2XJTA

X-ray structure of the n-terminal domain of the flocculin flo5 from saccharomyces cerevisiae in complex with calcium and man5(d1)
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
258
structure length
258
Chain Sequence
GLVPRGSHMSGATEACLPAGQRKSGMNINFYQYSLKDSSTYSNAAYMAYGYASKTKLGSVGGQTDISIDYNIPCVSSSGTFPCPQEDSYGNWGCKGMGACSNSQGIAYWSTDLFGFYTTPTNVTLEMTGYFLPPQTGSYTFSFATVDDSAILSVGGSIAFECCAQEQPPITSTNFTINGIKPWDGSLPDNITGTVYMYAGYYYPLKVVYSNAVSWGTLPISVELPDGTTVSDNFEGYVYSFDDDLSQSNCTIPDPSIH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLOCCULATION PROTEIN FLO5
publication title Structural Basis of Flocculin-Mediated Social Behavior in Yeast
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Cell adhesion
total genus 61
structure length 258
sequence length 258
ec nomenclature
pdb deposition date 2010-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07691 PA14 PA14 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.280 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2xjtA02
2.60.120.1560 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2xjtA01
4AHWA 4AFAA 4LHKA 4COUA 5A3LA 4D3WA 4CP1A 2XJQA 4AI2A 4AFBA 2XJTA 4COVA 4LHNA 2XJUA 4AF9A 2XJSA 4AHYA 4LHLA 4AI1A 4CP0A 2XJPA 4GQ7A 4AHZA 2XJRA 4CP2A 4AI3A 4AFCA 4AI0A 5A3MA 4COYA 4COZA 4ASLA 4AHXA 4COWA 2XJVA 4A3XA
chains in the Genus database with same CATH superfamily
1PK6A 2Y6KA 1E8JA 3MW3A 2GSYA 4R9DA 1SPPB 1X8EA 2E33A 4LHKA 4Y26A 4AL9A 4B1MA 4BA6A 5LW9A 2XBO3 5T5OA 1ENRA 4P5HA 2BGCA 1POV3 1PZ9A 3PVOA 4QMAA 2FDHA 3AKTA 4UXAA 4NOTA 5FWJA 3ZMOA 3HJRA 3GZTB 3KV9A 4YGEA 1QOOA 3UNPA 1O4YA 5T5PA 1OPMA 2P17A 4MO3M 2P1BA 1SFOL 1LOGA 1YFYA 2Z3RB 1OQEA 2YPDA 5JXGA 2KD7A 5CVRA 2A5ZA 3THPA 3VDDB 2J1AA 3WDWA 1DF0A 1FV3A 3F95A 4ZN3B 4AG4A 3PVEA 2I2SA 2ETEA 1XXNA 3J8F2 3CHXA 4K9FA 3VD9A 2ZCWA 4M3CE 5A3LA 3JD71 2E6VA 5FZ3A 2DWRA 3OPTA 4AI2A 2A6VA 3RI9A 3THTA 1DQ1A 3UKTA 4XUTA 5A7WB 1F5FA 4IV1A 3PUIA 3LNLA 4EN0A 4XMIA 3IMMA 1GNYA 4AHYA 3M3QA 2B5ID 2A6ZA 3VDCA 2LALA 3N3HA 1IKQA 2JDHA 2DCZA 3PIP1 2OPKA 4NRQA 4D0QA 1K5JA 1GNZA 2ES3A 2PN5A 1UX6A 4JGZA 5JZGA 3ZPYA 1JYIA 3NMBA 2AZ5A 5K4LA 1UQXA 4Q26A 2P5BA 3WG1A 5BNPC 2ZGKA 1WD4A 5DM61 2JD9A 4ONUA 5I0DA 1CADA 3KYVA 4L99A 5CFCC 1RUC2 4NROA 3HBZA 2A7AA 3WUCA 5A32B 4RR3B 4WM8A 2ZAAA 2BBAA 1G6NA 1UIJA 1PNFA 2EF6A 2WZR2 5C3QA 1VZIA 3LB9A 5FLJA 1RUH2 2CU5A 1PIV1 3VKNA 3C2UA 3CU7A 5C3OA 1J59A 4RGAA 5C9AC 4LE4A 4FBFA 1W9SA 2JA6L 1BMV2 2RG4A 5FZ4A 2VBPA 5FZMA 1JUHA 1SHWB 2Z2SB 4AR2A 4C0HA 3WP3A 4CCKA 5J09A 1ZRPA 4TYSA 5HV4A 5IT6A 1W0NA 5C44L 2C4XA 3VBOA 5LWBA 4LBQB 4XUOA 2R30A 3WF2A 1PIV3 3BVCA 3VDBA 2UY8A 3WXPA 1UXZA 1YXWA 2AREA 2VBBA 3HN1A 3M7AA 4GXLA 4H14A 1I1EA 4JGYC 2PAMA 3ILFA 2YMZA 5IHRA 2RS51 2XWBB 5DAXA 2C6AA 5FV3A 1JYTA 3KV6A 4AQSA 3IZOA 4AI8A 4BOWA 3V56A 4DMIA 2CHHA 2E63A 4QGMA 4YM2A 4AVVA 4IV3A 1UN1A 4XHXA 4YW2A 4ZZ5A 1OSGA 1PO22 3WY6A 2JA8L 2RR11 1H7VA 5BV6A 1LHOA 2HEVF 2YBPA 3J26N 4YM0A 4YG3A 3RQ0A 3THDA 1MZFA 3ZR5A 3GTQL 4RHV3 4QKFA 4FPYA 2RS53 4MHUA 4HANA 2PXJA 2ZEYA 3OUJA 4LXLA 3HJYB 3ZX7A 4K1ZA 1MZEA 3PU3A 3PUAA 1H8VA 4HSLA 4Y33A 5I8TA 4BDVB 2RR13 3POJA 3ZXJA 4ZU7A 1F31A 1R1A2 2WNUA 1R64A 5EZWA 4HKWA 4AXOA 1W8HA 1SLTA 4IETA 4XTMA 1AX2A 4EN7B 1BVVA 1PM4A 2A70A 3OTFA 2ZZJA 1UU5A 4IDZA 1Z92B 3K7AL 2WFF1 3D82A 5J96B 4DIQA 1GYKA 5FUNA 3DYOA 4N43B 5FY0A 3RVHA 5IVVA 1FMD2 3PUSA 1CN1A 4UW3A 1BFYA 1OD5A 2BFUS 4YRDA 2VW0A 1R9TL 4LOSA 3C7GA 4XXAA 2XH6A 3D6EA 3WW4A 5IYDL 1AYN2 2WFF3 5FLIA 5CG8A 5D8AA 3HOXL 3S1ML 1CD3G 3S1NL 3ES1A 3PMSA 5M0TA 4RQPA 3T08A 5BY5A 3A23A 1KFUL 2YBKA 1ENQA 3GTGL 3X29B 2E32A 1VBE1 3IWZA 5M5XL 4WVZA 2WQ4A 2NVXL 3BPZA 3ENRA 2MPFA 1HXS1 2IWGB 2LS6A 1ODMA 3ZXEA 1LU1A 4GULA 1ZZBA 1YLLA 4POGA 3KSCA 3OBRA 5FYYA 2WZPP 7RXNA 4RFT0 4AGVA 5J36A 4A6SA 3RZHA 1VBE3 2RHPA 3K48A 3TNQA 4V2WA 1CQ9A 1QJZA 2NMOA 3S15L 2PQQA 4FFGA 3WCRA 4EROA 1YQ5A 5FYUA 5CADA 1HXS3 2DVDA 3HJWB 3MLJA 1OMIA 2R16A 4IL7A 3M2MA 2YV8A 1URXA 2RDRA 1NX9A 1NKGA 1K5MA 1QXRA 4F7ZA 1R0IA 3LOBA 2OZJA 2WWSA 3VBRB 5MF6A 3G6JB 5IFTA 1JOBA 4Z92B 2R32A 1YUZA 4FTEA 3WHTA 1DGWX 2C6BA 4UW6A 4JQRA 1W6PA 2VVDA 1W9WA 3P2AA 3FWEA 1CJPA 4TZDA 2IFWA 1HQWA 4BQXA 4XZPA 2FDIA 1LB2A 2WZR1 4ZXKA 4QX7A 4XF1A 1OVSA 1RUH1 1PHMA 1FYUA 3I4IA 5FJKA 4GALA 3FL7A 3I2HA 2DVGA 1AL21 4AEDA 1H2KA 4YLZA 3K75B 2K9ZA 2RDVA 4QDRA 1H1AA 1MS9A 2BFUL 1W6QA 1TME2 1BHGA 1PO12 1J3PA 3VGIA 1DZQA 1W8UA 4PJYA 4CU9A 1RUH3 4BPZA 3AK0A 3WDTA 3KF5A 2VQAA 3JBG2 2ORXA 3ZFEC 5FAXA 2VMHA 4E4HA 2QQUA 1AL23 3R4DB 2ZAHA 4CCCA 2J1SA 3RGBA 4CDWB 3D8CA 2P4EA 1Q8SA 3HNMA 2LROA 2VGDA 1MQTC 2VVFA 1PGW1 5I0SA 1NXGA 2ZGRA 5E6HA 1VCXA 2PQSA 3FUOA 3N36A 2QZ2A 4I30A 4HZFA 3MBWA 4JTOA 1PO21 1AR71 1TNRA 3B01A 1FHHA 3A4UA 4BK5A 4ATEA 1LHVA 3DUIA 2W3JA 2X5IA 1HRV1 1X36A 2G9FA 4XACA 4FQ4A 1UY1A 4Q27A 4XCBA 2QZ3A 2ZGSA 2JDPA 3BIWE 1ZBE1 3FHAA 3I59A 3K4DA 4CXXA 5KHJA 1OLQA 4B8CD 1DQ5A 1PO23 1AR73 2V3BB 1VAVA 3LA7A 4A7YA 4F83A 4R9AA 2WDBA 4XQDA 2TNFA 1HRV3 5BNNC 5FYSA 2JDKA 3S1RL 2B8MA 3VD3A 2OVUA 3JB8A 2D6PA 2P6CA 1XB9A 5FIXA 4TLFA 1ZBE3 2PLV2 2J7MA 2R072 4RGKA 2JG9B 3VPBE 2EICA 2SBAA 4COUA 5IAXA 4YGDA 4POFA 