2XJSA

X-ray structure of the n-terminal domain of the flocculin flo5 from saccharomyces cerevisiae in complex with calcium and a1,2-mannobiose
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
258
structure length
258
Chain Sequence
GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLOCCULATION PROTEIN FLO5
publication title Structural Basis of Flocculin-Mediated Social Behavior in Yeast
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell adhesion
total genus 61
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2010-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2xjsA02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2xjsA01
4AF9A 4AI1A 4CP2A 4AHWA 4COUA 2XJVA 4AFCA 4GQ7A 4ASLA 4LHNA 2XJQA 4CP0A 2XJPA 4AI0A 4AHXA 2XJRA 5A3MA 4D3WA 4LHKA 4AFAA 5A3LA 4LHLA 4CP1A 4AFBA 4COZA 4A3XA 4AHYA 4COVA 4COWA 4AI2A 2XJSA 4AI3A 4COYA 4AHZA 2XJTA 2XJUA
chains in the Genus database with same CATH superfamily
3N9QA 2NQYA 2LALA 2RS11 4PCRA 2VMDA 2WNVA 3AMHA 1DLLA 3FFZA 3W59A 4POGA 4E4ZA 4ARXA 5FWJA 1R0IA 1WLDA 1EAH3 3FFQA 2WQ8A 3DKWA 5IAVA 5K0UC 1S1AA 2V5DA 4XDQA 3BPSA 4E27A 2LROA 4ISQA 2XLGA 1ENSA 5C4XL 2ZKLA 1J83A 1IROA 3OD4A 3BODA 4ATFA 1JZ8A 1K83L 1AR92 1RUF3 4FPLA 2WNOA 4D7TA 3RZLA 3N9PA 2Z3QB 5C3OA 3EYPA 1QJU3 2JG8B 5FZKA 5F3IA 2P3IA 3GZTB 4I0WB 2YYOA 4Q1RA 2HWD1 1BK1A 4XF4A 1AR91 3VBOB 4LJHA 5FR3A 2B8MA 2Y0SP 5KHHA 2IFRA 2Y6GA 1Q8OA 3WZ1A 1JZ3A 3WWLA 3TEZA 4AHXA 3HVDA 1Q8QA 1URXA 4AQSA 3GBFA 1DGWA 1KITA 2BGPA 2JI3A 1RUC2 1SPPB 4GWNA 4YWMA 3GNEA 3NAPC 1IS6A 3MPPG 5I91A 2BNMA 1QF3A 2AYHA 1NCRB 3AYAA 3KCCA 3WP5A 1DIWA 5BV6A 3PUHA 3ILRA 3CJXA 5MGNA 5EINC 2NMNA 1HQNA 4NAMA 2E7QA 2UYAA 4K8FA 2AR6A 4DINB 2WFF2 2CHHA 3BN6A 3HT2A 4IW3A 4MGQA 2D3PA 4C3IL 2QBXA 5FK7A 3IDEA 1RDGA 3WX5A 4XCAA 2ENRA 3O1TA 2ZX3A 4A41A 3K7AL 1DCSA 1XJAA 4LO7A 3RS6A 3LIHA 1RYTA 5CG9A 3J8F1 2WFF1 3LIGA 3DKQA 1IPKA 5FKCA 1I1EA 1JYCA 1L7LA 4Y4YA 5F6LB 2B4KA 4LA2A 3WNNA 1HXS3 2YPJA 3I59A 1KS5A 4OUSA 5GLUA 4B1LA 3U0ZA 5G05L 4LHLA 4HZFA 1QOTA 3KWVA 3LAGA 3LEMA 3JBG3 4YVSA 1E5IA 2QZ3A 1OSGA 3ES1A 4EE2A 4CXXA 3DPRC 4AR4A 4QX2A 5GZFA 1HJGA 4RS5B 3D8CA 4UW3A 4D0QA 3OPTA 1UY0A 2B42B 4TTGA 2ZX0A 3EBRA 3KT1A 3RWNA 4U2AA 3TEXA 5IY0A 2E26A 5CA6A 5FQ0A 1RVF3 3QACA 1IG3A 4CP0A 2HKXA 3KD4A 3E6CC 3WVJA 3ZXFA 1Q56A 1XYPA 4FP2A 2NN8A 4Q4Y2 5LK7B 1R093 3UL2A 1HB3A 4AE2A 4OLLA 4RR3B 1VBD2 2Y0OA 4CCCA 2RDVA 2CL2A 3MYXA 1LKOA 1FT9A 1YK5A 1PZ9A 1HB1A 2EIEA 1IKPA 2YV8A 4FPFA 1ASJ2 2KR2A 1XBFA 2ZX2A 5G04L 4WZFA 5GM0A 1AYN1 1XNAA 4SBVA 3UNPA 2XPJA 3ZXEA 1PZXA 1REEA 3WD5A 1BBT3 5E89A 3WW1A 3C7GA 4QPIC 4GMP3 1AYM3 3WW4A 3C7EA 4ZZ8A 3GHNA 4D7SA 4TPUA 2GMPA 1ASJ1 1WW5A 3ZFEC 1W6QA 4BQ3A 2GNBA 4Q4X2 4QGMA 2D40A 4OHYA 2CYFA 1VMHA 1W04A 4DRRA 1E5SA 3ZFGC 3N3HA 4BWOA 5DAWA 2F6BA 4CYDA 2F17A 1R1A1 4CDWB 4FFIA 1QNYA 3IAPA 1H9PA 4QIWP 4Q4X1 1UYPA 3KF3A 3OB8A 2UU8A 4W4ZA 2YDEA 3NFPI 4TLGA 4JTNA 1S30A 1EPWA 2YROA 1BMV2 1EV12 4AR2A 4E2QA 2RR13 3MI8A 3DV8A 3LWCA 1FOD1 3PJQA 3MV11 4L99A 5I8TA 5CVRA 3L2YA 2H6CA 4JGYB 4LK6A 2QZ2A 2DTYA 1FNYA 4JV4A 4P9YA 3T30A 1BMV1 2JDAA 2M6PA 5APAA 1SLIA 1OOPC 2V09A 5F5CA 2WZEA 2R071 5IYYA 1H6YA 1NQJA 4IEUA 3HQUA 4XAAA 2A6WA 4KU8A 4GKXA 1C1LA 2D6KA 1UY4A 4OVEA 3WV6A 4UI9L 4E9KA 4QHBA 2RVAA 3ILNA 3OBZA 4L11A 4NHLA 4HG6B 4Q4W2 3ZLIA 2PAKA 1PZ7A 1COV2 2Q1FA 1VRBA 3H3LA 2IXJA 3IMNA 3WNPA 8RXNA 4K1ZA 4FPEA 4FQ4A 2HWC3 1REDA 2V72A 4WM8A 3VKOA 1W2UA 2W2IA 3S15L 2EIDA 1AL0G 1XRUA 2PTMA 5GLWA 3QCWA 2Y34A 1LU1A 1WLCA 2MNGA 2ZCWA 3WINE 1RUG2 4WVWA 2WBKA 3B08B 2Q1MA 4KG8A 4M4PA 4WFN1 1NX9A 2L0ZA 1UIJA 2V0FA 4Q0UA 1LECA 2C1FA 3MW2A 4LIVA 4AI0A 1QQP3 1VRH1 4XE9A 4XQWA 1DQ2A 2V5YA 2YU2A 1PX3A 4V2VA 5FOJB 1QJY3 4XDPA 3H99A 1F31A 1QGLA 3BB6A 3VD3A 3TNQA 2R93L 3PKIA 2VPVA 4ORFA 5DM71 5JZGC 1O6UA 3FLRA 2EAAA 5KXEA 2E31A 2Z4FA 3AP7A 4W8JA 4XF0A 1BJQA 4FI9A 2D3SA 5AFBA 1W8FA 3VDAA 2Q5TA 1PO23 2ID4A 4ZPIA 3M4FA 1K3IA 1V6OA 3S57A 4QT6A 1DYOA 4ET7A 2VW0A 2D5FA 4GULA 4KG0A 2XLFA 2CDPA 5HXVA 4Z1VA 4UBHA 3NNJA 4NRPA 5BNOC 2UY8A 5CAZA 5FCCA 5I8YA 3ES4A 4NHYA 3KYVA 4LEJA 4R4ZA 1J58A 2E7TA 4XDOA 1Q5OA 3IDBB 4IV3A 3HOXL 3CEWA 3MPBA 4Y22A 4YG6A 2EICA 3VN4A 4BJ0A 3MO4A 1ZREA 2RJ2A 1U5YA 1OURA 2HWE2 3M8LA 4L92A 1E5HA 3H1MA 3PHMA 4QXCA 1AR63 4R9CA 1SFNA 5I0DA 3O0XA 3M3OA 1N3QA 4N9IA 3VKNA 1AUYA 3VHNA 1WUVA 1JOJA 2NLRA 3AFGA 2HWE1 1QJX3 2C9KA 5FAXA 1RTVA 1YC61 2ERJA 1MVQA 4X6QB 3PZAA 3GBWA 4N43A 5GADc 2PVEA 2BQPA 5A3PA 2W0XA 1S2EA 1LU2A 1WCSA 2DCTA 3RZKA 2ZGNA 1IOAA 1UOGA 1LOFA 1DYPA 4MGYE 3FKIL 1YJKA 2OPWA 5E8AA 3NW4A 1UPSA 3O1OA 3KV9A 3HNMA 1CIWA 3ZYRA 5A32B 1AL22 2FCTA 3GHMA 2QE3A 1ZRDA 1V6MA 2FCVA 2JKBA 5F7UA 2FDFA 1VZGA 1NCQB 2BGOA 1SMMA 3LE0A 1ZZ8A 1AR82 3DL3A 3RZDL 2RMU1 1PGW2 4LBOA 4AHZA 2J22A 3ZVXA 1ND2C 1UKRA 5I93A 1K12A 4FBFA 1LULA 2HWF1 3PVOA 5IVFA 3MEPA 2M6OA 1TVGA 3OUJA 4YW6A 3WDWA 5JMOA 2IXCA 1LGBA 1SG3A 1JHJA 2FZ1A 5EIOC 3WNKA 4G9SB 1QQTA 1JZ7A 2X8KA 1RUE2 1YFUA 1FYUA 1X9PA 1WCML 3SHRA 5FJ8L 4O7XA 2XR4A 2ZJCA 4RN5A 3LD8A 3LWRB 2VZPA 4RGKA 5JOZA 5T54A 2JKXA 2X5IC 3LSEA 4AEKA 1OA4A 2ZACA 3O0VA 3WG2A 