2XJSA

X-ray structure of the n-terminal domain of the flocculin flo5 from saccharomyces cerevisiae in complex with calcium and a1,2-mannobiose
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
258
structure length
258
Chain Sequence
GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Flocculin-Mediated Social Behavior in Yeast
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell adhesion
molecule keywords FLOCCULATION PROTEIN FLO5
total genus 61
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2010-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2xjsA02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2xjsA01
2XJRA 4A3XA 4COVA 5A3MA 2XJTA 4AI3A 4AF9A 4AFBA 4AHWA 2XJSA 4COUA 4CP0A 4LHKA 4AFCA 2XJUA 4AHYA 2XJPA 4ASLA 4D3WA 4COYA 4AHXA 4AFAA 4CP1A 4AHZA 2XJQA 4LHNA 2XJVA 4LHLA 4COWA 4AI2A 5A3LA 4GQ7A 4AI1A 4AI0A 4COZA 4CP2A
chains in the Genus database with same CATH superfamily
1MS0A 2O1QA 1S2KA 4Q4V1 2VOKA 4DZGA 3J8F3 1W6OB 4M0HA 3T0AA 1IW7D 2IXHA 3K2OA 1FNYA 2HWF2 3VDDB 1RB8G 4A3LL 2Y64A 2JXAA 4IW3A 1DCSA 3RQ0A 2BQPA 1URXA 3B69A 1ND2C 2XDVA 4ZXEA 3ZR6A 1PFVA 1ZZ8A 2R043 4IV1A 3NV3A 5FMBA 4Y1UA 2XJQA 4QD2A 4B8CD 4AW7A 2A3WA 3HOUL 2A6YA 5CKMA 4ET7A 3KYUA 1UQXA 2Q5TA 1IU5A 3B9IA 4MGTA 3R4UA 4BE3A 5I8SA 1Y9MA 5GZEA 5K0UA 2WYSA 2ZX1A 2GZWA 1KJLA 2QZ2A 3CJXA 4PDWC 4XXAA 4LO5B 5IP7L 1EPZA 3GBWA 5CADA 1RUJ3 4A3IL 3CLPA 4LKFA 3VHOA 3USSA 4BQ5A 5FZGA 3GTLL 3FZ3A 3WNNA 5C8CA 2PHLA 1UOJA 1UD1A 2VH9A 5EYYA 1LHVA 2ZGTA 5E88A 5CZKA 3POBA 1KXGA 3WZ1A 3H42B 1ULFA 3PWFA 5E6HA 5FUPA 1H1AA 4LO4B 5J36A 2QE3A 3KLSA 1VBB2 3RZOL 3NKTA 1L7QA 1OLME 5J98B 2FDHA 5J96B 1F15A 1NZCA 2NN8A 3ZG6A 4GQ7A 3E97A 3IM0A 2VPVA 3AZWA 2E6VA 2QCSB 1RUD2 1WGPA 2YUEA 5F5AA 3UNPA 3KS7A 1HQLA 1CAUA 1YV1A 1PZ8A 2JIJA 4S2DA 5JR7B 1QXPA 2JICA 4JKMA 4YG3A 3GCWA 4AFMA 4BQ2A 2WO2A 1LODA 1RUE3 2UY8A 2QQNA 4Q4V2 5HCAA 1V6LA 2CHHA 4YWMA 1N3QA 4OI4A 2PQQA 3ZXAC 2YDEA 5FP9A 4C8DA 1US2A 1HB2A 4O7XA 3AM2A 3RZTA 4U2AA 4BISA 3IDCB 2FQPA 2ZS6B 1ND3C 3OGVA 5L36A 2BJSA 1ZRCA 5H9QA 2ZHMA 2VZ3A 4QPGA 1RUE2 1GQGA 1P8JA 2DBNA 3VZOA 4YZ5A 1BEV3 4G6BA 5DG1A 2GMMA 3WSOA 1UO9A 2DYCA 3J9SA 3B00A 5DDJ2 4JQTA 3ASIA 2JI3A 1LJ7A 2IXKA 1WMXA 4AAPA 3HVDA 3DEMA 4P08A 2CGPA 4DXRA 2W08A 1D7PM 3OPTA 1TWAL 3HN1A 3V64A 5KBFA 2YG0A 1UKGA 1VZGA 1PVC2 2VBBA 2DVAA 3U78A 2WLQA 1HIXA 1XB9A 1LAJA 1QDOA 3VBFC 4BZ4A 1BE7A 3UGGA 4AG4A 1CONA 4I0BA 2C6SA 3GHMA 5L9RA 1IS4A 1IGOA 3CKHA 1B35B 3PMEA 4WM7B 3VBUB 2VW2A 3B0AB 5IYYA 5GAGc 2DUPA 4WZFA 5FZ3A 5FYZA 1X33A 2JB4A 3OPZA 5IHRA 4BH9A 5FY4A 4N53A 3LB9A 1BYHA 3LWQB 3E1F1 4O65A 5ISLA 1TMF2 1JUHA 1ENRA 4XZPA 5LBBA 4BQYA 5BYNA 1WMEA 1F5JA 2HWC3 1W6QB 3PUSA 3ZPYA 4CCNA 4AVTA 5JUVA 4QPWA 3CEWA 4CEYA 2M4VA 3PIO1 3ZYBA 2ZMKA 4AE2A 1UIJA 1NA1B 1AR73 3FJSA 3TAYA 4Q8LA 1X9PA 3N3HA 4HL0A 4CYDA 1NG0A 3ACLA 4HN0A 4GXLA 4LQRA 4N9HA 4JGZB 3USUA 3I3MA 4ZU7A 1N1SA 2D6KA 1F4AA 4AHZA 1RUH2 1W9FA 4EN9B 4ZPIA 4DRVA 1HDKA 5KR7A 5LY2A 2BYVE 3PDQA 5DZGA 5DAXA 4YZ4A 4CEWA 1H6YA 3BTYA 4LLOA 3ZMNA 4BXXL 1WLWA 4A41A 1KJRA 2QJVA 5DAPA 2C0ZA 2VUDA 5K8SA 1S30A 1SLBA 2QBXA 1VALA 2ENRA 1WCUA 3T08A 4JAAA 5EJZB 2Y26A 1RUH3 3MF6A 3RWNA 1NY72 2CAUA 2WNUC 1MEC2 3MEPA 3KCYA 4PIYA 4LBOA 4M3CE 1XNCA 4OLLA 5DAVA 2JG9A 2GNMA 3V0BA 4XMIA 2VQAA 3O1TA 2XLAA 3HJYB 3E5XA 4YW7A 2W9XA 4J6GA 2FDKA 1SMUA 3K4AA 2P6HA 4Y22B 1H8TA 3AZZA 4FTEA 3N9OA 2Z4FA 4DS0A 4FFGA 3OUIA 4Q1PA 2MEV3 5JZGB 1QQP3 1JI6A 1Y1WL 1S55A 2DVFA 4QMAA 1FPN1 2DFCA 1KFUL 4OHZA 2JD4A 4LR4A 3R4DB 2ZGUA 4Q29A 1POV1 4F7ZA 4IV1C 1XNAA 4QHZA 2M6PA 4AL9A 2PAMA 2HWB3 1AL0G 7RXNA 4RN5A 4ORFA 1UMHA 1OLRA 1EAH1 2HWE1 2ET1A 1MZEA 4I3PA 2FDIA 1NLSA 3ACFA 2I07B 2XH6A 5ACA3 5FYSA 2PMZP 4A3JL 3PL5A 2A73B 5CFCA 2QQMA 2YFUA 4P9WA 5F6LB 1F9KA 3UKVA 3ES1A 1CIYA 1G8WA 1SMMA 2VZVA 1Q8VA 2MHFA 1O4YA 1XYPA 5DM61 2CV6A 1ULDA 2HWD3 3CL1A 3MIDA 4YWAA 3S14L 3SMHA 5C3PA 1WCSA 3AZVA 3IN9A 3OGGA 4Z82A 4TWTA 2GNBA 4URAA 2RDSA 4AYUA 3H0OA 3OY8B 4LITA 4E4DX 1IROA 4AYBP 1CJPA 2RS53 3POEA 2Y8KA 1NE4A 3T1MA 4AEMA 4X6RB 4YNIA 1OPOA 1OH3A 2WAOA 2XONA 3DN7A 3J7HA 1EYBA 5KC6A 2VNOA 4R9AA 4XJZA 3HIFA 1VLNA 3RNSA 1ASJ2 4PQQA 4C1XA 4JGZA 4CP0A 1CN1A 1FAYA 3A0KA 4KBBA 4LA2A 5GJ6A 1PM7A 1YK5A 5CG9A 4UBGA 1A8MA 1AJKA 1QJEA 4NROA 5AC91 5J37A 2HR5A 4EE2A 1DZRA 1W2AX 1DYPA 4Q2FA 4EWAA 2G1MA 3N9LA 1I5ZA 2JD9A 2LS6A 3JBG3 4XZUG 2LUWA 1J59A 4QGLA 2FZ2A 4A3GL 1CPMA 2DCJA 2YV8A 3IMNA 5FJHA 5JVVA 3NWKA 5MF6A 3PO2L 1JOBA 1MQTA 1W2NA 2PELA 3NKGA 1RUC3 4UAPA 1BHGA 1RXFA 4HVRA 5FPLA 2Y6FA 5HCFA 1G9BA 2BW8A 5TSWA 2XJTA 5A80A 2OPKA 4CDQC 1OD3A 3LWVB 2Y34A 4P9GA 2VC9A 3T09A 2OYZA 1J3RA 1SPPA 4PI0A 5HI0A 2HVYC 1FPN2 1SLLA 1W9YA 2Q30A 2MEV1 4FI9A 2YXSA 1NY71 2D98A 3O0WA 5DM71 2R93L 3DXTA 4DPNA 2TBVA 1R0FA 4W65A 3C3VA 2J7MA 4GMP0 2PXJA 3GALA 3BOPA 4M4RA 2CDOA 2DCTA 3QD6A 4PHZA 4W6XA 1IRNA 2GMEA 2DU1A 1VBE2 2WL1A 3BYWA 1O91A 4FVVA 5EYXA 1FPN3 1QYBA 1IS6A 4A3EL 2Q8EA 4POGA 4GALA 5BXXA 3M3OA 3WUDA 1DBNA 2RMU3 4WM8A 2YC0A 4Q0VA 1RC6A 3VBOB 4Q4V3 1ND3A 2GC1A 4KWKA 4OUSA 1RUJ2 2ZGOA 2ID4A 2R041 1QHDA 5KHHA 1U5YA 2AR6A 4NE9A 