1IG3A 5GADc 3RZZA 5KHHA 3NV1A 4H3WA 1SBFA 2Q0AA 1FMD1 4QPWA 5LRSA 3H1WA 3ACHA 1CIWA 1UYZA 2C0ZA 2HWF1 3WQ0A 1ZREA 2Y6GA 3ACGA 1IGOA 5FMCA 5FZOB 3SHRA 4DXZA 4JKKA 4B4PA 1GZWB 2CV6A 5KXEA 1DG6A 2CWSA 1CAUB 4EN6B 2CAVA 4W8JA 2QQNA 4KI5M 4IGOA 5A3MA 4S2HA 3B0AB 1KDMA 2BERA 3MEPA 3POYA 1YI9A 1L7QA 3AP9A 1OFNA 3TEYA 3SLIA 4A41A 3P3PA 4MGKE 1H2MA 4HMZA 2HWF3 1QKQA 4COWA 3O1TA 1RYYA 3MIEA 4KG0A 1GQHA 4B8EA 1J3QA 3B5LB 1HKDA 1HV1A 1WUVA 3NV2A 2WS92 3VBHA 3K4AA 2G1MA 2ZGNA 4QX0A 3VLBB 1MACA 2ZGPA 1WCDJ 2VXJA 1HQNA 1NCQC 2WSUA 3HWJA 4UFKA 2M4VA 1SBDA 2D3SA 1VALA 4AAPA 3DPRA 1B13A 4ZU5A 3URFA 1MS1A 5GAEc 5FMBA 1VBB2 3J7NA 1WW5A 1ZZCA 2GNTA 5FQ0B 3BCWA 3N9PA 5LK5A 3MI8A 4EYUA 1US3A 3WZ1A 1SDDB 2VU9A 5T52A 2NVTL 3KV4A 3OF1A 2YZ4A 1RUNA 2WO1A 4QU1A 5L9VA 2UYBA 4GJZA 5FRAA 4ZU4A 3MF9A 3U0ZA 2BOIA 2C9AA 2AH2A 2VPVA 1XU2A 3ZR6A 3BTXA 1HB4A 1TWFL 3INAA 5EYYA 2VULA 3VDDC 2OPWA 4OI0A 1EAH2 2PHXA 4AVAA 1GWLA 4A3DL 1KQRA 3K77A 4QKNA 3B93A 4GH4B 1ZBA1 4OZXA 4M3CB 2E26A 1RMU1 4E2SA 5A1LA 3AKQA 5K7PA 5LBEA 1LAJA 1ACCA 2PSMC 3NNJA 1PZ7A 3M3EA 3I2DA 3KD4A 4YW6A 4BXFA 4LO6B 4JAGA 2DTWA 3BALA 1PMJX 2JDMA 3FLTA 5IW0A 4EE2A 1ZVFA 3AP5A 4ES8A 1WCUA 1ZBA3 5C8CC 1RMU3 1TME1 4CEYA 2DBIA 3PWFA 3LFIA 4DXSA 3SISA 3WW3A 2PPTA 3JBG1 5FXXA 3VKFC 3WG3A 3ILNA 5F37A 4JQTA 1A8DA 2EXIA 2D97A 4FP2A 1OF3A 1GV9A 1SFYA 1UZ0A 2R1BA 3WT3A 1C5IA 4MGYE 5A33B 3WQ7A 4B1LA 1GOFA 2PVEA 1KRIA 3ZYRA 3NV3A 2Y6JA 3JBG3 3O1MA 5CU1A 3ZG6A 1XBFA 2XKPA 5T5LA 3WDXA 4A3FL 3IU3I 2FD8A 4YVWB 4RR3C 2XJPA 4JZRA 1W3XA 2HWC2 2NVQL 4QHZA 3TN92 4DPNA 4GMP1 4DY3A 5AC92 1B2OA 5ANNA 3LGRA 1FXZA 4CP9A 4FPOB 2ZX4A 2FBEA 1Y43B 4AFCA 4LORA 2WR9A 4ZONA 3RZOL 5CFDB 2BW8A 2FDGA 1SCSA 2ZEWA 1AXYA 2OUHA 4IEVA 3ME2A 1NOVA 3GALA 3MLKA 1JOJA 1C5HA 1HN1A 4LKSA 5FP3A 4UI9L 3KT7A 5IVCA 2PLV1 4MADA 5C4XL 3MFCA 2BRTA 1OWBA 2JE7A 4HXCA 2B45X 1J1LA 3USUB 4XUPA 1CAVB 3DV8A 5AVPA 1QH6A 5FR3A 2NN8A 3ZXAC 1ZZ9A 5LASA 3GZAA 3LIGA 2ZGQA 5LZ6A 4CUGA 1CPMA 3VZLA 2H6CA 1RXFA 4QQOA 1ALYA 4B7EA 2VCCA 1QXPA 2PHFA 1OOPB 4LMFA 4HL0A 5F3EA 3BOPA 1UXXX 5FUIA 4HPKB 3QBQA 5JIAA 4AR5A 1SLLA 2HWB2 3PTYA 1W8FA 3T0AA 3UYJA 3NRUA 3AYCA 4NIDA 4K1YA 4P9YA 3PIO1 2R1DA 4QD2A 4Y20A 2R041 2WS91 4AW7A 2WNVB 3MO4A 1QU0A 4UAPA 1UOFA 5DN2A 3ZN4A 1TMF2 1HB1A 1AYM2 2CNAA 4RXNA 4U671 2G19A 4ZPIA 1PGL1 4Y22A 1MS3A 4QX8A 1E5HA 1VBB1 4CUCA 1NAEA 2GNDA 4E4ZA 3VHPA 1VMJA 4G3YC 2B63L 4ZS2A 2R043 4KWUA 4UF0B 3C8XA 2WRAA 2KKDA 3SH5A 3IKWA 3PIJA 4N43C 4E4DX 2PHDA 4K20A 3ELNA 3EHKA 4QM9A 5FP4A 1BBT2 2R062 3JUUA 4KG8A 4L9BA 2JXAA 1IS5A 2DV9A 2VNOA 4Z2WA 1VBB3 5A6YA 4CXYA 1EPZA 2XGXA 2RJ2A 4HOOA 3WX5A 1SLBA 1RUE3 4E6YA 4H7MA 2A69D 1X9PA 3HAXC 3DN7A 2PHTA 1Q8PA 3GCXA 3W21A 5AI3A 2AC1A 3DYPA 4NR1A 3ZPOA 4WM7B 3H50A 1SFPA 1RVF2 2D6KA 4JRLA 4K6BA 5HXVA 4A6OA 5I8YA 1I50L 2PA7A 3H8UA 1XOYA 1WW6A 1BEV2 4YW3A 3H3ZA 4PBPA 2V4AA 4JX0A 1STMA 1X33A 3OY8B 2D3RA 4WFN1 1YFXA 1M06G 4D7TA 1NZIA 3CF6E 4A3ZA 5A3PA 2XUMA 1COV1 2ZKLA 1VJ2A 4Q4X1 3WSOA 1V6NA 4F3JA 4Y1VA 3RZMA 5FYIA 5HCHA 2A68D 1Z7S1 2ZX2A 5C70A 1KFXL 1VR3A 4FO9A 3WNMA 4CP1A 4MZUA 1Y9QA 4KU8A 3JZVA 2BNNA 4TXWA 4FOQA 5EV7A 3M3YL 4I0WB 3N7JA 4GB32 4FFFA 4I3PA 4Y4RA 4QPYA 3VBRC 1C8M1 4YVSB 1COV3 1OHFA 1VPHA 4L11A 1IPKA 2R7EB 4Q4X3 5DAPA 2QCSB 5A7SA 1CWPA 3DCQA 4MXVA 2EY4E 3H42B 3WDVA 4AQ6A 4CP0A 2O5JD 1AVBA 1Z7S3 5CZKA 4DFSA 3OG2A 1W6MB 4AHZA 2EIEA 1R082 2HWC1 3IPVB 4LIUA 4MHRA 4X6QB 5G04L 3TN91 3RWKX 3ZYFA 5FY9A 1D0HA 1GU3A 4CDXC 2W92A 5C7GA 4YNIA 1C8M3 2W08A 4XTPA 1DQ6A 3OCPA 1VBC2 3V0AA 3O12A 5LBBA 5BPXA 3S7EA 4WVWA 1XRUA 4CZSA 5C4WB 2QBXA 5KXCA 1AF9A 1HX6A 4N53B 4D3WA 1IS3A 2R49A 3SEEA 4BLIA 3POGA 2QUOA 5FLML 2IXLA 4JKLA 4FTSA 4XC9A 5AN9H 2AACA 5DG1A 4A3ML 4CDWC 5TSWA 1JZ7A 3VZNA 5FY1A 1OXCA 1CAAA 1W6NA 4W6YA 1J84A 2X53S 4GQ7A 1RXGA 5F6KA 5CFCA 1ZX5A 3P6BA 3N35A 1AX1A 3H9AA 2RS32 2Z69A 2LRPA 2DUQA 3RG0A 2WQ8A 4E9KA 2VZOA 2VMGA 4OLLA 2HWB1 3VZMA 5DPNA 3FC0A 1H8TB 1S0BA 4K8FA 4LJHA 2CGNA 5JR2A 5I91A 1IU5A 3HOBA 4E8DA 2Y0OA 2VZTA 3Q8CA 5A6XA 1NY71 3HOVL 1RUD2 1DVBA 2VMDA 3ZFFB 4Y1XA 2J9UB 2BEOA 2RV9A 2JI2A 4W6WA 4K7JA 3E1F1 4B7KA 3O7OA 3CJIC 4BQ5A 3AMMA 2JG9C 4WBBA 4Y3OA 1RDGA 4JCKA 1Z78A 2ZBJA 2DDUA 1LGCA 4JGYA 3CKHA 4NAOA 4W4ZA 1K42A 1LOCA 1UZVA 1ND3B 1QQP1 1MS0A 4CEWB 3FHIB 5FXVA 3LDKA 4W65A 2Y26A 2J1EA 2WAQP 4XIKA 1O8SA 4IE5A 1BK1A 1G86A 1LEDA 1KGYA 3T30A 3GDBA 3WV6A 1S0JA 1QQP3 3FJSA 4M00A 3QQCE 3FMGA 3GJAA 4IQPA 4EN9B 5F8PA 4LBQD 2XKOA 5FZBA 2VAUA 2VOTA 3OYWB 1G7YA 4H7LA 1ZRFA 2VCMA 2M6PA 1OT5A 1NQJA 3M8LA 5H9PA 2E2HL 2MEV1 3SXWA 4C90A 3O1RA 4IE7A 3QH7A 2B46X 1JU3A 1QJU1 1BEV1 1U0AA 5EIYB 2V72A 3WR0A 5C3PA 2MEV3 1OLRA 4PIZA 1RUI1 5BXXA 1KEXA 4FXGB 4AGRA 4MGTA 3K35A 4OI4A 3K51A 4UW4A 4EN8B 2EA7A 1QJU3 4JADA 1WCKA 5JR7B 2R0HA 3KGLA 2CR8A 2ARAA 5B4XA 4XF4A 1BQ8A 1QEXA 2GDFA 1RUG2 2AYJA 3NJZA 2VNRA 2VUML 1RUI3 2VTFA 3R05A 5ISLA 4QGNA 3NVCA 1IPSA 3RS6A 5A7PA 1O5LA 2F6BA 4GH4C 1UPSA 4O7XA 1S0FA 2YYOA 1F4HA 2ZA9A 3OD0A 4XEZA 1OPOA 3ATGA 3GBWA 1GUIA 5JDBA 5KXDA 4UFMA 1O8PA 1CJDA 3E6DA 2WZ8A 4GMP0 5FZLA 4OI2A 5FPBA 2JECA 1RC6A 4Q4V2 5CG9A 1Q8OA 4NHYA 3I54A 1XNKA 3OEAA 3LWCA 1MR5A 3A44A 1OUXA 1W6OA 3I2FA 