1ZZ7A 1D4VB 3I2JA 1W6PA 4A3CL 1QYBA 4AHYA 3E5UA 1UQXA 2JB8A 3HNYM 4XMAA 5E88A 4RQPA 2WAOA 1MS4A 1SFOL 5FYUA 1JYNA 1SLAA 4HVRA 1PK6B 1RMU3 2A70A 3TN93 4QM8A 1ZBA3 2DVDA 2W91A 3OBAA 3ZKUA 3RZOL 1K5MB 2JICA 1PFVA 4RSUA 1PO13 5DAVA 3AP4A 2J1RA 3IKWA 5B2GB 1F4LA 5BNNA 4OQ8A 5FYYA 1G8WA 3OYWB 4HOOA 4Y1ZA 4AVSA 2VL6A 4C3HL 1QXPA 4YW4A 2XJPA 2GNMA 4JGZB 2GMGA 5FV3A 2PHLA 1ND3A 1RWDA 3I4IA 3E97A 1CX4A 2RJLA 1PMHX 1VBB1 1X50A 1GNYA 2D93A 5FZDA 5A6YA 3RYPA 3ZX7A 3KHCA 3UGFA 5LEJA 4GH4A 4XAEA 4LMFA 1RGSA 5F9TA 1EAH1 3MUZ1 2DU0A 2RDSA 3SH3A 1W2TA 4IEZA 4AR3A 3VPBE 2VJXA 1KRIA 3FLTA 4QXHA 4PLMA 5ABJA 4TSVA 4CUGA 3CMGA 1SBEA 3WF2A 2X10A 1CR7A 1RUF1 5FZMA 2YU9L 1XSRA 4IGQA 2GALA 4QKBA 5L7OC 1S0BA 2CR8A 5F39A 5TSWA 1QJU1 3IIAA 1V9U2 5GZGA 2Y33A 4CDQB 5FZOB 3RZGA 2PQSA 4P00B 2V4AA 5FPUA 4K9FA 4KBBA 4E6YA 1JS9A 2VUJA 2XVGA 1F4AA 1BKZA 1IZ3A 1YIPA 2JDMA 2L9LA 3FLPA 3UESA 2H0VA 3H8XA 1PNGA 3LOBA 3B69A 5KXBA 5F2SA 3RRDA 1Z7S2 3IM0A 1OLMA 2NVQL 4TYSA 3WP4A 3ZN6B 3H3ZA 1V6NA 2NVTL 3GJBA 2XKOA 4M3CE 4O9GA 1D2QA 2PHXA 2JDZA 5C5UA 2PHDA 4Q27A 1X33A 5J3UA 1MS8A 1POQA 3K46A 4ZZ5A 5T55A 4K1YA 3ZSJA 1S2BA 1RUC3 3E1F1 5DUXA 1B2JA 5M5XL 4XBLA 2HWB2 2NVYL 3M3CA 2W92A 1QJEA 1U12A 2AC1A 5ACA3 1BQPA 2XXZA 3BGAA 4UF0A 1HXS2 4AVVA 3MLLA 1OWCA 1UIKA 1KD7A 1UU6A 4XW3A 3PKJA 3USUA 1WD4A 5M0TA 2OT7A 2OA2A 5GALA 1CZSA 3OG2A 3VBUA 1W8HA 4IL7A 1HXS1 2QQJA 5HCAA 4E8CA 1ZZ6A 2W52A 1V6JA 3VHOA 2W5FA 3W5MA 4FTBA 5IVJA 3JBG1 1F9KA 3ME2A 4HXCA 3VBSB 5CFDB 5IVCA 2GNDA 4QKFA 2D6OX 2XWBB 3J7Z1 4XURA 3KVBA 2IUWA 1F8VA 4MZUA 4BXSV 2VMCA 1QIQA 4IEOA 4WVMB 1QXRA 1NAEA 2O14A 1V6IA 2BFUS 3PUQA 2WZPP 5CEHA 4DB5A 3S0MA 3VBFC 3T0DA 2EF6A 3X29B 1DZTA 1RVF1 1W99A 3O7OA 4OYUA 2WYFA 3N7KA 2VVEA 1H8TB 3I3BA 2ETEA 3NRUA 4MHUA 1ZYBA 4QQOA 5A33A 3PIJA 1JZ2A 1R091 1TG7A 1UD1A 2VTXJ 4YM0A 5IVEA 1KFXL 3M4OL 5F3GA 1HX6A 4WBBA 2O1QA 4HMZA 5FZBA 3I97A 2XGXA 3VDDA 3FHAA 1YIFA 4Q4Y3 2A69D 2PVXA 1ZZBA 3MIFA 3CHXA 1X82A 1VBD3 3PO2L 2WA3A 4CDXB 5JSRA 3WW3A 4ASMB 4M0NA 1JMUB 1BBT1 5BNPB 4GMP1 1AYM1 5FY5A 4JDOA 5CFCA 5JXJA 4OI4A 3GTJL 4K7JA 5DAXA 1X36A 4CRQA 2VQUA 4CEWB 3DUIA 4XFHA 5HV0A 2B46X 2BFUL 2BOIA 1H1MA 4CP9A 4NMIA 3H9CA 7RXNA 3G7DA 2IC1A 2MHFA 4WM7A 2ZPXA 1R1ZA 2VOTA 3BI3A 3FZ3A 1HDKA 4DY3A 4K20A 1W8ZA 3AZYA 2UYBA 3AXEA 4FPGA 1BCXA 4MSVA 3EQEA 3LNLA 1BLZA 1PM4A 2PA7A 5T5LA 3I2KA 3OGRA 4QXKA 2RJKA 2P6HA 2RM22 2ET7A 5A7SA 3QLQA 1O4YA 1WBFA 1P7PA 2IZWA 3VBRB 3LWOB 4A3ZA 4EROA 1SHWB 5A3UA 2VNRA 1W05A 4Q4V2 3RG0A 5AN9H 2AENA 3LDKA 4TZDA 2RR11 3R0RA 3HMYA 1DQ5A 4QPGB 5IK7A 2JE8A 5GJ6A 4ZU7A 1ZZ9A 1EV13 1LHUA 3T2OA 3J7NA 1CADA 5D21A 4YFZA 2GU9A 1IS3A 3NNFA 2XDVA 4XC9A 3LCPA 3NVCA 4HETA 1U5IA 4H14A 1RUJ2 5JR2A 1CPMA 2E9QA 3LQCA 4HKLA 2Q8DA 3SH4A 1YQCA 2Y6HA 3MIDA 2GMMA 1HRV2 4FPYA 4HK9A 4K3UA 4QKNA 2PPTA 1IQDC 1MQTA 3ASIA 5JAXA 2BDRA 3CIHA 1BFYA 3B0AB 4XFAA 5FK8A 2Q8OA 3W58A 1A8DA 3WP3A 1PM7A 2GNTA 3NV2A 4QQLA 5EYXA 4NE9A 2QQOA 4UT5A 3GTGL 4JRLA 1H0BA 4NHKA 3VBHB 4JRAA 3ZYJB 4FAGA 1HRI2 5DUVA 2HWC1 1ZA4A 4JKKA 3KV4A 4Y1YA 5IFPA 1AR72 4AEJA 3N36A 1RUH2 4PDWA 4Q4W3 2AGSA 4MHRA 1QJY2 4A4AA 1UW8A 2ZGPA 1COV3 5LCWL 1H2NA 1W3XA 3JU9A 2ZZJA 3AP6A 3WNMA 5FP4A 2CV6A 2WNVB 3S7EA 4BQWA 2YBKA 1WCDJ 4GALA 5FLHA 4L0PA 2YUEA 1QQP1 3BU7A 5CB7A 3UGGA 3Q8BA 4LLOA 4Y4RA 4NRMA 3H9BA 1UZZA 4A45A 4AGGA 1GICA 1QJY1 4OUMA 3LFMA 1RUG3 4MG2A 2E33A 3KHBA 5JVG1 2A6VA 2ZEZA 3BALA 1TMF2 2CSGA 2UURA 3K51A 2CKCA 2VL4A 3ENRA 4GWJA 4P02B 4JAGA 2VCMA 3HOVL 4YW3A 5FIXA 5DPNA 1ULFA 1VR3A 3AB0A 5LZ6A 1GZWA 4A93L 3LWVB 2Y6FA 4XFIA 3HQXA 4E8DA 2BRTA 4HVOA 2J9UB 3PLQA 1PO21 2XVLA 4P14A 3S1RL 5A3LA 3GTLL 1HQLA 2PFWA 3I8TA 1YQ6A 4P9XA 2E53A 2X29A 5CYYA 4BQ5A 1VIWB 4KH9A 5FZ8A 1CAXA 1IHMA 3WP6A 4Y24A 1JYTA 3W9AA 2JG9C 3JCIA 1BEV2 3E6BA 2W1SA 3C2UA 1HJFA 5JVVA 4URAA 2HH9A 1BZWA 2KD7A 2EIGA 4XQ4A 5KBFA 2G19A 3B7MA 1AR61 1R0GA 2BWAA 4LOSA 3ZKYA 3P3NA 2WDBA 2Q1ZB 4M3CF 1S0DA 1ST8A 5C3EL 2FHRA 5FPZA 1D2SA 4FPCA 1VAKA 3WEZA 1LEMA 1PMJX 5HV4A 1Q43A 1QJX1 2HYKA 1FI2A 3QVDA 2C6BA 1I5PA 3LPEB 2J1UA 2BNNA 3IPVA 5KWRA 1OKQA 5I8SA 1K45A 4BLIA 1JUIA 4P5HA 4RD7A 2GAUA 3MHZA 4CDXA 3O1SA 3U14A 1OHFA 4XHXA 2EXIA 2RFKB 2VUAA 5FO7B 4AEDC 5AVAA 1X8MA 4IE5A 3P8BA 2GN7A 1BQ9A 1PFWA 2P3YA 2YBSA 3MUY1 5FPAA 2FDHA 4IUGA 2YFZA 3GZUC 5FZCA 1LHWA 5JIAA 4GWMA 4Y1XA 3I59B 3PL0A 1NE4A 2ZTNA 3RJRA 2QQKA 3IAQA 3MF6A 1LAJA 2BTVC 2JDKA 2BBVA 2ATFA 1RINA 1VBC3 3BU0A 4PQQA 1FHHA 1REFA 3GM8A 3ZPYA 1CWPA 3VL9A 2WT0A 4DUWA 2R042 3NV4A 4UWDA 4XFFA 1AL23 4YVSB 1OVPA 1QOSA 4J6GA 2BVVA 2ZOEB 1O3TA 2QDRA 4AVBA 3E5XA 5C9AC 4JVAA 3OUHA 4IV1C 2XKPA 3KT7A 1AR83 3USSA 4JDNA 2B5ID 4AZZA 4XCBA 3PJYA 4HKOA 3IT8A 2V4VA 1AX2A 1NA1A 2G4IA 5FQ0B 3SMHA 5L9VA 1POV3 4YVWC 2GN3A 3ACIA 1NZIA 3R4SA 2W3JA 4N53C 4EWAA 1DQ6A 1GU3A 2W08A 3W20A 2R0FA 1MACA 5EYYA 1RMU2 3KMHA 3SCHA 1RUE3 1T9QA 3H8UA 2PHTA 4QB1A 2W95A 4BMBA 1J3RA 3IU3I 4NR1A 2CGPA 2BYVE 3I3EA 2AUSB 4B7KA 1UN1A 3RJ2X 4DXTA 1NLQA 5T3NA 5JSOA 3S5QA 5MFZA 1VBA2 4HKWA 3VB9A 4DIQA 1JOPA 1G7YA 1W06A 1RMU1 2UWAA 1SFPA 3KCXA 3S6PA 3TN91 1ZBA1 2JWPA 3U11A 3D0SA 4S2GA 4CEYC 4P9LA 4BY7L 