2E2JL 1TVGA 1FX5A 3NNFA 3GBGA 2Y60A 5A32B 2RFKB 3LFIA 1PIV1 4JTOA 3DYPA 1RUNA 1MACA 3Q8CA 3N7LA 4P02B 3MGUA 3N9MA 4AGRA 2G9ZA 2JG8C 4EYUA 3O1RA 3WDTA 2HWD1 2W47A 4FBFA 3PJYA 1BKZA 1NZIA 2KXLA 4QPIA 2B5HA 1AX1A 2ZKNA 4OI2A 4WVZA 2JKXA 3I2KA 3O0VA 5LASA 1UW8A 1UZVA 5M3FL 1TZOA 3WCSA 4CEWC 1GOGA 1MZ6A 1ONAA 1YFYA 1J1TA 5LZ6A 5IYCL 3HAXC 1AX2A 2D40A 1LENA 3M7AA 3O7OA 3ZSJA 4BIFA 1LRHA 5L7OB 3BIEA 3OOXA 3MPBA 2R7EB 1QXRA 4WVVA 2WZR3 2E32A 5EP9A 3S5QA 2ZHNA 3WG2A 1JYWA 3GDBA 1UXZA 4BK5A 1S0IA 1ODHA 2WT2A 4KBZA 1LOFC 3FBMA 2PHDA 1RUI1 4NIAA 1W04A 5M3ML 4GJZA 2WAQP 3BVCA 3RFRA 2XMLA 2VNVA 3IZOA 5FYUA 4D6SA 2R063 3JD72 1TWGL 1RVF2 2I45A 1GZWA 1BEV2 4BQ4A 2PSMC 1DQ1A 3X29B 1Z7S2 2D6LX 4YG6A 4DXSA 1AR92 4GA9A 2A68D 2GMGA 5EINC 1W8OA 3FBYA 2JDMA 3A44A 2UU8A 1O3SA 1BBT1 2J1RA 4IEWA 1PNFA 2AACA 3DYOA 2F4LA 5FZ4A 1VMJA 3UT0A 1W0PA 3JD73 5CBLA 1V6MA 2GSYA 3T2PA 3H1MA 4PLMA 3ZXKA 3MV11 2PYTA 4YGBA 1W2TA 2W94A 4Q4Y3 4K21A 5FBJA 1JZ8A 1LB2A 5CVRA 2JDYA 3VBFB 1W2UA 1CAVB 3AP4A 4CDWC 1GR3A 1GZCA 3TRSB 3ZSEA 2E2HL 3MIBA 1W6MB 5L19A 4UOJA 1PIV2 2WINB 1QJY2 1Y3TA 5ERLA 2CL2A 1K42A 2R042 4V2WA 3K35A 3O0XA 2W3JA 4X6QB 4IETA 2VUCA 4JRLA 2XBO1 1RUD1 5J09A 4AZZA 4H3WA 4EWEA 2F4PA 3VBRC 3SCFA 2J1TA 2WSUA 2AC1A 4Y24A 1H7VA 4GMP3 3TNPB 3NO8A 3WVJA 4BDVB 2GU9A 2A6ED 4GB31 3PVNA 4L99A 1ZM1A 4Z8BA 3VUOA 2J1UA 3KQ4B 3PKJA 4GJYA 1BVP1 2QFEA 5ANNA 1H30A 5LK7B 4HOOA 4J1XA 1LKMA 3WDUA 4Q1RA 5IJRA 5FZ1A 5FYHA 2VOTA 2C1FA 3EQEA 3A4UA 2HWB2 1PMJX 4HFSA 1TWCL 3WDVA 4CU8A 1F4HA 1KS5A 4KGGA 1CZVA 1Q8QA 5IY0A 3EXUA 3TWIA 5I0SA 3PU3A 1LESA 5FPAA 4FO9A 2WQ8A 3JU9A 2ZZJA 3AYCA 1DLLA 5JOXA 4A3CL 2RVAA 4OHYA 1BQPA 1UPIA 4IGOA 1PVC1 2JKBA 2Z69A 5IVJA 5IFTA 1UY1A 3MYXA 4IV3A 5I91A 2ZXQA 3Q8AA 1RUI3 4FQZA 4NHMA 2ZBJA 4TPUA 1EP0A 2D5HA 4NRMA 3E5QA 4AOCA 4COYA 2VTXJ 1XJAA 2EAAA 4LHNA 4NPLA 3WF3A 4CDXA 2A5ZA 5FWJA 4Z92B 1OKOA 3SKVA 5HV4A 3MF9A 4AI2A 4YVWA 5FFOC 4QKBA 5C9AC 2IVIB 4H2AA 3DGTA 4WZCA 4FPEA 4OUMA 2BNNA 3FHAA 4K40A 3GHNA 3BODA 1W8ZA 3C2UA 3VBUA 4AR2A 5FZIA 2UURA 4LJHA 4FPKA 1VAVA 4BQWA 5FZ0A 3FC0A 3FWEA 3KWVA 4NAOA 4DUWA 1COV2 1H1MA 4BK4A 3PJQA 5BNOC 1VAMA 4XJAA 3JB8A 1H2NA 2XBO2 3A0NA 5DQ0A 5A3UA 3FFQA 3PUAA 3I3BA 3SLIA 2VM9A 1EAH2 1NLQA 2HWE2 2ZMNA 1KEXA 4BY7L 3D6EA 4RR3C 4UFKA 4OUEA 4QM8A 4TLFA 2ZACA 4XFBA 4LOSA 1NA1C 2JECA 2W5FA 4LIUA 4XE9A 1GWKA 1A8DA 2RDQA 2EIEA 2XR4A 4OMDA 1SZBA 2HEVF 3ZN6B 4CDQA 3ZXGA 5F37A 4XUTA 1COV3 4IE5A 5FPBA 1QQP1 1QGLA 2R0HA 2YGLA 5A7SA 4MLOA 4RS5C 4INDA 1J83A 2D5FA 5IYBL 2WQZC 4Q5OA 3S7EA 3Q9OA 1XOYA 2V5DA 4LK7A 5DXDA 5LA1A 1DYOA 3I2IA 4MHRA 2P6CA 1W6NB 1GP6A 2F6BA 2VXJA 4JCKA 1JN2P 2DCZA 2PLV1 3TBDA 3WNMA 4FXGB 1ZVFA 1PFYA 1LOAA 3QOPA 2WUHA 3IDEA 4Y26A 1XYNA 1JYXA 1VZIA 2R0FA 1GICA 3KHCA 2YPDA 4LBJA 4LE3A 1GNHA 2GN7A 3TEWA 2WS92 1XE8A 4W8JA 1NYWA 2IFRA 3ETPA 5A6YA 3VD7A 1AX0A 2VZPA 2FCUA 2RDVA 5FUNA 1LTEA 1Y4WA 4FFHA 1PHMA 3S2HL 1R083 5T5PA 2Q0AA 5A33A 4FQ4A 4FPJA 4WM8C 4LHLA 1KITA 3MI8A 4Y5Z0 3LEIA 3VHPA 4TXWA 2VULA 4CUAA 4N9IA 3FLRA 4M00A 2OUHA 5FZMA 4LNVA 2FHRA 3IBMA 4I0AA 4BY1L 4AQTA 1KDKA 3VDDC 2ARCA 5KXDA 1JZ4A 3BCWA 1K12A 1VBD2 3WD5A 3ZYRA 2L0ZA 2IWGB 2EXHA 2D6MA 1RVF1 1H8VA 1APNA 2V3BB 2BVVA 4QPYA 3MQKB 2BNMA 1QU0A 2VVEA 2XWBB 2AEZA 4COUA 1Z0HA 4CCJA 4EJRA 4EZHA 3LWOB 5LWBA 3H9AA 3UETA 5IAVA 2WO1A 3VBFA 5FZAA 4NIIA 5CG8A 3PL0A 3WXPA 1Y43B 2NZ9A 3H1YA 3BI3A 4P9XA 3VKLA 2NMOA 1JOJA 4QDRA 2A7AA 2K46A 3DKWA 3GTQL 5F3CA 2JI2A 5AI3A 4MO3M 1UY3A 1WLDA 5A7OA 4B4QA 5GLVA 1RIRA 5F3IA 1DF0A 4KGQA 5A6QA 5JR2A 3SISA 3VHNA 1AR82 3KT7A 1OFNA 2O8QA 2FDFA 5A7NA 2WA3A 3MHZA 5CFDB 5M0TA 3IAPA 2DWRA 3B01A 4FPCA 2ERFA 4RS5B 4MGIE 3O1UA 1TME3 3S1RL 3G6JB 2D3RA 3OBZA 4PBPA 1FV3A 1D2SA 4DXTA 3A21A 1DFQA 2WLPA 1T9OA 2NVTL 3MFCA 4GIQA 4HANA 5J1XA 3K4DA 2W39A 5F2SA 1LULA 5T5OA 3S57A 5FR3A 4CA9A 3MPSA 1MS1A 4ZU5A 1UY4A 4IE7A 1ULOA 4N43A 4YW1A 3LPEB 4XACA 1T6GC 1YLLA 1O3TA 5L7OA 2ZGRA 1O5LA 2A3XA 3KV9A 4FOYA 4QQLA 1J58A 5F32A 4R9CA 5CISA 3J7Y1 3H9CA 2XL9A 3HAGA 1UZ0A 2RG4A 2JG8B 4XHBA 4W50A 1DGWX 1ZBA3 1RDGA 4B1MA 4CDUA 1C5HA 1XYOA 2HEYF 3PIJA 4B1LA 2NP0A 3VBSA 4FCAA 5GLUA 1ZZ9A 3H7JA 3T30A 3AX4A 1C8NA 1GKBA 3S7IA 1ZBE3 3EB7A 2CY6A 4PI2A 4OQ9A 5FY9A 2E63A 2KA3A 1S0DA 2XWJB 3IMMA 3RI8A 1W9TA 1N3PA 1EV12 1HW5A 5JXGA 1O3QA 1QNWA 3OGJA 3MLJA 5LK5A 5J7MA 2CGOA 5EQUA 5I93A 4NPRA 4YM0A 1PIV3 3MW2A 3VL8A 2DTYA 5C70A 1VBA3 3LA2A 5IATA 3OD4A 1R081 1CR7A 2X5IA 3MLKA 4HKOA 2H6BA 4RQPA 3RZKA 1W0NA 4R9DA 3WP6A 1TE1B 1PX3A 1EPWA 4COVA 4PT6A 5D8AB 3BOWA 2V72A 1JU3A 1Z7S3 2SBAA 4WFN1 3JCIA 4PIXA 1CAVA 4QKNA 4ZONA 1OVPA 3AP7A 3MIGA 3DL3A 1SDWA 4CCOA 1NXGA 2C5DA 1REEA 2BGCA 1NLRA 3OEAA 1ULEA 3U07A 1ST8A 1MS9A 3CZJA 4IEZA 4E4ZA 1WCML 2L9LA 2QUOA 2Y38A 2Y6HA 3KV4A 2UWBA 3RYPA 4BM8A 1BFYA 5JLVA 3PLQA 3AXDA 3BKZA 5FJKA 1VPHA 2E31A 4X8NA 3HD8B 2ZJCA 3O14A 4NHYA 3NW4A 2UY9A 2X8KA 4O9EA 5FMOL 1LHUA 4RR3A 3HOVL 1HRI1 1ODMA 5BNNC 1RJ7A 1E5IA 2XLFA 4IE4A 4K6BA 4XJUA 4Z07A 4YVSC 4BQ1A 1PVXA 1AL23 4IV3C 4XGHA 2ZX2A 5JOYA 2VL4A 2HEWF 5FXZA 3GTKL 4AFBA 2GAUA 2A6XA 1VRBA 2RM22 1OWBA 8RXNA 3I3DA 2QZ3A 4YVWC 2D43A 