3J4UH 4MV2A 4YM3A 1R092 3VBUB 3SCHA 1UKRA 2GP5A 3WVJA 2YGMA 4YGCA 2BQPA 2P37A 1D2QA 1RHI2 2RVAA 1YFUA 1TWCL 4NMIA 1FOD2 4N90A 4LLFA 2VM9A 1MZ6A 2I74A 4HKLA 5JZGB 5JXIA 2JE8A 4JGZB 3HKZP 1D7PM 3RZLA 3PHMA 4UT5A 1TWHL 1YNAA 2RS31 4QX5A 1GR3A 5K0UB 2NYYA 2O8QA 3AP6A 5A7QA 2ERSA 3AP7A 3J7Z1 3I3QA 3BU7A 4XQ4A 1ST8A 3O0VA 5APAA 4YVWC 1T6BX 4MXWA 1LOFC 3BUCA 1JS9A 1UW8A 1T6GC 3VBSB 4D7SA 1PVC2 1RWDA 1Y1WL 4WM8B 5BNQA 4S2GA 1RIRA 3I2JA 4JC1A 1D2SA 5SV5A 2BGOA 2O1QA 4IESA 4B29A 5FKCA 4G4FA 3WG4A 5CFDC 1OQDA 3MIGA 4G9SB 3LEKA 3ILRA 3MFAA 1RUF2 4SLIA 4XF0A 1A34A 3O1UA 4LKFA 1GQGA 3CL1A 3Q8BA 3B9CA 2K2SA 2NLRA 4MGZE 5FY7A 5JI7A 2ZABA 2W87A 1JBCA 1H6YA 2VVEA 5JMOA 1Q3EA 5A3NA 2CSGA 5KR7A 4UYBA 3T1LA 1FHMA 2A6ED 2D43A 2P3YA 2WZEA 4AR4A 4XYXA 2NQYA 2VZRA 3VBOB 4YZ3A 3BPSA 1RINA 3WNXA 4BIFA 3RYGA 4M0HA 5FPUA 4BB3A 3JR7A 4XE9A 2ZPXA 5DUWA 4EWAA 1W3VA 2VXRA 5FP7A 2R93L 1AR91 1DFQA 5AFEA 1UY2A 2GC2A 2CL2A 1JYXA 4IGPA 3SKVA 2E7TA 5AI2A 1OOPC 1F4LA 3ITQA 2EIDA 1UKGA 4UOJA 4CDQB 1XNTA 1C09A 1VB4A 4IV3B 1UOJA 1LHNA 1NA1C 1O91A 2NM1A 3WINE 2DVBA 3I4ML 1AR93 1S2EA 4QX2A 4OZOA 3JCIA 3KT4A 2CDOA 4EZ4A 5BNNA 2VOWA 4XCAA 2JICA 2WIIB 3MLLA 3OJBA 2PAKA 2VY0A 4YWLA 2RJKA 2VQ0A 2VZ3A 2WNVC 3CIHA 3JD73 4XBQA 3HOWL 5T5JA 5DZFA 3UKVA 1S4CA 1QF3A 2YROA 2D6OX 4ZS3A 3OGJA 5GLVA 4J6GA 3RYKA 2WNUB 2VH9A 2PMWB 2O0OA 4LO5B 1ULOA 2UWCA 4Q4W3 4XABA 2JIGA 4BU2A 4Q0VA 4OUSA 2CDPA 4INDA 5C8WA 5JCTA 2Y38A 3SEPA 3A0NA 3BOWA 1BKZA 2Q8DA 1KITA 5AVAA 5DUXA 4KNCA 4WZFA 4QQ2A 1DQ4A 3DGTA 1RUG1 1V9U1 4HK9A 2A1XA 1RYTA 2XJSA 2O8OA 1QHDA 5H9RA 3C3VA 3ZXKA 4XF3A 4CPBD 4OQ8A 1BCXA 3LSDA 2JB8A 4Y1UA 1YIPA 3ZYJB 1K83L 4ME3A 1REEA 3OBTA 4MOAA 2P6HA 2NPIA 4GIQA 4RQPB 2W52A 3HPNA 4Q1RA 1NCQA 1RUG3 1V9U3 4WM7C 3V0BB 5H9SA 3W5MA 2VMIA 2SLIA 2XJVA 4DEQA 2HEYF 1YJKA 4Q4V1 3NAPC 1C8NA 4OHYA 1SPPA 5FJ8L 1ULCA 4HONA 2WO2A 2VMFA 2VR4A 2APOB 5J48A 2YGLA 1QYBA 1IROA 4XFAA 3UESA 3I3DA 1R091 2ZGOA 5FBZA 1UPIA 3PL5A 1L7LA 5FYVA 4PDWB 3T3YA 4AQ2A 1ODNA 1LECA 5EJ3A 4E27A 1CR7A 4K3UA 3EB7A 3VDAA 2O14A 1RHI1 2W1QA 4Q0QA 4Y5Z0 4FPFA 5F3GA 3WUDA 4B4RA 1FOD1 3WWLA 4EQVA 4DUVA 3FLPA 4AYBP 1VBD2 2YFUA 2VG9A 2GMEA 2YUEA 1K5MB 4PQQA 1NZCA 2JDUA 4D94A 4YVSC 3RYPA 1LHWA 4MX3A 2L9LA 3DYMA 2CAUA 5C33A 4IEPA 1UYYA 1FOD3 2ADDA 2DCYA 3HAGA 3I3MA 4ZHNA 2J1UA 1NE6A 5FUPA 5ABJB 1QNWA 1PVC1 1FNYA 2YY1A 1AUYA 5DDJ2 3RDIA 3BIEA 1UF2C 2XJQA 5T50A 2PFWA 4CCNA 1CAWA 2RDNA 4HFSA 3MV11 2D3PA 5C8CA 2XL9A 3WF3A 3GTLL 5A7WA 1YIFA 4D6QA 4N8MA 1SMVA 4OHZA 3WNLA 3AVRA 2YU1A 2ZEZA 2G9ZA 4PIXA 5ANQA 5FZCA 2DUOA 4N53C 5C4WC 1SFNA 4OFGA 1LOBA 3LPFA 2ZS6B 5L7OB 4FFHA 3KMHA 1YEWA 4P14A 2XONA 3KYWA 2HBUA 1KDKA 2EALA 4QHBA 3LZZA 5E1RA 1OA4A 4C91A 5C6CA 3J8F1 3WNNA 4QPIB 3OGRA 2ZMKA 4MVTA 2D44A 1N1TA 2IFRA 2VZUA 1H2LA 1S2KA 1SEFA 2ZGTA 3BODA 3PTRB 3MICA 1H8TC 3RFRA 1W8OA 1DGRA 1UY4A 1XU1A 1BZWA 2UURA 4LHSA 3TYJA 2C6SA 3S7IA 3J8F3 5M3ML 1OI6A 4U36A 4OVEA 3I59B 4JDNA 4AOCA 5A6QA 2Z5WA 2OUJA 3ZFFC 2GAUA 2JD4A 3H0OA 2XHNA 1PFUA 3PO2L 5LA9A 1DX8A 2ZX3A 5FXWA 3S2HL 1G9CA 1H6XA 2BVBA 1RITA 5KWRA 3LFMA 2YU2A 5KC6A 1ND3C 1RUC1 3Q8EA 3PUHA 3FKIL 4GA9A 2JI3A 4UFHA 1O3RA 4CEWC 2RE9A 1O4TA 1XNBA 3LSEA 2GMMA 5F7UA 3LPGA 1XSRA 3AMPA 4BQ3A 1JXNA 1UAIA 2HJIA 2RDQA 4H55A 4IERA 5HV0A 2IXKA 3A21A 2DURA 4A42A 2E7AA 1RUC3 1BMV1 5D21A 1QIQA 3D0SA 4ISQA 5GZCA 3POFA 2ENRA 3C7OA 4Q4W1 1N3PA 2F4PA 5JSOA 2WZR3 4ES9A 3S5AA 2BUKA 5JVVA 4ASMB 1WCQA 5ACA2 3LDRA 3H9BA 1NCRB 3DKQA 3IBMA 2WFPA 3KZ4C 5KHIA 2JDYA 5LCWL 3H8RA 2JA5L 3PUQA 1BVP1 3AZXA 3VBHB 3LCPA 2YU9L 2YG0A 2AUSB 3C7FA 3SKJE 1LOEA 1V6IA 1LJ7A 3MIBA 2YC0A 4XJUA 1U12A 4S2FA 2QKDA 3DPRB 4N43A 3U07A 1O3TA 1FX5A 3ZFGC 3OOXA 3VBFB 1YRZA 1WBLA 3WEZA 2JEMA 3VD5A 3CMGA 5FYBA 2VOVA 2WYFA 4X8NA 3TBDA 5FZ0A 2M4YA 4GJYA 1W39A 2GH2A 4LO4B 1QOTA 2WT0A 2XJRA 3LA3A 3I3EA 3ACLA 3R4SA 4R9BA 3C7HA 3POWA 3IT8A 5F39A 3WW1A 1LKOA 4RFRB 1NQDA 3LWPB 5CEHA 2FDJA 4NHKA 5HXMA 4KU7A 3PKIA 1JZ8A 4BYYA 2ZOEB 1VAKA 1R1A1 2BTVC 3AZWA 5FPXA 1C4RA 1OUSA 4QQPA 5CKQA 2GALA 5L19A 3ZLIA 4A3LL 4S2DA 3RZ6A 4KGQA 1K3IA 5FXZA 3D5OA 2VZVA 2ZMNA 1OBNA 1JH5A 2H0BA 4MLOA 1DLLA 4RL7A 2Y6LA 4LA3A 2VUDA 3HOZL 1R1A3 4QX3A 1GANA 1UCXA 1XYNA 3J7LA 5EHDA 4NIIA 3RI8A 5FZ9A 1WLDA 3HVDA 2J1TA 5CYYA 5C5TA 3VBUC 4UBHA 5JOYA 3ACFA 1GFF2 1QH7A 1W9TA 2VNVA 2I45A 5BUVA 1AYN1 3A0KA 3BTZA 3OPZA 3GBGA 3S30A 4A3BL 1TE1B 2OQ6A 3EBRA 3VZOA 1FPN2 1FMD3 1QQTA 3K3NA 3NO8A 1ULGA 3RWNA 4QX1A 1QJX2 1HRI2 1YO8A 3S2DL 2FQPA 2VQTA 5J3UA 5D2AA 3ZXFA 4QPGB 3VHNA 1S0GA 4NRPA 5C5UA 4QGLA 3NSTA 1AYN3 3MYXA 3NNGA 5K0UC 1IRNA 5RXNA 2PYTA 1EV12 2Z79A 2XJTA 1Y1VL 1A8MA 3ALQA 3KB5A 3RNSA 4CDXA 1SMWA 3GJBA 1QDCA 5BNOC 1AR82 2F4LA 4LE3A 1WMFA 3T2QA 3VBSC 3OGGA 1B09A 4URAA 3GTPL 3M3CA 4NE9A 4ZXEA 5LB6A 5JXHA 1REDA 4P02B 4A44A 4Z8BA 5FZEA 2V4VA 4CP9B 2VL6A 1GZ9A 2V0EA 3H97A 4L92A 2P2KA 4DEVA 3KT1A 4XAEA 4FAHA 5KXBA 1CGPA 3E5XA 1DGLA 4IE6A 4FSJA 1DDLA 2Y6FA 5IFPA 3UGGA 1RDVA 2UWBA 4FCAA 4CRQA 5GJ6A 2ERJA 3GZEA 2IXIA 5FZ6A 4BMEA 3B08B 2Q1MA 1ENXA 4NWVA 4IE0A 5L73A 2Z3QB 1GZCA 2QDRA 5IYCL 2FDKA 1HIXA 1XE8A 2ZTNA 5F32A 4W6XA 4XW3A 1S0DA 1VBA2 4QXBA 3PZAA 2ARBA 5J98B 4NHMA 1PGSA 1LENA 