1PO11 2UWBA 3ZO0B 1SEFA 4LUKA 2Y6LA 3ELNA 2Y60A 3HJYB 2FBEA 5FREA 1GKBA 1C09A 2HLEA 1ONAA 2LM3A 1W6QB 1DP0A 1GWLA 3ZFFA 1S4CA 5JLVA 3LWQB 5FYSA 1YNAA 2Z2SB 3K48A 5FBJA 2EALA 5J48A 1YQ8A 3RDIA 1LTEA 5LRRA 3VD4A 3T4VA 2VU9A 1BHGA 4RHV2 4MGSA 2QQPA 5C4WA 2VZUA 1FHMA 2JDNA 4NO4A 2UWCA 2D43A 2ZHKA 2F4LA 2XONA 3ZIXA 4YWAA 2R0HA 3PTYA 3ST7A 2Y8KA 2JD4A 2OQ7A 4NIHA 1FPN2 1XOYA 5KHIA 4HL0A 4UYBA 1A6CA 4BQ2A 4U671 5JSPA 4Y20B 2P17A 3K75B 5LB6A 2JG9A 4FFGA 3ACHA 3OUIA 4XUNA 4NIIA 4BISA 2WN3A 2VGDA 1RIRA 1W9WA 4BPZA 3R6SA 1PZ8A 3B02A 2OUJA 4WV8A 4POFA 1YV1A 4P5YA 3JD72 2RS52 4QHOA 3H7YA 4QHZA 2VNOA 1D4M3 2ORXA 1V9U3 3OGJA 4FVVA 3ROUA 5GZEA 1OF4A 1FV3A 2IFWA 1SCRA 2A3XA 3S7IA 4B7EA 1FX5A 1KEXA 2HEYF 1E5RA 3O14A 4D6SA 5HPOA 1TME2 2WSVA 4M00A 4MXVA 2DUOA 4WM8B 1VALA 2A3WA 1Z7S3 5ACA2 4YZ3A 2WQZC 3IIIA 5DUUA 3O1VA 3MZHA 3RYGA 2K2SA 3LOIA 5F32A 4DPNA 1QHDA 1W9SA 2RS33 2XJUA 1RUC1 2BBAA 1SLCA 2PAEA 3CJIA 5A7OA 2DFCA 1S2ZA 3ZXAC 2VNGA 3AKTA 4AVTA 5ACA1 1PIV2 3S30A 1R0JA 3NMBA 3BPZA 5KXDA 4FQZA 2JG8C 2D3RA 4D7YA 4Q2FA 1B35A 4UOJA 5A7WB 1RB9A 2HWB3 3VBOC 1Y1WL 3RYKA 2XJRA 2VW2A 4ZS3A 5LBFA 3S1ML 1PFUA 3O1UA 1CAAA 1WGPA 4MH0E 3ZXLA 1ENXA 1XNDA 2R30A 3MIEA 3PWFA 3THDA 1DX8A 1VZIA 3S17L 1CIYA 3M2MA 1RXGA 2PAMA 1FMD2 1NZCA 4XFBA 1YFWA 3N9NA 4Q26A 1JYVA 3LF7A 5D2AA 1LENA 1NYWA 2WNUC 1TWCL 4N53A 5F2WA 2WZR3 1UZYA 1NCRC 1YI7A 4KWLA 1IRNA 1C8M2 1HW5A 4COUA 4DXSA 4S2DA 5JXIA 2J42A 3M1HA 3ETQA 4IV3B 4Y22B 2QDNA 2WC2A 4NVPA 4AAXA 2A6YA 3H3UA 3HOUL 2VZSA 3PVEA 5CG8A 1JODA 4DY5A 2LUWA 1LOCA 5J37A 5LY1A 4LIUA 5FLIA 2VBPA 3CLPA 1W39A 4JKLA 4W50A 2WO1A 1RUI2 2ZMLA 4EQVA 4Z2AA 2P6CA 2JA8L 1KS4A 4IEPA 4QPIB 4CCEA 4LKDA 1Q8VA 4A3IL 5IVVA 4CSWA 3ZG6A 1W9TA 3HOZL 3VZNA 3EB7A 4AR5A 4Q4Y1 5IUQA 3KLSA 3EO6A 1LR5A 4N43B 3MGUA 2WAQP 4UY81 1VBD1 1RUI1 4M4RA 4Q29A 3HOYL 3TYJA 3VZLA 2DV9A 4B1MA 2VC9A 4INDA 5CIRA 3A7QA 1GSLA 4YW2A 1U5ZA 4FPKA 3PUSA 2B45X 4PQ9A 4AQ2A 4RS5C 2W87A 2Z5WA 4V2WA 1R64A 5K0UA 2WS92 5T5PA 3MICA 4BBRL 3ZR6A 1YJLA 2KXLA 3V0AA 3FN9A 2Y38A 4CU8A 4LA3A 3BTAA 3AC0A 5CADA 1QEXA 3H1WA 3D6EA 3KM5A 3T1MA 2OYZA 4N9HA 3AXDA 5L36A 1O5UA 2P1BA 5EJZB 2V73A 5KHKA 4RR3C 5DAQA 4Y5TA 5IYDL 3RPQA 4M3CA 1ZBE2 2DBIA 2VMIA 1OKOA 2BVBA 4QX7A 5HCBA 4XJUA 2OXBA 3I2IA 3DCQA 4XBQA 3RZMA 3B9CA 3GXUA 4Y20A 2RM23 4QDRA 2GDFA 4KI5M 1IW7D 2YGMA 1ODHA 3I3MA 3HPNA 4CE8A 1WCQA 5FMBA 2DCJA 2XL9A 1EV11 1JOBA 2PHUA 4Q4V3 1STMA 4GB32 3CF6E 2FMDA 3VDCA 4S2HA 1OBNA 1VB2A 1W6PB 4J25A 4YZ1A 1WMDA 1N1YA 4XF3A 4A3LL 2ILMA 4ONUA 4IXLA 4RQPB 4XUOA 1RC6A 4EJRA 3NAPA 3HAXC 4YG3A 5C8WA 1T9OA 1XC6A 2PMWB 4FTEA 5GZDA 3GJAA 5BNNB 1RUJ3 5LA0A 3I4ML 1AX0A 4B8EA 4CDWC 1HRV3 4G3YC 1H30A 2JEMA 4BIOA 1G86A 1CAUA 1F35A 1ND3B 2VTXA 3MDPA 5A7NA 2QQWA 4BA6A 2VAUA 4Q4W1 4AVCA 4LNVA 5M3FL 2KM2A 1COV1 4ARYA 5IHRA 2Q8CA 3DEMA 3MLKA 1DZRA 4LXLA 5CKNA 4GZ9A 1HRI3 1X9TA 2ARBA 5IVYA 4JADA 1AR73 1YXWA 1OMIA 4JGYC 1HKDA 1GLHA 1RUH3 3GCWA 3MW4A 4FOQA 4GH4B 2LCQA 1LCLA 3T1LA 3U07A 1C5IA 1RUG1 3RSJA 4A3DL 3UJOA 3WF3A 5FOBB 2APOB 1UXXX 5A7WA 4TLFA 4OHXA 3RI8A 3QH6A 5C71A 4XTPA 3DPRA 5FY0A 5ABJB 4IEWA 4E4HA 4NIDA 3CU7A 1UYXA 1UY1A 4GD4A 3WF0A 3OTFA 4XZPA 1MS1A 1TMF3 2LW8A 4ZXKA 4DUXA 2D6PA 3N35A 4AQTA 4CA9A 5LEKA 3BVCA 2CDOA 2DSXA 4PF1A 3WF1A 5CKMA 5FYHA 1CQ9A 4IE4A 1N1TA 1QXJA 4XABA 1SLTA 1AX1A 4DO0A 2WIIB 4MLOA 1PGL2 3N7LA 2VCAA 1LODA 3POIA 4QX3A 2FDGA 1W9YA 1JN2P 3TRSB 2NMOA 3HWJA 3LA2A 4OUEA 1H7VA 1T2XA 1UPIA 2VG9A 3LPFA 3AZXA 3ACGA 3K4ZA 4ME3A 4XIOA 5H9SA 1CJPA 1WBLA 2K46A 2W39A 1BEV3 1Y43B 4Y5SA 3ZIWA 1SLBA 3WCSA 4EV0A 2E51A 3B5LB 1D0HA 1UWWA 1LOGA 4LBJA 5I0SA 4QPIA 2W94A 3J4UH 3ZN5A 3WWNB 2RHPA 1GNHA 1ZVFA 1XNCA 3OCPA 4IETA 3PURA 3ZFEA 3RI9A 1EUTA 3MLJA 1BK0A 4E4SA 3JQWA 5A1AA 4OQ9A 4AFDA 5FYBA 5BYNA 2B7YA 2E2IL 4KNCA 2GC1A 4UF0B 2CWSA 5MFPA 5I0TA 3ZSKA 3HD8B 2BZDA 2F4PA 3T0AA 4HK8A 3USUB 3WDVA 5FPLA 1L7QA 5F6KA 1VBC2 3ZFGA 3RZJA 1KXGA 1RDVA 2WINB 2DCZA 3VBUB 2YFUA 2WQ4A 3BOPA 3HT1A 3J26N 5BUVA 4F8AA 3K3OA 1CAWA 1H4GA 2J1EA 4PHZA 2QCSB 4IE7A 2XMLA 3OBRA 4F3JA 1VBC1 2ZX4A 5AFEA 3FBYA 2ZGOA 4CDUC 4PIYA 2HEWF 5KXCA 4I02A 1AL21 1S0JA 2OQ6A 2IXHA 4A6SA 1ULPA 4AHWA 2O5JD 2OZ6A 1DHKB 5JI7A 3U37A 4RFT0 2WN2A 2DYCA 1S0GA 2Y0IA 5IK5A 1GBGA 3PUIA 5GZCA 1AR81 1UOFA 2HJIA 2WO7A 1EUUA 1PGW1 4YG0A 5KC5A 2R043 3FX3A 3PTRB 5IP7L 1KDKA 1OOPA 1ODNA 2A75A 2KA3A 2Q4SA 3E5QA 4TVMA 1WMXA 3POYA 4MUVA 3GALA 4V1PA 2WSUA 5A3MA 1POV1 4Z82A 2DDUA 2VBDA 5A33B 4BDVB 4B3NA 3ZM8A 4RGGA 1UU5A 1RUE1 3PVBB 1OH4A 4C2M1 2GH2A 4A3JL 1GP4A 1YUDA 2VE1A 4JQRA 1KGYA 1WW4A 5I0UA 5C5TA 3KYUA 3VDDB 2QQMA 3E6DA 4BM8A 2XVKA 4LBQD 1NCQC 4XILA 1KJRA 3UYJA 2PMZP 1VBA3 3ZDSA 4G6BA 1NT0A 2C9AA 5FKBA 5C8CA 3M3IA 5CFCB 3HJRA 5EXOA 4TWTA 3WDTA 4PI2A 4NHMA 4HN1A 2VOKA 2PSMC 1F5FA 4CP9B 4YWLA 4LKEA 4JAAA 4WM7B 2ZA9A 1UOBA 2Z79A 3MBWA 5FYVA 4E2GA 4W6XA 1CGPA 2Y6KA 5JZGA 1RUOA 1RL3A 5HXMA 1GQGA 3ZSLA 4QU2A 1NKGA 3PVNA 1QU0A 2YG0A 4IQPA 3J9SA 4QD2A 3T0BA 4NIGA 2FQPA 2W68A 2QL0A 3FDJA 3AKQA 5FBZA 2VCCA 1N3PA 3LB9A 2JDYA 4RHV3 3T2PA 4DXRA 3U4XA 1MVEA 1HB4A 4XACA 1GOHA 3BYWA 4XUPA 4BH9A 2A6XA 4R4XA 5BNOA 1PK6C 