3NMBA 3VN4A 4D7SA 3BTZA 3AP6A 3UKTA 3ZYJB 3WEZA 2VOVA 1G9CA 3HOBA 4BYYA 5LATA 4H7LA 5HCHA 5AI2A 2FZ1A 2RMU2 3I7DA 4YM2A 4UFMA 3WW2A 4BMEA 5FQ0A 2RDRA 4S2FA 5JZGA 5FMDA 5FO9B 4G9SB 1XBFA 1UYPA 3P5BA 4AQSA 1RUG2 4FOWA 3QQCE 5EWSA 3H8OA 4ARXA 3T4HB 4B4RA 3W21A 5JOWA 1W9SA 1YQ6A 1UAIA 1Q5OA 3M3IA 4M3CF 3HNYM 1VAKA 2XLGA 1X50A 2E53A 2BFUS 3JQWA 3DPRA 3ON7A 3QACA 2YBKA 3QH6A 4NOTA 5L9BA 3UK9A 3TN93 5LA0A 1ULCA 3HBKA 3WNKA 3GNEA 5FXWA 1SFOL 3LPFA 3OGRA 3K75B 2WNUB 3LEGA 4OHXA 2D97A 1VMHA 4K1ZA 4W6WA 5F5CA 3VDDA 5F9TA 3WDYA 5JCTA 3W5MA 4A7YA 2BERA 4BXSV 3WNOA 4GMP1 5IUQA 1CD3G 2D7FA 3HJRA 1MR5A 4FPFA 4IV1B 4KU7A 5IK5A 5D1IA 1XE7A 2WWUA 3HKZP 3LDBA 4X8PA 5C4JL 4QGNA 3RZLA 5DAWA 4XDOA 4IERA 3U75A 3BU7A 1SLAA 2FMYA 2VVDA 3A22A 5APAA 1AF9A 5EV7A 1TG7A 4LUKA 3WUCA 4AVVA 1DYKA 3L9JT 4QX1A 4MXWA 3P1IA 5A1AA 1ZRDA 1XE0A 3ZXDA 5JPNB 3RMYA 1ENXA 3G7DA 2RJ2A 2X10A 2ES3A 3ETQA 5C4WC 1UNBA 4LIVA 4HVOA 5FYCA 5LY1A 2J9UB 4TVMA 4BLJA 5T5LA 3CIHA 2W1UA 2CWSA 4Y22A 5DPNA 1Q43A 2NYDA 1VMFA 4RR3B 1F35A 2VOXA 2EALA 4CSWA 2P1BA 1HRI3 5E1RA 2LW8A 1CWPA 3H3ZA 1JBCA 2QQJA 4YG0A 4QPIC 1RXGA 3AP9A 5DDJ3 5C3QA 4DEVA 1DX8A 3H97A 2PMWB 5FWEA 3N4MA 3PVEA 1HXS1 5LB6A 3RI9A 2PTMA 2VG9A 1WLTA 4N53C 1FYUA 1HRV3 3WNPA 2UYBA 1QOSA 4XMAA 2WZEA 1O59A 4QM9A 2XHNA 5A6XA 2RS13 1OQDA 4IE0A 4RXNA 2GC2A 5E89A 2VW1A 5JI9A 1BRFA 3ZO0B 2DDUA 2ETEA 2JI1A 1QKQA 2CKCA 1PX4A 3AMQA 4MX3A 5T50A 3THPA 4R4XA 1J3PA 4CDQB 2WRAA 2NQYA 1ZZCA 2UWAA 4RL7A 5F2WA 2VZUA 4EV0A 2HYKA 2XJRA 1O4ZA 2WA4A 4XIKA 1MEC3 1QCVA 1V0AA 2VD7A 5DN2A 4E27A 1ND2B 1W6PA 3FHIB 3PUHA 4LKEA 5F8PA 3N36A 4PIZA 3TEXA 5DMYA 2H6CA 2RE9A 1RHI1 2VNGA 1KS4A 2YU1A 2EXJA 1OOPC 2Q8OA 5FK8A 4EROA 3OBAA 1R64A 2AYHA 1O5UA 4UY81 3FHQA 4AFAA 4Y33A 4QAWA 2A75A 4YGEA 4FTBA 4JAGA 1CVNA 2YC2A 5FP8A 1VRH2 1M06G 2P3YA 3IWZA 1RYQA 1H2MA 1ULGA 1CAUB 1YQ8A 2BUKA 3RRDA 3VBHC 1C1LA 1RL3A 2ORXA 3PTRB 3RWKX 2KKDA 2W91A 4SBVA 3VBOC 5GLTA 1IQAA 2BFUL 2WFF2 2VBDA 1OWCA 1S2BA 2I2SA 4RGGA 3H50A 4FPGA 1R1A2 1IG3A 1AYN3 4E2GA 3IIIA 3WQ7A 2NVYL 2Z3QB 2EY4E 1JS9A 2Y6JA 1JYTA 1OHFA 4ZZ8A 3HJWB 2WO3A 1KQRA 4IEPA 3WOGA 4P14A 3KT1A 1COV1 2HWD2 4XFHA 3ILRA 3AVSA 4H7MA 2RR13 1I1EA 2R061 5C8CB 4P9IA 1AHSA 5C5UA 1H4HA 1VBA2 3AJZA 4XW3A 5GZDA 4GS7D 2W1WA 3ZX7A 4Q26A 1PGL1 2APOB 1AZDA 1CZTA 1H9PA 1UWWA 4FP2A 2WT1A 1HB4A 4HKLA 4LOTA 2RS52 3RYKA 4CTEA 5IK8A 1UX6A 3AFKA 3HQUA 3NNLA 4NIHA 4O9GA 2B5ID 4WVWA 3WQBA 3RJRA 2WZPP 2VCMA 1JTZX 5IYDL 1K5JA 2Z42A 3POIA 3ST7A 4BPZA 2CWMA 1EY2A 1K3IA 2QQVA 2JA6L 2WKKA 1NAEA 3KYVA 1SBDA 2DU0A 2YMZA 4MH0E 1PK6C 4PF1A 5FP4A 5A3PA 1NCQB 1HXS2 3A23A 5IP9L 4IEOA 3AZXA 1W99A 3E6DA 3I97A 5G04L 4Z2WA 3O1PA 2C9KA 4EQVA 1WD3A 2V4VA 3ZSKA 4D94A 3WDWA 3AK0A 1VB2A 5HV0A 5FZLA 5A3NA 4OI0A 5BNPB 1DGLA 3AFGA 4B3NA 6RXNA 1I3QL 1QNYA 1O6UA 4CCKA 2AREA 2RS31 1WD4A 2NMNA 3LPGA 5FYYA 5CKNA 3WWLA 5F7UA 3WWNB 3ZSLA 1CX4A 3JR7A 4Q4W3 3M8LA 3CMGA 5DZFA 4JGYA 2FD8A 5FLHA 4FPLA 4JAFA 4ISQA 4Y20A 5D8AC 3OD0A 3C7GA 1ZA4A 4JVAA 1YJLA 1POV0 4CPBD 5BNOA 5JZGC 3NV2A 1B35C 4WM7C 1JXNA 1FI2A 5C44L 1MZ5A 1R1ZA 1AR63 4IEYA 5RXNA 1QOOA 4NIDA 5H9SA 3M2MA 2I74A 2EICA 1SDDB 3D0SA 4BBSL 1WA6X 1X8MA 3DPRC 1RUF1 2ZABA 4UXAA 5F1RA 1YQCA 1LU1A 2VU9A 4XFGA 4BQXA 1VBA1 1K5MB 2OVUA 3NJYA 5C7GA 1GLHA 1QJY1 3SKJE 3V0AB 2QQPA 1S1AA 3RGBA 3IPVA 3FFZA 1Z78A 4ITCA 1OA4A 1R091 1YIFA 3AKSA 3C7EA 2NVXL 3J7NA 3MFAA 3APBA 3U1XA 2ZGQA 5BNPA 1QJU3 1WA4A 1FOD1 2XOMA 4GKXA 1XC6A 1B13A 1UCXA 2VZQA 2ZMLA 4J25A 5LBFA 2M6OA 2MS3A 1PGL2 1R0HA 4AHXA 5J3UA 2OKXA 4AQ6A 4AR3A 2VOWA 3ITQA 1LHNA 1SEFA 2GH2A 2E7TA 5JPMB 1POV3 3MIFA 1DDLA 5FZKA 5DUUA 2A71A 3GTJL 4JX0A 4JDNA 1CAAA 1YQ2A 2R30A 4W4ZA 1FHHA 1MEC1 2JB8A 5FUIA 3AP5A 3L2YA 4KU8A 5T5JA 5C4WA 1CAXA 1V6IA 3AB0A 3GTML 5GZGA 3OCPA 3IAQA 1W39A 3MICA 2A6HD 2XGXA 2AUSB 3WP5A 2V0FA 4CUBA 1AYM2 1ZZ6A 2JE7A 1HV0A 2AQCA 1LHWA 1N1YA 4HXCA 4CEYC 3S1NL 1VIWB 4PF5A 4QB1A 3WLUA 5JMOA 1OFSA 1SFNA 4ZN1B 1UYYA 1QQTA 3WHTA 3Q8FA 1RUE1 5FPXA 4CPBA 3WNXA 3LSDA 1NNQA 4IEUA 5FKCA 4ATEA 1UZWA 3N7JA 3ZN4A 5GAHc 1OVSA 1U12A 4LBNA 1REDA 3O12A 5FMCA 1JUIA 3IU3I 5M5YL 3R4SA 4QB6A 4GWJA 4UW6A 4N8MA 5FYVA 4A7KA 4AI9A 1PZXA 3LEKA 4JKKA 5LRRA 4AVAA 1O3RA 1NXEA 1Q56A 3SEPA 2YHJA 4Q4W1 1C4RA 3JQXA 4Q8KA 1OLMA 2E33A 1AYN1 3RYGA 1AXKA 2WR9A 3ACHA 3B5LB 3CJIC 1DZQA 3JZVA 3KF3A 5CYYA 2RS33 5IK7A 3O1VA 4NWWA 4YVSB 3LCPA 1G6NA 4PBOA 4DXZA 3J7Z1 3ME2A 5IAXA 1SQ4A 3NAPC 2ADDA 2WBKA 3ZYFA 4M4PA 1H8TC 2RM21 2TUNA 1KD7A 3ATGA 3KGLA 4C1WA 2VNRA 3RDIA 5FY7A 1VBE1 4L2NA 5LEKA 5GM0A 3VDCA 3ZYPA 5A32A 2ATFA 3KYXA 1Q8OA 4JQRA 2JDHA 1JHNA 3TOJA 1OKQA 2YB7A 1TQ5A 1GNZA 3BALA 3HWJA 3GTOL 1OA2A 2Y0SP 1PMIA 5FYMA 4A7ZA 1W28A 5SV8A 3VKOA 1B2JA 1W8WA 2OZJA 3ZFFA 3WT3A 1R0IA 3ZYHA 4EN8B 4Q0PA 2R16A 2P4EA 4GH4B 1RDVA 1AR93 1F2NA 4NJ4A 1TWFL 2CR8A 4LBKA 4FP3A 4HVQA 3OY8A 4HG6B 1O8SA 1SLTA 4ZS3A 3EMRA 2OPWA 2WNVC 4QQ2A 1MVEA 4Q0UA 3KHBA 2DBIA 1XU1A 5DAQA 2P2KA 2Z2SB 4NHLA 1JYVA 1U5XA 1OXCA 3IPVB 1EUUA 1ND2A 1NXMA 3HMYA 4HLTA 1PK6A 3RG0A 3RMXA 1CGPA 3N35A 3WCRA 3KT4A 2FCVA 3LSEA 5K9YA 4E8CA 4QX2A 1YFXA 2VO5A 4FT8A 4UW5A 1R9TL 