4OHWA 3I3BA 3QACA 4CDQC 4Y7NL 1T2XA 1GBGA 4JDOA 1LKMA 1GWMA 2MNGA 4AFDA 2DU0A 2H12A 2D5HA 3N9LA 4YFZA 4OCTA 3LWVB 1PO11 1WMEA 4XURA 2RM22 1UNBA 3EYPA 1G9FA 3DF0A 1HB3A 2DFCA 3LEGA 1YQ2A 3ETQA 3CJIA 4I02A 2YC4A 1H30A 2JI1A 2HWD2 1VIWB 2YDEA 2OX0A 2ZGUA 1N1VA 1TME3 1H0BA 2ET1A 3ZDSA 4LULA 4KWLA 1W28A 2WNUC 1PO13 4DUWA 4E2GA 1G9DA 4BXXL 2V73A 1QJY2 4NPRA 4X8PA 1JYBA 3MUY1 3KYYA 1MVQA 1ZZ7A 3J7MA 2XPJA 1ODHA 1YQ6A 2GU9A 4LA2A 5GZFA 1FATA 1MS4A 3PKJA 2V09A 3SS2A 2DFBA 1CAUA 3GTJL 2K46A 2YPJA 4Y1ZA 4ITCA 4CTEA 3O1SA 3VD4A 1NG0A 3RYRA 1HJFA 3HN3A 3LWOB 3O0WA 2VJXA 5FWEA 4DUXA 1IOAA 5FZDA 1HQLA 4QIWP 1P8JA 1VB2A 2Y34A 4LBKA 4XJAA 5FREA 1SLIA 2BPA2 1IW7D 2FCUA 2AENA 5H9QA 4GMP3 3V64A 1JHNA 4UY81 3MV01 2W1SA 3ZYHA 1H1MA 4J1XA 5FO7B 4RQPC 5DAQA 1CVNA 2R071 5J1XA 2B9UA 5JXJA 1MEC2 1R0HA 3BYWA 5E88A 1TEIA 3A22A 4LLOA 4QU2A 1EP0A 2JB4A 5IVBA 5DAVA 5IJRA 5KHKA 2DYCA 4A93L 4QQLA 3TEZA 1S0CA 3U4XA 4P00B 5FKBA 1VRH2 4TPUA 2PLV3 2R073 2JDNA 2EXJA 3PMEA 2GH8A 5A6ZA 4PDWC 4IEWA 2QDNA 2QJVA 4QDSA 1DGWA 4QDQA 4XBLA 4PQ9A 3B3QE 4MGIE 2PHUA 2Q8CA 2W95A 2OYZA 4BWOA 3AJZA 3I49A 4META 2ZZQA 1LULA 4RN5A 1HRI1 5DMYA 1H4HA 3U37A 4A3KL 5FZGA 1K5MC 2BBVA 1JOPA 2A75A 4GH4A 3O1PA 4WVMA 3O1OA 2Q30A 1F5JA 2VUCA 3BB6A 4AZZA 1EV11 3RSJA 1TZOA 5JVH1 3CZUA 3NNLA 2GC0A 4FPGA 2XDVA 2TUNA 1HRI3 5LA2A 2Y33A 5ABJC 4ZKTB 1YK5A 5MFPA 3G7DA 3IDAA 3UETA 4OUEA 1DBNA 1UO9A 3H3VM 1O4ZA 2WS93 5DZGA 4YW5A 4RS5A 2P3JA 4PIYA 3WP4A 2JE9A 5HCAA 2XHKA 2AEYA 2WWUA 1Y7BA 2C9KA 3I2KA 1D4M2 2A6XA 2LM3A 2F17A 4XUQA 1HB2A 4XIOA 1C1FA 1UIKA 5IUQA 1XYOA 1E5RA 5L9BA 5L7OC 2B4KA 1ULPA 1T9OA 3KWVA 1WZXA 1YYNA 4HN1A 1H2NA 1B35A 2PTMA 4J1WA 4LO8A 1EAH1 3ZKUA 5HCFA 4V196 1OFSA 2PAEA 5FJHA 3BI3A 3TEWA 1Y4WA 1I9RA 3HQRA 3LOIA 3GTKL 2V5DA 2OXBA 3KVAA 2XJUA 2W9XA 3PLQA 2XVKA 4LBNA 5DQ0A 1WA6X 1Q43A 2DU1A 3OGSA 4CA9A 1XJAA 2X05A 1QJFA 1UZYA 1LOFA 1ND2B 4QPIC 4WZCA 2WN3A 2VW1A 1EAH3 1O5UA 3W5NA 3OBAA 2BE5D 4PBOA 4A7ZA 2VBDA 5CFDA 1W8NA 3MDPA 4RYDA 5B4NA 3MGUA 3CNAA 3U14A 2RM21 4Q4Y2 4ASLA 2Y0SP 2AYHA 1RB9A 3WHUA 4AFAA 4BE3A 3RZGA 3S1QL 1P7PA 5FMDA 2BWCA 3KCCA 5GAHc 1OA3A 1ZA4A 3GNEA 1HDKA 1IS6A 3USUA 4RGGA 4OHVA 1QJY1 5IVEA 2K0GA 1WBFA 3MQKB 3S6PA 1OF4A 2CYFA 3E6BA 3ZYGA 4JGYB 1ZRCA 4YFWA 2WSVA 4DO0A 2GMGA 3N9NA 5AC91 2GC3A 2FZ2A 2QL0A 4DS0A 2W91A 5EXOA 2XUEA 5I0TA 1B71A 1PFWA 5HPOA 1VRBA 3B94A 3RMYA 1YCIA 1QJY3 2JG8B 4BZ4A 1BJQA 1NA1A 2WJSA 3MIHA 1JZ5A 4OMDA 3KHCA 5JLVA 5JWPA 1EY2A 4Q8LA 5FYZA 3KHBA 4JAEA 2XLGA 1PX3A 2YHJA 4JVAA 2QQOA 2QQVA 2HWC3 1V6JA 2HBTA 2B5HA 1SMMA 2W1UA 4XJ8A 3TN93 5AC93 4UBGA 4OMCA 4XQWA 5GALA 5M3FL 3CLPA 3DXUA 3AFGA 1MEC1 1NCRC 2RS12 1W8ZA 4YYOA 3I2GA 1NT0A 2PMZP 3HNYM 3AL6A 3HR9A 3NQHA 5IK4A 4CCEA 4LBOA 2N7GA 1ULDA 4AK3A 2Z4FA 5BNPA 3LF7A 4PF1A 4C2M1 4XAAA 5FPZA 2LTNA 3I2IA 4L97A 2JDAA 3ZN5A 4AEMA 3AM2A 4TLGA 4Y4YA 3RRDA 3OD4A 3TEXA 3M4OL 2Y8KA 3N7MA 4MUVA 4NN0A 2ID4A 3VBFC 4TWTA 3ZKYA 3MPSA 1IQAA 4QXHA 3QVDA 1PVXA 4YARA 3ZYBA 3GXUA 4D6SA 1UY3A 2ARCA 5C9AA 3P1IA 2BZDA 3FN9A 1PMIA 1F35A 2Z42A 3CJXA 2L0ZA 2RMU2 3AXEA 4XDPA 5GKAC 1QWRA 4IW3A 4NPLA 4KBBA 2HWB3 2LCQA 3POSA 1TMF1 5T54A 4FFIA 1AYM1 2CKCA 4LHLA 4GKXA 3EXUA 1YQCA 4IE4A 4V2VA 3VZKA 4AEJA 5M5WL 3ZXDA 3NAPA 2QNKA 2XBO2 3ECQA 4BQYA 1JYWA 3HD8B 3I2OA 1UOBA 5IK7A 1NLQA 1TVGA 3FBYA 3ES4A 3OY8A 3DXTA 3L9JT 1CAXB 1TMF3 2XG3A 2Y64A 3PDQA 4PLOA 1AYM3 1BBT1 2GNBA 2R061 2A3XA 2PHRA 3JQWA 1MVEA 1D4M1 1OLMA 2AR6A 4LR4A 2R0FA 2A6HD 2WAOA 4BJ0A 3S16L 1DP0A 1W6OB 3NJVA 3M4FA 2BV4A 2XVLA 4XDOA 3FDJA 1PNGA 1L3JA 1JODA 4YVSA 5KC5A 1BBT3 2DVFA 2EIGA 5JVG1 2R063 3M1HA 3QD6A 4HETA 3T2PA 5FP8A 3WDUA 1D4M3 1MS5A 5FLHA 3MW4A 2Y0IA 2A3YA 4AF9A 4AVCA 2VUJA 4QPGC 3IIAA 5FO9B 1RVF1 3HIFA 1W6MA 1NXD1 4HLTA 4OULA 2VCAA 5LATA 4CDUB 3N9OA 4NIGA 5FPVA 1TNFA 2WINB 1W90A 4AVSA 2W46A 3JQXA 2A3WA 3ZYPA 3UV9A 1MPXA 2YC2A 3LEIA 1I6XA 1W8WA 5C3SA 4MXWB 1RVF3 1YUXA 1PK6B 2W1WA 4BQWA 3PO3L 2WC2A 3I97A 3R4UA 2LUWA 3B02A 3B9IA 4FOYA 1E57A 4BQ4A 3POBA 4HVQA 1RB8G 1JW6A 5FZHA 4FVVA 1U5ZA 4P9JA 1I3HA 1BEV3 3J9SA 5EFUA 4LQRA 1A6CA 3WF0A 3AYDA 4ISRA 1U5IA 5HCBA 3ZO0B 4GB31 3RZDL 4L0PA 1ZRIA 2JKBA 2VW2A 1JYCA 1DHKB 2AEZA 4M4RA 4K8RB 3WQ1A 2NMNA 1AXZA 2OKXA 1R081 2WT1A 1DLCA 4N7IA 4PHZA 2R92L 4Z07A 5LBCA 4GB33 4KBZA 3KQRA 4BQ2A 2RJLA 4O61A 1VBC1 3H99A 4QB6A 4CCOA 3P8BA 5EJ1B 1C3HA 2BVVA 3NWKA 4C0BA 1CX4A 1R083 1HLCA 5F6LB 4N9HA 1JUIA 1TWAL 3AYAA 3UJQA 5IYYA 4IEQA 2P3KA 3UKNA 1PIV2 3ZFFA 3ZM8A 2Q8OA 4Z1VA 4IV1B 1VBC3 1W2TA 1H4GA 2D93A 1WJVA 3MUZ1 1ULFA 3C7EA 3FFZA 4HVRA 4C1WA 2RDSA 1YI7A 1UL9A 2JKXA 5JOZA 4MGQA 3N9QA 4QXKA 4C8DA 1EPWA 3M70A 3O1VA 5FDBA 1JYNA 5M5YL 2UWAA 1NXMA 4JTNA 4W50A 4CEWA 2G4IA 1SCRA 2WLQA 5FY5A 2EAKA 4AR3A 3WQBA 2X8KA 2ZHMA 3QOPA 4R4XA 4Q0PA 5EP9A 4RHV2 4A7KA 5I0RA 1NLRA 2RS52 2M6OA 2ARXA 2XB6C 3HBKA 3D4KA 3HQUA 4CYDA 3OGVA 5K9YA 1IKPA 5LEJA 3Q9OA 1IHMA 3VL9A 4KH9A 4DXTA 4MGSA 3NKGA 5GLTA 2RS33 5FZKA 1OKOA 1GSLA 2MS3A 1RUD1 2GN3A 3FUQA 3OEBA 1GQPA 2PHLA 3OYWA 4HKOA 3LDBA 3RJRA 3WDYA 3ZFEA 5DAWA 1UD1A 1GP6A 2X09A 4GWNA 1V70A 4Q8KA 1LR5A 2HH9A 1XYPA 1FAYA 2GNMA 2VNGA 2XBO1 4L8QA 2B42B 2WLPA 4LBLA 2WB1P 1MQTA 4BHPA 3K46A 4IUGA 