1PVXA 2G9ZA 1MS0A 2NZ9A 1K5MC 3VDBA 1D4M2 5GLZA 1HLCA 3POGA 1FAYA 4AYBP 1ZRIA 1QNWA 1FPN3 1VZHA 2VW1A 3SH5A 3KYYA 3NKGA 4AFMA 1BXHA 4AYUA 1W28A 2DVAA 3VKFC 2VMHA 3ZXJA 5A6QA 1D4M1 4QPYA 3A0KA 1V9U1 1MQTB 3GZEA 1HIXA 3U75A 3UV9A 3GTQL 3JD73 2RS53 4OI1A 2VZOA 2A73B 1H2LA 2RS32 2YC4A 5C44L 5BPXA 3V64A 3GYDA 4GS7D 5FZ1A 1Z7S1 4LHNA 1G9CA 1H1IA 1SDDB 2BUKA 4IGPA 5FYMA 4PDWB 3KT4A 3N7JA 2Z69A 5DG2A 1W6NA 3H50A 4N7UA 3T2TA 1UZ0A 1S0FA 1TME3 2AH2A 2QVSB 2RS31 4B4QA 3BOWA 4FOYA 4WZCA 1LTLA 4C91A 2GC2A 4HBNA 3WCRA 4QPWA 3PIP1 1O59A 1MEC2 1WD3A 1UZWA 2BV4A 3CKHA 5FFOC 2JDUA 2W46A 2XJSA 1R0HA 3PMSA 5LW9A 1D7PM 4JZRA 3S1QL 2HWB1 3SCFA 5FP3A 2VTFA 3GZAA 1MPXA 1ND2A 1PIV3 3DGTA 3POWA 4MYEA 4NJ4A 1OXCA 3NJXA 3NL1A 4YGCA 4CU6A 4META 2HYXA 4FXKB 3ZYIB 4AF9A 4OI0A 1GZWB 3MQKB 2E2JL 1FNZA 4A44A 4XJ8A 2WZR2 4ISRA 1JW6A 2WO3A 4QX5A 4C3JL 2O8QA 1F15A 2WRAA 4WVZA 4AWDA 4BQXA 1ULDA 3V0BA 3LWPB 3AMNA 2WAAA 3ABZA 1ACCA 1I5ZA 5AVPA 5KC6A 2PHRA 2W1QA 2PLV2 5DN2A 1CAXB 1E8JA 2VOWA 1FMD3 2WZR1 3J7LA 2X5IA 5FXWA 3DXTA 2IXLA 4F83A 5FLJA 1MS3A 3GTKL 2VOXA 2JECA 5H9PA 1GZCA 1I3HA 3Q9OA 3FWEA 5FXZA 1VBE2 3SKJE 3NSTA 1HV0A 5C3QA 2CY6A 1C8M3 4GAZA 3PU3A 3H42B 4KQ7A 1GP5A 4PLNA 2IVIB 5JI9A 4I30A 4RYDA 4YW7A 3U4SA 4CPBA 4ITCA 1RUD2 5DM61 1OPMA 2YBPA 1IS5A 4AXOA 2BP6A 1YEWA 3IPVB 3GTML 4LR4A 5JWPA 5F3CA 1SQ4A 2Y64A 4AGVA 3AMMA 1RUI3 5FUNA 2ERSA 1OFSA 2AYJA 2JA7L 3SEEA 1WZXA 1FATA 1F5JA 3VBSC 3VZJA 5CFDC 3K35A 1R082 1B09A 3R4DB 1YCIA 2ZS6B 5FYZA 3ZXDA 4AI3A 4XFGA 1YK4A 1YQ2A 1BVVA 2ZGLA 3I4NL 5C70A 1VP6A 3BIEA 5HBAA 4ZXEA 5J1XA 5FP8A 4AOCA 1WW7A 1AJOA 1H8TC 4Z2WA 2WS93 3SKVA 4DRVA 5FY4A 5L7OA 5ANNA 1TEIA 5DUWA 5SV8A 2VZ1A 4OFGA 3L2HA 3ACFA 4PLOA 1NUKA 2OKXA 3WLUA 2DCKA 3I54A 3POBA 1NA1B 4HSJA 4YZ2A 2RM21 2WWSA 5D8AC 3Q8EA 1ZBE3 1GWMA 1N1VA 2TUNA 2OVUA 2R6QA 2WL1A 3TEYA 3RZZA 1W8NA 4Q4V1 5T5JA 5BNPC 4QKDA 2W1UA 1FXZA 1TQ5A 5FP7A 3AZZA 4LBNA 1LESA 3MFCA 3K4AA 2IXKA 1NLRA 2X09A 3FUOA 3K2OA 4L8QA 3AJZA 3SISA 2ZGQA 4CEWC 4PT6A 1TWFL 3C7FA 4GB33 3D82A 2R92L 1HB2A 4Q0PA 4MGKE 4ZS2A 1RUJ1 1GP6A 2VOVA 3B9IA 3H8OA 1HRV1 3EXUA 3UT0A 1OI6A 1Y9GA 4Q8KA 4LO4B 1XYNA 3HEIA 3VBRC 3WHUA 4K8RB 3ZFFB 3CDZB 4YGDA 3KCYA 2NVXL 2GH8A 3RNSA 1GMMA 2ZHMA 1RHI3 1HRI1 2VUDA 4XXPA 3PO3L 1J3PA 3A44A 4IESA 2XBO2 1AR71 2E2HL 4QPGC 5C4WB 1G6NA 1RUH1 3NV3A 3WQ0A 1DGRN 3POFA 4W6YA 4XHBA 5E1RA 5FJKA 4ZY9A 5LWBA 3PL5A 1O5LA 2P3JA 5FPXA 5LBCA 1Y1VL 4P9GA 3FL7A 2QJVA 3LA7A 5LA1A 4G4FA 1KDMA 4I0AA 1AZDA 1IU6A 1HN1A 1ZNPA 5CU1A 4YGBA 1G9AA 2D6LX 3C7OA 5HCHA 1ENRA 4NAOA 4D3WA 5JCTA 2WWUA 1TMF1 1UYZA 1SCSA 4DMIA 2JG9B 4CUCA 3S2DL 4FT8A 3AL6A 3NWKA 3VBFA 3VZKA 3VBHC 2E32A 5FZIA 2WNEA 5FY1A 2ADEA 4CTEA 1UL9A 4MV2A 1GQHA 2G9GA 3PMEA 4MVTA 4Y7NL 1YYNA 4HANA 1GYKA 2ARXA 5FY9A 3BTYA 2QUOA 5GAGc 3W21A 5FZ3A 3AZVA 2JA6L 2VZRA 1XU1A 2WNVC 5FMCA 5CZKA 3ZYPA 2ZGRA 1W3VA 5CBLA 3DECA 1OQDA 2RDQA 4DEVA 2PYAA 3GGLA 1BEV1 1ODMA 1OFNA 3LDRA 4XBNA 1T6GC 3OOXA 4R9AA 3HOBA 1XNKA 2DF7A 4XOGA 3CJIB 4JHTA 4MGZE 4BK4A 4COVA 2MEV2 4LQRA 4COYA 1JYWA 5H9QA 3ILFA 2BERA 3W5NA 4I0BA 1AXKA 1NQDA 2AEZA 1B35B 3OY8A 5LASA 2K9ZA 2DTWA 4CPBD 1OWBA 4NPMA 3T3YA 5LRSA 1PNFA 2AUYA 2ZMNA 3RVHA 3B93A 4BE3A 1PGL1 2JE9A 4HPKA 4YM1A 1N47A 1P8JA 2WYSA 3ZPOA 4ZN3B 4DZGA 3S1NL 5J09A 1HQWA 1GV9A 4SLIA 3B01A 4FXGB 4XJZA 5EWSA 3AK0A 5GLVA 3KF5A 5JR7B 4Y33A 4N53B 5ANQA 1GFF2 4CU7A 2D97A 2VD7A 1VLNA 2P4EA 3D0JA 3NNLA 4N7IA 4YW5A 3KQRA 5FJHA 4AEMA 1Q3EA 3T09A 3H97A 2R041 4DQAA 1PVC2 4A3FL 1K5JA 4LO5B 2X53S 2VMEA 3BCWA 4OHVA 5HCFA 1F4HA 3WXPA 4YNIA 2WABA 1C4RA 2NP0A 3EMRA 2VVDA 4LORA 3ATGA 3KB5A 4URTA 3BKZA 3CQZL 1WMEA 2VR4A 1I6XA 5DXDA 1UKGA 5KHJA 1W8WA 2QNKA 1O4ZA 1CAVA 4XGHA 1H1AA 1VJ2A 3H1YA 1AF9A 5FWEA 5AC92 5FMOS 2A3YA 1W6MA 2MS3A 2I2SA 2JB4A 3POEA 4Z92B 1S0IA 4EZHA 2W1WA 4BBSL 3QOPA 4QAWA 4UFJA 1XQNA 3RMYA 2E7AA 4Z8BA 1BRFA 2CGNA 4GJZA 5JOYA 1RUNA 1YFYA 2OIIA 2VQTA 3ZDVA 5FPVA 1SMVA 3O12A 4YVSC 4A7KA 3I2FA 1VBA1 2WKKA 1L7RA 4AR6A 2C6SA 3M70A 4XVHA 4Y26A 4J1WA 2B9VA 1O3RA 1DF0A 3RZ6A 1OH3A 2Q30A 4OMCA 1LGCA 3QQCE 4BXFA 3AKRA 3AYCA 3ECQA 4M01A 5IW0A 4TN7A 1GOGA 2MPFA 4XETA 5C3PA 4BOWA 5K0UB 3LDBA 4ZN1B 4LO8A 4OCTA 3LA3A 2UY9A 3V0AB 1M06G 3KV6A 3G6JB 3V65A 3K3NA 4RA0A 4ZONA 3WT3A 4D94A 4CXYA 1K42A 5GKAC 2R062 2JX9A 1UU4A 4KL1A 1NY72 4AAPA 3OGSA 1YQ5A 3C7HA 4XYXA 1GR3A 5FMOL 4JKMA 5FO9B 4RHV1 4A3GL 4M3CB 4L9BA 3JQXA 3VV1A 4COZA 4KMQA 2RS12 2DBNA 1CN1A 2ZGMA 5JPNB 1DYKA 2EIBA 1ULGA 2C5DA 3K77A 1DQ0A 3HN1A 2ERFA 3CO2A 1UX7A 1C8NA 4LKSA 4XXAA 2FDKA 1LKPA 4F7ZA 2VVFA 2CAUA 3HKZP 5A3TA 4NRQA 1N3OA 1UYYA 3PUAA 3IMMA 4H2AA 4BIFA 1JU4A 4MGTA 1FPN1 3FC0A 1Y7BA 4I3PA 5FZ4A 1WA4A 4KWUA 2ZMKA 4HN0A 4UFIA 3OF1A 5FZ0A 2QFEA 2ZEYA 5EFUA 2B5HA 5CISA 2VZ3A 3NAPB 2WR9A 1C57A 3I3DA 5A7PA 1JTZX 3B94A 4A3EL 4LPLA 4EN9B 1UO9A 2JI2A 4Y5Z0 2AREA 5DZFA 1W6OA 3D5OA 5T52A 1TE1B 5M3ML 2J1TA 3D3AA 4C1WA 4BQYA 1WMFA 1NOVA 2RS51 1JYBA 1QKQA 1ENQA 2HWD2 2QQNA 3JD71 4QMAA 5BY5A 2TBVA 2VXRA 1UY3A 2OPKA 2BEOA 1CAUB 5DG1A 5K7PA 5AI3A 1GZ9A 3QBQA 1W2NA 1W2OA 4XFCA 1UMHA 3RWKX 3SCGA 3CZUA 4XJWA 4AEDA 3WG3A 4I01A 5A1FA 