2X09A 1FHMA 2ZGNA 3VZNA 4ZKTB 3AMHA 5L7OC 1ALYA 1GBGA 1D0HA 5FZ9A 3N9NA 5BUVA 3RJ2X 5DDJ1 1QJZA 4BIOA 5C8WA 5IVEA 1I3HA 1POQA 4IL7A 4I09A 2JE8A 3I59A 1W03A 4FFFA 4A3KL 1OPMA 1T2XA 1MS3A 2B42B 2VGDA 2ZGSA 5FLJA 3VL9A 2KN9A 1YXWA 3QBQA 1BMV1 4AI8A 4JGYC 3LGRA 3VB9A 1XNKA 3PTYA 1F4LA 4IEXA 4LO7A 4DOUA 5CFDC 1K45A 1IPSA 2XXZA 1UXXX 3V0AA 2W1SA 3LKJA 1N1VA 1SMVA 1S0FA 1C28A 1UZZA 4XJ9A 3RVHA 2O0OA 5H1Sc 3VBSB 4YVSA 5FIXA 3WF1A 4J1WA 3CNAA 3CBNA 1ODNA 3IIAA 4QX8A 3FX3A 1AR81 1E57A 3MIHA 2LRPA 4XURA 1ZZBA 4EZ4A 2Y6GA 3CQZL 1JOPA 4IEVA 4TZDA 4PJYA 3WV6A 4E9KA 1DHKB 2DSXA 3J4UH 1YRZA 1AYN2 4JC1A 3POWA 1GFF2 5LEJA 1UU4A 2QDRA 3D5OA 3VD5A 4EN0A 2R071 5DUVA 3GBFA 4Q0SA 5FP3A 4CXYA 2ZX4A 4JHZA 1WJVA 2EXIA 2JDUA 3AMNA 2B9VA 2XUMA 4AVCA 1RGSA 5JVH1 3ZXLA 1JZ6A 2PHXA 1NA1A 1ASJ3 2AUYA 4G3YC 1PGSA 2YYOA 4ZU4A 5LBCA 4CEWB 5C8CC 4LULA 5J48A 3BIWE 5K4LA 3WG1A 2VCBA 4CCDA 4AEDA 1REFA 3LWRB 2RS51 4P9YA 2JDZA 3E6CC 4A2UA 4C0HA 3QVDA 2WABA 3EBRA 5FZ6A 4XUOA 3MIEA 3GZAA 4DNYA 1DIWA 3BTAA 3VHRA 3LDRA 2HWF1 4LPLA 3I2JA 4P5YA 4D3WA 4YW2A 3OBTA 4BWOA 5MGNA 4R9BA 4AEJA 2A6VA 2IXIA 3KM5A 5DUWA 3THTA 4C91A 4LBMA 2EXKA 1G86A 3A7QA 3PU8A 4Q4Y1 4XF0A 2P3KA 1EV11 1HRV2 3P3PA 5LBEA 5KHKA 1S4CA 1DQ5A 1X7NA 2E9QA 1QWRA 5FPZA 1B71A 1VZHA 1I6XA 1AL21 4Q0QA 2YC4A 4KWLA 2XKOA 2P3JA 4FOQA 3S16L 1DQ6A 3OTFA 3AXEA 5I0DA 3K48A 1GU3A 4ZN3B 4L0PA 4NHXA 3ZXFA 3VDBA 4YM1A 4FAHA 1RUC1 2VCAA 1ZBA1 1YFWA 3K3OA 1WCQA 2FDJA 1A78A 2VZOA 1V6OA 1ACCA 3ZFGC 4BBRL 3BU0A 1UKRA 3IB3A 3CJIA 4C90A 1UPSA 2NM1A 4QKFA 4XF1A 4JZRA 1GOHA 1US3A 3EYPA 1N3OA 1KRIA 1VBC2 4OVEA 4RQPB 2ZEYA 1OF4A 3NAPA 4YW5A 5FPUA 2ZGLA 2WZR2 3FL7A 2J1EA 3GZEA 2C9AA 3DPRB 2CU5A 4BU2A 2J22A 5FRAA 2W95A 1KFXL 3UGFA 1J3QA 3OYWB 4AGGA 2ZX0A 2DCYA 3L2HA 1TME2 1VRH3 2PQSA 5LCWL 1BJQA 1GYKA 1HJFA 3N7MA 1WBFA 2E7AA 2R072 5JXJA 1YHFA 4XYXA 3EO6A 2XJUA 1JZ3A 1WW7A 2O14A 1N1TA 3POSA 3Q8EA 3UJOA 4ASLA 2HJIA 3WX5A 1FT9A 1ZRPA 1CIWA 3IKWA 1XNDA 3JBG1 3LOIA 2JG9C 4KQ7A 2JENA 3ZIWA 4Z2AA 1GP4A 2RDNA 2ZX3A 3MSUA 5A1FA 1OUXA 1E5SA 4RHV3 1XNTA 4JRAA 2C6AA 5JVG1 1HV1A 3R6SA 3TEZA 5JAXA 3VD4A 1ZZ7A 5BPXA 2GP3A 4ONUA 4MGYE 3CZUA 4S2GA 4LO8A 2ZGPA 3WG4A 3S1ML 2C4XA 4N43C 5BY5A 4AR6A 1OMIA 4L97A 4F83A 2GNTA 4RD7A 3VBRA 2Y0IA 1DGRN 2O8OA 2R6QA 2VECA 1D0GA 1IHMA 2AENA 5FXXA 1QMJA 4K3UA 3FUOA 1HJGA 4DY3A 2KR2A 2G19A 5ABJC 1W6NA 5IT6A 4A3BL 5M5XL 1OA3A 2RJKA 1BEV1 2W68A 4Q4X1 3NFPI 2YBPA 4NVPA 5C4XL 4K1YA 3HNMA 3NJVA 3U37A 3ZYGA 4PQ9A 4AFDA 1BMV2 4YZ1A 4WVMA 1B2OA 1W8UA 4QPGB 4XXPA 3FUQA 5A3WA 3P3NA 1HXS3 3B9CA 4COZA 5I0UA 1AVBA 1A3KA 2VUJA 3VBOA 5FOBB 1KDMA 5C3EL 4AI3A 2VMHA 2ERJA 1YQ5A 1XQNA 4HN1A 4UT5A 5CFDA 3T2TA 2QNKA 4C2M1 4B7KA 5C4WB 1AUYA 3HBZA 3ACIA 1DGRA 4Y5SA 1IS5A 3U14A 3ZDSA 3D82A 3OPWA 5EPAA 3W5NA 4I0WB 2J1AA 1BZWA 4AEKA 4A93L 1DQ0A 1TEIA 3LWPB 2QL0A 1PO11 2OS2A 3NAPB 3T0DA 4LKSA 3ZFFB 1GZ9A 1OOPA 3J7MA 4QU2A 3Q8BA 5K2ME 3O1SA 3POYA 4LBLA 4L92A 2MNGA 4UF0A 5C71A 3MW3A 2JDPA 4DUXA 1NOVA 3HN3A 2JG9B 4K7JA 4AI0A 1DVBA 2VMDA 5C9AA 3IDBB 5L9VA 1O8PA 3P2AA 4HKWA 4LLFA 1PGW1 5CFCC 4A3XA 3AKRA 3TYJA 4AF9A 2WQ4A 1U5IA 4AVSA 1M4WA 5KHIA 3FMGA 3HOWL 1RUD3 2BDRA 2ORZA 4N43B 4XF4A 3PIP1 5FYIA 5C3OA 1UF2C 2JE9A 3LDKA 1WZXA 4YGDA 1RYTA 5BV6A 3I4ML 2HH9A 1YEWA 4META 5JWPA 4JADA 4JDOA 2VY0A 4E4HA 2EIBA 1LOGA 2LALA 2PAEA 2GNDA 2BRTA 5CIRA 4BQ3A 4XF9A 3B02A 3HNBM 4FPHA 1QF3A 4BA6A 1AJOA 1C8M2 2CAVA 2TNFA 2WYFA 3B94A 3NSTA 5G05L 1VBD1 1RUG3 1SACA 2GH8A 5FZ8A 4CDXC 1QJU2 4CZSA 1RUH1 3INAA 3ZMOA 4RS5A 3CF6E 2H0BA 2VE1A 4G4FA 1MS4A 4DIQA 3FKIL 4Y1VA 1SMWA 4ASKA 2QQLA 1T6BX 5JMCA 1U5ZA 3ALQA 4XQWA 5MLC3 3SH4A 1WMFA 3KYWA 4AHWA 1AL22 4XXBB 3OUHA 2VMEA 3J26N 3NQHA 3CJIB 4CXXA 2BE5D 1Z7S1 4Q4X2 1DG6A 4IESA 5B2GB 5FO8B 1RWDA 4EN7B 4MVTA 2A1XA 1B35A 4WM7A 2C24A 2GDFA 3ZKYA 5K0UB 1YI7A 1H6XA 3GF6A 2EIGA 5AVPA 4EWDA 3SQOA 1ENQA 4WV8A 1UX7A 1W6QA 1OD5A 2LM3A 4Y5TA 4C3JL 4XAEA 4Y52L 4NWVA 1IS3A 2VMGA 3HT2A 4HT1T 4Q4X3 3WW3A 2XBO3 5FYTA 2ZAAA 1SLCA 3ZLIA 3OG2A 3AZYA 1W8FA 2XUEA 1LGCA 3M3QA 1YUDA 2DCKA 5FLIA 2OQ6A 2VMIA 4KMQA 5CNAA 4UYBA 2D6NA 1UY2A 3B08B 4E2QA 2WFF1 4FPOB 1JYIA 3QH7A 3TN92 4XILA 1JW6A 3KCXA 5FLML 4UW4A 4W6YA 4LT5A 2BBVA 4KNCA 1YI9A 3NVCA 5DUXA 4Y1YA 3M3CA 4ZXKA 3VDAA 3CDZB 4DY5A 2HWC2 2VMCA 2JX9A 5C5TA 4LEJA 5D2AA 1BQ8A 3S0MA 5MFPA 1HRI2 2JDKA 5L73A 4B29A 4I02A 5FYBA 1H0BA 1G7YA 4NAMA 4QX7A 1VBB1 3ZIXA 2DVGA 2BWAA 2Q1MA 4GWNA 1TWHL 5AFEA 3KYYA 2X53S 4YLZA 4IQPA 3U11A 2C26A 1MS8A 1NKGA 4LBQB 3NNMA 4LE4A 3FDJA 4KWUA 3MO4A 4Y4RA 1SFYA 3LA3A 2EIDA 4XJWA 3I2DA 3R0RA 3ZFEC 2F17A 3I8TA 1W9WA 3FE5A 2HBUA 4XCAA 1VCXA 2FDGA 3CHXA 5F3GA 1NX9A 4N7IA 3T1LA 5EZWA 3ZYIB 2Y0OA 1HLCA 3ELNA 5FZDA 1PK6B 2DV9A 5BNPC 4P5HA 1RUG1 1VBD3 1PMHX 2V09A 1K83L 3M70A 5F6KA 3WF0A 2VXRA 2XQXA 1JU4A 5LA2A 1I50L 4WBBA 3RZMA 4KL1A 5A7QA 1TNFA 3SNMA 4OCTA 1W2OA 3ZXJA 1SHWB 5A33B 5I0RA 1FMD2 1L7RA 1JHJA 5IVCA 4XFIA 4XBQA 3FLPA 2BU9A 4UFLA 5C3RA 2ZGKA 4QIWP 4RSUA 1UOFA 1K5MA 1PNGA 1NQDA 4LO6B 4MZUA 3VBSC 2B4KA 1QXJA 2P34A 1S0BA 3S6PA 2Q1ZB 2Q4SA 1O7FA 3M1HA 5EXOA 2QVSB 1HN0A 2QQOA 5AN9H 1VR3A 4QHOA 4SLIA 