1O3SA 1FI2A 1RUD3 2JJ6A 3OPWA 4GAZA 1WD3A 3ZFGA 2J22A 4PCRA 2IXHA 1S0IA 1PM7A 1UZWA 1H9WA 4KWKA 5IVJA 4O65A 3MSUA 2C26A 1S2ZA 1F2NA 1XNAA 5CISA 2JENA 2WFF2 4DNYA 4NHLA 4FOVA 2GP3A 4CU6A 3ZSKA 2BNOA 4TVMA 2QQKA 3OSDA 5SV8A 4OQ9A 2E7QA 1QCVA 4HBNA 4COVA 3K2OA 4IGQA 2OQ7A 5EYXA 1LEMA 4AI1A 1WMXA 5E89A 3NJXA 5MLC3 2WUHA 2W2IA 2ZX0A 2YBSA 3AMQA 1ZM1A 5CNAA 4MSVA 2TEPA 1J83A 1W0PA 4KMQA 5A3WA 3ETPA 1RUJ2 5FZ1A 3VV1A 5FOBB 1VBE2 4HN0A 1ONAA 3T4HB 1BQ9A 4X6AL 4CXWA 3H7YA 1XNCA 4JHZA 3LWRB 1HXS2 3WNKA 1T9QA 5T3NA 3USSA 3ABZA 1CAWB 5FCCA 4A3CL 4EV0A 1J1TA 3RMXA 2D7FA 2QQIA 3VBUA 5C8CB 3PVBB 1S0EA 3IDBB 3IAPA 3GTML 5FMOS 3J7HA 2VTXA 1B2JA 3NNFA 3S5QA 2DUPA 1TQ5A 2BWAA 1F9KA 1SG3A 3KS7A 4TTGA 3MIDA 2XWJB 1C28A 1A78A 4ASKA 3ZN6A 4TSVA 3ASIA 4AQTA 4P9GA 5D8AB 3PU8A 3ST7A 3T0DA 2VE1A 4XFIA 5F2SA 5K0UA 1Y9GA 1JMUB 4IEOA 3LPEB 4MH0E 2NYDA 1CIYA 2ZXQA 4FI9A 4Y24A 2XQXA 2IUWA 4COZA 2CGOA 2B7YA 1US2A 2BJSA 3WD5A 5BNOA 1ND2C 4QKBA 4AYUA 3VBSA 4HK8A 1TWGL 1NYWA 2BNMA 5C3EL 3W20A 1QOSA 1I5ZA 1AJKA 3W9AA 3GGLA 2JIJA 5CKNA 2OIIA 3KYUA 1LRHA 3CBNA 4LOTA 3IN9A 1WCML 1AL22 3LWQB 3KM5A 1F8VA 3WCSA 4D7YA 1UY0A 4Q4V3 3H0GL 5FZ7A 3AP4A 1T9PA 5I93A 3I8TA 5A3TA 5DUVA 2GN7A 4QB1A 4Q0UA 2XR4A 5F3IA 1SLCA 5CBLA 1KJRA 5C71A 2OZ6A 2Q1FA 1S30A 4IEXA 1R093 3VDDA 1IQDC 1YJLA 4CSWA 4OUMA 3B7MA 5B2GB 1GP5A 3TAYA 1RHI3 3RPQA 1XNDA 1AL0G 4RHV1 3KCYA 4UFLA 3H9CA 1PGW2 1W6PB 3LD8A 1XE0A 4IXLA 4V1PA 4YW1A 1RTVA 4CDQA 4AWDA 3ACIA 2E2IL 3IB3A 1O3QA 4ZY9A 2ZGMA 2JG8C 4YZ5A 1AR72 4XETA 4DINB 5IY0A 4QKDA 1HRV2 1VP6A 4BMBA 1RUF1 5JSPA 4R4ZA 2WNEA 1UU4A 3VZJA 4AEDB 5FMOL 3SCGA 4UFIA 1ZBE2 5DG2A 1PVC3 1LTLA 3AZVA 1NXEA 2KR2A 1W6QB 5FYCA 3AYEA 2VL4A 1F4AA 2QQLA 2J42A 3Q8AA 2D5FA 3J7Y1 1VZHA 1NLSA 2XXZA 1VAMA 2W39A 1RUF3 4NAMA 4UWDA 1XQNA 4YG0A 1JZ2A 1RJ8A 1YQ8A 1JN2P 4XUNA 4XXBB 1PZXA 3ZXLA 3T2TA 2W5FA 1PMHX 5A32A 4RR3A 1J58A 5CB7A 3JB4C 3ZDVA 4JKMA 1Y9MA 1S55A 4QAWA 4AEKA 2OS2A 3AB0A 3RZKA 4LITA 2FHRA 2I07B 4YWMA 2IXJA 3WOGA 5HI0A 3UL2A 4BY7L 5IVYA 2HWF2 1DZRA 4I09A 1KXGA 1W8TA 2X5IB 5K2ME 2QQJA 2KM2A 2WKKA 1YK4A 5GZDA 3KCXA 2WBKA 4LKDA 4GS7D 5IP7L 4YGBA 5EWSA 4P9LA 4Q2FA 3AMHA 3ZOIA 4MG2A 2NZ9A 2HVYC 3U4SA 3W58A 1VMFA 1O7FA 1RUJ1 4I3GA 4LBQA 4GKYA 5FZFA 4AGGA 3V0BA 1K45A 3A7QA 4CE8A 1UMZA 2PYAA 2J1RA 3KVBA 2B9VA 1SDWA 1CZSA 1R0GA 4P9XA 3K3OA 5AFBA 3AL5A 4XZUG 3GM8A 4XVHA 4A3EL 1VMHA 5FPLA 5J7MA 1RUJ3 1JZ3A 4COYA 4FPCA 1W99A 4PDWA 1OQ1A 3S0MA 3LEMA 1L7RA 4LEJA 3HT1A 4NWWA 5GAGc 1DQ2A 4HG6B 2Q8EA 1JYVA 2XQRA 4BY1L 1R0JA 4A3IL 3DEMA 4FPLA 5A7OA 4GWJA 1SLAA 3O0XA 3PL0A 3SNMA 5LY2A 2E53A 3MW2A 1OLME 2D6NA 2X29A 2BP6A 2C5DA 4CCDA 2R6QA 2QVSB 4LT5A 2XL7A 3GF6A 4CDUC 1LKPA 3AVSA 3POIA 5ABJA 4NIHA 1SACA 3EJKA 4HVOA 3TWIA 2JA7L 1ZBA2 2W68A 3AJYA 1RMU2 4BQ1A 3H3LA 4LNVA 4CDXB 2VOKA 2IVIB 2HYKA 3BN6A 1AHSA 3EQEA 5DZEA 5IWFA 1PK6C 1PFVA 1V6KA 3DL3A 4JV4A 4FPJA 4O9GA 1S2BA 2QE3A 3MZHA 5A3OA 5F5QA 2XLFA 4LBJA 3H1YA 5IVFA 3DKWA 5L7OA 1U5XA 1DQ0A 3LAGA 2GC1A 3S14L 2VZSA 3GCWA 3JXSA 5F2WA 4N9IA 4BCUA 2Y60A 4Q0SA 1VBD1 4CU8A 5HBAA 3N7KA 3SCFA 4CCJA 1ASJ2 2XOMA 2EXHA 5KHGA 4YZ1A 3AZZA 4M3CF 4FPHA 3ZIXA 4GD4A 3M3IA 4XPVA 2AUYA 3ZSMA 4XMAA 1OURA 4QPIA 1K12A 3NKTA 1VBD3 3UT0A 1G8WA 5DDJ1 2A6YA 1GP4A 4G6BA 5GM0A 1R0FA 5A3UA 1BLZA 3O5SA 2E2JL 1QJEA 4IEYA 1VE0A 4JAAA 1QMJA 4YSFA 5DXDA 3LE0A 1Z0HA 2HR5A 2YXSA 4BIOA 2E51A 4Y5TA 4XJ9A 5LA1A 2DCTA 1GZTA 5DDJ3 4X6RB 1G9AA 4P9WA 3N4MA 4BBRL 2P3IA 3QH6A 4CEYB 3HEIA 4IV1C 1EYBA 4H2AA 3W59A 3KV5A 3E6CC 3SH4A 1QY4A 3IMNA 5IAVA 1YFWA 5IK5A 3VBRA 3RJ2X 2C24A 2ZX1A 2HWE2 1TG7A 4XFCA 1POV0 3B69A 2EIBA 2BGPA 1DYKA 1LHUA 3B00A 3CJIB 3NV4A 5T55A 5JZGC 4JGZC 4Y5SA 1ZYBA 3MHZA 4FXKB 3H8OA 4YPJA 4BLJA 2VC9A 2ERFA 1XC6A 1IZ3A 1OC1A 4R9CA 1ZZ6A 3HOUL 2ZACA 4B3NA 1D0GA 4Q29A 1W2UA 5K8SA 4WM8C 4QHOA 1APNA 5C4JL 1S1AA 4ET7A 1ZRDA 1W05A 2IC1A 4BH9A 1UZZA 3HMYA 2ET7A 2XMLA 4N7UA 2DTYA 4LK6A 1I5PA 1NCRA 3GHMA 2EXKA 4LK7A 1DGRN 1C1LA 1QNYA 1LESA 2GZWA 1IS4A 2Q5TA 3AC0A 5JUVA 4CDWA 2R042 3ZSLA 5FY4A 2WT2A 1ENSA 2BDRA 5FP9A 3PVNA 5FYHA 3VBOC 3T09A 2Q4SA 1MZ5A 4I0AA 3WP5A 2VD7A 1O6UA 1PGL2 2ZMLA 3H3UA 2HKXA 4LHNA 3VBFA 5FYTA 1OWCA 2DF7A 3P5BA 1OH4A 2JWPA 2VO5A 5JI9A 3ZXGA 1YV1A 1Y3TA 4AVBA 4C3JL 2DCJA 2ZHLA 3U75A 4ZZ8A 3BGAA 1RUE2 4NO4A 4IV3C 4K9SA 3H7JA 4WV8A 1PZ8A 2YFZA 4ORFA 4Q1PA 1W2OA 2UY9A 5JPNB 4YZ4A 3MF6A 2DCKA 1IPJA 3E5UA 2ZJCA 4OI1A 1BXHA 5ACA1 1CZTA 4CPBA 2DSXA 2OW4A 4QB2A 1I6HL 4Y20B 2VTXJ 3MIFA 4BBSL 2JG9A 5FK8A 1V6OA 4WVMB 2OA2A 3VL8A 2FMYA 4KL1A 1VZGA 1W0OA 1CONA 4XXPA 3U11A 2VCBA 3KF3A 5ACA3 4ARYA 5F9TA 2QQPA 4FTBA 1REFA 4Y22B 3WW2A 1W06A 5IATA 3MPBA 1X7NA 4R8HA 3BU0A 3ZMNA 3RZTA 5FZOA 4XOGA 4Y52L 4RS5B 5D1IA 1GZWA 2ZHKA 4RSUA 5GLWA 4AAXA 1GNHA 5E16A 5F3CA 5JMCA 4PLNA 2W47A 3WF4A 1EUTA 1HW5A 4E4SA 1WCSA 5EQUA 1COV2 3ROUA 3ZSJA 1ASJ1 4Q4X2 2Y6HA 4FPEA 1V00A 2KA3A 3APBA 4P5YA 4AHXA 3I4NL 1WGPA 4LPLA 4A3XA 1Z7S2 1V6LA 5CAZA 4QPGA 1W2AX 5D8AC 1MS8A 4YM1A 1J3RA 1B35B 5G05L 1U5YA 1W03A 1C8M2 2TBVA 4DQAA 1ASJ3 4BISA 3GHNA 1X9TA 2A73B 3CQOA 2PHWA 1G9BA 1UYXA 2NP0A 1AZDA 3TNPB 4ZN1B 1WLCA 5FQ0A 1N3OA 3LIHA 2UU8A 1CESA 3AKSA 1DZTA 1YHFA 4C3IL 2ADEA 2E31A 