3IDCB 1Y4WA 1WA6X 4IDZA 1TME1 2R7EB 2X05A 3T08A 4A2UA 2BE5D 5FZLA 3SXWA 1O7FA 1W0PA 3JUUA 5FRAA 4FOVA 4YPJA 3UETA 4XF9A 1JYXA 1JU3A 2PELA 5FY8A 3R4UA 4M0HA 3AP5A 1OUXA 1SMWA 1XE8A 3J7HA 3ORJA 4IEYA 2IWGB 4XMIA 3WG4A 4A7ZA 3KYWA 3NJZA 3B3QE 4DS0A 1PIV1 1MEC3 1MS9A 1XPWA 3DPRB 4XZUG 3RMXA 2WNUB 5FDBA 3J7MA 1SBDA 3MIBA 3HOWL 5C9AA 4IV1A 1WLWA 4P08A 2K2DA 5JIUA 2RV9A 5DZEA 5KR7A 1W90A 5B4XA 3IZOA 3ZMNA 2EVXA 1CPNA 3WSOA 2R49A 4NIAA 3J8F2 3KZ4C 1ZRCA 1Y9MA 2A1XA 4YVWA 4WM8C 4BQ4A 3FUQA 3NJYA 4C8DA 4CP2A 1FMD1 4BYYA 2ZAAA 1LNSA 3AP9A 1VB4A 2H6BA 1MZ6A 4Q8LA 2GC3A 3QD6A 3QH7A 4C0BA 3V56A 4YFWA 5C33A 2R7ZL 1QOOA 4CCOA 2PLV3 4FFHA 1DVBA 3HAGA 2PHWA 1UXZA 3WQ1A 1C8M1 3H7JA 1DG6A 4LHSA 3HJWB 4CEYA 4O61A 4GMP0 1WWYA 3HBZA 2CGOA 3WOGA 4LT5A 3TEWA 5FZ7A 3O1PA 4AFBA 5FMDA 3BUCA 1VBE3 1LKMA 1US3A 2JIJA 2OS2A 4NOTA 4HVQA 5AI2A 5T50A 4HFSA 2BGCA 3ACLA 4QX0A 4UFMA 3ZFEB 4H55A 4LE4A 2LRPA 2JD9A 2OUHA 3OD0A 1EY2A 1QCVA 1RUD3 1UMZA 1SLLA 3FHIB 1FV2A 3FMGA 4D8MA 5EQUA 3ZFGB 1YI9A 2HBTA 3NKTA 1R0FA 4YGEA 4XXBB 2FCUA 1NG0A 4A3BL 1A8MA 1GUIA 2BW8A 2DURA 2I07B 3N9MA 1AVBA 4H3WA 4JTOA 4LITA 5A6XA 5B4NA 1AYN2 1CAWB 2JI1A 4IV3C 1R083 3J7Y1 2WO2A 4ATEA 1MS5A 2NYYA 3JZVA 1HN0A 2ADDA 1VCXA 4MXWA 4OZOA 1Z92B 2WS91 3MPSA 3RQ0A 1W0OA 1H8VA 4Y1VA 1LHVA 2JE7A 3KYXA 2DCYA 1DQ1A 2SBAA 3PU8A 5JXGA 5DDJ3 2NM1A 4OHWA 4IEXA 1OOPB 1I9RA 1ZM1A 2BNOA 4LLFA 4PI0A 4QX8A 3RGBA 2YC0A 4LBQA 1AXYA 5FY7A 2Y26A 1R1A2 4N43C 4C1XA 3I49A 2RE9A 4I2OA 5DQ0A 3DXUA 4AL9A 1NLSA 1DU3D 1ZBE1 5IATA 2J7MA 2WZ8A 5LBBA 5T5OA 1DFQA 1LOFC 3RZTA 1TWAL 2A71A 2QQUA 3TAYA 4EN7B 1KFUL 5DZGA 1GQPA 5IFTA 4UAPA 1UF2C 3AMQA 3KGLA 1FOD2 4GA9A 4ZU5A 1OLQA 1A78A 3I2HA 2P34A 1JH5A 3M3QA 4GB31 4GXLA 3MW3A 3NO8A 5FTTC 5A7QA 5C8CC 1L3JA 3UJQA 3UKNA 4QGLA 4WVVA 5F5QA 1ZRPA 1LRHA 1IPSA 3LGRA 4Q0SA 2D6NA 4XJAA 1CJDA 2R072 5K8SA 2YC2A 5C8CB 1RHI2 2XWJB 4NPRA 6RXNA 1VMFA 5EP9A 2PYTA 2ZEWA 1W2AX 3CZJA 2IXIA 2JG8A 5K4LA 3IN9A 3A23A 4JCKA 4QWNA 4Y3OA 1A34A 1OUSA 1RITA 2BJSA 3TBDA 3OEBA 3VBOA 1RHI1 4MO3M 5LATA 2E6VA 3HBKA 5JZGB 3DN7A 5FZ9A 1HV1A 5BXXA 3TWIA 3AJYA 1A3KA 1PFYA 1DGRA 1XE7A 2EXHA 2XUMA 2YY1A 5FUIA 5LBEA 5IYBL 4B4RA 4NWVA 3VUOA 4AI9A 5I0RA 3ZSEA 5EJ1B 2HVYC 4DFSA 3C3VA 2JA5L 4K40A 3O1RA 3R05A 1C5HA 2JXAA 4A42A 4COWA 5BNQA 1RJ7A 2ZGKA 3I3QA 3VGIA 2XBO3 4CCKA 5J7MA 1SPPA 1O4TA 1Y3TA 2YPDA 3B00A 4RQPC 3ZYBA 4CZSA 2WNUA 4DOUA 4NWWA 5BNOB 1VRH2 3VL8A 1NCRA 5FYIA 5JOXA 4K6BA 1C1FA 2D44A 1QH6A 3U1XA 5KHGA 5JVH1 3DYPA 5BNNC 1ZZCA 2A5ZA 4PBPA 1Z78A 1W0NA 1U0AA 2JJ6A 4QU1A 3UGHA 2VH9A 2HEVF 1ND3C 3VD7A 3F95A 5IK4A 2G1MA 1IU5A 1NNQA 4NUBA 4AFAA 4C0HA 1LJ7A 1LOEA 3WUCA 3A22A 2VULA 5L19A 3IBMA 3A0NA 3S2HL 1IQAA 5JXHA 3JB4C 4MX3A 2VXJA 3DF0A 3NNGA 4GH4C 2C0ZA 1I6HL 2VO5A 1V00A 4OHZA 3SC7X 1US2A 4LULA 1NXEA 2CWMA 2XB6C 5DAPA 3S5AA 3RYRA 3VHRA 1W6NB 2IVJA 4AFCA 4CDUB 1QJFA 5ABJC 3FE5A 2R16A 1KJLA 4L2NA 4QB2A 1JUHA 2ZGUA 3VKMA 4D6RA 2D5HA 4RS5A 1AJKA 1O8PA 1VMJA 1RYYA 2BPA2 5EPAA 1LHNA 3APBA 1SACA 3LEGA 2HBUA 2C24A 1EP0A 3I2DA 1UCXA 4LOTA 1BYHA 4LHKA 3MV01 4AI8A 1YRZA 2MEV3 3P1IA 3K4DA 4DXZA 1ND2B 2J1AA 3MF9A 4IEQA 4QQPA 5FZFA 4JQTA 4BLJA 4A3ML 3KV5A 2JIGA 4X8PA 4RR3A 4YLZA 5A80A 3TB0A 3I7DA 4KWKA 5JPMB 2ES3A 3SS2A 2VQAA 5FYTA 2VZQA 4QXBA 3V0BB 2ORZA 1DZQA 1YLLA 2ZAHA 2XJVA 3RFRA 2LS6A 3JXSA 1YO8A 5F8PA 4EZ4A 5JDBA 5E16A 5IWFA 4ZHNA 3HQRA 2GSYA 2TNFA 3ZYGA 2X5IB 3H0OA 1CD3G 4BQ1A 3WUDA 3U78A 1APNA 2K0GA 4EYUA 4ZKTB 3NQHA 4I09A 4YM2A 1TWGL 2RMU2 3GTOL 5F37A 1QH7A 3WDXA 2VUML 1ZA7A 5GAEc 2HWF2 2ZGSA 2ARCA 1IKQA 1OQEA 2P3KA 2WFPA 4R52A 5IT6A 1PVC3 1T6BX 3WNXA 1SDWA 5FZ6A 4H7MA 1IPJA 1YHFA 4Y52L 2QQLA 4N90A 5M5YL 4QDQA 3VBUC 4CDWA 3VZOA 5DMYA 3AVSA 2M4YA 2A68D 5C6CA 3ZXKA 1LB2A 3AX4A 2V3BB 4X6AL 2KN9A 2XLAA 4QQ2A 2VCBA 1LGNA 4CXWA 1W03A 4NROA 5AC93 4CCNA 2XOMA 4OI2A 3GDBA 1QMJA 4GWIA 4FFFA 3BIWE 3ZYHA 1V6LA 4JGYA 5LA2A 2VBBA 4YRDA 4YZ4A 1JZ4A 4Q5OA 4CVUA 3S14L 3MIHA 4OULA 3GCXA 1OA2A 3SLIA 2CAVA 3O5SA 4OMDA 4R9BA 1RXFA 1V6KA 4AI2A 4EWEA 1O3SA 5FO8B 1OD3A 2WJSA 3WG1A 2VECA 1WJVA 4BXXL 3HNBM 3JB8A 5F5AA 4LE3A 1DBNA 3AKSA 2HR5A 2D6MA 5C4JL 1Y9QA 5L7OB 3THCA 1UOJA 3A21A 5FXXA 1VBB2 5IVBA 2ZIXA 1S0CA 2R063 3OEAA 3HIFA 3LEIA 4Y1UA 3WW2A 3VDDC 2FD8A 2GP3A 1JXNA 4L97A 4LTAA 5K2ME 4OZXA 3AL5A 1EAH2 1SBFA 3URFA 5FZHA 4ES9A 4EN6B 1S24A 4LBKA 1SZBA 2CNAA 2RS13 1WCUA 3SQOA 3OGGA 2A6ED 2DU1A 3LEKA 4XQDA 5CFCC 4KU7A 4BU2A 4JGZC 4IEVA 5C3SA 3TOJA 1EPZA 1G9BA 3GTPL 1B71A 2ZBJA 2I45A 3DYOA 4AGRA 1RUF2 1JBCA 2C4XA 2QTWB 4PF5A 5J36A 4WM7C 3LPGA 4QM9A 3SNMA 1LKNA 1W9FA 3WF4A 4JDMA 5F3EA 3CNAA 1BVP1 1QJU2 1UZVA 1V70A 4AI1A 2VUCA 1UY2A 2Q8EA 5ISLA 2RG4A 4JAFA 1NXMA 4YYOA 2KKDA 1E57A 2O8OA 4XUTA 2Q0AA 4P9JA 5F5IA 2CKAA 1LOAA 1BE7A 3M3EA 4BK5A 5A6ZA 1LEDA 1CONA 2WT1A 1S0EA 2HWD3 2VM9A 2VZTA 3KGZA 3OPWA 3AYDA 1AR93 4X6RB 5L9RA 3WR0A 3WQ7A 4BHPA 4CUBA 1D0GA 1XXNA 4UFLA 3JR7A 3KSCA 2GC0A 4O65A 1W8TA 2B63L 1MZFA 4U36A 4XUQA 1PHMA 2EAKA 3UK9A 4CDQC 2GP5A 3H0GL 2I74A 1JHNA 4FPHA 4CDUA 4QGNA 2XJTA 3FBMA 1QDOA 1TZOA 2YB7A 3I2GA 1R9TL 4Q0QA 4UW6A 1BQ8A 1TWHL 4YZ5A 1MEC1 1ZRFA 1OLRA 