1PM4A 2IXLA 1WCDJ 3H3UA 3WY6A 4YM3A 2K9ZA 2BEOA 5F3EA 4XFAA 3O5SA 4IE6A 3OYWA 5IFPA 4RHV2 4NRQA 5HPOA 5CEHA 3LFMA 4QQOA 2VAUA 1NT0A 1RJ8A 3MZHA 1ZA7A 3OF1A 2W2IA 3ZN6A 3K46A 3U10A 5T52A 4Y1XA 4RQPC 1RUJ1 2PFWA 3DF0A 5F5QA 2BOJA 5CKQA 5CU1A 4XTPA 2DURA 3OB8A 3SH3A 3TN91 4ME3A 4DFSA 3JUUA 2TEPA 4E8DA 3PO3L 1ZYBA 3VBHA 1OH4A 4D7YA 1IPJA 5CAZA 3H9BA 3NNJA 3F95A 1GQPA 4C0BA 1TME1 2WNVA 2R073 2PHUA 2R1DA 4R4ZA 3WP4A 3GYDA 5KXEA 5GZCA 4MG2A 3HOYL 2W52A 4MGKE 2RR12 1CAXB 1F5FA 4I3GA 2UYAA 4FOVA 2J1VA 4XBLA 2IXJA 3I2OA 4QPIB 2ZOEB 3H3LA 4OFGA 1JODA 2ZZQA 3T3YA 3URFA 4D69A 4HK8A 3AJYA 1LNSA 5T3NA 3WQ1A 1VB4A 2NLRA 2V73A 4XPVA 2X29A 3ROUA 5ACA2 2CYFA 4C3IL 1G9FA 1ZBE2 1OUSA 2YPJA 2GP5A 3PIGA 3QCWA 1IZ3A 2IZWA 3WF4A 2BV4A 3GTPL 4MOAA 3UL2A 3K3NA 1MVQA 3B93A 1UYZA 4CEYB 5A3MA 2P37A 4XJ8A 2WNEA 3N9QA 3GGLA 2B63L 2X05A 1GP5A 3SCHA 3BUCA 2Z3RB 2BPA2 3POGA 1F8VA 3K4ZA 3RZZA 1S0GA 2BGPA 1RUC2 4OYUA 4FPYA 3UESA 1MS5A 4HK9A 4IGQA 3UKNA 3VZKA 1XSQA 2ZGMA 3O1MA 1WW6A 3HOZL 4LTAA 3DCQA 4NPMA 3ILFA 2VTXA 3PVOA 2VMFA 4I01A 4I30A 2RM23 4CDUB 2DF7A 2N7GA 2PVEA 4UWDA 4ASMB 1OSGA 4XDPA 4CUGA 1PO22 3GTGL 2WIIB 3ES4A 5KWRA 1R0JA 3W59A 1QOTA 3AMMA 2AEYA 2J42A 1HRV1 4BHPA 5FOJB 1DZTA 2P5BA 1GZWB 2QQUA 1Y9QA 4OULA 4UI9L 4CE8A 4YZ2A 2WT0A 2AH2A 1CQ9A 1C57A 1ZRRA 3IT8A 1V70A 2YFZA 4FSJA 2VZ1A 3K77A 4U36A 2AYJA 2VBPA 2G9GA 2OZ6A 3WHUA 2X5IB 4AR5A 1AR62 3H3VM 3VBRB 2YGMA 1DQ4A 2ZAHA 4C3HL 5FMOS 4ZZ5A 2OW4A 1IG0A 5D8AA 4ATFA 3VBHB 3M4FA 1C8M3 1I6HL 4MSVA 1PO12 4IDZA 3T2OA 1BLZA 3UV9A 1W8HA 4V2VA 2LTNA 1MQTC 1W6PB 4ZHNA 4YW4A 3E6BA 5H9PA 5A7PA 1LR5A 3S15L 4QWNA 3B3QE 2V0EA 2VQ0A 3N7KA 1S2ZA 4BMBA 4RFT0 4DEQA 5GADc 1OLQA 1VBE3 3NV4A 4GH4C 2XHKA 4P00B 3NJXA 3O1OA 2XJPA 1AXZA 2LROA 4IXLA 4UF0B 2ET7A 2PHTA 1OURA 1NUKA 4CVUA 4FAGA 2PA7A 2D3SA 4RGAA 4LXLA 2WNVB 3RZDL 2XJVA 2VQTA 2QDNA 5GKAC 1C09A 4COWA 1PFUA 2WWJA 5FDBA 1TMF3 1SBFA 3W20A 2B8MA 1SCRA 4D8MA 2B46X 3OUJA 1U0AA 5ANQA 3WINE 3I49A 3ACGA 3POJA 5GLWA 2BGOA 4N7UA 2KM2A 2WO7A 5FBZA 3JD71 3KD4A 4F8AA 5FREA 5FZEA 5FZBA 1PVC3 5IW0A 4WVMB 1W8NA 3RYRA 1AR91 2CSGA 4OI1A 1RUF2 3AC0A 3GJBA 4XIOA 3SITA 1OQEA 2ARXA 5BNOB 2NYYA 3D4KA 4A3ZA 1PO21 2VJXA 4B4PA 4QDSA 3MDPA 4AVBA 1AR61 5KHGA 4NHKA 2VW0A 4PDWB 5FZOA 2A3YA 2W1QA 2Y6KA 1UMZA 1RB9A 1WMDA 3KB5A 5EIYB 3ZFEA 5F5IA 1LCLA 3D8CA 2E26A 4K20A 2PHRA 1NCRC 1BXHA 3F2ZA 4AAXA 1YJKA 2G9FA 3LIHA 5FZCA 1JH5A 1SPPB 3ZKUA 4LMFA 3THCA 1EUTA 2W87A 1QJY3 4YGCA 4MV2A 2W46A 1PGW2 4K8FA 2OXBA 3ZPOA 4UFIA 1CJDA 1OBNA 4E2SA 1LKPA 3S17L 1GMMA 1H9WA 1X82A 2W0XA 3GCXA 2R062 3KVAA 4BXFA 1PZ7A 5FY0A 4LA3A 4CDWA 5GLZA 1XXNA 1MPXA 2B9UA 3TNQA 4GD4A 2R92L 4QXKA 4B7EA 1LOBA 2WNOA 5FY8A 2FBEA 3ZFGA 5FPVA 3WP3A 4FTSA 3OEBA 3HEIA 5C3SA 3I4NL 1K5MC 1XPWA 1VP6A 1QJFA 2QQKA 2WNUA 4QT6A 5FAXA 3AYAA 1BK0A 3H8UA 4RYDA 3AKPA 1V9U1 5JIUA 2PLV3 4N90A 3H8RA 3VKMA 2D3PA 2WFPA 5HXMA 2JA7L 1I5PA 2RS12 4YYOA 4XUPA 1IPKA 4GWIA 3NNGA 1IKQA 4K9FA 2IVJA 5JSRA 1QH7A 2C6BA 3VPBE 1Z92B 4AHYA 2D93A 2WFF3 3HT1A 3I54A 4LBQD 2CKAA 2DTWA 2HKXA 2PLV2 4QGMA 4CCMA 2PHFA 4CP1A 1S24A 2MEV2 1XU2A 3DV8A 5CA6A 3BPZA 3OSDA 5FKBA 5K0UC 1QIQA 4P9JA 3ILNA 1YUXA 1QJX3 1YYNA 2NPIA 2XPJA 2BWCA 1Q8SA 1RUI2 1SBEA 1AYM1 5FV3A 2Q8CA 3SXWA 2NVQL 3I3QA 3NRUA 3HPNA 3AVRA 2PYAA 3N9PA 5HXVA 3ZN5A 3LOBA 3WW4A 1QJU1 1W0OA 2OQ7A 2RJLA 1PFWA 2CGNA 2VR4A 4XF3A 2YU9L 1FXZA 1IU6A 1L3JA 3PVBB 1R093 2JJ6A 3ENRA 4HBNA 3GM8A 1UU6A 2R49A 4MXWB 4DRRA 4A6SA 5A3OA 2AZ5A 5K7PA 2WZR1 4QQHA 1FOD3 4YWLA 1XSRA 4U671 5EJ3A 5FO7B 4BCUA 2BNOA 2GC0A 5FXVA 3AL6A 2CDPA 4UFHA 1DQ2A 1YK4A 1R1A3 4QU1A 2IUWA 5JXIA 1P7PA 3VBUC 3K7AL 1RMU1 2SLIA 1F31A 4PDWA 2DUOA 5FZOB 5JSOA 2K0GA 2WJSA 1IKPA 4E4SA 1VJ2A 4JKLA 3ABZA 2MPFA 1GSLA 2VZSA 3USUB 3AYEA 2WN3A 4HMZA 4CP2A 1OT5A 4LKDA 3ZM8A 2B7YA 3KSCA 5GZFA 1SCSA 3KCCA 1STMA 3KV6A 3KVBA 2GN3A 4XQDA 3PUIA 3S2DL 1BBT3 2D6PA 4AFCA 3GXUA 5EHDA 4POFA 4QXCA 4NR1A 5B4NA 3V56A 3PURA 1T9PA 1NQJA 3BGAA 4O61A 2QQWA 3E5UA 5BNNA 3J8F2 2ZHLA 1GWLA 1WBLA 4CCEA 3KQRA 1OF3A 5IVFA 3PKIA 1UMIA 3HOXL 4GB32 3JBG2 4CU6A 2DVBA 4RFRB 2WS93 1WW5A 1YUZA 1D4M1 2JDNA 3MBWA 4LUMA 4XC9A 3KF5A 1G9DA 1EAH3 2HWE3 2XKPA 2YU2A 4CU9A 1R082 1D4VB 2KD7A 4HZFA 5KXBA 4A42A 1CPNA 5FZHA 2D44A 1ZBE1 3BPSA 3DYMA 3NL1A 4JTNA 5A1LA 3RS6A 2YZ4A 1XNBA 1H4GA 1E8JA 3TB0A 4GWMA 4F3JA 4XUNA 1AXYA 3B7MA 4P9LA 1JZ2A 1WLCA 4AGVA 4NIGA 1ZRIA 4OZXA 4AQ2A 1LECA 4OZOA 4ZS2A 4DQAA 4X6AL 3AKTA 3M3EA 4JAEA 2ZEXA 4Q27A 3VGIA 4QPGC 3LIGA 4D6RA 1FNZA 1PO13 4L11A 4R8HA 5HBAA 4Q4W2 5FCCA 4TTGA 4V196 1ZX5A 4AI1A 5A7WA 1J84A 3PMSA 2WC2A 4RHV1 5B4XA 3WQ0A 1WUVA 3ZR5A 4CCLA 1E5RA 4A3FL 4GKYA 4MGSA 1RMU2 4MGQA 4UBHA 1CZSA 1UOGA 1OOPB 3DXUA 4HSJA 4L9BA 5KC5A 2JA8L 4YZ3A 1CX1A 2JA5L 2EA7A 1FMD1 4IV3B 5IK4A 2H12A 4A44A 3ZVXA 1Q8PA 1AR83 1C3HA 1W3XA 5KHJA 4HSLA 5IVBA 4D6QA 1UU5A 2IFWA 3KV5A 1WKYA 3C7OA 4IGPA 1WWYA 3RZ6A 1ENSA 3AYDA 4QHBA 3V65A 2WWSA 4LORA 5LRSA 2DFBA 3ZSMA 3LF7A 2XVLA 5A3TA 1UZYA 5KXCA 4A3ML 2RR11 2WDBA 4TSVA 1UOBA 4I2OA 3R05A 2ERSA 1HB1A 1W05A 2Z5WA 2ZTNA 4HPKA 4KWJA 2E51A 1L7LA 1R1A1 1UN1A 1D2QA 3MPPG 2D6OX 4BB3A 3J7LA 