 1X50A 5I8YA 5A3NA 5DAPA 4EN8B 4FQ4A 4GZ9A 2XL7A 4NR1A 3VGIA 5A6XA 3MW4A 4E2GA 2WINB 2D7FA 3E6BA 1QF3A 4WM7C 3B69A 1RINA 2E31A 3PWFA 4W6WA 4WM8B 4XTPA 1B35C 4QX5A 5FYMA 1O7FA 2ZTNA 5M3FL 3AZXA 1R081 2VM9A 2VO5A 2ARBA 3HVDA 1W6QA 1HB1A 4JGYC 1RUJ2 4I0AA 1COV3 2OVUA 3K4ZA 3TEZA 3NKGA 4POGA 4R9CA 1PVC1 4XZUG 4K7JA 3B94A 4Y22A 1QJY3 3TN92 1ZBE1 5JPMB 2UY8A 4FPEA 4PIYA 4AF9A 2XHKA 3B02A 1JH5A 4UOJA 4ZHNA 4CDUA 5KXBA 1MQTA 2XGXA 1H9WA 1KDKA 1SLLA 2DUPA 1RUE3 3JBG1 1MPXA 4RHV3 3VD3A 2APOB 3WNPA 4LIUA 2W08A 5LBEA 5FV3A 5DAXA 4PHZA 4PQ9A 3WP4A 5IFPA 2OUJA 1OSGA 1RUD2 2R043 1YIPA 2R1DA 4Q4W1 4Y20B 5K8SA 1JU3A 1ZRIA 4QX0A 3BTYA 4K1YA 5J3UA 4COYA 4TPUA 1H2MA 2OS2A 3I59B 5BNOA 5J48A 1GBGA 5FZKA 4A3JL 2Q1MA 1H8TA 1N3PA 1NLQA 4QPIA 3RZZA 3I2FA 3DYOA 4A3CL 1XNTA 4NJ4A 2L9LA 1V0AA 4UBGA 1A8DA 3C7OA 4JHTA 1JZ2A 4OI0A 1ULPA 4QWNA 2XJQA 1OLQA 5H9QA 3J7Y1 1X8MA 4IEZA 3ZFFC 4GJYA 2GALA 2VY0A 3IKWA 2LS6A 3ZFEB 2GDFA 2IVJA 1WLCA 3FUOA 4PCRA 5KXEA 4OUMA 5FXZA 1Y9QA 2Q8CA 1AL23 2DVDA 4PI2A 2WQ4A 4MOAA 3I3BA 2BVBA 5F9TA 3HMYA 5BNPC 2IC1A 1DCSA 1T2XA 5JXGA 1QXPA 3SXWA 2L0ZA 2VUCA 2XL9A 2XKOA 3JQWA 4YVWB 3H3VM 3WG4A 5JOYA 4AFMA 1OHFA 5IP9L 2V72A 3MQKB 2VW0A 4Q4Y3 5E1RA 3S57A 2WZR1 3SCFA 2WJSA 2QDNA 5K4LA 1WLDA 1ZREA 1QH7A 2H6BA 1ALYA 1BEV1 2HVYC 1EPZA 4ZPIA 5K0UB 1ZYBA 2VMDA 4LIVA 1EY2A 1G9FA 4P02B 2ZHLA 3M2MA 1GU3A 4Q8LA 4DXTA 4LBMA 3H50A 1HDKA 3D5OA 4FCAA 3WF1A 4AGVA 1UNBA 1V6LA 4CDWB 1W6NA 3VV1A 3T09A 4FTEA 3N7LA 2JJ6A 4LOSA 3VDDC 1IHMA 2QJVA 2BW8A 4C3JL 4CXWA 1VMFA 4EN0A 3LOBA 1F15A 2AACA 2X53S 2HWC2 3MO4A 4NWVA 4CCOA 5FYSA 2YGMA 2HWE1 4LOTA 2O5JD 5FP4A 3WF2A 2C6BA 1NNQA 3H97A 3FFQA 1NQDA 3GHMA 4QX2A 2QQPA 1TME2 3MF9A 3WWLA 3U1XA 4F3JA 2R92L 1ENSA 4DUVA 1Q43A 1RVF1 2R16A 2DVAA 3ZN4A 1ZZ9A 2ADDA 3OD0A 1TVGA 2PFWA 3H7JA 4OZOA 4D8MA 3HJWB 2X5IB 3OTFA 2WNUB 4GAZA 5ACA2 5J37A 1FV2A 4P9GA 1GSLA 4QPYA 4UFHA 4XF3A 4XJ8A 3VBHA 1CX1A 1H8VA 2E32A 1H7VA 2D3SA 5AC93 2Y0IA 4PIZA 4QQPA 2A71A 4BYYA 4PIXA 5A1FA 3ZFFB 3HBKA 1I50L 4XDPA 3E1F1 3LIGA 1QJU2 1HRV2 1NXEA 4X6AL 2A69D 3ILFA 5EQUA 4DQAA 5FYCA 4GWIA 4MZUA 1GP6A 2VOWA 2VQAA 3W21A 2WFF1 3NAPB 2ZHMA 2R32A 1YK5A 3AZZA 3IWZA 3KSCA 4A6OA 4EWEA 1J3RA 2IXLA 2PHRA 2EVXA 1IS5A 2QKDA 1LULA 4UFLA 2E2HL 2R063 3VHNA 1LKOA 3ELNA 1NOVA 4JRLA 3WX5A 5FZLA 3QLQA 4CDUC 5DZFA 1ZRPA 1HRI1 2WZEA 1U5YA 4NUBA 2WL1A 4N9IA 1R0GA 1VJ2A 3OBZA 4NE9A 3HNMA 5DG1A 3RZTA 4QDQA 1CZTA 3G7DA 1UIKA 1JUHA 1NCRA 2YY1A 1RUG2 1V00A 1HW5A 5H9SA 1C8M1 2HR5A 1O5LA 1H8TC 3ASIA 3POWA 1E57A 1OH4A 1IPSA 4QPIC 1PGL1 3GCXA 2ATFA 1STMA 4A4AA 3OGSA 2PHWA 2X09A 4P9YA 2G4IA 3ZIWA 3I3QA 3L2YA 1HV0A 2PHUA 4R4XA 2A75A 3WW4A 5FZCA 4HK9A 2DV9A 2VCCA 3AKPA 5J36A 1BBT1 3RJRA 1PM7A 3MGUA 3MYXA 4FPFA 4AI0A 1C1FA 3EB7A 1G9AA 5H1Sc 3T2TA 1IROA 3ZPYA 3DYPA 2RS32 2WWSA 4BXXL 1IRNA 3LSEA 2WWJA 3MFAA 3WF4A 1SFOL 2XVLA 1W03A 3Q9OA 1UXZA 4FPCA 1OUXA 2BYVE 2VNGA 1LOFA 2FDFA 4CDXA 1IGOA 1AUYA 3ZN6A 4CVUA 4MH0E 2JWPA 3GNEA 4HZFA 3W5NA 4AHWA 1A3KA 3ILRA 4D6RA 3HOXL 3K77A 1D4M2 4DNYA 1K83L 2QQLA 3ZPOA 2PLV3 1UQXA 3P8BA 3ZN5A 1KFUL 1ZBE2 2DVGA 2B39A 4X6QB 2ZZJA 4DUWA 5FZOA 4QKFA 3R6SA 4QB2A 5FP3A 4BY1L 1CJPA 2OXBA 1ZRFA 1DYOA 1SCSA 5LATA 2NMNA 4IEYA 3D8CA 4COWA 4QHZA 1W8OA 5K7PA 3ACIA 1NXGA 3D6EA 1J58A 1YNAA 4NO4A 1W6QB 4WVMB 3MDPA 4ZZ8A 1RUF2 2Q0AA 2JDYA 2X29A 1RJ7A 4Y5TA 5CVRA 1GOGA 4GS7D 4AAPA 3LWQB 3HN3A 5FPVA 3J8F1 4LTAA 2LUWA 1GP5A 4B8EA 3TN93 4Y5SA 4LK7A 4IGOA 1LHWA 4Q4X1 5KHHA 1MQTB 2QDRA 3RZDL 1MACA 3VKOA 2VXRA 4AYUA 3I4ML 3EO6A 5M5XL 4BIFA 2IXCA 1QGLA 3IDCB 2RMU3 1QNYA 2VOKA 3AMQA 3LFIA 5A3TA 2FHRA 3M3CA 5JIUA 3O1RA 1NCQA 2WABA 5BNOB 3HR9A 2D93A 2I74A 3LZZA 5AI3A 1AYN3 1JZ6A 5IK8A 2DBIA 4ZXEA 5IUQA 5DDJ3 5C5UA 5A7PA 3VD9A 2VTXA 3VBHC 4DEQA 3LKJA 5A7NA 5DUXA 1DGWA 3CZJA 2W1UA 2NVXL 2QZ3A 2Z3RB 3J7MA 5APAA 1H9PA 5KC6A 1R1A3 5JWPA 4EROA 3VD4A 2WZ8A 5H9RA 3GZAA 5T5JA 4XGHA 4TTGA 2EIBA 4XETA 3JB8A 1JHNA 4ATEA 2JG9A 4FT8A 1AJOA 2UYBA 1OLME 4YW7A 5C3QA 3U4SA 4KBBA 1ASJ1 1WCUA 1Q8QA 3DKWA 1ZA4A 1L7QA 2BRTA 5L9BA 2QQIA 2LCQA 5BNNA 4WZFA 4C1WA 