1WLWA 2IXCA 4A2UA 4Z2AA 1AJOA 3VHOA 3ZVXA 1BQPA 4J25A 1W04A 4YWAA 1QXJA 1WLTA 4GZ9A 4XDQA 1AX0A 1FPN1 1RYQA 2H0VA 1SMUA 1N47A 1W2NA 2A71A 2HWE1 2QFEA 2VQUA 2WL1A 3U10A 4DY5A 1QJX1 4LBMA 3VHRA 3WF1A 3R0RA 1E5SA 4QM8A 4PI0A 4AFBA 4FQZA 1X50A 3SC7X 2CY6A 1NUKA 2UYAA 3PJQA 3K4ZA 4FT8A 3OB8A 4I01A 4M3CA 4UW5A 3KYXA 1FPN3 2D6LX 2HWE3 3CDZB 4C1XA 1AR62 1AR81 5LA0A 1XSQA 1QJX3 1UX7A 2FZ1A 3NL1A 2ZIXA 2ORZA 5GLUA 5A1AA 1W9FA 2QQWA 3EO6A 1NA1B 1EV13 3WNPA 4D8MA 3V0AB 1A3KA 1WKYA 3NNMA 1GOHA 1FV2A 1ZNPA 4AEDC 5FZAA 1AR83 1OVPA 1WW4A 2FMDA 3IDCB 4XFBA 2W0XA 3MPPG 2WN2A 3GZUC 4NHXA 5CKMA 3LKJA 3V65A 4BK4A 3CEWA 1NY72 4AR6A 4R52A 5EJZB 3P3NA 1LODA 4FP3A 5A33A 2B39A 3L2HA 2AGSA 2J1VA 3OBZA 3ON7A 1JI6A 1WWYA 3OUIA 3PNAA 4MYEA 5DABA 5IP9L 1VBA1 4NPMA 5JOWA 3N9MA 5FBJA 1W6NB 5BNPB 3UGHA 2VOXA 2HLEA 4YVWA 2CGPA 1JZ6A 6RXNA 1EUUA 1JTZX 4NIAA 5CFCB 1OKQA 1R1ZA 2C1FA 1QQP2 4AVTA 4P9IA 4CP2A 1RUE1 3CZJA 2ZHNA 4L2NA 2BU9A 4CU7A 5H1Sc 4AI3A 4XFGA 2FCTA 1AXKA 2WA4A 4AI0A 3PJYA 2IZWA 3RZJA 4DXRA 1HJGA 3KQ4B 3KLSA 1VBA3 2X5IC 3PIGA 3VB9A 3AXDA 3GYDA 4YZ2A 3VKOA 1DU3D 3CQZL 4AHWA 2G9GA 2VZ1A 5C9AB 4ARXA 1Q56A 5A70A 4LIVA 5MGNA 2KN9A 3HOYL 3FHQA 4CUBA 2HWD1 5FFOC 5EIOC 3DECA 2D40A 3LQCA 5F5CA 1CAVA 2RM23 5DM71 1RL3A 2MEV2 4YW7A 3NW4A 5JAXA 2IVJA 4ATFA 1BRFA 2WQZC 1KJLA 4GWIA 5EPAA 1JU4A 1VLNA 3NAPB 1DYPA 1QJU2 4XHBA 3SITA 2YB7A 4CUAA 5EINC 4BXSV 1C57A 2HWD3 2D98A 1LOAA 1XE7A 2WWJA 2X10A 3D3AA 4XJWA 1OOPA 1WMDA 3TB0A 3LA2A 4HPKA 2RFKB 3WP6A 1QGLA 3T1MA 1RUI2 4F8AA 3JU9A 4JHTA 5JSRA 1KS4A 1LCLA 1X8MA 2ATFA 4OHXA 2OT7A 1GICA 4RD7A 2PELA 1PX4A 4A3JL 4BM8A 4K21A 1D4VB 4A4AA 2P34A 3NJYA 5FZ8A 1ULEA 2WNVA 4JAFA 2ZGLA 5J37A 3KGZA 1ZZ8A 4M01A 2FDFA 2VZPA 3FBMA 1SQ4A 4DB5A 2VUAA 3AZYA 3IAQA 3QLQA 2R7ZL 4XBNA 3ORJA 5F5AA 3VBHC 1UWWA 1IU6A 1RUOA 1LGNA 5JIUA 1BK0A 4NUBA 4UFJA 1Q8QA 4YW4A 2CWMA 4LKEA 2WO7A 4UF0A 5BYNA 2WYSA 5MFZA 1VRH1 2H6BA 4CVUA 3DPRC 3BKZA 8RXNA 1MEC3 2CTVA 1Q5OA 2BYVE 4PLMA 3VD7A 5FZIA 4DZGA 3WWNB 2QTWB 2WNOA 3UK9A 1JHJA 3BTYA 1X82A 4XFHA 2V5YA 3FE5A 4KQ7A 4NRMA 3S17L 2EVXA 4LUKA 5A1FA 1POQA 3T4VA 5FY8A 5C3RA 1WW7A 3BTAA 3FLRA 3ZIWA 4P08A 5I8SA 1VRH3 3H1MA 4TN7A 4QT6A 1S24A 2VZQA 3SH3A 4YG6A 3F2ZA 1NE4A 4KWJA 2FCVA 1QDOA 4HSJA 4WM7A 1FNZA 3GBFA 3GTOL 4RA0A 1AR61 3HNBM 1PFYA 5JOXA 1ND2A 3UGFA 1F15A 4HT1T 5GZGA 5GZEA 2W94A 2D6MA 2DBNA 1H9PA 1WA4A 3CO2A 2JDZA 1V0AA 4E2QA 3OUHA 4OYUA 5IK8A 4A45A 4JDMA 4FOWA 1AR63 5GLZA 2HEWF 3HT2A 5CA6A 4CEYC 2GMPA 3IDEA 2VECA 3POEA 3SMHA 1YUDA 3E97A 2DVAA 5DUUA 1FT9A 3NFPI 4LUMA 1ZRRA 2KXLA 2ZEXA 4FPKA 4DOUA 3VKMA 1JZ4A 2Q1ZB 1E5IA 3IPVA 1M4WA 5KBFA 4IEZA 3AMNA 3THCA 2A6WA 4A3GL 5IYBL 4AE2A 2LW8A 1GOGA 3O14A 2JG8A 4XF9A 1IG0A 1AR92 1YC61 3FX3A 5LY1A 3ZSEA 3TRSB 4CCLA 4U2AA 4I0BA 3SQOA 1CX1A 1UU6A 3Q8FA 4GWMA 4Q4Y1 5L9RA 3M3OA 3JD72 4M0NA 5FTTC 5FYMA 1CPNA 5A80A 1SZBA 2V0FA 5C4WA 4N53A 2MHFA 4PI2A 3ZYIB 3S57A 1GKBA 1N1YA 2EAAA 3QCWA 4XFFA 4DRVA 2E9QA 4EWDA 1LGBA 5LK7B 4O9EA 3ZFEB 1NNQA 1Q8VA 3D0JA 4Q4Y3 4Q4W2 4CCMA 3FZ3A 4I2OA 1HV0A 2QQMA 5CIRA 4AI9A 2WA3A 1KS5A 1GLHA 1OD3A 3WLUA 1DYOA 2WAAA 5L36A 1MQTB 4PT6A 3VN4A 5ERLA 3HQXA 5I0UA 1O59A 1I3QL 2K2DA 1GMMA 3ZFGB 2HYXA 4D69A 1H8TA 5F1RA 4EZHA 3UJOA 5FO8B 1CZVA 1UMHA 5JPMB 5E8AA 3U78A 4WVVA 4QQHA 3PURA 4Y1YA 1BYHA 2NVYL 1N1SA 3E5QA 4SBVA 1V9U2 4XJZA 4EJRA 4XGHA 1V6MA 2RS11 5LRRA 3VUOA 4KGGA 4B4QA 4DRRA 3IIIA 1RGSA 2VMEA 4K40A 1LNSA 4EWEA 5BNNB 1GWKA 2AQCA 2BOJA 1UYPA 3I7DA 5FPAA 1ZA7A 4XILA 3U1XA 2JX9A 1LU2A 1N3QA 2WO3A 1ND3A 1XPWA 4QWNA 3EMRA 2RS13 1LKNA 2VMCA 3WG2A 1CAXA 1KD7A 1OH3A 2WABA 3AKPA 2PVXA 2ILMA 4Q5OA 3H8XA 4C3HL 1HN0A 3FFQA 1UOGA 1W9YA 4LO7A 4RS5C 5LEKA 3AKRA 3N7LA 4IEUA 5FOJB 2XLAA 1RJ7A 1UMIA 4D6RA 2RR12 2RMU1 4FAGA 4M4PA 3AFKA 1YWKA 3IM0A 1BE7A 4JRAA 2CKAA 4PF5A 2XVGA 3T2OA 1B35C 3ZN6B 4CDUA 5LBFA 4URTA 3R6SA 4E8CA 1SBEA 3TOJA 1DCSA 2RMU3 1POV1 4AFMA 1LTEA 2ZKNA 1DIWA 3L2YA 1NCQB 1OA2A 1H1IA 4NVPA 4QXCA 4Z82A 3AX4A 5F5IA 3T0BA 3VKLA 5FK7A 3WNOA 5BNOB 4NJ4A 5A7NA 4LTAA
chains in the Genus database with same CATH topology
1PK6A 1E8JA 3MW3A 2GSYA 4R9DA 1X8EA 4LHKA 4Y26A 4BA6A 2XBO3 5T5OA 1ENRA 4P5HA 2BGCA 1POV3 1PZ9A 3PVOA 4QMAA 3AKTA 4UXAA 4NOTA 3ZMOA 3GZTB 4YGEA 1QOOA 1O4YA 5T5PA 1OPMA 2P17A 1LOGA 1YFYA 2Z3RB 1OQEA 5CVRA 3THPA 2A5ZA 3VDDB 3WDWA 1DF0A 1FV3A 4ZN3B 4AG4A 3PVEA 2I2SA 2ETEA 1XXNA 3J8F2 4K9FA 2ZCWA 4M3CE 5A3LA 3JD71 2E6VA 2DWRA 4AI2A 2A6VA 3RI9A 3THTA 1DQ1A 3UKTA 1F5FA 4IV1A 4EN0A 3LNLA 4XMIA 4AHYA 3M3QA 2B5ID 2A6ZA 2LALA 3N3HA 1IKQA 2DCZA 3PIP1 2OPKA 2ES3A 1GNZA 2PN5A 5JZGA 1UX6A 4JGZA 3ZPYA 1JYIA 2AZ5A 4Q26A 3WG1A 5BNPC 2ZGKA 1WD4A 5DM61 4ONUA 1CADA 3KYVA 4L99A 5CFCC 1RUC2 3HBZA 2A7AA 3WUCA 5A32B 4RR3B 4WM8A 2ZAAA 1G6NA 1UIJA 1PNFA 2EF6A 2WZR2 1VZIA 3LB9A 5FLJA 1RUH2 1PIV1 3VKNA 3C2UA 3CU7A 1J59A 4RGAA 5C9AC 4LE4A 4FBFA 1BMV2 4C0HA 1JUHA 2Z2SB 5J09A 3WP3A 1ZRPA 4TYSA 5IT6A 3VBOA 4LBQB 2R30A 1PIV3 2UY8A 3WXPA 1YXWA 2AREA 3HN1A 3M7AA 4GXLA 4H14A 1I1EA 4JGYC 2PAMA 3ILFA 2YMZA 2RS51 2XWBB 2C6AA 4AQSA 4AI8A 4BOWA 4DMIA 3V56A 4QGMA 2E63A 4YM2A 4AVVA 4IV3A 1UN1A 4XHXA 4YW2A 1OSGA 1PO22 3WY6A 2RR11 5BV6A 1H7VA 1LHOA 2HEVF 