3CQOA 4DO0A 1LOEA 2ADEA 4XABA 4YARA 2VTFA 5DABA 2OX0A 2YBSA 5FQ0B 4BLIA 5JDBA 1UIKA 1UYXA 2HWB1 2B45X 3THDA 1X9TA 1NCQA 3K51A 1CADA 1V6KA 1LOFA 2DVDA 2OIIA 2WAAA 3J8F1 5D21A 4CCCA 3VD3A 2XB6C 2P17A 1S0EA 2J1SA 4QX0A 4ARYA 1WW4A 4PLNA 4B8EA 2O5JD 1HN1A 2B39A 1DP0A 5FK7A 2XQRA 4CXWA 1W8TA 3EJKA 4R52A 3VKFC 2VL6A 4AWDA 4XUQA 4XQ4A 4QKDA 4JHTA 4PLOA 4RGKA 2OUJA 3VV1A 2ZIXA 1AYM3 4NUBA 5EFUA 2VUML 5T55A 1IQDC 1KGYA 1LOCA 2R1BA 2CNAA 4CDUC 3U4SA 1EV13 3VKNA 2RMU1 1C5IA 5SV5A 5C9AB 1HB3A 4FFIA 4CDXB 1A34A 1ZRFA 2A6ZA 2E2IL 1H1IA 1LHOA 3I4IA 3RZJA 2GC3A 3MUZ1 5FY5A 4D0QA 1MZFA 3T4VA 4DINB 3WW1A 2BZDA 5GAEc 1HQWA 2XG3A 1V6NA 1ND3B 3PNAA 4KG0A 3DUIA 4GULA 1RUF3 1W6OA 4IUGA 3TEYA 1TMF1 4YFZA 1LKOA 1J1LA 2X5IC 2XVGA 5E8AA 3VZJA 3HQRA 4FXKB 4M01A 3WDXA 1JYBA 4XBNA 2A69D 2RS32 1BK1A 2VZRA 4Y20B 1YNAA 2JWPA 1V6JA 1SG3A 5DZEA 1ZREA 3ZXEA 5A7WB 1ZNPA 1YWKA 1S0JA 1QY4A 2Z79A 4QX5A 4RA0A 3MV01 3OJBA 5F39A 5FY1A 4E6YA 1Y7BA 2M4YA 1NCRB 3W9AA 1JMUB 2OA2A 2XJSA 5JOZA 1BQ9A 2R7ZL 3ZFGB 1OQ1A 2HWF3 2UWCA 2PVXA 5BNQA 3IDAA 5A6ZA 5JIAA 1PO23 4LHKA 5FTTC 4BJ0A 2W92A 4TYSA 4D7TA 1B09A 4A3DL 3POFA 4N53B 4BOWA 3RZHA 4QXBA 3UGHA 4NO4A 3LZZA 1LU2A 3I2GA 4XFCA 3FLTA 1GUIA 4XTMA 3GZUC 3UJQA 2PPTA 2JDAA 1D4M3 1W06A 1QJX2 4CRQA 3FN9A 5A3LA 5AFBA 5FP7A 4A4AA 2PN5A 1GZTA 2PHWA 2OT7A 1YO8A 3JXSA 4GZ9A 3WR0A 2E7QA 3C7FA 3D0JA 3DECA 5GALA 3ZFEB 1S0CA 2ZPXA 2BBAA 1QQP2 4M3CA 4CUCA 2VVFA 5E16A 4PCRA 2ARBA 1D4M2 1LGNA 3RPQA 2ZEZA 4JGZC 3RSJA 5EJ1B 3S30A 2GMPA 2RS11 2WN2A 3AL5A 3LQCA 4Y1ZA 4AR4A 3NJZA 3VZMA 5C6CA 1YCIA 1OC1A 3MW4A 3SH5A 4MADA 2BTVC 4XAAA 1Y1VL 1VBB3 1FATA 1PZ9A 2BVBA 4TLGA 5JI7A 1E5HA 4XDQA 2ZEWA 3SHRA 4CP9A 4YPJA 1BCXA 1C1FA 2V4AA 1SFPA 1LTLA 3M3YL 4A45A 3ORJA 1CAWB 2ARAA 4MXVA 3LD8A 4L8QA 2WZ8A 3DKQA 4QQPA 4MUVA 5LA9A 4OMCA 1H2KA 1AR71 3PUQA 1GANA 1GNYA 1GWMA 1YFUA 3VZLA 1JYCA 4DB5A 5A70A 4YRDA 4URTA 5JSPA 5ABJB 2EVXA 2LCQA 4YFWA 2V5YA 1VRH1 1UL9A 1VBC1 4XFFA 3U4XA 4XVHA 4EN6B 2JG8A 3CO2A 4NMIA 3LAGA 4CP9B 3PHMA 1YIPA 1NXD1 4GB33 1N47A 1CESA 5M5WL 5MFZA 5IWFA 3I2FA 4QXHA 4A6OA 4JDMA 4YW3A 2Y6LA 2XL7A 2EAKA 5LW9A 4CDWB 3MLLA 3NV1A 4H55A 3BN6A 1QJX1 1ULPA 1HQNA 2VCCA 4MGZE 3SS2A 3KMHA 5T54A 3V0BB 3H8XA 5BNNB 1W6MA 5C33A 1WCKA 3MUY1 5AC92 4H14A 3LNLA 1H8TB 4NRPA 1LEMA 2A70A 3I2HA 1RINA 2IC1A 4AEDC 3SCGA 1UY0A 2ZA9A 2K2SA 5FZFA 2ZHKA 3LA7A 1JZ5A 4XETA 5H9RA 1GV9A 4M3CB 4YVWB 3SEEA 3LE0A 4NN0A 2WSVA 3HR9A 1RUOA 1VE0A 1NCQC 3W58A 4DUVA 1V9U3 5AC93 1QEXA 3S1QL 1LKNA 1X8EA 1SLIA 3GZTB 3OBRA 4TN7A 5I8TA 3KGZA 2K2DA 4Y3OA 5CFCB 2ZCWA 1DLCA 3RZGA 1V00A 2VQUA 1X36A 1GQHA 4CU7A 1XRUA 1RMU3 2G4IA 1H2LA 2CTVA 3C8XA 4JV4A 1RHI3 5ACA1 1HX6A 4ES9A 2YY1A 3T2QA 3U0ZA 4HONA 1V9U2 3C7HA 2Q8DA 2HLEA 1LEDA 2JEMA 1QH6A 2VZTA 3EHKA 3H7YA 3JB4C 3AMPA 3CU7A 5IVYA 1AR72 4GAZA 4QB2A 1Y9GA 3S5AA 2VUAA 4AXOA 3KZ4C 3P6BA 4Z1VA 3HQXA 2FMDA 4QDQA 4UFJA 5HCBA 1C8M1 2H0VA 2IXCA 4OQ8A 4Y7NL 2WB1P 3M4OL 2HYXA 2QTWB 4GH4A 1RHI2 3GJAA 4OHWA 4XEZA 3PZAA 2EF6A 2FCTA 4LK6A 3ZOIA 2HBTA 2P3IA 2Y33A 3ZDVA 3LEMA 3I59B 1ZBA2 4K8RB 2QKDA 4XOGA 3T0BA 4ES8A 1NCRA 2Q1FA 1JYNA 1S2EA 1G9AA 2DUQA 1RITA 2JIGA 3VLBB 4XCBA 2ZKLA 1DGWA 4MHUA 3H0GL 2GALA 5I0TA 1VBC3 4YW6A 1I9RA 4KH9A 1YC61 4HETA 3ZFFC 3ECQA 4JGYB 1OI6A 1CAWA 1IOAA 3WG3A 2YROA 3SC7X 2RV9A 4AEDB 2BOIA 4UW3A 1FV2A 1QDCA 3I3EA 3WNLA 4KG8A 3VD9A 1JZ7A 2ILMA 1NE6A 1Q3EA 1RYYA 3QLQA 3H1WA 3H99A 5IVVA 1LGBA 3P8BA 1R092 4IEQA 4Y4YA 1W3VA 3AKQA 4XHXA 1T9QA 4MYEA 1FMD3 1ASJ1 1FOD2 4AK3A 1A6CA 2QQIA 5DG2A 1MQTB 1O4TA 2A6WA 4ISRA 2R32A 3D3AA 4K9SA 4ZY9A 5CB7A 4LBQA 1TNRA 4M0NA 4KI5M 4OHVA 2HWC1 1RVF3 2AGSA 5FJ8L 3WF2A 2RHPA 5JXHA 1GOFA 1RTVA 3BTXA 4LHSA 4QX3A 4V1PA 2WS91 3BB6A 2BP6A 4HPKB 1BVVA 1DU3D 2PAKA 3LWCA 4DMIA 5AVAA 5ABJA 4S2HA 3UYJA 1BBT2 1R0GA 3OGSA 1W90A 4YSFA 2XVKA 4WM8B 5EIOC 5I8YA 1HKDA 5FZ7A 4Q4Y2
chains in the Genus database with same CATH topology
1MS0A 2O1QA 1S2KA 4Q4V1 2VOKA 4DZGA 3J8F3 1W6OB 4M0HA 1IW7D 2IXHA 1FNYA 2HWF2 3VDDB 1RB8G 2JXAA 3RQ0A 2BQPA 1URXA 3B69A 1ND2C 1ZZ8A 2R043 4IV1A 3NV3A 4Y1UA 2XJQA 4QD2A 4B8CD 4AW7A 2A3WA 2A6YA 3KYUA 2Q5TA 1IU5A 3B9IA 3R4UA 4BE3A 5I8SA 5GZEA 5K0UA 2ZX1A 2GZWA 1KJLA 2QZ2A 3CJXA 4PDWC 4XXAA 4LO5B 1EPZA 3GBWA 5CADA 1RUJ3 3CLPA 3VHOA 5C8CA 3FZ3A 2PHLA 2VH9A 1UD1A 5EYYA 1LHVA 2ZGTA 5E88A 1KXGA 3WZ1A 1ULFA 3PWFA 1H1AA 4LO4B 5J36A 2QE3A 3KLSA 1VBB2 3NKTA 5J98B 5J96B 1NZCA 2NN8A 3ZG6A 4GQ7A 3E97A 3IM0A 2VPVA 3AZWA 2E6VA 2QCSB 1RUD2 1WGPA 2YUEA 3KS7A 1HQLA 1CAUA 1YV1A 1PZ8A 5JR7B 4S2DA 1QXPA 2JICA 4YG3A 4AFMA 1LODA 1RUE3 2UY8A 4Q4V2 5HCAA 1V6LA 4YWMA 1N3QA 4OI4A 2PQQA 3ZXAC 2YDEA 3AM2A 3RZTA 4U2AA 3IDCB 2FQPA 2ZS6B 1ND3C 5L36A 1ZRCA 5H9QA 2ZHMA 4QPGA 1RUE2 1GQGA 3VZOA 4YZ5A 1BEV3 4G6BA 5DG1A 2GMMA 2DYCA 3J9SA 3B00A 5DDJ2 3ASIA 2JI3A 1LJ7A 2IXKA 2CGPA 2W08A 3HN1A 3V64A 5KBFA 1UKGA 1VZGA 1PVC2 2DVAA 2WLQA 1HIXA 1QDOA 3VBFC 4BZ4A 1BE7A 4AG4A 1CONA 4I0BA 3GHMA 1IS4A 1IGOA 1B35B 3PMEA 4WM7B 3VBUB 2VW2A 3B0AB 5GAGc 2DUPA 4WZFA 1X33A 3OPZA 4BH9A 4N53A 3LB9A 1BYHA 1TMF2 1JUHA 1ENRA 4XZPA 5BYNA 1WMEA 1F5JA 2HWC3 1W6QB 3ZPYA 4AVTA 3CEWA 