1QJY1 3KQ4B 3PVOA 2D5FA 1TWHL 3JD73 4AGRA 1JZ4A 1H1MA 1PO23 3VLBB 1RXGA 3N35A 3UESA 3HIFA 2EAAA 4OQ8A 1RUE1 4CXYA 2HWF3 1GV9A 3PKIA 1NCRC 2E9QA 3B93A 1WMDA 4Y33A 5T54A 2PELA 2WQ8A 2LTNA 5EWSA 5JPNB 4P5HA 1SQ4A 1CN1A 1ZVFA 2DTYA 3IDAA 4AFDA 1TZOA 2K46A 2I07B 1A78A 3H1MA 4ZONA 5HBAA 2PAEA 5FZAA 1QJX1 1Y9GA 1BKZA 1AX2A 5CFCA 2VCAA 1R0IA 2W94A 1YIFA 3OBRA 2G19A 3AZVA 5FPBA 5FPXA 5EIOC 3NVCA 1RYQA 1RVF2 4BMEA 4QIWP 1GWKA 3AP7A 1AR62 1POQA 1UOBA 2Q8EA 3W5MA 5GZFA 3NKTA 2WWUA 2GNBA 7RXNA 1UY4A 1LRHA 5JOZA 4UT5A 4R8HA 3BIEA 3GYDA 4AQSA 4IQPA 4S2HA 2P6CA 4O9GA 4WZCA 1Q8PA 5C4WB 1LOFC 2Q1ZB 1OFNA 1Q5OA 4JGZA 1T6GC 1W99A 1XBFA 1Z0HA 4OMCA 4CDXC 4W6XA 2BUKA 2C24A 4Q0UA 3MHZA 3WW2A 1VBA2 5F5AA 3ST7A 1TME3 5CADA 2C26A 5DMYA 4QHOA 1JN2P 2AC1A 1PGSA 3NV1A 4IUGA 4DY3A 4Z07A 1QH6A 3KLSA 1ND3A 1PM4A 4Q4Y1 3I2OA 3EJKA 1QJFA 3SH5A 1WW6A 3H9BA 1OOPA 4LLOA 4PLNA 1QU0A 5KBFA 3BGAA 3CMGA 2PTMA 2A73B 2VZPA 4XBQA 1ODNA 1XQNA 1QWRA 1SFPA 3T3YA 1LNSA 4XURA 3WUCA 1XPWA 3RZMA 1OA2A 1S2EA 3M3OA 5A3MA 4XFAA 1LU2A 1T9PA 3KCYA 3KVAA 1Q8OA 1HRV3 1QJU3 5CZKA 5I0RA 2ORXA 2ZKLA 1SCRA 2CY6A 4OI4A 2AR6A 1NE6A 1C8M2 4LT5A 1DGRN 4GQ7A 3PTYA 2XWJB 1KJLA 1ZBA2 2QQOA 4L97A 2W0XA 5DG2A 4OCTA 2RR12 3PU3A 4KWJA 1BQ9A 1SLIA 2A6ED 3HOWL 1CAWA 1IU6A 1LENA 4A93L 2GNTA 2MS3A 2EF6A 3ZFGC 4YVSB 1U5IA 4LQRA 5FWEA 4L92A 1UU5A 2YU9L 3QH6A 1NCQC 2CKCA 1UOJA 3NNGA 2ZEZA 4XXPA 4LMFA 3UK9A 1S0BA 3AM2A 4CU9A 1KD7A 4D7TA 1RUG3 2FMYA 3KWVA 4QQ2A 5F5QA 2J1SA 2WS92 4CCEA 4R9DA 2LM3A 4GIQA 3ZKUA 4BQ5A 3ME2A 3N9QA 4PLMA 3PNAA 4AI1A 5FUIA 3ZYPA 3OUIA 4IV3C 3MIBA 1NQJA 1VBC3 3ZDSA 4NVPA 4RA0A 5MFPA 2AEYA 3K2OA 1MVEA 3INAA 3I2GA 3VBUB 3VHPA 1QDOA 1SBFA 2FQPA 1Y4WA 1Y43B 1DGWX 2FCUA 1LECA 3DXTA 4QXBA 2JG9C 2Q8DA 4F83A 1FHHA 2AUYA 2BFUS 3NRUA 4AVAA 5IYBL 3ZG6A 1I3HA 1B2OA 1S24A 2FBEA 2ZGOA 3PZAA 4K8FA 1P7PA 5A1AA 1VALA 5A3WA 5BNNC 3MV11 4BQXA 4DRVA 2RS33 4E2SA 2Y6KA 5GAGc 4IE0A 1DGRA 4Q8KA 1GZTA 1OQEA 3MIGA 2A6XA 2YROA 1W6MA 2R061 3B9IA 4UW6A 5DXDA 1VZHA 1JYVA 2GH2A 3ZN6B 1CADA 3C7EA 3VBRA 4P5YA 3S15L 3AXDA 5HI0A 2R0FA 4IEQA 8RXNA 1WD3A 3ZM8A 4ZZ5A 4W6YA 1RUNA 4V196 2AREA 2PHLA 4AOCA 4EZHA 3KD4A 3FL7A 3S2HL 4KG8A 2EY4E 2D6MA 4DXZA 3FBMA 3PMSA 1VMJA 1XNAA 4OHXA 1EUTA 5T5LA 5CFCC 1HXS2 3LA7A 5L9RA 3GM8A 3DKQA 2R93L 4QU1A 3PVBB 5C3PA 4CDQA 4H7MA 3LIHA 1J1TA 4IEWA 3KM5A 1J3QA 4WM8A 3ZXFA 3R0RA 4LHKA 3VUOA 4L99A 2WZPP 1IU5A 1W9WA 1W2AX 2SBAA 4H7LA 4BLIA 4B4QA 2VVDA 4YM1A 2WT2A 1JZ7A 2JDZA 1H6YA 4GB33 4YRDA 5FY7A 2VZQA 4YW3A 4BE3A 1E8JA 2MEV2 1Z7S2 1PGW2 2XJRA 2NLRA 3KV6A 4YW6A 2R072 3LD8A 5CISA 1PO12 3N9LA 3UJQA 3SEPA 4BDVB 3ECQA 2FDKA 2A6VA 3MW3A 1BMV1 1VLNA 1R1ZA 2B42B 3ETQA 5E88A 4LBJA 5FY8A 4UFKA 1O5UA 2PVEA 3SH4A 1ND3C 3VHRA 5IATA 2V09A 3UT0A 1PZ7A 2DFCA 4Y20A 1FOD2 3WNLA 5F5IA 1OOPC 1RDGA 3I59A 2UURA 3H9CA 2JA5L 1YFXA 3HQUA 2JA8L 3R4SA 4B8CD 1ZZ8A 4LK6A 4NHKA 3GBFA 4WBBA 3FLPA 1L3JA 3IMNA 1S2ZA 1BK1A 5A3PA 3N9NA 3AP4A 3OGJA 1UPSA 1G8WA 5KHKA 3ZMNA 2ZCWA 3ZFEA 3ZVXA 3O14A 1DZQA 1JOPA 2WLPA 1F31A 3WDXA 1X7NA 3WNMA 1MS9A 5DM61 5FR3A 3WNKA 2PHFA 5HXVA 4CP2A 1Y7BA 3FJSA 2NN8A 3A7QA 2GC2A 3KMHA 3IIAA 1GOHA 3LSDA 4M01A 4OUSA 5F6LB 1VBD2 3O0XA 4CP1A 1MZFA 3RI9A 5KC5A 4YVWA 1T9OA 1GR3A 1OD3A 2FCTA 4DXSA 4Z1VA 2RS53 1N47A 5CIRA 4L9BA 4IESA 1PZXA 1W9SA 3KYVA 5GKAC 4UW4A 4CCMA 1W3VA 5F39A 2J1VA 5HCAA 4FP3A 1SPPB 4FOQA 3LDBA 4A3ZA 2DYCA 2R6QA 3MSUA 5DDJ1 3RFRA 1VBE1 5FXVA 4JKKA 3S1QL 1ODMA 5K0UA 3UL2A 2IUWA 4EE2A 2JB8A 1SBDA 4XCBA 2R1BA 2GAUA 1LGBA 5A32B 1UU6A 2OIIA 4CSWA 4YFZA 3OGVA 4GKYA 2ET1A 1W0OA 3MLKA 4RN5A 4XUPA 3MEPA 1X36A 5KXCA 1MZ6A 3LAGA 1ONAA 3DV8A 5EP9A 3PVEA 4S2DA 4RR3A 4CDWA 3RVHA 4PLOA 3O5SA 4XFGA 3BALA 4XIOA 4ZU7A 4CUGA 4JGZB 4YW1A 3BODA 3MIHA 4BJ0A 1ULDA 1XU2A 4JDMA 3IMMA 4NRMA 3IIIA 2WT0A 3GALA 2ZIXA 4EWAA 3JD71 3S5AA 1PO21 2BBAA 5KR7A 4NAOA 2K9ZA 1Q3EA 4CU7A 5FPAA 3M4OL 2DCTA 2VUML 2HWF1 3PU8A 4C90A 1OMIA 1K3IA 3OPTA 5FZ7A 1LTLA 3TOJA 3UV9A 3BIWE 4CE8A 3V65A 1FT9A 1QXJA 3KT1A 2RJLA 1B09A 1WBFA 1WW7A 1QQP3 2WNUA 5A6YA 5F37A 3V0AB 3SCGA 2YMZA 