3J26N 4YM0A 4YG3A 3RQ0A 1MZFA 4RHV3 4FPYA 2RS53 4HANA 3ZX7A 4K1ZA 1MZEA 1H8VA 4HSLA 5I8TA 2RR13 3ZXJA 4ZU7A 1F31A 1R1A2 2WNUA 5EZWA 4HKWA 4AXOA 1SLTA 4IETA 4XTMA 1AX2A 4EN7B 1BVVA 2A70A 3OTFA 2ZZJA 1UU5A 1Z92B 2WFF1 3D82A 5J96B 1GYKA 4N43B 1FMD2 1CN1A 4UW3A 1BFYA 1OD5A 2BFUS 4YRDA 2VW0A 4XXAA 2XH6A 3D6EA 3WW4A 1AYN2 2WFF3 5FLIA 5CG8A 5D8AA 1CD3G 3ES1A 3PMSA 4RQPA 5BY5A 1KFUL 1ENQA 3X29B 1VBE1 3IWZA 4WVZA 2WQ4A 3BPZA 3ENRA 2MPFA 1HXS1 2IWGB 3ZXEA 1LU1A 4GULA 1ZZBA 1YLLA 4POGA 3KSCA 3OBRA 2WZPP 7RXNA 4RFT0 4AGVA 5J36A 1VBE3 2RHPA 3K48A 3TNQA 1CQ9A 1QJZA 2NMOA 3WCRA 2PQQA 4EROA 5CADA 1HXS3 2DVDA 3MLJA 1OMIA 2R16A 4IL7A 3M2MA 2YV8A 1URXA 1QXRA 1K5MA 4F7ZA 1R0IA 3LOBA 2OZJA 2WWSA 3VBRB 5MF6A 3G6JB 4Z92B 2R32A 1YUZA 3WHTA 1DGWX 2C6BA 4UW6A 4JQRA 1W6PA 2VVDA 3P2AA 3FWEA 1CJPA 4TZDA 2IFWA 1HQWA 4XZPA 1LB2A 2WZR1 4ZXKA 4XF1A 1RUH1 1PHMA 1FYUA 3I4IA 4GALA 2DVGA 1AL21 4AEDA 1H2KA 4YLZA 2K9ZA 2RDVA 1H1AA 1MS9A 2BFUL 1W6QA 1TME2 1PO12 1J3PA 3VGIA 1DZQA 4PJYA 1RUH3 4BPZA 3AK0A 3WDTA 3ZFEC 2VQAA 3JBG2 5FAXA 2VMHA 3R4DB 1AL23 2ZAHA 4CDWB 3D8CA 1Q8SA 2VGDA 1MQTC 2VVFA 1PGW1 5I0SA 1NXGA 2ZGRA 1VCXA 3FUOA 3N36A 2QZ2A 4I30A 4HZFA 4JTOA 1PO21 1AR71 1TNRA 3B01A 1FHHA 3A4UA 4ATEA 1LHVA 3DUIA 2X5IA 1HRV1 1X36A 2G9FA 4FQ4A 4Q27A 2QZ3A 2ZGSA 3BIWE 1ZBE1 3I59A 5KHJA 1OLQA 4B8CD 1DQ5A 1PO23 1AR73 2V3BB 1VAVA 3LA7A 4A7YA 4F83A 4R9AA 2TNFA 1HRV3 5BNNC 2B8MA 2OVUA 3JB8A 2D6PA 4TLFA 1ZBE3 2PLV2 2R072 4COUA 2JG9B 3VPBE 2SBAA 4YGDA 4POFA 5GADc 3RZZA 5KHHA 3NV1A 4H3WA 1SBFA 2Q0AA 1FMD1 5LRSA 3H1WA 1CIWA 2C0ZA 2HWF1 3WQ0A 1ZREA 1IGOA 4DXZA 3SHRA 4B4PA 1GZWB 2CV6A 5KXEA 1DG6A 2CWSA 1CAUB 4EN6B 2CAVA 5A3MA 4S2HA 3B0AB 1KDMA 3MEPA 3POYA 1YI9A 3AP9A 1OFNA 3SLIA 3P3PA 4MGKE 1H2MA 4HMZA 2HWF3 1QKQA 4COWA 4B8EA 3MIEA 4KG0A 1GQHA 1J3QA 3B5LB 1WUVA 1HKDA 1HV1A 3NV2A 2WS92 3VBHA 3VLBB 2ZGNA 1MACA 2ZGPA 1WCDJ 1HQNA 1NCQC 2WSUA 3HWJA 2M4VA 1SBDA 2D3SA 1VALA 3DPRA 1B13A 4ZU5A 3URFA 1MS1A 5GAEc 1VBB2 1WW5A 1ZZCA 2GNTA 5FQ0B 3BCWA 5LK5A 3MI8A 3WZ1A 2VU9A 5T52A 3OF1A 1RUNA 2YZ4A 2UYBA 5FRAA 4ZU4A 3MF9A 3U0ZA 2C9AA 2AH2A 2VPVA 1XU2A 3INAA 5EYYA 2VULA 3VDDC 4OI0A 1EAH2 2PHXA 4AVAA 1KQRA 3B93A 4GH4B 1ZBA1 4OZXA 4M3CB 4E2SA 1RMU1 3AKQA 2PSMC 1PZ7A 3M3EA 3I2DA 3KD4A 4LO6B 4JAGA 2DTWA 3BALA 3FLTA 1ZVFA 3AP5A 4ES8A 1ZBA3 5C8CC 1RMU3 1TME1 4CEYA 3PWFA 3SISA 3WW3A 2PPTA 3JBG1 3VKFC 3WG3A 3ILNA 1A8DA 2EXIA 2D97A 4FP2A 1GV9A 1SFYA 3WT3A 2R1BA 1C5IA 4MGYE 5A33B 3WQ7A 2PVEA 1KRIA 3ZYRA 3NV3A 3JBG3 5CU1A 3ZG6A 2XKPA 5T5LA 3WDXA 3IU3I 4YVWB 4RR3C 2XJPA 4DPNA 2HWC2 3TN92 5AC92 4GMP1 4DY3A 1B2OA 3LGRA 1FXZA 4FPOB 2ZX4A 2FBEA 1Y43B 4AFCA 5CFDB 2BW8A 1SCSA 1AXYA 2OUHA 4IEVA 3ME2A 1NOVA 3GALA 3MLKA 1JOJA 1C5HA 3KT7A 2PLV1 3MFCA 1OWBA 2JE7A 2B45X 1J1LA 3USUB 5AVPA 1CAVB 3DV8A 1QH6A 2NN8A 3ZXAC 1ZZ9A 3GZAA 2ZGQA 1CPMA 3VZLA 2H6CA 4QQOA 1ALYA 4B7EA 1QXPA 2PHFA 1OOPB 4HL0A 3BOPA 4HPKB 3QBQA 5JIAA 4AR5A 1SLLA 2HWB2 3PTYA 3AYCA 4K1YA 4P9YA 3PIO1 2R1DA 4QD2A 4Y20A 2R041 2WS91 4AW7A 2WNVB 1QU0A 3ZN4A 1TMF2 1AYM2 2CNAA 4RXNA 4U671 1PGL1 4Y22A 1MS3A 1VBB1 2GNDA 4E4ZA 3VHPA 4G3YC 2R043 2KKDA 3SH5A 3IKWA 4E4DX 4N43C 2PHDA 4K20A 3ELNA 3EHKA 4QM9A 1BBT2 2R062 3JUUA 4KG8A 4L9BA 2JXAA 1IS5A 2DV9A 2VNOA 4Z2WA 1VBB3 1EPZA 2XGXA 3WX5A 1SLBA 1RUE3 4E6YA 4H7MA 2A69D 3DN7A 2PHTA 1Q8PA 5AI3A 4NR1A 4WM7B 3H50A 5HXVA 1RVF2 2D6KA 4JRLA 4K6BA 5I8YA 2PA7A 3H8UA 1WW6A 1BEV2 4YW3A 3H3ZA 4PBPA 1X33A 3OY8B 2D3RA 4WFN1 1YFXA 1M06G 4D7TA 3CF6E 2XUMA 1COV1 2ZKLA 1VJ2A 4Q4X1 4F3JA 1V6NA 4Y1VA 2A68D 1Z7S1 2ZX2A 1KFXL 1VR3A 4FO9A 4CP1A 4MZUA 1Y9QA 4KU8A 3JZVA 2BNNA 4FOQA 5EV7A 4I0WB 3N7JA 4GB32 4I3PA 3VBRC 4QPYA 1C8M1 4YVSB 1COV3 1OHFA 4L11A 4Q4X3 1IPKA 2QCSB 4MXVA 3WDVA 4AQ6A 4DFSA 4CP0A 4FTEA 2O5JD 1AVBA 1Z7S3 1W6MB 4AHZA 1R082 2HWC1 3IPVB 3TN91 4X6QB 1D0HA 4CDXC 4YNIA 1C8M3 2W08A 4XTPA 1DQ6A 3OCPA 1VBC2 3V0AA 3O12A 5BPXA 3S7EA 4WVWA 1XRUA 4CZSA 5C4WB 5KXCA 1AF9A 1HX6A 4N53B 4D3WA 1IS3A 2R49A 4BLIA 2QUOA 2IXLA 4FTSA 5AN9H 5DG1A 4CDWC 5TSWA 3VZNA 1W6NA 1CAAA 4W6YA 2X53S 4GQ7A 5F6KA 5CFCA 1ZX5A 3N35A 1AX1A 3H9AA 2RS32 2Z69A 2DUQA 3RG0A 4E9KA 2VMGA 4OLLA 2HWB1 3VZMA 3FC0A 1H8TB 1S0BA 4K8FA 2CGNA 5I91A 1IU5A 2Y0OA 1NY71 1RUD2 3ZFFB 1DVBA 4Y1XA 2J9UB 2BEOA 2JI2A 4W6WA 4K7JA 4B7KA 3O7OA 3CJIC 3AMMA 2JG9C 4WBBA 1RDGA 4JCKA 1Z78A 2ZBJA 4JGYA 1LGCA 1LOCA 1ND3B 1QQP1 1MS0A 4CEWB 3FHIB 4W65A 2Y26A 4XIKA 1BK1A 1G86A 1LEDA 3WV6A 1S0JA 1QQP3 3FJSA 4M00A 3QQCE 3FMGA 4IQPA 4EN9B 4LBQD 2XKOA 3OYWB 1G7YA 4H7LA 1ZRFA 2M6PA 3M8LA 1NQJA 5H9PA 3SXWA 2MEV1 4C90A 3QH7A 2B46X 1QJU1 1BEV1 1U0AA 3WR0A 2MEV3 1OLRA 4PIZA 1RUI1 5BXXA 4FXGB 4AGRA 3K35A 4OI4A 3K51A 4UW4A 4EN8B 2EA7A 1QJU3 4JADA 1WCKA 5JR7B 2R0HA 3KGLA 2CR8A 4XF4A 1BQ8A 2GDFA 1RUG2 2AYJA 3NJZA 2VNRA 1RUI3 3R05A 4QGNA 3NVCA 3RS6A 1O5LA 2F6BA 4GH4C 1UPSA 1S0FA 2YYOA 2ZA9A 5JDBA 3OD0A 4XEZA 1OPOA 3ATGA 3GBWA 5KXDA 1CJDA 3E6DA 4GMP0 4OI2A 2JECA 1RC6A 4Q4V2 5CG9A 1Q8OA 3I54A 1XNKA 3LWCA 1MR5A 3A44A 1W6OA 3J4UH 4MV2A 4YM3A 1R092 3VBUB 3SCHA 1UKRA 3WVJA 2YGMA 4YGCA 2BQPA 2P37A 1D2QA 1RHI2 1YFUA 1FOD2 4N90A 4LLFA 1MZ6A 2I74A 4HKLA 5JZGB 4JGZB 3PHMA 4QX5A 1YNAA 2RS31 5K0UB 1GR3A 