4CEYA 2M4VA 3PIO1 2ZMKA 4AE2A 1UIJA 1NA1B 1AR73 3FJSA 3TAYA 4Q8LA 3N3HA 4HL0A 4CYDA 1NG0A 3ACLA 4HN0A 4GXLA 4N9HA 4JGZB 3USUA 4ZU7A 1N1SA 2D6KA 1RUH2 4AHZA 4EN9B 4DRVA 1HDKA 2BYVE 5DZGA 4CEWA 4YZ4A 4LLOA 3ZMNA 1WLWA 1KJRA 2QJVA 5K8SA 2C0ZA 1S30A 1SLBA 1VALA 2ENRA 4JAAA 2Y26A 1RUH3 3MF6A 3RWNA 1NY72 2CAUA 2WNUC 1MEC2 3MEPA 3KCYA 4PIYA 4LBOA 4M3CE 1XNCA 4OLLA 3V0BA 2JG9A 2GNMA 4XMIA 2VQAA 2XLAA 3E5XA 4J6GA 1SMUA 4Y22B 1H8TA 3AZZA 4FTEA 4DS0A 4Q1PA 2MEV3 5JZGB 1QQP3 1S55A 2DVFA 4QMAA 1FPN1 2DFCA 1KFUL 4OHZA 2JD4A 4LR4A 3R4DB 2ZGUA 4Q29A 1POV1 4F7ZA 4IV1C 2M6PA 2PAMA 2HWB3 1AL0G 7RXNA 4ORFA 1OLRA 1EAH1 2HWE1 2ET1A 1MZEA 4I3PA 1NLSA 2I07B 2XH6A 5ACA3 2A73B 5CFCA 4P9WA 5F6LB 1F9KA 3UKVA 3ES1A 1G8WA 1SMMA 2MHFA 1Q8VA 1O4YA 1XYPA 5DM61 2CV6A 1ULDA 2HWD3 3CL1A 3MIDA 3SMHA 1WCSA 3AZVA 3IN9A 3OGGA 4Z82A 4TWTA 2GNBA 4AYUA 3H0OA 3OY8B 4E4DX 1IROA 1CJPA 2RS53 1NE4A 3T1MA 4AEMA 4X6RB 4YNIA 1OPOA 3DN7A 5KC6A 1EYBA 2VNOA 4R9AA 4XJZA 3HIFA 1VLNA 3RNSA 1ASJ2 4C1XA 4CP0A 4JGZA 1CN1A 1FAYA 3A0KA 4KBBA 4LA2A 5GJ6A 1PM7A 1YK5A 5CG9A 4UBGA 1A8MA 1AJKA 5AC91 5J37A 2HR5A 1DZRA 1DYPA 4Q2FA 4EWAA 1I5ZA 3JBG3 1J59A 2LUWA 4QGLA 2FZ2A 1CPMA 2DCJA 2YV8A 3IMNA 3NWKA 5MF6A 2PELA 1MQTA 3NKGA 3ZYRA 4CP2A 1RUC3 4HVRA 5HCFA 1G9BA 2BW8A 5TSWA 2XJTA 2OPKA 4CDQC 4P9GA 2OYZA 1J3RA 5HI0A 1FPN2 1SLLA 2Q30A 2MEV1 2YXSA 1NY71 2D98A 3O0WA 5DM71 4DPNA 2TBVA 1R0FA 4W65A 3C3VA 4GMP0 3GALA 3BOPA 3QD6A 2DCTA 4W6XA 1IRNA 2GMEA 2DU1A 1VBE2 2WL1A 4FVVA 1O91A 5EYXA 1FPN3 1QYBA 1IS6A 4POGA 4GALA 5BXXA 3M3OA 3WUDA 1DBNA 2RMU3 4WM8A 2YC0A 4Q0VA 1RC6A 3VBOB 4Q4V3 1ND3A 2GC1A 4KWKA 4OUSA 1RUJ2 2ZGOA 2R041 1QHDA 5KHHA 1U5YA 2AR6A 1FX5A 3GBGA 5A32B 4JTOA 1PIV1 1RUNA 1MACA 3N7LA 3MGUA 4AGRA 2JG8C 3WDTA 2HWD1 4FBFA 3PJYA 1BKZA 4QPIA 2KXLA 2B5HA 1AX1A 2ZKNA 4OI2A 4WVZA 3O0VA 1UW8A 4CEWC 3WCSA 1MZ6A 1ONAA 1YFYA 1J1TA 3M7AA 1AX2A 2D40A 1LENA 3O7OA 3ZSJA 4BIFA 5L7OB 1LRHA 3MPBA 1QXRA 4WVVA 2WZR3 2ZHNA 3WG2A 1S0IA 1ODHA 2WT2A 1LOFC 3FBMA 2PHDA 1RUI1 2R063 3JD72 2I45A 1RVF2 1GZWA 1BEV2 2PSMC 1DQ1A 3X29B 1Z7S2 2D6LX 4YG6A 1AR92 4GA9A 2A68D 2GMGA 5EINC 3FBYA 3A44A 2UU8A 1O3SA 1BBT1 4IEWA 1PNFA 1W0PA 3JD73 5CBLA 1V6MA 2GSYA 3H1MA 4PLMA 3ZXKA 4YGBA 2PYTA 4Q4Y3 4K21A 1LB2A 5CVRA 3VBFB 1W2UA 1CAVB 3AP4A 4CDWC 1GR3A 1GZCA 3TRSB 3ZSEA 3MIBA 1W6MB 5L19A 1PIV2 2WINB 1QJY2 1Y3TA 2CL2A 2R042 3K35A 3O0XA 4X6QB 4IETA 4JRLA 2XBO1 1RUD1 5J09A 4H3WA 4EWEA 2F4PA 3VBRC 3SCFA 2WSUA 4Y24A 1H7VA 4GMP3 3TNPB 3NO8A 3WVJA 2GU9A 2A6ED 4GB31 3PVNA 4L99A 1ZM1A 4Z8BA 3VUOA 3PKJA 1BVP1 2QFEA 1H30A 5LK7B 4J1XA 1LKMA 3WDUA 4Q1RA 2C1FA 3EQEA 3A4UA 2HWB2 4HFSA 3WDVA 1KS5A 4KGGA 1Q8QA 5IY0A 3EXUA 3TWIA 5I0SA 1LESA 4FO9A 3JU9A 4OHYA 2ZZJA 3AYCA 1DLLA 5JOXA 1BQPA 1UPIA 1PVC1 2JKBA 2Z69A 3MYXA 4IV3A 5I91A 4FQZA 1RUI3 4NHMA 2ZBJA 4TPUA 1EP0A 2D5HA 4COYA 3E5QA 4CDXA 2EAAA 4LHNA 4Z92B 2A5ZA 3MF9A 4AI2A 4YVWA 5FFOC 5C9AC 3DGTA 4WZCA 4FPEA 4OUMA 2BNNA 4K40A 3GHNA 3BODA 3C2UA 3VBUA 2UURA 4FPKA 1VAVA 3FC0A 3FWEA 1COV2 1H1MA 3PJQA 5BNOC 1VAMA 4XJAA 3JB8A 1H2NA 2XBO2 3A0NA 3FFQA 3SLIA 1EAH2 2HWE2 2ZMNA 4RR3C 3D6EA 4QM8A 4TLFA 2ZACA 4XFBA 4XE9A 1NA1C 2JECA 1A8DA 2HEVF 3ZN6B 4CDQA 3ZXGA 1COV3 1QQP1 1QGLA 2R0HA 2YGLA 4MLOA 4RS5C 4INDA 4B4RA 2D5FA 2WQZC 3S7EA 3Q9OA 5DXDA 1W6NB 3TBDA 2F6BA 4JCKA 1JN2P 2DCZA 2PLV1 4FXGB 1ZVFA 1LOAA 4Y26A 3QOPA 3IDEA 1XYNA 1VZIA 2R0FA 1GICA 4LE3A 4LBJA 1GNHA 2GN7A 2WS92 1XE8A 1NYWA 2IFRA 1AX0A 2RDVA 1LTEA 1PHMA 1R083 5T5PA 2Q0AA 5A33A 4FQ4A 4FPJA 4WM8C 4LHLA 1KITA 3MI8A 4Y5Z0 3VHPA 2VULA 4N9IA 3FLRA 4M00A 2OUHA 4LNVA 2FHRA 3IBMA 4I0AA 4AQTA 5KXDA 1KDKA 3VDDC 3BCWA 1VBD2 3WD5A 2L0ZA 2IWGB 2EXHA 2D6MA 1RVF1 1H8VA 1APNA 2V3BB 2BVVA 4QPYA 2BNMA 4COUA 1QU0A 2VVEA 2XWBB 4EJRA 1Z0HA 3H9AA 3VBFA 5CG8A 3WXPA 1Y43B 2NZ9A 3H1YA 4P9XA 3VKLA 2NMOA 1JOJA 2A7AA 3DKWA 2JI2A 5AI3A 1WLDA 4B4QA 5GLVA 1RIRA 1DF0A 4KGQA 3SISA 3VHNA 1AR82 3KT7A 1OFNA 2O8QA 5CFDB 2WA3A 2DWRA 3B01A 4FPCA 2ERFA 4RS5B 4MGIE 1TME3 3G6JB 2D3RA 4PBPA 1FV3A 1D2SA 1DFQA 2WLPA 1T9OA 4GIQA 3MFCA 4HANA 2W39A 5T5OA 1LULA 3MPSA 1MS1A 4ZU5A 4YW1A 4N43A 1O3TA 3LPEB 1T6GC 1YLLA 5L7OA 2ZGRA 1O5LA 2A3XA 4FOYA 4QQLA 1J58A 4R9CA 3J7Y1 2XL9A 3HAGA 2JG8B 4XHBA 1DGWX 1ZBA3 1RDGA 4CDUA 1C5HA 1XYOA 2HEYF 2NP0A 3VBSA 4FCAA 5GLUA 1ZZ9A 3H7JA 3AX4A 1C8NA 1GKBA 3S7IA 1ZBE3 2CY6A 2E63A 2KA3A 1S0DA 2XWJB 3RI8A 1N3PA 1EV12 1HW5A 1O3QA 1QNWA 3OGJA 3MLJA 5LK5A 5J7MA 2CGOA 5I93A 4NPRA 4YM0A 1PIV3 3MW2A 3VL8A 2DTYA 1VBA3 3LA2A 3OD4A 1R081 1CR7A 2X5IA 3MLKA 4HKOA 2H6BA 4RQPA 3WP6A 4R9DA 1TE1B 1EPWA 4COVA 5D8AB 3BOWA 1Z7S3 2SBAA 4WFN1 3JCIA 4PIXA 1CAVA 3AP7A 3MIGA 3DL3A 1SDWA 1NXGA 2C5DA 1REEA 2BGCA 1NLRA 1ULEA 3U07A 1MS9A 4IEZA 4E4ZA 2QUOA 2Y38A 2UWBA 3RYPA 4BM8A 1BFYA 5JLVA 3PLQA 3AXDA 4X8NA 3HD8B 2ZJCA 3O14A 3NW4A 2UY9A 2X8KA 4O9EA 5FMOL 1LHUA 4RR3A 1HRI1 5BNNC 1RJ7A 2XLFA 4XJUA 4K6BA 4Z07A 4YVSC 4BQ1A 1PVXA 1AL23 4IV3C 4XGHA 2ZX2A 5JOYA 2HEWF 4AFBA 2GAUA 2A6XA 2RM22 1OWBA 8RXNA 2QZ3A 4YVWC 2D43A 3VN4A 4D7SA 3AP6A 3UKTA 3ZYJB 2VOVA 1G9CA 4BYYA 4H7LA 5AI2A 2FZ1A 2RMU2 3I7DA 4YM2A 3WW2A 4BMEA 5FQ0A 4S2FA 5JZGA 