3TYJA 3A44A 1W8TA 3WP5A 3ZIXA 4ZXKA 3QQCE 3HAXC 4WM8C 2QZ2A 3RSJA 3ZR5A 2MHFA 1LHNA 1RUC1 1AR81 3BOPA 3J7HA 4HKOA 3P6BA 2HEWF 1CIYA 5LA1A 3NMBA 1O3TA 1CR7A 2GC0A 4TN7A 2A68D 2XR4A 2Y6JA 3D3AA 4KNCA 4DZGA 1H0BA 5DAVA 4XQWA 3NAPA 1N1YA 1C5HA 1QNWA 1GNHA 1QIQA 2XXZA 2M6PA 2JICA 1A6CA 2YBPA 4BQ1A 4QM8A 1XNBA 2Q8OA 3UGFA 5FYYA 5LW9A 3VBFA 2RR13 1RDVA 1OH3A 5FMCA 4MX3A 2PMZP 4ME3A 1R0HA 1IQAA 4Z2WA 2XKPA 3N7KA 2BGCA 4LNVA 3H1WA 1TWGL 4NHLA 1PHMA 4RGGA 3WR0A 1TMF2 4QX8A 2XVKA 4U36A 2OYZA 4QXHA 5FYZA 3V0BB 4DO0A 5FBJA 1GQGA 4LLFA 4C91A 1PMHX 5KWRA 3AZWA 1WMXA 1UY1A 1RTVA 2BU9A 2DU0A 2WS93 3OF1A 1PVXA 3H0OA 3FLRA 5FZ3A 3SHRA 2VW2A 4OUEA 4JHZA 1TWCL 1TWAL 4LO8A 4Y4YA 1V9U2 3VZMA 2GC3A 1W05A 4INDA 3H8OA 1TWFL 4FFIA 3BTXA 1UZ0A 5FOBB 3THPA 4J1XA 1J3PA 1UOFA 3ZFEC 1JYNA 1KITA 1LGCA 3DN7A 1AYM2 3RI8A 1U12A 2VZVA 3E6DA 2V5DA 2HEVF 4AI2A 2A6YA 4LR4A 1IQDC 3AKRA 4LHNA 4N53B 4Z82A 4Q1PA 2IFRA 1S0EA 1MEC2 2B9UA 3D0JA 4H3WA 4JAFA 3POSA 3VZOA 3RZGA 2QUOA 3RGBA 3I4NL 1HX6A 1UPIA 5G04L 1APNA 1ODHA 3VBRB 4CZSA 5FLML 1XNDA 1RWDA 4E27A 2XJSA 1CAAA 2V3BB 1VBB2 1NA1B 2PYTA 3OBTA 3H8UA 4YVWC 3ROUA 5C8CA 1G9BA 1JYTA 1RHI2 3T08A 2TUNA 3NV2A 1URXA 4OVEA 1EV13 4N9HA 1VAVA 2WFPA 4M0HA 4N43B 5FJHA 2NVYL 2H6CA 2RJ2A 2ARCA 4M3CE 5D21A 4CDQB 5K0UC 4B3NA 2P3KA 3FDJA 5GLZA 5FLHA 2OQ7A 5C71A 1PIV3 2CGNA 2JE9A 3DUIA 3O7OA 4W50A 3THDA 4JC1A 1EUUA 4A3FL 4WVMA 1VMHA 3I3DA 3W58A 4QMAA 5FZHA 2W68A 1C28A 3VD5A 1HQWA 1RUI2 4H14A 5CKMA 4CDWC 1AR73 5FZBA 5T5OA 5JSPA 1WW4A 5LY2A 4BB3A 1DQ4A 4LBQB 2RS13 2WNVA 5FKBA 2W95A 2ZGQA 3EQEA 3T4HB 1O6UA 3CL1A 2MEV3 5LBFA 1SACA 1Z7S3 1IW7D 4ES8A 5HXMA 2CL2A 1WGPA 4W8JA 4NIGA 5CG8A 4AHZA 3MUY1 3CQZL 3P3NA 2Y8KA 4ONUA 4QXKA 1K42A 4Y5Z0 2PVXA 2NYDA 4NHYA 4DINB 5A80A 3UETA 4HL0A 2V5YA 4I3PA 3PDQA 2GH8A 4LORA 4A3IL 2X5IC 3POBA 1C3HA 2WNUC 4JV4A 3WQ0A 4DPNA 4NIIA 2VUJA 5JLVA 1BZWA 1FXZA 3AXEA 4LPLA 4YYOA 2E33A 4P08A 1UZWA 3NJXA 3OUJA 2C9AA 4D94A 1OPMA 1NLRA 3BOWA 1US2A 1W0NA 1H4HA 1OWCA 1S0IA 1ZM1A 4YZ5A 2QQUA 2O8OA 2ZS6B 3H1YA 2PN5A 3PIP1 3M3EA 5CB7A 1SMWA 4YWLA 1NY72 3B00A 3NAPC 4U671 4O61A 4AEKA 4NIAA 1SEFA 1EAH3 1CAXB 1PK6A 1RUH2 2PA7A 4GB31 4ARXA 1ZNPA 2HWB2 2D6LX 1DP0A 4YZ4A 4QPGB 1H1AA 3OGRA 5M5WL 2D6NA 2P34A 3GDBA 1CQ9A 1VP6A 2IXHA 3T2PA 4DFSA 4ZY9A 4B1LA 2ET7A 5T55A 2WUHA 5HCHA 3SCHA 4CCDA 3OEBA 4NHXA 3WNXA 1DFQA 3ZKYA 5AFEA 3RZLA 4NPRA 3GXUA 3M8LA 1GZWA 4AI3A 3Q8CA 4MXVA 3AYAA 2VULA 3PURA 1QEXA 4E4ZA 2Z69A 4I3GA 4CA9A 1UWWA 2ZAAA 2D40A 4GD4A 1VAKA 1W2TA 4FVVA 3FKIL 5LA0A 4FP2A 4A3XA 3NV3A 4ISRA 4AQ2A 1YHFA 3AFKA 4MGSA 3IM0A 3PJYA 1LJ7A 4GMP3 4AL9A 3J9SA 4HXCA 4Y1ZA 1C57A 3P3PA 4RR3B 4UFIA 4DIQA 2JECA 4Q0SA 3GHNA 5L73A 4AK3A 3M4FA 4QQOA 3PVNA 3LWRB 3OBAA 3RYKA 3RWNA 3U07A 3RZHA 3KYXA 5DM71 2J22A 3E5XA 2WO2A 2YYOA 1CPNA 2DU1A 2RM21 3WCSA 1PFUA 1DX8A 2BNMA 3RJ2X 5C4WA 2B4KA 3N9PA 3IZOA 2I45A 4NPLA 1RUC2 3VPBE 2WO1A 4QPWA 5CYYA 4FTSA 3PIJA 4A2UA 4XXBB 1OPOA 1WKYA 2VBBA 4DB5A 4EWDA 4Q4V2 3EHKA 2RS51 3LPEB 4G9SB 4N7IA 4RS5B 3RMXA 3ZXEA 1RMU2 4MLOA 4R9AA 3H42B 4ZS2A 1PNGA 2VQ0A 1B71A 2M4VA 2D5HA 2YPDA 4MYEA 4S2GA 3DF0A 3NL1A 5LEKA 1AR91 3V56A 4YARA 2MNGA 4BCUA 3OB8A 4P9IA 1S0CA 3TNPB 2WN2A 3CJXA 2GNMA 1WMFA 3KT4A 3NWKA 4FI9A 4KBZA 4O65A 3S2DL 4AXOA 3O1UA 3VBOA 1RXFA 1N3OA 4C1XA 2JXAA 1OUSA 2P1BA 2VOXA 4XJAA 3ABZA 5C8WA 2IXIA 3F95A 2JI1A 4AEMA 4Q5OA 4O7XA 5FZEA 1XE0A 3VBFB 2BV4A 1G6NA 1R093 1MQTC 1OA4A 3N9MA 3THCA 5CBLA 1MS8A 5E8AA 5D8AB 3PTRB 4JDNA 2GSYA 4NHMA 1OFSA 3M70A 2WYFA 4COVA 3GJBA 3VZLA 5L7OB 3A0NA 4XF4A 4YVSA 5MLC3 2BERA 1Y9MA 1W6OB 5BNOC 3D0SA 1FX5A 1UZYA 2KM2A 2VMHA 4KWLA 3WHTA 3P1IA 1GWLA 5K2ME 4P9JA 2Y60A 3B9CA 5GAEc 3LWCA 1FMD3 4MXWB 1ND2A 5FXWA 3AMNA 1QQP1 4CP9A 2GN7A 4ZU5A 1VIWB 2JIJA 2TBVA 4BU2A 2VZ3A 5F3CA 3AMPA 3FX3A 5AFBA 4BHPA 3I3MA 4RXNA 3VBUA 4TSVA 4YW5A 1REFA 3KVBA 2Y34A 1O4ZA 2GN3A 1N1TA 3WF3A 4HVRA 2QQMA 1WBLA 3O12A 4LBOA 4MGZE 4KU7A 2YFZA 1UXXX 4FPOB 2XBO3 4NROA 5IVCA 4XZPA 1MEC3 2EAKA 2Z4FA 2NM1A 3OSDA 1Q8SA 3A0KA 1D2QA 3LF7A 2NPIA 1VRH3 4MGKE 5C8CB 1NXMA 2FCVA 3WP3A 