2XK4A

Structure of nek2 bound to aminopyrazine compound 17
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
277
structure length
252
Chain Sequence
SRAEDYEVLYTIGTYGRCQKIRRKSDGKILVWKELDYGSMTEAEKQMLVSEVNLLRELKHPNIVRYYDRIIDRTNTTLYIVMEYCEGGDLASVITKGTKERQYLDEEFVLRVMTQLTLALKECHRRSRDLKPANVFLDGKQNVKLGDFGLFVGTPYYMSPEQMNRMNEKSDIWSLGCLLYELCALMPPFTAFSQKELAGKIREGKFRRIPYRYSDELNEIITRMLNLKDYHRPSVEEILENPLILEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE/THREONINE-PROTEIN KINASE NEK2
publication title Aminopyrazine Inhibitors Binding to an Unusual Inactive Conformation of the Mitotic Kinase Nek2: Sar and Structural Characterization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 73
structure length 252
sequence length 277
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00069 Pkinase Protein kinase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2xk4A02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2xk4A01
3UZRA 2WQMA 4RWKA 4BBFA 2ZV2A 4M97A 2HWOA 2RSVA 4C4EA 4ZY5A 5T3QA 2F57A 4GKHA 2VO0A 4FK6A 4BTMA 1KSWA 2XM8A 5EQPA 3FLNC 4X3JA 2HENA 4EK6A 3OCBA 2YM8A 4CFUA 3KGAA 3GU6A 5IU2A 3PIXA 3QWKA 3ENMA 4FIIA 4C4JA 2EXEA 4LUEA 4U3ZA 3RHKA 2ITVA 4UB7A 4CMTA 4EH6A 3TTIA 5AFVA 5J9YA 5FTGA 1U54A 1KV2A 4XRLA 3ZBXA 2XH5A 4Z55A 1VYZA 1RJBA 2OZAA 2XVDA 2Y8OA 3LFQA 4W4WA 3AMBA 4MD9E 2HW6A 5HNIX 4QP2A 2GNGA 2WNTA 4ACDA 5IUIA 4J53A 2IZRA 2R3NA 5BVKA 2W0JA 3HV6A 5EDPA 5IA1A 3BGPA 3FI3A 4FKVA 2E9NA 4UWBA 4FKJA 2BZIB 5CSPA 1T46A 3DNEA 3QBNA 5F4NA 3U6HA 3EKNA 4L46A 1SVGA 4V0GA 3VS0A 3HUCA 4G6OA 3LW0A 4HZRA 1JSUA 3R7GA 5BQ0A 1SVEA 4KKEA 4K8AA 4EEVA 3GFEA 3IDBA 5C8MA 1OL2A 2OZOA 5AEPA 4M14A 4UBAA 2VNYA 4FSWA 4D2VA 1P2AA 2GS2A 3LXNA 3EQRA 4F7SA 4NCTC 3K5UA 4IFCA 3FDNA 4PTGA 4LV5A 4YNEA 3R9DA 5HE2A 3NWWA 4IJPA 3FY2A 4CT2A 5AR3A 3GCSA 5HOAA 2J4ZA 4L01A 3PVWA 1PY5A 1UU7A 2X4FA 2Y4IC 4OTFA 1B39A 2W99B 3UVQA 4BBEA 4F9YA 2YZLA 3SKCA 4RWJA 1WBOA 1U4DA 5TF9A 4I5PA 3C5IA 3S0OA 2X1NA 4OTIA 4UXLA 2R7BA 1PXLA 5JFXA 2QKRA 3MS9A 4UYNA 1JNKA 4I21A 4QP9A 2P2HA 2PL0A 4H1JA 4DHFA 2ITQA 4U41A 4UXQA 3NSZA 3OZ6A 5E7RA 1ZOEA 4DFUA 3C0HA 3NAYA 2F9GA 3KRWA 3VBQA 5AV4A 4ALUA 4U79A 2BIKB 3RHXA 5HE3A 4ERWA 4EZ5A 2VGOA 2UZWE 4U97A 3QTWA 1OKZA 1OM1A 3EQHA 4EHEA 3EQIA 4F70A 1OB3A 2PK9A 1WBTA 3ZLSA 1QPCA 2WAJA 3KCKA 3CR0A 2XIYA 3KK9A 5CSXA 2R9SA 3VUHA 3QA8A 3DDQA 3GCQA 2OJFE 1RE8A 4FV0A 3UP2A 2YM5A 3A4OX 3BRBA 2BALA 1JOWB 3Q2MA 3IK3A 2ZB0A 4GEOA 4MTAA 3LCKA 2J90A 3VBXA 3R7EA 1IAJA 3BEGA 4IWPA 4UALA 2CHLA 1UWJA 4K11A 4LQMA 4PTEA 3P5KA 3VC4A 3VUIA 4C36A 4C62A 5CWZA 4JQ8A 4BDHA 1ZARA 4AACA 4DTBA 5C4LA 