2NYYA 2O8QA 3AP6A 2ERSA 3AP7A 3J7Z1 4XQ4A 3BU7A 4YVWC 3O0VA 4MXWA 1LOFC 1UW8A 1T6GC 3VBSB 4D7SA 1PVC2 1RWDA 4WM8B 5BNQA 4S2GA 1RIRA 4JC1A 5SV5A 1D2SA 2O1QA 4IESA 4B29A 4G4FA 3WG4A 5CFDC 1OQDA 3MIGA 4G9SB 3ILRA 3MFAA 1RUF2 4SLIA 4XF0A 1GQGA 3CL1A 3B9CA 2K2SA 2NLRA 4MGZE 5JI7A 2ZABA 1JBCA 2VVEA 1Q3EA 3T1LA 1FHMA 2A6ED 2D43A 3VBOB 4YARA 4AR4A 4XYXA 2NQYA 4YZ3A 1RINA 3WNXA 4BIFA 3RYGA 4M0HA 4XE9A 2ZPXA 5DUWA 4EWAA 2VXRA 1AR91 1DFQA 5AFEA 2GC2A 2CL2A 2E7TA 5AI2A 1OOPC 4CDQB 1UKGA 1C09A 1VB4A 4IV3B 1LHNA 1NA1C 1O91A 2NM1A 3WINE 2DVBA 1AR93 3JCIA 3KT4A 5BNNA 2VOWA 2JICA 2WIIB 3MLLA 3OJBA 2PAKA 2VY0A 4YWLA 2RJKA 2VQ0A 2WNVC 3JD73 4XBQA 4XQDA 3UKVA 5T5JA 5DZFA 1QF3A 2YROA 2D6OX 3OGJA 5GLVA 4J6GA 3RYKA 2WNUB 2VH9A 2O0OA 4LO5B 2UWCA 4Q4W3 4Q0VA 4OUSA 4INDA 5C8WA 5JCTA 2Y38A 3A0NA 3BOWA 1BKZA 1KITA 5AVAA 5DUXA 4KNCA 4WZFA 4QQ2A 1DQ4A 3DGTA 1RUG1 1V9U1 4HK9A 2O8OA 1RYTA 2XJSA 5H9RA 1QHDA 3C3VA 3ZXKA 4XF3A 1BCXA 3LSDA 4Y1UA 1YIPA 3ZYJB 4ME3A 1REEA 3OBTA 4GIQA 2NPIA 4RQPB 2W52A 4WM7C 4Q1RA 1NCQA 1RUG3 1V9U3 3V0BB 5H9SA 2VMIA 2SLIA 2XJVA 2HEYF 1YJKA 4Q4V1 3NAPC 1C8NA 4OHYA 1ULCA 5J48A 2YGLA 1QYBA 1IROA 4XFAA 5FBZA 1R091 2ZGOA 1UPIA 4PDWB 4E27A 1LECA 5EJ3A 1CR7A 4K3UA 4Q0QA 1RHI1 4Y5Z0 3WUDA 4B4RA 4FPFA 1FOD1 3WWLA 3FLPA 1VBD2 2VG9A 2GMEA 2YUEA 1K5MB 1NZCA 4D94A 4YVSC 3RYPA 1LHWA 4MX3A 2CAUA 5C33A 4IEPA 1FOD3 2DCYA 3HAGA 1NE6A 5ABJB 1QNWA 1PVC1 1FNYA 2YY1A 1AUYA 5DDJ2 3RDIA 1UF2C 2XJQA 5T50A 2PFWA 1CAWA 4HFSA 2D3PA 5C8CA 2XL9A 1YIFA 1SMVA 4OHZA 5C4WC 4PIXA 2DUOA 4N53C 1SFNA 4OFGA 1LOBA 5L7OB 2ZS6B 3KMHA 4P14A 3KYWA 1KDKA 2EALA 4QHBA 3LZZA 5E1RA 1OA4A 4C91A 5C6CA 3J8F1 4QPIB 2ZMKA 4MVTA 2D44A 1N1TA 2IFRA 1H2LA 1S2KA 1SEFA 2ZGTA 3BODA 3MICA 1H8TC 1DGRA 1XU1A 1BZWA 2UURA 3TYJA 3S7IA 3J8F3 4U36A 1OI6A 4OVEA 3I59B 4JDNA 2Z5WA 2OUJA 3ZFFC 2GAUA 2JD4A 3H0OA 1DX8A 2ZX3A 1G9CA 2BVBA 1RITA 5KWRA 5KC6A 1ND3C 1RUC1 4GA9A 2JI3A 1O3RA 4CEWC 2RE9A 1O4TA 1XNBA 3LSEA 2GMMA 3AMPA 1JXNA 1UAIA 2HJIA 4H55A 4IERA 2IXKA 2DURA 2E7AA 1RUC3 1BMV1 3D0SA 4ISQA 5GZCA 4Q4W1 2ENRA 1N3PA 2F4PA 5JSOA 2WZR3 4ES9A 2BUKA 5JVVA 4ASMB 5ACA2 1NCRB 3IBMA 2WFPA 3KZ4C 5KHIA 1BVP1 3AZXA 3VBHB 3LCPA 1LOEA 1V6IA 1LJ7A 3MIBA 2YC0A 4XJUA 1U12A 4S2FA 2QKDA 3DPRB 4N43A 3U07A 1O3TA 1FX5A 3ZFGC 3VBFB 1YRZA 1WBLA 2JEMA 2VOVA 4X8NA 3TBDA 2M4YA 1W39A 2GH2A 4LO4B 1QOTA 2WT0A 2XJRA 3LA3A 3ACLA 3R4SA 4R9BA 3WW1A 3POWA 3IT8A 1LKOA 1NQDA 4NHKA 4KU7A 3PKIA 4BYYA 2ZOEB 1VAKA 1R1A1 2BTVC 3AZWA 5FPXA 1C4RA 4QQPA 5L19A 2GALA 4S2DA 3RZ6A 4KGQA 3D5OA 2ZMNA 2H0BA 1JH5A 4MLOA 1DLLA 4RL7A 4LA3A 1R1A3 1GANA 1UCXA 1XYNA 3RI8A 1WLDA 3VBUC 4UBHA 5JOYA 1GFF2 1QH7A 5BUVA 2I45A 1AYN1 3A0KA 3OPZA 3GBGA 3S30A 1TE1B 3EBRA 3VZOA 1FPN2 1FMD3 3RWNA 3NO8A 1ULGA 1QJX2 1HRI2 1YO8A 2FQPA 5J3UA 3ZXFA 4QPGB 3VHNA 1S0GA 4QGLA 3NSTA 1AYN3 3MYXA 5K0UC 1IRNA 5RXNA 2PYTA 1EV12 2Z79A 2XJTA 3ALQA 1A8MA 3KB5A 3RNSA 4CDXA 5BNOC 1SMWA 1QDCA 1AR82 4LE3A 1WMFA 3VBSC 3OGGA 1B09A 3M3CA 1REDA 4Z8BA 2VL6A 1GZ9A 2V0EA 4L92A 2P2KA 3KT1A 5KXBA 4FAHA 1CGPA 3E5XA 1DGLA 4FSJA 1DDLA 1RDVA 2UWBA 4FCAA 4CRQA 5GJ6A 2ERJA 2IXIA 4BMEA 3B08B 2Q1MA 1ENXA 4NWVA 5L73A 2Z3QB 1GZCA 2QDRA 1HIXA 1XE8A 2ZTNA 4W6XA 4XW3A 1S0DA 1VBA2 3PZAA 2ARBA 5J98B 4NHMA 1PGSA 1LENA 4OHWA 3QACA 4CDQC 1GBGA 4JDOA 1LKMA 2MNGA 4AFDA 2DU0A 2H12A 2D5HA 1PO11 1WMEA 2RM22 1G9FA 3DF0A 2DFCA 3ETQA 3CJIA 4I02A 1H30A 2JI1A 2HWD2 1VIWB 2YDEA 2ZGUA 1N1VA 1TME3 1H0BA 2ET1A 3ZDSA 4LULA 4KWLA 2WNUC 1PO13 4E2GA 1G9DA 2V73A 1QJY2 4NPRA 4X8PA 1JYBA 3KYYA 1MVQA 1ZZ7A 2XPJA 1ODHA 2GU9A 4LA2A 5GZFA 1FATA 1MS4A 3PKJA 2V09A 3SS2A 2DFBA 1CAUA 4Y1ZA 2YPJA 4ITCA 4CTEA 1NG0A 3RYRA 3O0WA 1IOAA 1HQLA 1VB2A 4LBKA 4XJAA 5FREA 1SLIA 2BPA2 1IW7D 2AENA 5H9QA 4GMP3 3V64A 1JHNA 4UY81 1H1MA 4J1XA 5FO7B 4RQPC 1CVNA 2R071 2B9UA 1MEC2 1R0HA 5E88A 1TEIA 4LLOA 4QU2A 1EP0A 5KHKA 2DYCA 4QQLA 1S0CA 3U4XA 1VRH2 4TPUA 2PLV3 2R073 2EXJA 3PMEA 2GH8A 4PDWC 4IEWA 2QDNA 2QJVA 1DGWA 4XBLA 4PQ9A 3B3QE 4MGIE 2PHUA 2OYZA 4BWOA 3AJZA 4META 2ZZQA 1LULA 1HRI1 2BBVA 1H4HA 1K5MC 2A75A 4GH4A 4WVMA 2Q30A 1F5JA 3BB6A 1EV11 3RSJA 5JVH1 2GC0A 4FPGA 2TUNA 1HRI3 5ABJC 4ZKTB 1YK5A 5MFPA 3G7DA 1DBNA 2WS93 1O4ZA 5DZGA 4YW5A 4RS5A 2P3JA 4PIYA 3WP4A 2JE9A 5HCAA 2XHKA 1Y7BA 1D4M2 2A6XA 2LM3A 3RMXA 5K7PA 5L7OC 4XIOA 1C1FA 1UIKA 5IUQA 1XYOA 1T9OA 4HN1A 1YYNA 4J1WA 4LO8A 1H2NA 1B35A 2PTMA 1EAH1 5HCFA 4V196 1OFSA 2PAEA 1I9RA 3LOIA 2XJUA 3PLQA 2XVKA 4LBNA 1Q43A 2DU1A 1UZYA 4QPIC 1LOFA 1ND2B 4WZCA 2VW1A 1EAH3 1O5UA 2BE5D 4PBOA 4A7ZA 5CFDA 3MDPA 3MGUA 3CNAA 4ASLA 2RM21 4Q4Y2 2AYHA 1RB9A 3WHUA 4AFAA 4BE3A 2BWCA 3KCCA 5GAHc 1OA3A 1ZA4A 3GNEA 1HDKA 1IS6A 3USUA 4RGGA 4OHVA 1QJY1 2K0GA 1WBFA 3S6PA 2CYFA 3E6BA 3ZYGA 4JGYB 1ZRCA 4YFWA 2WSVA 2GMGA 5AC91 2GC3A 2FZ2A 2QL0A 4DS0A 5EXOA 5I0TA 1B71A 3B94A 3RMYA 1YCIA 1QJY3 2JG8B 4BZ4A 1BJQA 1NA1A 2WJSA 3MIHA 5JLVA 5JWPA 1EY2A 4Q8LA 4JAEA 2XLGA 2YHJA 4JVAA 2HWC3 1V6JA 4XJ8A 2B5HA 1SMMA 3TN93 5AC93 4UBGA 4XQWA 5GALA 3CLPA 3AFGA 1MEC1 1NCRC 2RS12 4YYOA 3HR9A 5IK4A 4LBOA 2N7GA 1ULDA 4AK3A 5BNPA 5FPZA 2LTNA 4L97A 3ZN5A 4AEMA 3AM2A 4Y4YA 3RRDA 3OD4A 3N7MA 4MUVA 4NN0A 3VBFC 4TWTA 3MPSA 1IQAA 3QVDA 1PVXA