3NJVA 3DL3A 1CONA 4XJUA 1AX1A 4Q2FA 1R082 5CKNA 5H9PA 3IAPA 5LBCA 1IPJA 1ZA7A 3KV4A 1RHI3 1E5SA 1LKNA 2AYJA 4I30A 5FAXA 3MZHA 1DDLA 2JG8B 1MZEA 1PVC2 2VG9A 5LASA 2E7TA 2OPWA 1NZIA 1W2OA 2VNRA 4ET7A 2K2DA 5JVH1 1JMUB 5L19A 1SDWA 5EYXA 1SFYA 1FPN1 2IXKA 3A21A 5FUPA 4JAGA 3JBG2 1UN1A 1DQ2A 4BBRL 4JAAA 4UWDA 5I8SA 3S17L 4CCCA 4YWAA 1RYYA 2EXIA 4Q4W2 4XMIA 4YZ3A 3RDIA 3N3HA 2VZ1A 3LWPB 2CYFA 1RUJ3 2W91A 3T2OA 4J6GA 3ZXJA 3QBQA 2WNVB 2EA7A 1BFYA 2HBUA 5C9AB 2OT7A 3S1RL 2ZGTA 3ITQA 4MUVA 2ENRA 5GJ6A 1DF0A 2V73A 5C3EL 2P3YA 5I91A 5C4WC 3AFGA 2A6HD 3KF3A 3DPRB 2ZOEB 5A3UA 5K9YA 2HWD1 3ZXKA 2ZGNA 3KT7A 5E6HA 5HV0A 4CU6A 2VBPA 2B45X 2C4XA 5M3ML 2X8KA 1KXGA 3LA2A 1RUD3 2XLAA 3K7AL 1DG6A 1W06A 1X8EA 2ZX2A 2ZX4A 4FPKA 2GMMA 3IN9A 5FY5A 1SLAA 3MICA 4Z92B 1VAMA 1X33A 4P14A 4RSUA 5FY1A 4CUAA 5F1RA 5JR2A 5HV4A 4IEXA 3K35A 3JCIA 5CG9A 2WNEA 1O3RA 2BZDA 4WVZA 2CAVA 3WNOA 2NYYA 2ADEA 2P4EA 1CD3G 1PFVA 3CJIA 4XDOA 5KHGA 4NIDA 3ORJA 3S0MA 2UWCA 3ZXDA 2VVFA 2WZR2 2E2IL 3VKLA 3VD7A 5B4NA 2JKBA 4XTMA 3VDBA 4AR3A 2B63L 1V6MA 2FZ1A 3A23A 3MIDA 2FZ2A 1PK6B 1COV1 1UD1A 3KYUA 2Q5TA 1YWKA 3R4DB 1AR71 1BEV2 1WA6X 4KU8A 2JA7L 4XAAA 2RS11 1LODA 2X05A 1OXCA 4B1MA 1JHJA 4Q0PA 2CDPA 2XPJA 3W9AA 2DUOA 3K4DA 5C44L 2VXJA 4I02A 4RHV1 4YVSC 1LGNA 1RJ8A 1PZ9A 1DQ1A 3USUA 2A3WA 1GZWB 2ZHNA 1NX9A 2ES3A 2R041 3ZDVA 1YQ2A 4CPBD 3KYWA 3H3UA 1GANA 4CCNA 4FOYA 3D82A 5JVVA 4CYDA 2Z79A 5LRSA 1T9QA 1SPPA 4P00B 2YBKA 5JXIA 1UU4A 3SITA 1F4LA 4EYUA 2RM22 2BFUL 5EV7A 4AWDA 5JXHA 2HWE2 2QE3A 1OKQA 2VL4A 1SZBA 5DAWA 5ERLA 1CZVA 1YXWA 3GTOL 4UFJA 3CNAA 4EZ4A 3OD4A 2GMGA 3VBUC 1YJLA 2JKXA 2E26A 4CPBA 1GZ9A 5A32A 4LO6B 2HYKA 1QCVA 1UO9A 2RDNA 2XQRA 1YUZA 3PLQA 3B0AB 3PUSA 4DMIA 4XUOA 1ZX5A 4M4RA 2ZXQA 3M1HA 1GLHA 5LA9A 3VDDA 2B5ID 1IG3A 2BVVA 3WHUA 1AL21 2RDRA 4HMZA 1BXHA 1C09A 2QCSB 1EAH1 4UBHA 4BPZA 5JCTA 1F5JA 2ZPXA 1DLLA 4OFGA 2RHPA 1F4AA 1PX4A 2HWC3 2QVSB 4QHBA 1AR92 1MS5A 2ZEYA 3AB0A 3U14A 5ABJB 3DGTA 4YW4A 5T5PA 4AEDA 2W9XA 2VW1A 1XYNA 4LBKA 1I6HL 3NV4A 2LALA 4AEJA 1YUXA 4QM9A 1JODA 1IOAA 4XDQA 2BE5D 5EJ1B 1GP4A 1YO8A 2HLEA 4Q4V3 2WFF2 5IVBA 1GFF2 3G6JB 4RQPB 3I49A 1SHWB 1VPHA 4BWOA 1H2NA 5EHDA 5T50A 5ACA3 3N4MA 2WNOA 3ALQA 5JAXA 1BCXA 4IEUA 3GCWA 4LUKA 4CP0A 3AKTA 1HRI2 4BQ2A 1V6IA 3V0AA 5GADc 3S1NL 3CZUA 1BQ8A 1IS6A 1DHKB 2W1SA 4UW5A 2MPFA 4KGQA 4PBOA 5IYDL 1QKQA 1UCXA 3IPVB 3VBOB 1W39A 5C4JL 4S2FA 1UIJA 2J1EA 1HJGA 1L7RA 4GMP1 4QKBA 4XHBA 4K3UA 5GZEA 2JDNA 3NQHA 2Y6GA 2XVGA 1PGL2 2OZJA 4B7EA 5GM0A 5IFTA 2H0BA 1ENXA 2ERJA 1P8JA 1ZZBA 4MADA 3FZ3A 1QXRA 2YGLA 5DQ0A 3RZOL 3IT8A 1OURA 2RDSA 4N7UA 2ZX3A 1OLMA 4V2VA 3FHQA 4BM8A 1BBT2 3I4IA 4HSJA 1IG0A 1GWMA 3GBGA 4BZ4A 1UYZA 2NMOA 4HKWA 5FJKA 5JSRA 3V0BA 1BQPA 1N1SA 3PMEA 1XRUA 4ORFA 1R0FA 4HVOA 4O9EA 1OLRA 5FMDA 5AI2A 1CAVB 2VC9A 1ND2B 1O3QA 5C70A 4CP9B 2JD9A 5GLUA 5A3LA 4Y7NL 2TNFA 4YM0A 1RC6A 4FXKB 1V70A 4EN7B 5AC91 3I2IA 5FZ6A 3MUZ1 4HVQA 1V6JA 1XSRA 2EICA 2M6OA 3BCWA 4XCAA 3KHCA 3QCWA 3GF6A 4CTEA 4MV2A 5KHJA 4DEVA 3T0DA 3E5UA 4K20A 3SMHA 3LFMA 2O8QA 2V0FA 3LPFA 1FATA 3B08B 6RXNA 2A1XA 3HT1A 3ILNA 4N53A 1H4GA 3S6PA 2WO7A 2JX9A 2ZGLA 3GJAA 1HV1A 2HYXA 1SLCA 3FWEA 1RUOA 1JYCA 3IAQA 1R091 1OVSA 1W0PA 2CNAA 3WDVA 3WW1A 1CZSA 3LOIA 2H12A 5JUVA 1BYHA 1K12A 5A7SA 1Q8VA 4IE5A 4HPKA 4SBVA 5FY4A 1NA1A 1W6PB 1TE1B 3HNYM 2PSMC 2P3JA 3UKTA 2DWRA 4C3HL 2PAMA 5AVPA 5FRAA 1M06G 3GTLL 1D4M3 2GP5A 2HH9A 2JDKA 2YFUA 3J8F2 2EIGA 1ZZ6A 2ERFA 4GA9A 1ZBE3 4N43A 3POGA 4Q4X2 4QQLA 4YGBA 3TBDA 1FMD1 1DIWA 1N1VA 4E6YA 3AP9A 4UI9L 1DQ0A 4XUNA 3WDYA 3OEAA 3DYMA 4IGQA 4LBQD 3NNLA 2D98A 3JBG3 4IETA 5J7MA 3HOYL 4Q0QA 3NW4A 1WA4A 4PDWA 3OPZA 5FLJA 3RS6A 3T30A 3PUHA 3FLTA 3RYGA 1UAIA 3I2HA 1RUF3 5LY1A 2CV6A 1C4RA 3DCQA 1UMIA 1D0HA 2FMDA 4XFIA 4K40A 3IBMA 4K9SA 5FP7A 3ZYRA 4BXFA 1OC1A 5IVJA 5IHRA 5IY0A 3AC0A 4COUA 4AR6A 1NAEA 1VB2A 4LBQA 1EYBA 1GQPA 2XBO1 4JGZC 2ZABA 2PQQA 1DYPA 2UWAA 3MLJA 3MIFA 1C8NA 4GH4B 2GMPA 1VRH1 2EXJA 3J4UH 4JADA 5DUVA 3VDAA 2ETEA 1PFWA 2WA4A 1Y1VL 2OX0A 3ZSLA 2CDOA 2J1UA 4A7KA 2YC4A 3PUQA 4ZU4A 