1YWKA 2CTVA 3Q8FA 4KBZA 4MGIE 3RZHA 1MQTC 2WB1P 2XQRA 1W8OA 3AMPA 3VZMA 2DWRA 4BMEA 1H6XA 4E4DX 4YM3A 3VD9A 5EV7A 1TNRA 2D98A 4LK7A 3P3PA 2AEYA 3VBFB 1J59A 1X7NA 4HT1T 4C90A 4NHXA 3PDQA 2DFBA 1QJZA 3MFAA 4ASKA 4A3KL 4LKFA 4CCDA 1SMUA 1GNZA 2P37A 4PDWC 2VMGA 3BTZA 2C26A 3N4MA 1XU2A 2P2KA 2R32A 3S16L 3F2ZA 5IJRA 4FCAA 3J8F3 3N9LA 2WFF3 1VE0A 1RB8G 1W8UA 4PBOA 1XB9A 3JBG2 5A32A 2PLV1 1GANA 1ULCA 4K9SA 5L9BA 3WNLA 3IWZA 2YXSA 1NCQA 2ZXQA 4J1XA 3ZN4A 1XSQA 2J1VA 4ASLA 1VAMA 3LZZA 1VBE1 2YGLA 2ARAA 4Q0VA 5EHDA 3SITA 2B9UA 1XNBA 4RGAA 5LY2A 3AKPA 2NPIA 4UFHA 1RVF2 3ZYFA 3ZXGA 3SEPA 5H9RA 4BY1L 2PQQA 1R092 4KGGA 3ZMOA 1GWKA 1RUD1 4IGOA 3FJSA 4A7YA 4AVAA 4YARA 5C3RA 2JDPA 2EXKA 2LTNA 3OY8B 5LA9A 1H9WA 4QX1A 1X8EA 1WW6A 1M4WA 2W9XA 1CX1A 2FDIA 1CZTA 3PNAA 4B4PA 1OF3A 4H7LA 4MOAA 4UXAA 4HPKB 3IB3A 1R081 4S2FA 3OJBA 1G9FA 1I3QL 1OC1A 1BBT2 4DNYA 5K9YA 2EA7A 1AYM2 3H9AA 1YFXA 4RL7A 5DDJ2 1PK6A 1F2NA 2XJQA 1C28A 3DYMA 3ETPA 4D69A 5FXVA 1AYN3 5D8AB 1K5MA 5FLML 4E2SA 1JZ6A 3C8XA 4BCUA 2TEPA 4PIXA 4CU9A 1V0AA 1VAVA 2SLIA 3OYWA 5DDJ1 4W65A 2AZ5A 4HLTA 1ASJ3 4JGZA 4R8HA 2DVFA 2BU9A 5F1RA 1QY4A 1ULEA 1Q8PA 3FHQA 4FAHA 5A70A 1LOBA 3LKJA 2W47A 4CDXC 4JX0A 3VLBB 1C3HA 4I3GA 3PIO1 3AZWA 3T4HB 5H1Sc 2XQXA 1N1SA 3CL1A 3HR9A 3HN3A 4YW1A 3P2AA 2H12A 3Q8AA 1CAVB 1R1A3 5FYCA 2QQVA 2N7GA 5ERLA 2RR12 3O0WA 4Q4X3 2GZWA 1W6MB 5RXNA 1LHOA 4UFKA 3POSA 4UW4A 4LBLA 1XNTA 1XYOA 2V0EA 3H3VM 4K21A 4AW7A 4AG4A 3I2OA 1WKYA 2R1BA 2A6ZA 3ZSMA 2ZHNA 3PIGA 4FPJA 5FP9A 2QQIA 1U5XA 4JHZA 1FOD3 5HI0A 2ET1A 3VD5A 5FPBA 1PMIA 5C7GA 4A6OA 3O1MA 4FP3A 3WY6A 1YUXA 2DUPA 2R1DA 5M5WL 4CDQA 1B2OA 1ALYA 2ZGTA 1IS4A 2ZX1A 4R9DA 4ZU4A 1UAIA 5FZOA 4HSLA 3INAA 2RDRA 3MSUA 2R073 4AK3A 5FZAA 3ZR5A 4XTMA 5CKQA 4NN0A 1NA1C 1J84A 3D4KA 5LK5A 5JMCA 2HWC2 4UBGA 4UW5A 4GQ7A 4PJYA 4QQHA 2OW4A 3IDAA 1CZVA 2PHFA 3ON7A 4HONA 3ZN6A 2YMZA 2ZABA 5A3WA 1CESA 3AYEA 3MIGA 2XBO1 2Y6JA 4LO6B 2B39A 2PN5A 4FSJA 2P5BA 1QQP2 4FPOB 3NV1A 1NE6A 1B13A 4CUAA 4NPLA 3UKVA 4FTSA 3OPZA 1VRH3 3VKLA 5IAXA 4BZ4A 2YZ4A 5A3OA 4CCJA 2PXJA 4LBMA 3ZFFC 3GF6A 3THPA 1YUZA 3AFKA 5L73A 5JOWA 1CVNA 1QWRA 1PO22 4IE0A 3POJA 1JI6A 2XHNA 1W6OB 3M7AA 3EJKA 2E63A 5C4WC 5IK8A 4DUVA 1JYIA 4LUMA 4TXWA 4CCLA 1KQRA 2XH6A 4P9IA 5A1LA 1DGLA 4B29A 4YSFA 4B8CD 1G9DA 3OGVA 3N9OA 1GZTA 2WLPA 2OX0A 1O91A 5MLC3 1IG0A 3VBSA 1SFYA 2ZHLA 4W6WA 5CFDA 4AEDB 2C6AA 4JAEA 1EYBA 2BOJA 2G9FA 4CP1A 1MR5A 1UX6A 2JENA 2A6HD 2DVBA 1S2KA 4XPVA 1OT5A 2WA4A 1AR62 4WVMA 3ZOIA 4Q1PA 3CQOA 3WHTA 3WNOA 4QB6A 2A7AA 5EZWA 1RJ8A 1NXGA 1QJX2 1NXD1 5EJ3A 4FOWA 2D7FA 2MEV1 1H8TA 4ES8A 3BTXA 2AACA 3LFIA 1O8SA 4GKYA 5FUPA 3TNPB 2WWJA 2EXJA 1UNBA 3ALQA 4BB3A 5C9AB 4IV1B 5GAHc 3ITQA 2HWE3 2YHJA 2WUHA 1POV0 2NYDA 4EN0A 3P6BA 1DQ4A 4CCMA 4Z07A 2BWCA 1GOFA 4IERA 3KS7A 4GIQA 4YVWB 2CU5A 4KGQA 5D8AA 5E6HA 2OZJA 1J3QA 4DEQA 2ZKNA 2DVGA 4O9EA 2Z42A 3UKTA 1OA3A 1WCKA 1I50L 1J1LA 3VHPA 5BNPA 5J96B 1JZ5A 5A3NA 4P9WA 2FDJA 1DDLA 3L9JT 1O3QA 2DUQA 3CJIC 4CEWA 1H4HA 4EWDA 1OLME 1VPHA 3A4UA 2VZVA 2FMYA 2O0OA 1PGSA 3OBTA 1MZEA 4CEYB 5J98B 2RDNA 1ULOA 1PVC1 3EHKA 3Q8CA 1B35C 1TNFA 2RMU3 5EIYB 1OD5A 4KWJA 1OVSA 2Z3RB 3WDYA 1RYQA 2HWF3 1XE0A 3LSDA 1IGOA 1OQ1A 4FO9A 3THTA 4RFRB 3VBRA 4RXNA 3GBGA 3WQBA 4A3XA 1T9PA 5AC91 2AQCA 1DLCA 1DGWX 1UMIA 2VMFA 4MADA 3OSDA 3AM2A 1ZX5A 1J1TA 5JUVA 3NJVA 3H8RA 4XEZA 1H2MA 2ZEXA 2WT2A 2GMEA 3CBNA 4QPGA 5D1IA 5FZEA 2XG3A 4X8NA 3NNMA 1H2KA 4GJYA 4XF1A 2FZ2A 3TN92 2EY4E 5CNAA 5IP9L 1OPOA 4XIKA 1ZBA2 5MF6A 2JDHA 4JC1A 4QDSA 2ZZQA 3T2QA 2M4VA 1PO12 3U10A 2VNVA 4V196 4D6QA 2XUEA 1Q8SA 1QDCA 2H0BA 4EN8B 3AVRA 5IYCL 2VQ0A 1S55A 4N8MA 2WLQA 4MXWB 2QKDA 2YU1A 3N7MA 4XJ9A 3KVAA 4PIZA 5DABA 4IE6A 5SV5A 2VY0A 3M3YL 1MZ5A 1WLTA 3P5BA 1AXZA 1PX4A 2XL7A 3KQ4B 2J1SA 5FZGA 5GLTA 3VBHA 2R061 4AQ6A 2XHKA 1NY71 4LBQB 1ZRRA 1AHSA 3WDUA 1VBB3 1Z0HA
chains in the Genus database with same CATH topology
2NQYA 2LALA 2RS11 4PCRA 3FFZA 2WNVA 3AMHA 1DLLA 3W59A 4POGA 4E4ZA 1R0IA 1WLDA 1EAH3 3FFQA 3DKWA 5K0UC 1S1AA 4XDQA 4E27A 4ISQA 2XLGA 1ENSA 2ZKLA 1IROA 3OD4A 3BODA 4ATFA 1AR92 1RUF3 4FPLA 4D7TA 2Z3QB 1QJU3 2JG8B 2P3IA 3GZTB 4I0WB 2YYOA 4Q1RA 2HWD1 1BK1A 4XF4A 1AR91 3VBOB 2B8MA 5KHHA 2IFRA 1Q8OA 3WZ1A 3WWLA 4AHXA 1Q8QA 1URXA 4AQSA 3GBFA 1DGWA 1KITA 4GWNA 2JI3A 1RUC2 4YWMA 3GNEA 3NAPC 1IS6A 3MPPG 5I91A 2BNMA 1QF3A 2AYHA 1NCRB 3AYAA 3KCCA 3WP5A 1DIWA 5BV6A 3ILRA 3CJXA 5MGNA 5EINC 2NMNA 1HQNA 2E7QA 2UYAA 4K8FA 2AR6A 4DINB 2WFF2 3HT2A 2D3PA 3IDEA 1RDGA 3WX5A 2ENRA 2ZX3A 4LO7A 3RS6A 5CG9A 1RYTA 3J8F1 2WFF1 1IPKA 1I1EA 1JYCA 4Y4YA 5F6LB 4LA2A 1HXS3 2YPJA 3I59A 1KS5A 4OUSA 5GLUA 3U0ZA 4LHLA 4HZFA 1QOTA 3LAGA 3JBG3 4YVSA 2QZ3A 1OSGA 3ES1A 3DPRC 4AR4A 5GZFA 4RS5B 3D8CA 4UW3A 2B42B 2ZX0A 3EBRA 3KT1A 3RWNA 4U2AA 5IY0A 5CA6A 5FQ0A 1RVF3 3QACA 4CP0A 2HKXA 3KD4A 3E6CC 3WVJA 3ZXFA 1Q56A 1XYPA 4FP2A 2NN8A 4Q4Y2 5LK7B 1R093 3UL2A 4AE2A 4OLLA 4RR3B 1VBD2 2Y0OA 2RDVA 2CL2A 3MYXA 1LKOA 1FT9A 1YK5A 1PZ9A 1IKPA 2YV8A 4FPFA 1ASJ2 2ZX2A 5GM0A 4WZFA 2XPJA 1AYN1 4SBVA 3ZXEA 1REEA 3WD5A 1BBT3 5E89A 3WW1A 4QPIC 4GMP3 1AYM3 3WW4A 3GHNA 4D7SA 