5FO9B 4G9SB 4AQSA 1RUG2 4FOWA 3QQCE 5EWSA 5JOWA 1UAIA 1Q5OA 3M3IA 4M3CF 3JQWA 1VAKA 2XLGA 1X50A 2E53A 2BFUS 3QACA 3DPRA 4EV0A 3QH6A 4NOTA 3UK9A 3TN93 1ULCA 3GNEA 4OHXA 2WNUB 4W6WA 2D97A 4K1ZA 5JCTA 3VDDA 5F9TA 3WDYA 4A7YA 4GMP1 5IUQA 1CD3G 2D7FA 1MR5A 4FPFA 4IV1B 4KU7A 5IK5A 5D1IA 1XE7A 4X8PA 4QGNA 4IERA 3BU7A 1SLAA 2FMYA 2VVDA 1AF9A 5EV7A 4LUKA 3WUCA 4AVVA 1DYKA 3L9JT 4MXWA 1ZRDA 3ZXDA 5JPNB 3RMYA 1ENXA 3G7DA 2ES3A 3ETQA 5C4WC 4HVOA 2J9UB 4TVMA 4BLJA 5T5LA 2CWSA 4Y22A 1Q43A 2NYDA 4RR3B 2VOXA 2EALA 1HRI3 5E1RA 3H3ZA 1JBCA 4YG0A 4QPIC 3AP9A 5DDJ3 1DX8A 3N4MA 3PVEA 1HXS1 3RI9A 2PTMA 2VG9A 1WLTA 4N53C 1FYUA 1HRV3 2UYBA 1QOSA 4XMAA 4QM9A 2RS13 1OQDA 4RXNA 2GC2A 5E89A 2VW1A 5JI9A 1BRFA 3ZO0B 2ETEA 2JI1A 1QKQA 2CKCA 5T50A 3AMQA 4MX3A 3THPA 4R4XA 1J3PA 4CDQB 2NQYA 1ZZCA 2UWAA 4RL7A 2HYKA 2XJRA 1O4ZA 2WA4A 4XIKA 1MEC3 1QCVA 4E27A 1ND2B 1W6PA 3FHIB 3N36A 4PIZA 2H6CA 2RE9A 1RHI1 2VNGA 1KS4A 2EXJA 1OOPC 2Q8OA 4EROA 2AYHA 1O5UA 4UY81 4AFAA 2A75A 4YGEA 4FTBA 4JAGA 1CVNA 1VRH2 1M06G 3IWZA 1RYQA 1H2MA 1ULGA 1CAUB 2BUKA 3RRDA 3VBHC 1C1LA 1RL3A 2KKDA 4SBVA 3VBOC 5GLTA 1IQAA 2BFUL 2WFF2 1OWCA 1S2BA 2I2SA 4RGGA 3H50A 4FPGA 1R1A2 1AYN3 4E2GA 3WQ7A 2Z3QB 1OHFA 1KQRA 4IEPA 3WOGA 4P14A 3KT1A 1COV1 2HWD2 4XFHA 3ILRA 4H7MA 2RR13 1I1EA 2R061 5C8CB 4P9IA 1AHSA 1H4HA 1VBA2 3AJZA 4XW3A 5GZDA 4GS7D 3ZX7A 4Q26A 1PGL1 1AZDA 1H9PA 4FP2A 2WT1A 4CTEA 4HKLA 3RYKA 2RS52 5IK8A 1UX6A 3AFKA 4O9GA 2B5ID 4WVWA 3RJRA 2WZPP 1JTZX 2Z42A 3ST7A 4BPZA 2CWMA 1EY2A 2WKKA 4MH0E 3KYVA 1SBDA 2DU0A 2YMZA 1PK6C 1NCQB 1HXS2 4IEOA 3AZXA 4Z2WA 3E6DA 1WD3A 3ZSKA 4D94A 3WDWA 3AK0A 1VB2A 4OI0A 5BNPB 1DGLA 3AFGA 4B3NA 6RXNA 1QNYA 2AREA 2RS31 1WD4A 2NMNA 3WWLA 3WWNB 3ZSLA 1CX4A 4Q4W3 3M8LA 5DZFA 4JGYA 5FLHA 4FPLA 4JAFA 4ISQA 4Y20A 5D8AC 3OD0A 4JVAA 1ZA4A 5BNOA 1YJLA 1POV0 5JZGC 3NV2A 1B35C 4WM7C 1JXNA 1FI2A 1MZ5A 1R1ZA 1AR63 4IEYA 5RXNA 1QOOA 5H9SA 3M2MA 2I74A 3D0SA 1X8MA 3DPRC 1RUF1 2ZABA 4UXAA 5F1RA 1LU1A 2VU9A 4XFGA 1VBA1 1K5MB 2OVUA 1GLHA 1QJY1 2QQPA 1S1AA 3IPVA 3FFZA 1Z78A 4ITCA 1OA4A 1R091 1YIFA 3AKSA 3MFAA 3APBA 2ZGQA 5BNPA 1QJU3 1WA4A 1FOD1 4GKXA 2ZMLA 1B13A 1UCXA 1PGL2 2M6OA 2MS3A 1R0HA 4AHXA 5J3UA 4AQ6A 4AR3A 2VOWA 1LHNA 1SEFA 2GH2A 2E7TA 5JPMB 1POV3 3MIFA 1DDLA 5DUUA 2A71A 4JDNA 1CAAA 2R30A 1FHHA 1MEC1 3AP5A 3L2YA 4KU8A 5T5JA 5C4WA 1CAXA 1V6IA 3AB0A 5GZGA 3OCPA 1W39A 3MICA 2A6HD 2XGXA 3WP5A 2V0FA 1AYM2 1ZZ6A 2JE7A 1HV0A 1LHWA 1N1YA 4CEYC 1VIWB 4PF5A 3WLUA 1OFSA 1SFNA 4ZN1B 5FPXA 3WHTA 1RUE1 3WNXA 3LSDA 1NNQA 4IEUA 4ATEA 3N7JA 3ZN4A 5GAHc 1U12A 4LBNA 1REDA 3O12A 1JUIA 3IU3I 3R4SA 4UW6A 4A7KA 5LRRA 4AVAA 1O3RA 1NXEA 1Q56A 2YHJA 4Q4W1 1C4RA 3JQXA 4Q8KA 1AYN1 3RYGA 1AXKA 3B5LB 3CJIC 3JZVA 5IK7A 1DZQA 2RS33 4NWWA 4YVSB 3LCPA 1G6NA 4PBOA 4DXZA 3J7Z1 3ME2A 1SQ4A 3NAPC 1H8TC 2RM21 2TUNA 1KD7A 3ATGA 3KGLA 4C1WA 2VNRA 3RDIA 1VBE1 4L2NA 5LEKA 5GM0A 3ZYPA 5A32A 2ATFA 3KYXA 1Q8OA 4JQRA 1JHNA 1OKQA 1TQ5A 1GNZA 3BALA 3HWJA 1OA2A 1PMIA 4A7ZA 5SV8A 3VKOA 1B2JA 2OZJA 3ZFFA 3WT3A 1R0IA 4EN8B 4Q0PA 2R16A 4GH4B 1RDVA 1AR93 1F2NA 2CR8A 4LBKA 4FP3A 4HVQA 3OY8A 1SLTA 4QQ2A 2WNVC 1MVEA 4Q0UA 1XU1A 2P2KA 2Z2SB 4NHLA 1U5XA 3IPVB 1ND2A 1NXMA 3HMYA 4HLTA 1PK6A 3RG0A 3RMXA 1CGPA 3N35A 3WCRA 3KT4A 3LSEA 5K9YA 1YFXA 4FT8A 4UW5A 1FHMA 2ZGNA 3VZNA 4ZKTB 3AMHA 5L7OC 1ALYA 1GBGA 1D0HA 5BUVA 3RJ2X 5DDJ1 1QJZA 4BIOA 5C8WA 1I3HA 4IL7A 4I09A 3I59A 1OPMA 2B42B 2VGDA 1MS3A 5FLJA 2ZGSA 3VL9A 2KN9A 1YXWA 3QBQA 1BMV1 4AI8A 4JGYC 3LGRA 1XNKA 3PTYA 4IEXA 4LO7A 4DOUA 5CFDC 3V0AA 3LKJA 1N1VA 1SMVA 1S0FA 1C28A 1UZZA 4XJ9A 2O0OA 5H1Sc 3VBSB 4YVSA 4J1WA 3CNAA 3IIAA 3FX3A 1AR81 1E57A 3MIHA 1ZZBA 4IEVA 4TZDA 4PJYA 3WV6A 4E9KA 1DHKB 2DSXA 3J4UH 1YRZA 1AYN2 4JC1A 3POWA 1GFF2 5LEJA 1UU4A 2QDRA 3D5OA 4EN0A 2R071 5DUVA 3GBFA 4Q0SA 2ZX4A 1WJVA 2EXIA 3AMNA 2XUMA 4AVCA 1RGSA 5JVH1 3ZXLA 2PHXA 1NA1A 1ASJ3 2AUYA 4G3YC 1PGSA 2YYOA 4ZU4A 4CEWB 5C8CC 4LULA 5J48A 3BIWE 3WG1A 4AEDA 1REFA 2RS51 4P9YA 2JDZA 3E6CC 4A2UA 4C0HA 3QVDA 3EBRA 3MIEA 3GZAA 4DNYA 1DIWA 3BTAA 3VHRA 2HWF1 4D3WA 4YW2A 3OBTA 4BWOA 5MGNA 4R9BA 4AEJA 2A6VA 2IXIA 3KM5A 5DUWA 3THTA 4C91A 4LBMA 2EXKA 1G86A 4Q4Y1 4XF0A 2P3KA 1EV11 1HRV2 3P3PA 5KHKA 1DQ5A 1X7NA 2E9QA 1QWRA 5FPZA 1B71A 1VZHA 1I6XA 1AL21 4Q0QA 4KWLA 2XKOA 2P3JA 4FOQA 1DQ6A 3OTFA 3AXEA 3K48A 4ZN3B 3ZXFA 4YM1A 4FAHA 1RUC1 1ZBA1 1YFWA 1A78A 1V6OA 3ZFGC 1UKRA 3CJIA 4C90A 1UPSA 2NM1A 4XF1A 1N3OA 1KRIA 1VBC2 4OVEA 4RQPB 4YW5A 3NAPA 2ZGLA 2WZR2 2C9AA 3DPRB 5FRAA 1KFXL 1J3QA 3OYWB 4AGGA 2ZX0A 2DCYA 3L2HA 1TME2 1VRH3 1BJQA 1GYKA 3N7MA 1WBFA 2E7AA 2R072 1YHFA 4XYXA 3EO6A 2XJUA 1WW7A 3POSA 1N1TA 3UJOA 4ASLA 2HJIA 3WX5A 1FT9A 1ZRPA 1CIWA 3IKWA 1XNDA 3JBG1 3LOIA 2JG9C 4KQ7A 2JENA 3ZIWA 2ZX3A 3MSUA 4RHV3 4JRAA 2C6AA 5JVG1 1HV1A 3R6SA 5JAXA 1ZZ7A 5BPXA 4ONUA 4MGYE 4S2GA 4LO8A 2ZGPA 3WG4A 4N43C 5BY5A 4AR6A 1OMIA 4L97A 4F83A 2GNTA 4RD7A 3VBRA 2Y0IA 1DGRN 2O8OA 2R6QA 2VECA 1D0GA 1IHMA 2AENA 1QMJA 4K3UA 3FUOA 4DY3A 5ABJC 1W6NA 5IT6A 2RJKA 1OA3A 1BEV1 2W68A 4Q4X1 3NFPI 4NVPA 4K1YA 3ZYGA 4PQ9A 4AFDA 1BMV2 4YZ1A 4WVMA 1B2OA 4QPGB 4XXPA 3FUQA 3P3NA 1HXS3 3B9CA