1ASJ2 3K4AA 2WAOA 4UAPA 1S2BA 4MO3M 1I9RA 2PLV1 5ANQA 5EFUA 2VZRA 4Y3OA 1QJY2 2XUEA 3VZJA 1I5PA 1YQCA 4XEZA 1JZ8A 4QU2A 1YI9A 4Q26A 3CJIB 3VDCA 4EJRA 3GZTB 3SKJE 1RUE2 4G3YC 4XBNA 5J1XA 1LOGA 1S4CA 4LO5B 3HBZA 1ST8A 2R042 2D3PA 2YU2A 2BTVC 2WZR3 4HANA 4ES9A 5GZDA 5IK7A 1XOYA 1RUJ1 4CUCA 1K5JA 4IEVA 2QL0A 2PHTA 5EZWA 4A45A 1CAXA 2ZGKA 5IAXA 4MGTA 2XJPA 1QJX2 2BP6A 2ZA9A 3TN91 4XFHA 4AR2A 5J96B 1W9YA 4QPGA 1AL0G 4ZKTB 2TEPA 3PUIA 3USUB 1MS3A 2VCMA 5DUWA 5FWJA 2RMU1 1U5XA 2E63A 4QDRA 1RUD1 3BTZA 3HJYB 1NZCA 4IE7A 3ZXGA 1AYN1 4Y26A 1WJVA 1YV1A 2FDGA 2V4VA 4GWMA 4ZN3B 1HB2A 5A7WB 1CJDA 2JB4A 1G9CA 1DU3D 2ZMLA 2VNOA 1R1A1 4JRAA 1OVPA 5SV5A 3UKVA 1LEMA 3O0VA 1RVF3 2PHXA 1AR63 1YK4A 5FZGA 4Q4Y2 4AVSA 4CEWB 3LEIA 4FQZA 2JEMA 4Y1YA 4N53C 3UGHA 3CEWA 3OG2A 3B7MA 3F2ZA 4QX7A 4RGKA 3FHAA 5JDBA 3VBRC 2W52A 2YB7A 4AI9A 4AEDB 4F7ZA 3ACGA 4LXLA 4XFBA 3S5QA 5BPXA 4DRRA 1NA1C 1LB2A 4A7YA 1JYBA 1VBA3 4AVVA 4BMBA 4UFMA 4C8DA 2IFWA 2QQWA 5HCBA 5JIAA 4URTA 1XXNA 4A3LL 2OKXA 4XFFA 3T0AA 3U11A 2VZUA 4H2AA 5JR7B 2FD8A 1HQNA 3O1TA 4RS5A 3WDWA 5F3EA 4YSFA 4N43C 4R4ZA 2EALA 2XLGA 2Y6LA 3C7HA 1A34A 2VMCA 2O0OA 5JZGB 1YQ8A 5D1IA 4CDQC 3AMMA 1DZRA 2UWBA 4ISQA 3T4VA 5I0SA 2V0EA 3K3NA 1KQRA 2BPA2 3KQRA 4W4ZA 4K1ZA 2A6WA 2A6ZA 3M7AA 4AHXA 2QBXA 3HT2A 2DCZA 2JE8A 5JOWA 1TNFA 4IV1A 5FZ4A 5MGNA 3HOVL 3WY6A 2CR8A 1NKGA 3S1ML 4Q27A 1R64A 1C8M3 3RZ6A 3APBA 3WQ7A 4DXRA 1POV3 3TNQA 2CHHA 5BYNA 5B4XA 1SMMA 1ULGA 1ZBA3 3ZX7A 3N7MA 1A8MA 4CU8A 3E5QA 1W90A 1W8UA 3HOBA 1CAUB 3ON7A 3Q8AA 3QH7A 5FYBA 2HWC1 5AC92 4FSJA 1WCSA 2HJIA 1S55A 5D8AA 3U0ZA 5FFOC 1ZRRA 3K51A 4ITCA 4JVAA 4M00A 2XG3A 2DUQA 2ZJCA 3LA3A 1TME1 5F3GA 4XUTA 3WDTA 5L7OA 1OI6A 4V1PA 1XYPA 3B5LB 1W6OA 4JCKA 1R9TL 4LUMA 2BWAA 1CIWA 3FUQA 2P37A 5GLWA 3D4KA 4YLZA 3LWVB 1VE0A 1JXNA 3LE0A 4QX1A 1C5IA 4BK5A 5J09A 1BLZA 2R062 4MXWA 5ACA1 4YFWA 1I3QL 4YM3A 1S0FA 5BNPA 4WVWA 4CXXA 3QVDA 4LO4B 2E7AA 4XJ9A 3CU7A 1OQ1A 2B9VA 4Y1XA 4UF0B 4L0PA 2Y38A 4GWJA 1MS4A 2Y26A 4IEOA 3BUCA 3M3IA 1QJU1 1HRV1 1QDCA 1QMJA 3J26N 4FFGA 4B4RA 4JTOA 4LKEA 3WNNA 5IK5A 4BQWA 1FI2A 3WV6A 1H1IA 4DY5A 4I09A 3WDUA 2IZWA 2RDQA 4XABA 5FP8A 5EINC 2XJUA 4LBLA 4LE4A 4QPGC 3TRSB 5FMOL 2YG0A 1OF3A 2ZX0A 3BU7A 2W47A 2R30A 4HPKB 3MPSA 3MI8A 4B7KA 1BVP1 4GWNA 3KZ4C 1ENQA 3IDBB 4WFN1 1UKRA 1MS0A 3E6CC 3ACLA 4BXSV 3WOGA 4CEYB 5RXNA 3DEMA 2X10A 5JSOA 4BQ3A 2JG8A 1RUG1 2QQKA 3AP6A 3BI3A 4FPHA 2JI2A 3LCPA 4V2WA 2DVFA 4YGCA 3ZYGA 1V6OA 2DVBA 2YBSA 2JIGA 4XJWA 3SH3A 1HXS3 2Y6HA 2J1AA 3JZVA 3QACA 5FYUA 1WWYA 1VBC1 4HETA 4CCKA 2NVQL 4PDWB 1BMV2 4MVTA 4CRQA 3RZJA 5CFDB 4GJZA 4KG0A 2F4PA 1HB3A 1OF4A 1JZ3A 3LDKA 2W39A 4A3GL 3OPWA 4RR3C 4Y4RA 1DZTA 1HN0A 2D6OX 1ZRDA 4HBNA 1KS5A 5C9AA 4G6BA 2BQPA 1RGSA 4NIHA 3S7IA 4R52A 2B5HA 3PHMA 2RS31 4E2QA 3LEKA 2V4AA 2R073 1PMIA 2K2SA 3K3OA 4RFRB 1GYKA 1PO13 5E89A 2M4YA 3VBSB 5KXDA 1LTEA 3DPRA 1VR3A 1NE4A 5DABA 1AZDA 1PX3A 1W28A 1LOCA 1NT0A 1W8FA 3O0WA 2RVAA 5MFZA 5LB6A 2BNNA 3EMRA 4KWUA 4YG0A 4XHXA 1GNYA 3BPSA 4RS5C 3RMYA 1FOD3 1B2JA 3WWNB 2DCJA 4XUQA 1ASJ3 1J59A 1D4M1 4AVCA 3WXPA 5IP7L 4DS0A 2VCBA 1XJAA 1CPMA 1OT5A 2WIIB 4QB6A 5IVFA 1KJRA 5F2WA 3CBNA 3KYYA 3JU9A 3JR7A 4I01A 4X8PA 2PPTA 4YNIA 1CVNA 2R7EB 2W92A 4A3ML 2ZGSA 4TXWA 4IV1C 3O1MA 3ES4A 2RMU2 3LQCA 4XE9A 3WG2A 1MVQA 2F6BA 3I97A 1RUF1 3WCRA 2Y0SP 1AYN2 3ZR6A 5I8TA 4EN6B 1GQHA 4OI2A 5DDJ2 1LCLA 2Z3QB 2LROA 1VBE2 2N7GA 3AMHA 3QD6A 4KQ7A 3VBFC 4AG4A 2WLQA 3HWJA 1QJX3 2HEYF 4MGQA 5D8AC 2YC0A 4XW3A 4A42A 1VBD3 2B7YA 4AVTA 5EPAA 4YZ1A 4A44A 1R1A2 4Q0VA 1OQDA 1SLBA 3CDZB 4PI0A 1JYWA 1LHOA 5L7OC 1DYKA 1S0GA 4AR5A 4X6RB 5FPLA 4K9FA 3PIO1 1HJFA 2YC2A 3ATGA 2C1FA 2YDEA 2DF7A 5FMOS 4LKSA 5I0DA 1O4YA 4KMQA 3POJA 3AL5A 1LEDA 1IS3A 2CU5A 2W5FA 3CF6E 4QAWA 2LW8A 4A7ZA 4BY7L 2Q1FA 4C2M1 2YHJA 2VD7A 5FIXA 3PO2L 3JD72 4IDZA 3LNLA 1LOBA 1PO22 3AP5A 5CU1A 1UL9A 3JQXA 4YW2A 4HT1T 1K5MB 2BDRA 2EXKA 4BIOA 2AGSA 2HWF2 4M3CA 2WAQP 1SDDB 4E8DA 1Z78A 4P9LA 2KD7A 5JI7A 1UF2C 4BA6A 3U4XA 1S1AA 5FZ8A 3C7GA 2XWBB 4NRQA 5FY0A 5C33A 4META 3WG1A 1JYXA 2KA3A 