4TPUA 2GMPA 1ASJ1 1WW5A 3ZFEC 1W6QA 2GNBA 4Q4X2 4QGMA 2D40A 2CYFA 4DRRA 3ZFGC 3N3HA 4BWOA 2F6BA 4CYDA 1R1A1 4CDWB 1QNYA 1H9PA 4Q4X1 2UU8A 2YDEA 3NFPI 1BMV2 4JTNA 1S30A 1EPWA 2YROA 1EV12 4E2QA 2RR13 3MI8A 3DV8A 3LWCA 1FOD1 3PJQA 4L99A 5CVRA 3L2YA 2H6CA 4JGYB 4P9YA 2QZ2A 2DTYA 1FNYA 4JV4A 1BMV1 2M6PA 1SLIA 1OOPC 2V09A 2R071 1NQJA 4IEUA 2A6WA 4KU8A 4GKXA 1C1LA 2D6KA 4OVEA 3WV6A 4E9KA 4QHBA 4L11A 3ILNA 4NHLA 4Q4W2 2PAKA 1PZ7A 1COV2 2IXJA 3IMNA 8RXNA 4K1ZA 4FPEA 4FQ4A 2HWC3 1REDA 4WM8A 3VKOA 1W2UA 2PTMA 1AL0G 1XRUA 5GLWA 3QCWA 1LU1A 1WLCA 2MNGA 2ZCWA 3WINE 1RUG2 4WVWA 3B08B 2Q1MA 4KG8A 4WFN1 1UIJA 2L0ZA 4Q0UA 2V0FA 1LECA 2C1FA 3MW2A 4XE9A 4AI0A 1QQP3 1VRH1 5C8CC 4XQWA 1DQ2A 2V5YA 5FOJB 1QJY3 1F31A 1QGLA 3BB6A 3TNQA 3PKIA 2VPVA 4ORFA 5DM71 5JZGC 3FLRA 2EAAA 5KXEA 3AP7A 4XF0A 1BJQA 2D3SA 5AFBA 2Q5TA 1PO23 3M4FA 1V6OA 4QT6A 2VW0A 2D5FA 4GULA 4KG0A 2XLFA 5HXVA 4Z1VA 4UBHA 5BNOC 2UY8A 5CAZA 5FCCA 5I8YA 3ES4A 3KYVA 4LEJA 4R4ZA 1J58A 2E7TA 1Q5OA 3IDBB 4IV3A 3CEWA 4Y22A 3MPBA 4YG6A 3VN4A 1ZREA 3M8LA 1U5YA 2HWE2 4L92A 4XJ8A 4CDUB 3H1MA 3PHMA 4R9CA 5IK5A 1AR63 1SFNA 3O0XA 3M3OA 1N3QA 4N9IA 3VKNA 1AUYA 3VHNA 1WUVA 1JOJA 2NLRA 3AFGA 2HWE1 1QJX3 5FAXA 1RTVA 2ERJA 1MVQA 4X6QB 3PZAA 3GBWA 4N43A 5GADc 2PVEA 2BQPA 2W0XA 1LU2A 1WCSA 2DCTA 2ZGNA 1IOAA 4MGYE 1LOFA 1DYPA 5E8AA 1YJKA 3NW4A 1UPSA 1CIWA 3ZYRA 5A32B 1AL22 3GHMA 2QE3A 1ZRDA 1V6MA 2JKBA 1VZGA 1NCQB 1SMMA 1ZZ8A 1AR82 3DL3A 2RMU1 1PGW2 4LBOA 4AHZA 3ZVXA 1ND2C 1UKRA 5I93A 4FBFA 1LULA 2HWF1 3PVOA 3MEPA 2M6OA 3WDWA 2IXCA 1LGBA 2FZ1A 5EIOC 4G9SB 2X8KA 1RUE2 1YFUA 1FYUA 3SHRA 2ZJCA 5JOZA 5T54A 2X5IC 3LSEA 4AEKA 1OA4A 2ZACA 3O0VA 3WG2A 1ZZ7A 1D4VB 1W6PA 1QYBA 4AHYA 3E5UA 4XMAA 5E88A 4RQPA 1MS4A 1SLAA 4HVRA 1PK6B 1RMU3 2A70A 3TN93 4QM8A 1ZBA3 2DVDA 1K5MB 2JICA 4RSUA 1PO13 5B2GB 3AP4A 3IKWA 5BNNA 1G8WA 3OYWB 4Y1ZA 4AVSA 2VL6A 1QXPA 4YW4A 2XJPA 2GNMA 4JGZB 2GMGA 2PHLA 1ND3A 1RWDA 3I4IA 3E97A 1CX4A 2RJLA 1VBB1 1X50A 2D93A 3RYPA 3ZX7A 5LEJA 4GH4A 5F9TA 1RGSA 1EAH1 2DU0A 3SH3A 4IEZA 4AR3A 3VPBE 1KRIA 3FLTA 4PLMA 5ABJA 4TSVA 1SBEA 1CR7A 1RUF1 2GALA 5L7OC 1S0BA 2CR8A 5TSWA 1QJU1 3IIAA 1V9U2 5GZGA 4CDQB 4K9FA 4KBBA 4E6YA 2VUJA 2XVGA 1BKZA 1IZ3A 1YIPA 3FLPA 2H0VA 3LOBA 1PNGA 3B69A 5KXBA 3RRDA 1Z7S2 3IM0A 4TYSA 3WP4A 3ZN6B 3H3ZA 1V6NA 2XKOA 4M3CE 4O9GA 1D2QA 2PHXA 2JDZA 2PHDA 4Q27A 1X33A 5J3UA 1MS8A 5T55A 4K1YA 3ZSJA 1S2BA 1RUC3 5DUXA 1B2JA 4XBLA 2HWB2 3M3CA 1U12A 5ACA3 1BQPA 4AVVA 1HXS2 3MLLA 1OWCA 1UIKA 1KD7A 1UU6A 4XW3A 3PKJA 3USUA 1WD4A 2OA2A 5GALA 3VBUA 4IL7A 1HXS1 5HCAA 1ZZ6A 2W52A 1V6JA 3VHOA 4FTBA 3JBG1 1F9KA 3ME2A 3VBSB 5CFDB 2GNDA 2D6OX 2XWBB 3J7Z1 1F8VA 4MZUA 4IEOA 4WVMB 1QXRA 1V6IA 2BFUS 2WZPP 3S0MA 3VBFC 2EF6A 3X29B 1DZTA 1RVF1 3O7OA 3N7KA 2VVEA 1H8TB 4QQOA 2ETEA 5A33A 1ZYBA 1R091 4YM0A 1UD1A 1KFXL 1HX6A 4WBBA 2O1QA 4HMZA 2XGXA 3VDDA 1YIFA 4Q4Y3 2A69D 2PVXA 1ZZBA 3MIFA 1X82A 1VBD3 2WA3A 4CDXB 5JSRA 3WW3A 4ASMB 4M0NA 1BBT1 5BNPB 4GMP1 1AYM1 4JDOA 5CFCA 4OI4A 4K7JA 4CRQA 1X36A 4CEWB 3DUIA 4XFHA 2B46X 2BFUL 1H1MA 7RXNA 3G7DA 2IC1A 2MHFA 4WM7A 2ZPXA 1R1ZA 3FZ3A 1HDKA 4DY3A 4K20A 3AZYA 2UYBA 3AXEA 4FPGA 1BCXA 4MSVA 3EQEA 3LNLA 2PA7A 5T5LA 4QXKA 2RJKA 2RM22 2ET7A 3QLQA 1O4YA 1WBFA 2IZWA 3VBRB 4EROA 2VNRA 3RG0A 4Q4V2 5AN9H 2AENA 4TZDA 2RR11 3R0RA 3HMYA 1DQ5A 4QPGB 5IK7A 5GJ6A 4ZU7A 1ZZ9A 1EV13 1LHUA 1CADA 4YFZA 2GU9A 1IS3A 3LCPA 3NVCA 4HETA 1U5IA 4H14A 1RUJ2 1CPMA 2E9QA 4HKLA 3SH4A 3MIDA 4FPYA 4K3UA 2GMMA 1HRV2 4HK9A 2PPTA 1MQTA 3ASIA 5JAXA 4XFAA 2Q8OA 1BFYA 3B0AB 3W58A 1A8DA 3WP3A 1PM7A 2GNTA 3NV2A 4QQLA 5EYXA 4JRLA 4NHKA 1H0BA 3VBHB 4FAGA 4JRAA 3ZYJB 4OHYA 1HRI2 5DUVA 2HWC1 1ZA4A 4Y1YA 1AR72 4AEJA 3N36A 1RUH2 4PDWA 4Q4W3 2AGSA 1QJY2 1UW8A 2ZGPA 1COV3 1H2NA 3JU9A 2ZZJA 3AP6A 2CV6A 2WNVB 3S7EA 4I2OA 1WCDJ 4GALA 5FLHA 5CB7A 2YUEA 1QQP1 3BU7A 4LLOA 5I8TA 4AGGA 1UZZA 1GICA 1QJY1 4OUMA 1RUG3 5JVG1 2A6VA 3BALA 1TMF2 2UURA 3K51A 2CKCA 3ENRA 4JAGA 4YW3A 1ULFA 1VR3A 3AB0A 1GZWA 4XFIA 3HQXA 4HVOA 2J9UB 3PLQA 1PO21 2XVLA 4P14A 5A3LA 1HQLA 2PFWA 3I8TA 4P9XA 2E53A 2X29A 1VIWB 4KH9A 1CAXA 1IHMA 3WP6A 4Y24A 3W9AA 2JG9C 3JCIA 1BEV2 3E6BA 3C2UA 5JVVA 1BZWA 2EIGA 4XQ4A 5KBFA 3B7MA 1AR61 1R0GA 2BWAA 3P3NA 2Q1ZB 4M3CF 1S0DA 2FHRA 5FPZA 1D2SA 4FPCA 1VAKA 1LEMA 1Q43A 1QJX1 2HYKA 1FI2A 3QVDA 2C6BA 3IPVA 3LPEB 2BNNA 5KWRA 1OKQA 5I8SA 4BLIA 1JUIA 4P5HA 4RD7A 2GAUA 4CDXA 1OHFA 4XHXA 2EXIA 2VUAA 5FO7B 4AEDC 5AVAA 1X8MA 3P8BA 2GN7A 1BQ9A 3GZUC 5JIAA 1LHWA 4GWMA 4Y1XA 3I59B 1NE4A 2ZTNA 3RJRA 2BBVA 3MF6A 2BTVC 2ATFA 1RINA 1VBC3 1FHHA 1REFA 3ZPYA 3VL9A 2WT0A 2R042 3NV4A 4XFFA 4YVSB 1AL23 1QOSA 4J6GA 2BVVA 2ZOEB 1O3TA 2QDRA 4AVBA 3E5XA 5C9AC 4JVAA 4IV1C 2XKPA 3KT7A 1AR83 3USSA 4JDNA 2B5ID 3PJYA 4HKOA 3IT8A 1AX2A 1NA1A 2G4IA 5FQ0B 3SMHA 1POV3 4YVWC 2GN3A 3R4SA 4N53C 4EWAA 1DQ6A 2W08A 2R0FA 1MACA 5EYYA 1RMU2 3KMHA 3SCHA 1RUE3 1T9QA 3H8UA 2PHTA 1J3RA 3IU3I 4NR1A 2CGPA 2BYVE 4B7KA 1UN1A 3RJ2X 5T3NA 5JSOA 5MFZA 1VBA2 4HKWA 1G7YA 3KCXA 3S6PA 1RMU1 2UWAA 3TN91 3U11A 1ZBA1 4CEYC 3D0SA 4S2GA 4P9LA 2UWBA 1PO11 1SEFA 4LUKA 3ELNA 2FBEA 5FREA 1GKBA 1C09A 1ONAA 2LM3A 1W6QB 