4QD2A 3Q8BA 5GLTA 1S0JA 1X9TA 2DBNA 1DQ6A 2WSUA 1XSQA 5C8CC 2VU9A 4WM7B 5ABJA 1XE8A 2OZ6A 2WA3A 4K6BA 1AR82 2HKXA 5FO7B 1RYTA 1B35B 4KWKA 4R9BA 2OQ6A 3W59A 2Y64A 3L9JT 5JMCA 4Y1UA 1W3XA 4SLIA 4YPJA 5FLIA 1XYOA 4I0WB 5TSWA 3HJRA 3CQOA 2JG8C 4JGYB 2VAUA 5F2SA 4KH9A 2GU9A 2WR9A 2D6KA 4RQPA 3BVCA 1E5HA 1PZ8A 2PQSA 3CHXA 4ZN1B 3KCXA 5BNQA 3BPZA 4J25A 1ZZ7A 2BJSA 4AFAA 1N3QA 3I54A 3POFA 1DGLA 1IPKA 1MR5A 2CTVA 2G9ZA 4HFSA 2QQJA 4IV1B 2OW4A 5IW0A 3OY8A 1KEXA 1T6BX 3IPVA 4C0HA 2GMEA 3ZXAC 1UMHA 1XE7A 2A70A 2VMGA 3H7YA 1AR61 1X82A 3H3LA 4ZS3A 1IKQA 2VQTA 5FY9A 1YJKA 2CWMA 2WNVC 5C9AC 2JE7A 3MF6A 2ZBJA 4ATFA 1YFYA 2ZX1A 4OHWA 4A3KL 1LESA 2DURA 5DAQA 3X29B 5A6ZA 1CGPA 1DVBA 3DPRC 2E6VA 2WBKA 3NJYA
chains in the Genus database with same CATH topology
3KS7A 2RDVA 2YV8A 2Z42A 1TMF3 1VBA1 5DZGA 5KHIA 4XYXA 1AX0A 1U0AA 1YYNA 2K0GA 4FPGA 1EPWA 1WMEA 3OYWA 3L2HA 1CAVA 3RQ0A 3FE5A 3H3ZA 4K21A 2NP0A 5BNPB 4AHYA 5HCFA 1V9U3 3TB0A 2Q4SA 3VZKA 4AFBA 1NYWA 3B01A 1OA3A 5EJ3A 4PBPA 1ZRCA 2ZZQA 4NN0A 1AYM3 1RITA 1PK6C 3J7Z1 2WQZC 5BXXA 1IZ3A 1POV1 3WP6A 2KXLA 3WVJA 1ZBA1 4L11A 4AQTA 4MSVA 1LOEA 4FPYA 4MGIE 5DUUA 4EV0A 1VBC2 5GALA 4YWMA 2RR11 3SISA 5IK4A 3SNMA 3UJOA 2PAKA 5SV8A 1VBB3 1KFXL 4ASLA 4TWTA 2KKDA 1TQ5A 4TLFA 4WVVA 5FBZA 4OHVA 1W6PA 2QFEA 3I7DA 3NO8A 3H9AA 4KGGA 2VUAA 1JTZX 5A33A 1OWBA 3VDDB 4GKXA 2WS91 1MZ5A 1FV3A 3EXUA 2P3IA 3NJZA 4RGAA 3NSTA 2EXHA 1LKMA 4YZ2A 1JUIA 4LA2A 3VZNA 3QOPA 1VB4A 3ZYJB 3WUDA 1RUI3 3MW2A 4FXGB 1AXYA 5J98B 1BVVA 3HN1A 4XXAA 5AVAA 1WUVA 5ABJC 1C1LA 1NG0A 4GH4A 2BBVA 1LKPA 4BLJA 2BWCA 4AR4A 1EP0A 1YRZA 3WT3A 2E7QA 1H2LA 3ZXLA 3VHOA 4YGEA 4AW7A 1IS4A 5E16A 1EV11 2NQYA 4RQPC 1UKGA 4GB32 3GZUC 4Y22B 3I8TA 3ZSMA 1UZZA 3M3QA 3AJYA 1DBNA 2DFBA 4CDUB 1ENRA 1G86A 1HXS1 1QJZA 2VPVA 4PJYA 2DCKA 2ZGPA 1PIV1 2VGDA 2VVEA 3VBOC 4AE2A 3PKJA 2VECA 3LB9A 3ZFGA 4MGYE 2XJTA 3AYEA 3HQXA 1F5FA 1O4TA 1H8TB 4QPIB 1LHUA 4LA3A 3KGZA 1RUH3 4PF5A 3AK0A 5FOJB 1O91A 5J3UA 1VBE3 2HWB3 2MEV1 1Z7S1 1PGW1 3MPPG 2E51A 2RE9A 2R071 3VKNA 2E53A 1PO11 4IV3A 2XJVA 5T3NA 4OZXA 2DCYA 3E97A 2XH6A 3PJQA 1QOTA 1LOAA 3USSA 3EBRA 1JBCA 1QY4A 2WC2A 5MF6A 4RFT0 1FOD1 1ND2C 1ULCA 1VCXA 2ERSA 3RYRA 5CA6A 4FPJA 1W2UA 4XPVA 1REDA 3HAGA 4L2NA 5BY5A 2O1QA 4M3CB 3WLUA 4XMAA 2RS52 2DTWA 3POYA 4IEPA 4UXAA 4CEWA 4FAHA 1D2SA 2GC1A 1HQLA 3AKSA 5FPZA 2XLFA 2YZ4A 3ZMOA 1XNCA 2YUEA 3KCCA 4DOUA 3AYDA 4FPLA 1VBD1 1RUC3 1AR83 2BEOA 2XUMA 2RJKA 2XB6C 3URFA 2JENA 1F8VA 3C2UA 5IT6A 4XOGA 1POV0 4M3CF 1W6NB 3LGRA 1LR5A 3ES1A 2UU8A 4LE3A 2UY9A 1REEA 1UMZA 2Y0OA 1RMU3 5F6KA 5BV6A 3ZO0B 5JZGA 4HN1A 4X8NA 2D43A 2ARXA 5FQ0A 1F2NA 1F9KA 2Z5WA 3OY8B 4I2OA 3T1MA 1H30A 3KGLA 3ZSKA 3P2AA 4AGGA 1QHDA 3T1LA 4N90A 1AXZA 3JUUA 3MPBA 4GXLA 3WZ1A 4JAEA 4HSLA 1QQP2 3VBHB 4JTNA 2JI3A 4OHZA 4TZDA 3R05A 4FOWA 1CAUA 4GH4C 1DQ5A 4AFCA 4RD7A 3K48A 1AXKA 5GZCA 5C6CA 2G9GA 4P9WA 1AJKA 1SMUA 1R0JA 2DSXA 1NLSA 1SMVA 3OYWB 1HIXA 4F8AA 4YG3A 1CESA 4BOWA 3WD5A 5CAZA 1GKBA 2D44A 1Y3TA 1WLWA 3ENRA 4NWWA 4GULA 1FNYA 3MIEA 1AHSA 2OA2A 3CJIC 3SS2A 2C5DA 3HD8B 4D3WA 4NOTA 1NCRB 4D7SA 1G9DA 1WCDJ 4FBFA 3ZYIB 4GALA 4XILA 1ZZCA 1FPN2 4D7YA 3VKMA 3RRDA 4POFA 2CKAA 3AYCA 2AZ5A 3WG3A 4YM2A 1R083 4J1WA 4XQ4A 1TMF1 1FHMA 4CEYA 5A33B 1PVC3 3KB5A 4IL7A 5I0UA 3OCPA 5FO9B 3VL8A 4FTBA 1FNZA 2AH2A 3FFZA 2HWD2 1RIRA 4H55A 2C6AA 4CDXB 1D0GA 1V9U1 2CGPA 1I5ZA 5CFDA 4Q4W3 4QGMA 2ZKNA 1SBEA 2ZMNA 4FO9A 1EV12 4CEWC 1AYM1 5FTTC 1I6XA 2WKKA 2GZWA 1JYIA 1MEC1 1YI7A 4Y24A 2VL6A 4AEDC 3VBSA 1HLCA 1PIV2 4YGDA 1XNKA 3GBWA 1VBB1 5GZGA 2P17A 2I2SA 3ZSJA 1M4WA 1RHI1 2D97A 1COV2 1FYUA 4E9KA 4IXLA 1UX6A 1AR72 1LHVA 2Q30A 3VKFC 4Z8BA 1GNZA 2RS12 1VZGA 4BH9A 2JD4A 5JZGC 3TWIA 1RL3A 1AF9A 5JVG1 4XJZA 2YXSA 1WW5A 4RHV2 5AN9H 3ZSEA 3ZFGB 5LK5A 4FOVA 3S7EA 1NCQB 1QOOA 5I93A 2PYAA 3RNSA 2H0VA 1BE7A 1RUI1 3U10A 1RB8G 1BEV3 3FBYA 2A3XA 5GLVA 5FREA 4XIKA 4IV3B 4GMP0 1YCIA 1SFNA 4Q29A 2ZGUA 4LBNA 2AENA 1S2KA 4W65A 3FMGA 2JG9B 4QT6A 5I0TA 3S30A 4DNYA 1YLLA 2A7AA 1AL22 3IDEA 1Q56A 1CX4A 1EAH2 5BNNB 3THTA 4C0BA 4TVMA 1GICA 2RM23 3OJBA 2R0HA 2VMIA 2YPJA 1NXD1 2HWE3 4LULA 4P9XA 2R49A 5EYYA 4Q1RA 3MFCA 4M0NA 4YG6A 5FO8B 1KS4A 2VOVA 2KN9A 1K5MA 5LRRA 2A5ZA 2CAUA 2D3RA 1D4VB 1BJQA 1TNRA 1WCKA 2B8MA 4XF9A 1NY71 4LEJA 5DZEA 4FAGA 1YFWA 1VZIA 1RUH1 3RPQA 1AR93 2HWB1 4XF0A 1H2KA 1TEIA 5CFCB 3TAYA 4QGLA 2Z2SB 4WM7A 1FAYA 3V64A 3A4UA 1B35A 3I2DA 1AVBA 2ZGMA 3BTAA 1U5ZA 2C0ZA 4OI1A 4CEYC 5B2GB 3FC0A 2WFF3 1HKDA 3NFPI 4JGYA 2WT1A 4XBLA 4HK8A 3VL9A 2IWGB 1ULFA 5FQ0B 1S0DA 1V6NA 1HRI3 2OPKA 3N7JA 2ZACA 4PDWC 1LU1A 2B46X 4D69A 5CFDC 2GNDA 4RL7A 4AVBA 4IERA 5JI9A 3WQ1A 1ND3B 4E4DX 1JW6A 2VH9A 1OOPB 1OD5A 3WINE 1BRFA 4B29A 2ILMA 2AYHA 2X5IA 4XF1A 3B3QE 3BB6A 1B13A 3AZYA 4U2AA 5L36A 1XU1A 3VBSC 5LEJA 5FCCA 3MLLA 3FHIB 1RB9A 1BBT3 3JB4C 4ASMB 4L8QA 2BNOA 4E4SA 4OULA 1WLTA 1GZCA 2CWSA 3ZFFA 4AQ6A 4B4PA 5T52A 3N36A 4Q4V1 3SLIA 2OUHA 4KL1A 3UKNA 3AJZA 5FDBA 1YUDA 2PHDA 1RMU1 1R092 3IU3I 2QNKA 1IKPA 1CAWB 3VN4A 3WW3A 4JQRA 1KRIA 4HN0A 4TYSA 5BUVA 3CO2A 4XQDA 4EN9B 4QGNA 4AI8A 1Z92B 3OGGA 4UY81 4JDOA 4WV8A 2D6PA 1O3SA 3RYPA 3AX4A 1JOJA 2G9FA 1FMD2 2A3YA 2CGOA 1FPN3 4HLTA 2J9UB 4QQHA 3C3VA 5JOXA 2P2KA 2ZMKA 1WD4A 2IXJA 2ZAHA 2ZGRA 3R4UA 5GAHc 2NZ9A 4Y1VA 4G4FA 1YFUA 5LK7B 1QOSA 3J8F3 1UW8A 2XBO2 4XFCA 1QYBA 1V6KA 1ULEA 2UYAA 2ZHKA 3AKQA 4LO7A 4OLLA 4Q4X3 4UW3A 3RG0A 1J1LA 5EXOA 3VDDA 1W6MB 1I1EA 4COZA 1VRH2 1S30A 2HWD3 4I0BA 1KDMA 2SLIA 1SLTA 1PNFA 1K5MC 2WSVA 4OHYA 1MS1A 5CNAA 4LHLA 1G7YA 3CLPA 2PLV2 4HKLA 1X50A 5I8YA 4EN8B 4FQ4A 4NR1A 2XL7A 3VGIA 3MW4A 4E2GA 2WINB 2D7FA 3E6BA 1QF3A 4WM7C 3B69A 1RINA 3PWFA 4W6WA 4WM8B 4XTPA 1B35C 4QX5A 1O7FA 2ZTNA 3AZXA 1R081 2ARBA 1W6QA 4JGYC 1RUJ2 4I0AA 1COV3 2OVUA 3NKGA 4POGA 4R9CA 1PVC1 4K7JA 3B94A 4Y22A 1QJY3 3TN92 1ZBE1 5JPMB 2UY8A 4FPEA 4PIYA 4AF9A 2XHKA 3B02A 1JH5A 4CDUA 5KXBA 1MQTA 2XGXA 1H9WA 1KDKA 1SLLA 2DUPA 1RUE3 3JBG1 4RHV3 4DXZA 2W08A 3WP4A 4PQ9A 2OUJA 1OSGA 1RUD2 2R043 1YIPA 2R1DA 4Q4W1 4Y20B 5K8SA 4K1YA 4COYA 4TPUA 1H2MA 3I59B 5BNOA 5J48A 1GBGA 2Q1MA 1H8TA 1N3PA 4QPIA 3RZZA 4UBGA 1A8DA 4OI0A 2XJQA 1OLQA 5H9QA 3J7Y1 1X8MA 4IEZA 3ZFFC 2GALA 2VY0A 3IKWA 3ZFEB 2GDFA 1WLCA 3FUOA 4PCRA 4OUMA 1Y9QA 1AL23 2DVDA 2WQ4A 2BVBA 5F9TA 3HMYA 5BNPC 2IC1A 1QXPA 3SXWA 2L0ZA 2XL9A 2XKOA 3JQWA 4YVWB 5JOYA 3WG4A 4AFMA 1OHFA 2VW0A 4Q4Y3 5E1RA 2WZR1 3SCFA 2WJSA 2QDNA 1WLDA 1ZREA 1QH7A 2H6BA 1ALYA 1BEV1 1EPZA 5K0UB 1ZYBA 1EY2A 1G9FA 2ZHLA 3M2MA 4Q8LA 4LBMA 3H50A 1HDKA 3D5OA 4FCAA 4AGVA 1V6LA 4CDWB 1W6NA 3VV1A 4FTEA 3N7LA 2JJ6A 3VDDC 1IHMA 2QJVA 2BW8A 4EN0A 3LOBA 2X53S 4NWVA 2HWC2 2YGMA 2HWE1 2O5JD 2C6BA 1NNQA 3FFQA 3GHMA 1NQDA 2QQPA 1TME2 3MF9A 3WWLA 4F3JA 1ENSA 1Q43A 1RVF1 2R16A 2DVAA 3ZN4A 1ZZ9A 3OD0A 3H7JA 2PFWA 2X5IB 3OTFA 2WNUB 5ACA2 5J37A 1FV2A 4P9GA 1GSLA 4QPYA 4XF3A 4XJ8A 3VBHA 1H8VA 1H7VA 2D3SA 5AC93 2Y0IA 4PIZA 4QQPA 2A71A 4BYYA 4PIXA 3ZFFB 1QJU2 1HRV2 1NXEA 3ILFA 2A69D 4DQAA 4MZUA 2VOWA 2VQAA 2WFF1 3NAPB 2ZHMA 2R32A 1YK5A 3AZZA 3IWZA 3KSCA 4EWEA 1J3RA 2IXLA 2PHRA 2EVXA 1IS5A 2QKDA 1LULA 3VHNA 2R063 1LKOA 3ELNA 1NOVA 4JRLA 3WX5A 4CDUC 3QLQA 5DZFA 1ZRPA 1HRI1 1U5YA 2WL1A 4N9IA 1R0GA 1VJ2A 5DG1A 3RZTA 3G7DA 1UIKA 1JUHA 1NCRA 2YY1A 1RUG2 1V00A 1HW5A 5H9SA 1C8M1 2HR5A 1O5LA 1H8TC 3ASIA 3POWA 1E57A 4QPIC 1PGL1 2ATFA 2PHWA 4P9YA 2G4IA 3ZIWA 3L2YA 1HV0A 2PHUA 4R4XA 2A75A 3WW4A 4HK9A 2DV9A 3AKPA 5J36A 1BBT1 3RJRA 1PM7A 3MGUA 3MYXA 4FPFA 4AI0A 1C1FA 1G9AA 5H1Sc 3T2TA 1IROA 3ZPYA 2RS32 2WWSA 1IRNA 3LSEA 3MFAA 2XVLA 3Q9OA 4FPCA 2BYVE 2VNGA 1LOFA 4CDXA 1IGOA 1AUYA 3ZN6A 4MH0E 3GNEA 4HZFA 4AHWA 1A3KA 3ILRA 1D4M2 2PLV3 3P8BA 3ZN5A 1KFUL 1ZBE2 2DVGA 2B39A 4X6QB 2ZZJA 3R6SA 1ZRFA 1CJPA 1SCSA 4COWA 2NMNA 4IEYA 3D8CA 5K7PA 1NXGA 3D6EA 1J58A 1YNAA 4NO4A 1W6QB 4WVMB 3MDPA 1RUF2 2Q0AA 2X29A 1RJ7A 5CVRA 4GS7D 3J8F1 4LTAA 2LUWA 4B8EA 3TN93 5KHHA 1LHWA 4Q4X1 1MQTB 2QDRA 1MACA 3VKOA 2VXRA 4AYUA 3EO6A 4BIFA 2IXCA 1QGLA 3IDCB 2RMU3 1QNYA 2VOKA 3AMQA 5JIUA 2FHRA 3M3CA 1NCQA 5BNOB 3HR9A 2D93A 2I74A 3LZZA 5AI3A 1AYN3 5IK8A 5IUQA 5DDJ3 3VBHC 3LKJA 5DUXA 1DGWA 2QZ3A 2Z3RB 1H9PA 5KC6A 1R1A3 5JWPA 4EROA 5H9RA 3GZAA 5T5JA 