3ZFFA 5JLVA 1YNAA 2Z2SB 3K48A 2EALA 5J48A 3RDIA 1LTEA 5LRRA 2VU9A 2QQPA 4RHV2 5C4WA 1FHMA 4NO4A 2UWCA 2D43A 2ZHKA 3ZIXA 2R0HA 3PTYA 3ST7A 2JD4A 1FPN2 5KHIA 4HL0A 1A6CA 4U671 5JSPA 4Y20B 2P17A 2JG9A 2VGDA 1RIRA 4BPZA 3R6SA 1PZ8A 3B02A 2OUJA 4WV8A 4POFA 1YV1A 3JD72 2RS52 3H7YA 2VNOA 1D4M3 1V9U3 3OGJA 4FVVA 3ROUA 5GZEA 1FV3A 2IFWA 1SCRA 2A3XA 3S7IA 4B7EA 1FX5A 2HEYF 3O14A 1TME2 2WSVA 4M00A 4MXVA 2DUOA 4WM8B 1VALA 2A3WA 1Z7S3 5ACA2 4YZ3A 2WQZC 5DUUA 3MZHA 3RYGA 2K2SA 3LOIA 4DPNA 1QHDA 2RS33 2XJUA 1RUC1 3CJIA 1SLCA 2PAEA 3ZXAC 2DFCA 1S2ZA 2VNGA 3AKTA 4AVTA 5ACA1 1PIV2 3S30A 1R0JA 3BPZA 5KXDA 4FQZA 2JG8C 2D3RA 4D7YA 4Q2FA 1B35A 1RB9A 2HWB3 3VBOC 3RYKA 2XJRA 2VW2A 1CAAA 1WGPA 4MH0E 3ZXLA 1ENXA 1XNDA 2R30A 3MIEA 3PWFA 4YZ1A 1DX8A 1VZIA 3M2MA 5J37A 2PAMA 1FMD2 1NZCA 4XFBA 1YFWA 4Q26A 1LENA 1NYWA 2WNUC 4N53A 2WZR3 1UZYA 1NCRC 1YI7A 4KWLA 1IRNA 1C8M2 1HW5A 4COUA 4S2DA 3M1HA 3ETQA 4IV3B 4Y22B 2QDNA 2WC2A 4NVPA 2A6YA 3H3UA 3PVEA 5CG8A 4DY5A 2LUWA 1LOCA 5FLIA 3CLPA 1W39A 1RUI2 2ZMLA 1KS4A 4IEPA 4QPIB 1Q8VA 3ZG6A 3VZNA 4AR5A 4Q4Y1 5IUQA 3KLSA 3EO6A 1LR5A 4N43B 3MGUA 4UY81 4Q29A 1VBD1 1RUI1 3TYJA 3VZLA 2DV9A 4INDA 5CIRA 1GSLA 4YW2A 1U5ZA 4FPKA 2B45X 4PQ9A 4AQ2A 4RS5C 2Z5WA 5K0UA 2WS92 5T5PA 3MICA 1YJLA 2KXLA 3V0AA 2Y38A 4LA3A 3BTAA 5CADA 3KM5A 3H1WA 3D6EA 3T1MA 2OYZA 4N9HA 3AXDA 5L36A 1O5UA 2V73A 5KHKA 4RR3C 3RPQA 4M3CA 1ZBE2 2VMIA 2BVBA 5HCBA 4XJUA 4XBQA 3B9CA 4Y20A 2RM23 2GDFA 1IW7D 2YGMA 1ODHA 2DCJA 2XL9A 1EV11 2PHUA 4Q4V3 4GB32 3CF6E 2FMDA 4S2HA 1VB2A 1W6PB 1WMDA 1N1YA 4XF3A 2ILMA 4ONUA 4IXLA 4RQPB 1RC6A 4EJRA 3NAPA 4YG3A 5C8WA 1T9OA 4FTEA 5GZDA 5BNNB 1RUJ3 1AX0A 4B8EA 4CDWC 1HRV3 4G3YC 1H30A 2JEMA 4BIOA 1G86A 1CAUA 1ND3B 3MDPA 4BA6A 4Q4W1 4AVCA 4LNVA 2KM2A 1COV1 3MLKA 1DZRA 1HRI3 2ARBA 4JADA 1AR73 1YXWA 1OMIA 4JGYC 1HKDA 1GLHA 1RUH3 3MW4A 4FOQA 4GH4B 3T1LA 2LCQA 1LCLA 3U07A 5FOBB 1C5IA 1RUG1 3RSJA 3UJOA 4TLFA 4OHXA 3RI8A 3QH6A 4XTPA 3DPRA 5ABJB 4IEWA 3CU7A 3OTFA 4XZPA 1MS1A 1TMF3 4ZXKA 2D6PA 3N35A 4AQTA 5LEKA 2DSXA 1CQ9A 1N1TA 1QXJA 1SLTA 1AX1A 2WIIB 4MLOA 1PGL2 3N7LA 1LODA 1JN2P 3TRSB 2NMOA 3HWJA 3LA2A 1H7VA 1UPIA 2VG9A 4XIOA 3AZXA 5H9SA 4ME3A 1CJPA 1WBLA 2W39A 1BEV3 1Y43B 3ZIWA 1SLBA 3WCSA 4EV0A 2E51A 3B5LB 1D0HA 4LBJA 1LOGA 5I0SA 4QPIA 3J4UH 3ZN5A 3WWNB 2RHPA 1GNHA 1ZVFA 1XNCA 3OCPA 4IETA 3ZFEA 3RI9A 5BYNA 3MLJA 4E4SA 3VUOA 3JQWA 4AFDA 2B7YA 4KNCA 2GC1A 5I0TA 2CWSA 5MFPA 3ZSKA 3HD8B 2F4PA 4HK8A 3USUB 3WDVA 5F6KA 1VBC2 3ZFGA 1KXGA 1RDVA 2WINB 2DCZA 3VBUB 2WQ4A 3BOPA 3HT1A 3J26N 5BUVA 4F8AA 1CAWA 1H4GA 2QCSB 3OBRA 4F3JA 1VBC1 2ZX4A 5AFEA 3FBYA 2ZGOA 4CDUC 4PIYA 2HEWF 5KXCA 4I02A 1AL21 1S0JA 2IXHA 4AHWA 2O5JD 2OZ6A 1DHKB 5JI7A 4RFT0 2DYCA 1S0GA 2Y0IA 1GBGA 5GZCA 1AR81 2HJIA 4YG0A 5KC5A 1PGW1 2R043 3FX3A 2KA3A 1KDKA 1OOPA 2Q4SA 2A75A 3E5QA 4TVMA 3POYA 4MUVA 3GALA 4V1PA 2WSUA 5A3MA 1POV1 4Z82A 5A33B 4B3NA 4RGGA 1UU5A 1RUE1 3PVBB 2GH2A 1YUDA 4JQRA 1WW4A 5I0UA 3KYUA 3VDDB 3E6DA 4BM8A 2XVKA 4LBQD 1NCQC 4XILA 1KJRA 1VBA3 3ZDSA 4G6BA 2C9AA 5C8CA 3M3IA 5CFCB 5EXOA 4TWTA 3WDTA 4NHMA 4HN1A 2VOKA 2PSMC 1F5FA 4YWLA 4JAAA 4WM7B 2ZA9A 4E2GA 2Z79A 1CGPA 4W6XA 5JZGA 1RUOA 1RL3A 1GQGA 3ZSLA 4QU2A 3PVNA 1QU0A 4IQPA 4QD2A 3J9SA 2FQPA 2W68A 2QL0A 3AKQA 5FBZA 1N3PA 3LB9A 4RHV3 3U4XA 1MVEA 4BH9A 2A6XA 4R4XA 5BNOA 1PK6C 1PVXA 1MS0A 2NZ9A 1K5MC 1D4M2 5GLZA 1HLCA 1FAYA 1QNWA 1FPN3 1VZHA 2VW1A 3SH5A 3KYYA 3NKGA 4AFMA 1BXHA 4AYUA 2DVAA 3VKFC 2VMHA 3ZXJA 1D4M1 4QPYA 3A0KA 1V9U1 1MQTB 1HIXA 3UV9A 3JD73 2RS53 4OI1A 2A73B 1H2LA 2RS32 5BPXA 3V64A 3GYDA 4GS7D 1Z7S1 4LHNA 1G9CA 1H1IA 2BUKA 4PDWB 3KT4A 3N7JA 2Z69A 5DG2A 1W6NA 3H50A 4N7UA 3T2TA 1S0FA 1TME3 2AH2A 2QVSB 2RS31 4B4QA 3BOWA 4FOYA 4WZCA 1LTLA 4C91A 2GC2A 4HBNA 3WCRA 3PIP1 1MEC2 1WD3A 5FFOC 3PMSA 2XJSA 1R0HA 2HWB1 3SCFA 3GZAA 3POWA 1ND2A 1PIV3 3DGTA 4MYEA 3ZO0B 4YGCA 3NL1A 4OI0A 4META 4FXKB 3ZYIB 4AF9A 1GZWB 1FNZA 2WZR2 4ISRA 1JW6A 4QX5A 2O8QA 4AWDA 4WVZA 3V0BA 1ULDA 3AMNA 1I5ZA 5AVPA 5KC6A 2PHRA 2PLV2 4ES9A 1CAXB 1E8JA 2VOWA 1FMD3 2WZR1 4F83A 2X5IA 2IXLA 5FLJA 1MS3A 5H9PA 2VOXA 2JECA 1GZCA 1I3HA 3Q9OA 3FWEA 1VBE2 3NSTA 1HV0A 2CY6A 1C8M3 4KQ7A 4PLNA 5JI9A 4I30A 4ITCA 1RUD2 5DM61 1OPMA 4AXOA 1IS5A 3IPVB 4LR4A 5JWPA 1SQ4A 4AGVA 3AMMA 1RUI3 2ERSA 1OFSA 2AYJA 1FATA 1F5JA 3VBSC 3VZJA 5CFDC 3K35A 1R082 1B09A 3R4DB 1YCIA 2ZS6B 3ZXDA 4AI3A 4XFGA 1YK4A 1BVVA 2ZGLA 1VP6A 5HBAA 1WW7A 1AJOA 1H8TC 4Z2WA 2WS93 4DRVA 5L7OA 1TEIA 5DUWA 5SV8A 4OFGA 3L2HA 4PLOA 3WLUA 2DCKA 3I54A 1NA1B 4HSJA 4YZ2A 2RM21 2WWSA 5D8AC 1ZBE3 1N1VA 2TUNA 2OVUA 2R6QA 2WL1A 3RZZA 4Q4V1 5T5JA 5BNPC 1FXZA 1TQ5A 3AZZA 4LBNA 1LESA 3MFCA 2IXKA 1NLRA 4CEWC 3FUOA 4L8QA 3AJZA 3SISA 2ZGQA 4GB33 3D82A 4Q0PA 4MGKE 1RUJ1 3B9IA 2VOVA 1HRV1 3EXUA 1OI6A 4Q8KA 4LO4B 1XYNA 3VBRC 3WHUA 3ZFFB 4YGDA 3KCYA 2GH8A 3RNSA 2ZHMA 1RHI3 1HRI1 4XXPA 1J3PA 4IESA 3A44A 5C4WB 2XBO2 1AR71 4QPGC 1G6NA 1RUH1 3NV3A 3WQ0A 1DGRN 4W6YA 5E1RA 4XHBA 1O5LA 2P3JA 5FPXA 4P9GA 2QJVA 3LA7A 4G4FA 1KDMA 4I0AA 1AZDA 1IU6A 1ZNPA 4YGBA 5CU1A 1G9AA 2D6LX 1ENRA 4D3WA 5JCTA 1TMF1 1SCSA 4DMIA 2JG9B 4FT8A 3NWKA 3VBFA 3VZKA 3VBHC