4XGHA 4XETA 3JB8A 1JHNA 4ATEA 2JG9A 4FT8A 1AJOA 2UYBA 4KBBA 1ASJ1 3DKWA 1Q8QA 1ZA4A 2LCQA 5BNNA 4WZFA 4C1WA 1QJY1 3PVOA 2D5FA 3JD73 4AGRA 1H1MA 1PO23 3VLBB 3N35A 3HIFA 2EAAA 1RUE1 2HWF3 1GV9A 3PKIA 1NCRC 2E9QA 3B93A 1WMDA 5T54A 2PELA 2LTNA 5EWSA 5JPNB 4P5HA 1SQ4A 1CN1A 1ZVFA 2DTYA 4AFDA 2I07B 1A78A 3H1MA 5HBAA 2PAEA 1QJX1 1BKZA 1AX2A 5CFCA 1R0IA 1YIFA 3OBRA 3AZVA 5FPXA 5EIOC 3NVCA 1RYQA 1RVF2 4BMEA 1AR62 3AP7A 5GZFA 3NKTA 2GNBA 7RXNA 5JOZA 1LRHA 4R8HA 3GYDA 4AQSA 4IQPA 4S2HA 4O9GA 4WZCA 1Q8PA 5C4WB 1LOFC 2Q1ZB 1OFNA 1Q5OA 4JGZA 1T6GC 1Z0HA 4CDXC 4W6XA 2BUKA 4Q0UA 3WW2A 1VBA2 3ST7A 1TME3 5CADA 1JN2P 1PGSA 3NV1A 4DY3A 4Z07A 1QH6A 3KLSA 1ND3A 4Q4Y1 3EJKA 3SH5A 1WW6A 4LLOA 1OOPA 4PLNA 5KBFA 1QU0A 2PTMA 2A73B 4XBQA 1XQNA 1QWRA 3WUCA 1OA2A 3M3OA 5A3MA 4XFAA 1LU2A 1T9PA 3KCYA 1Q8OA 1HRV3 1QJU3 5I0RA 2ZKLA 4OI4A 1SCRA 2CY6A 2AR6A 1NE6A 1C8M2 4LT5A 1DGRN 4GQ7A 3PTYA 2XWJB 1KJLA 1ZBA2 4L97A 2W0XA 5DG2A 2RR12 4KWJA 1BQ9A 1SLIA 2A6ED 1CAWA 1IU6A 1LENA 2GNTA 2MS3A 2EF6A 3ZFGC 4YVSB 1U5IA 4L92A 1UU5A 3QH6A 1NCQC 2CKCA 4XXPA 3UK9A 1S0BA 3AM2A 4D7TA 1KD7A 1RUG3 2FMYA 4QQ2A 5F5QA 2WS92 4R9DA 2LM3A 4GIQA 3ME2A 4PLMA 3PNAA 4AI1A 3ZYPA 4IV3C 3MIBA 1NQJA 1VBC3 3ZDSA 4NVPA 4RA0A 5MFPA 1MVEA 3INAA 3VBUB 3VHPA 1QDOA 1SBFA 2FQPA 1Y43B 1DGWX 1LECA 4F83A 2JG9C 1FHHA 2AUYA 2BFUS 4AVAA 3ZG6A 1I3HA 1B2OA 2FBEA 1S24A 2ZGOA 3PZAA 4K8FA 1VALA 5BNNC 4DRVA 2RS33 4E2SA 5GAGc 1DGRA 4Q8KA 1OQEA 3MIGA 2A6XA 2YROA 1W6MA 2R061 3B9IA 4UW6A 5DXDA 1VZHA 2GH2A 3ZN6B 1CADA 3VBRA 3AXDA 5HI0A 2R0FA 4IEQA 8RXNA 1WD3A 1RUNA 4W6YA 4V196 2AREA 2PHLA 3KD4A 4KG8A 2D6MA 3FBMA 3PMSA 4OHXA 5T5LA 5CFCC 1HXS2 3LA7A 3PVBB 4CDQA 4H7MA 1J1TA 4IEWA 3KM5A 1J3QA 4WM8A 3ZXFA 3R0RA 4LHKA 3VUOA 4L99A 2WZPP 1IU5A 2SBAA 4H7LA 4BLIA 4B4QA 2VVDA 4YM1A 2WT2A 2JDZA 4YRDA 4GB33 4YW3A 4BE3A 1E8JA 2MEV2 1Z7S2 1PGW2 2XJRA 2NLRA 2R072 1PO12 3UJQA 3ECQA 2A6VA 3MW3A 1BMV1 1VLNA 1R1ZA 2B42B 3ETQA 5E88A 4LBJA 1O5UA 2PVEA 3SH4A 1ND3C 3VHRA 2V09A 1PZ7A 2DFCA 4Y20A 1FOD2 1OOPC 1RDGA 3I59A 2UURA 1YFXA 3R4SA 4B8CD 1ZZ8A 4NHKA 3GBFA 4WBBA 3FLPA 1L3JA 3IMNA 1S2ZA 1BK1A 3AP4A 3OGJA 1UPSA 1G8WA 5KHKA 3ZMNA 2ZCWA 3ZFEA 3ZVXA 3O14A 1DZQA 2WLPA 1F31A 3WDXA 1X7NA 1MS9A 5DM61 4CP2A 2PHFA 5HXVA 1Y7BA 3FJSA 2NN8A 2GC2A 3KMHA 3IIAA 5F6LB 3LSDA 4M01A 4OUSA 4CP1A 1VBD2 3O0XA 1MZFA 3RI9A 5KC5A 4YVWA 1T9OA 1GR3A 4Z1VA 2RS53 1N47A 5CIRA 4L9BA 4IESA 5GKAC 3KYVA 4UW4A 5HCAA 4FP3A 4FOQA 2DYCA 2R6QA 3MSUA 5DDJ1 1VBE1 5K0UA 3UL2A 1SBDA 2R1BA 2GAUA 1LGBA 5A32B 1UU6A 2OIIA 4YFZA 4GKYA 2ET1A 1W0OA 3MLKA 3MEPA 1X36A 5KXCA 1MZ6A 3LAGA 1ONAA 3DV8A 3PVEA 4S2DA 4RR3A 4CDWA 4PLOA 3O5SA 4XFGA 3BALA 4XIOA 4ZU7A 4JGZB 4YW1A 3BODA 3MIHA 1ULDA 1XU2A 4JDMA 2WT0A 3GALA 2ZIXA 4EWAA 3JD71 1PO21 2K9ZA 1Q3EA 2DCTA 2HWF1 4C90A 1OMIA 1LTLA 3TOJA 3UV9A 3BIWE 3V65A 1FT9A 1QXJA 3KT1A 2RJLA 1B09A 1WBFA 1WW7A 1QQP3 2WNUA 3V0AB 3SCGA 2YMZA 3TYJA 3A44A 3WP5A 3ZIXA 4ZXKA 3QQCE 4WM8C 2QZ2A 3RSJA 2MHFA 1LHNA 1RUC1 1AR81 3BOPA 4HKOA 2HEWF 1O3TA 1CR7A 2GC0A 2A68D 4KNCA 4DZGA 1H0BA 4XQWA 3NAPA 1N1YA 1C5HA 1QNWA 1GNHA 2M6PA 2JICA 1A6CA 4BQ1A 4QM8A 1XNBA 2Q8OA 3VBFA 2RR13 1RDVA 4MX3A 4ME3A 1R0HA 1IQAA 4Z2WA 5KXEA 2XKPA 3N7KA 2BGCA 4LNVA 3H1WA 4NHLA 4RGGA 1PHMA 3WR0A 1TMF2 4U36A 2XVKA 2OYZA 3V0BB 1GQGA 4LLFA 4C91A 5KWRA 3AZWA 1RTVA 2DU0A 2WS93 3OF1A 1PVXA 3H0OA 3FLRA 3SHRA 2VW2A 4LO8A 4Y4YA 1V9U2 3VZMA 2GC3A 4INDA 5FOBB 3THPA 4J1XA 1J3PA 3ZFEC 1KITA 1LGCA 3DN7A 1AYM2 3RI8A 1U12A 3E6DA 4LR4A 2HEVF 4AI2A 2A6YA 3AKRA 4LHNA 4N53B 4Z82A 4Q1PA 2IFRA 1S0EA 1MEC2 2B9UA 3D0JA 4H3WA 4JAFA 3POSA 3VZOA 2QUOA 1HX6A 1UPIA 1APNA 1ODHA 3VBRB 4CZSA 1XNDA 1RWDA 4E27A 2XJSA 1CAAA 2V3BB 1VBB2 1NA1B 2PYTA 3OBTA 3H8UA 4YVWC 3ROUA 5C8CA 1G9BA 1RHI2 2TUNA 3NV2A 1URXA 4OVEA 1EV13 4N9HA 1VAVA 2WFPA 4M0HA 4N43B 2H6CA 4M3CE 4CDQB 5K0UC 4B3NA 2P3KA 5GLZA 5FLHA 1PIV3 2CGNA 2JE9A 3DUIA 3O7OA 4JC1A 4WVMA 3W58A 4QMAA 2W68A 1C28A 1HQWA 1RUI2 4H14A 4CDWC 1AR73 5T5OA 5JSPA 1WW4A 1DQ4A 4LBQB 2RS13 2WNVA 2ZGQA 3EQEA 3CL1A 2MEV3 4ES8A 1SACA 1Z7S3 1IW7D 2CL2A 1WGPA