1Y91A 3VAPA 1IR3A 5CF6A 1R78A 2BZJA 3ORIA 5CY3A 5AAGA 2GSFA 4GT3A 2IVTA 1IRKA 5JKGA 4DFYA 4I5CA 4XJ0A 3WE4A 3HDNA 1SMHA 3O8UA 3PA3A 4MXXA 3NAXA 1Q8ZA 3FZTA 3PP0A 3C5UA 3PPZA 3C1XA 4Q5HA 3ZUTA 4B7TA 3OVVA 4BBMA 4HOKA 5M56A 5EM7A 3F3UA 3FUPA 4CFMA 3H0ZA 3QF9A 4AQCA 1WZYA 2PWLA 3KN6A 4HJOA 4LOPA 3IS5A 5AR5A 4CEGA 3FYKX 4LFIA 5AWMA 3SHEA 5GZ8A 3Q04A 5TKDA 2YLFA 3ZC5A 2BAKA 3DJ5A 1ZYCA 4M3QA 5CNNA 3R8PA 4DCAA 2C0IA 1PXJA 1MQ4A 3F3WA 4CKRA 2X7OA 3A7FA 5F1ZA 4HNFA 3SXFA 5F9EA 1ND4A 3QD3A 1YXXA 2UW3A 3OWPA 3MPTA 4FV1A 1GY3A 4Y5QA 1H27A 4YJVA 4ASXA 3UO4A 4FUXA 4JG7A 2CSNA 4IVDA 4NCTA 4GJ3A 5DR6A 3ANQA 3G0EA 1Y6AA 2IN6A 2YITA 3BI6A 2WU6A 4NIFA 4FEQA 3N4TA 2JITA 2ZVAA 3DKGA 3FSKA 5JZNA 4BB4A 3MH3A 4XP2A 2FSTX 2RKUA 3TDVA 5J5SA 4G34A 1ZYSA 3D2IA 3A7JA 4E1ZA 4QMNA 3LPBA 5BVEA 2E2BA 2UW8A 3FXXA 4J99A 4C4IA 4NEUA 5A9UA 3D5UA 3BHHA 4WHZA 1GOLA 3WE8A 4ALVA 2JD5A 3SRVA 1Q3WA 3QHWA 5EI6A 3TV7A 4O86A 3HMNA 5IQBA 3RWPA 2RG6A 3LFNA 4LGDA 2JDVA 5IDPA 4I92A 5ACBC 4ACGA 2X7FA 3JY0A 3KXHA 2VWBA 4MBLA 4AE6A 2HZ4A 3EN4A 4GSBA 4YHTA 5LOHA 5JGDA 1KUTA 2XZSA 4G3FA 4EOPA 5IUHA 1DS5A 3P78A 3U51A 3A7GA 5AUVA 1Q4LA 2GNLA 4PTCA 3CKWA 1J7IA 2R5TA 3FXWA 5HX6A 3ACKA 5FTOA 3HAMA 4QMUA 4BCHA 2FO0A 4CGAA 2HZNA 3ZO2A 4WUAA 4NM5A 3PRFA 3NW6A 4YO6A 2EU9A 3LCSA 4C3FA 1CKJA 2JGZA 1NVQA 3DKCA 4WRSA 4D55A 3VQHA 4FEWA 2PVJA 4YJSA 4AZVA 2YISA 2LAVA 5DPVA 3OY1A 2FSOX 1PYEA 2JDTA 2XIKA 3KF7A 4FKGA 3R8UA 1KE9A 4G2FA 2QOOA 5J9LA 5TT7A 1BUHA 3EQCA 3HV7A 3MW1A 1DAWA 3EQGA 3QGYA 4ZSGA 4FR4A 3DXQA 2E9VA 3I79A 3OTVA 4IWDA 3UGCA 1JSVA 4TYGA 4U7ZA 4BZOA 4M13A 4CLIA 3TZMA 2UZDA 4DYMA 1BI7A 2F49A 5D7VA 5BVDA 3RMFA 4HW7A 4FTQA 4JDKA 4LL0A 4D2WA 3FMNA 4AN3A 5CXZA 5GINE 5LVLA 4YJUA 5CF4A 4N4SA 4EK4A 2ZV8A 3UOKA 4J8MA 4TYIA 3OW3A 3F3ZA 4JR7A 4IZYA 4OGRA 2OH0E 1H01A 1ZY4A 4XG4A 4F1TA 2IO6A 3BEAA 4FT3A 4RJ5A 2YDJA 4WG4A 3R8MA 3U87A 3LM0A 4CNHA 1MRUA 2GHLA 5B7VA 3ALNA 4I0TA 4Y8DA 4EJ7A 3CIKA 3GNIB 3VS2A 2QI8A 1AD5A 4MXOA 2A27A 2YCRA 4X2KA 4EQCA 1OITA 1ZOHA 4RMZA 5HZNA 3FZ1A 3LCTA 2F7EE 4LRJA 2B0QA 2QOIA 3R7UA 4FV2A 4TXCA 2XNBA 1CSNA 1K2PA 1VEBA 2JEDA 5AUXA 2PU8A 3BBWA 3PJCA 1WVXA 5DEWA 4MBIA 4RSSA 3G5DA 2PZYA 4F0GA 3PPJA 3EL7A 4DBXA 5HTBA 2EB3A 1OL6A 3DBQA 2VTQA 3HYHA 2PZPA 4ZY6A 4QMLA 4JG6A 4ZTMA 2HOGA 4BDKA 4YC8A 1YWNA 3P0MA 4FTLA 3UOLA 1ERKA 4C58A 1W82A 3ELJA 4FL1A 5IA4A 3JXWA 4L8MA 4D5HA 3IGGA 3FXZA 2UZLA 3OOMA 5FDPA 4XV9A 5KMOA 5EFQA 4XUFA 5AA9A 1MP8A 2C68A 1J91A 3WZKA 2GQRA 5FXQA 2HAKA 5IMEA 1A48A 4Z16A 4FYNA 4AAAA 1XH5A 2FA2A 4EOKA 4S31A 2J5FA 2JKKA 4OW8A 3FI2A 2X0GA 1PKGA 1H4LA 4X6QC 1M2QA 3RI1A 2C1BA 3EYGA 4EHZA 1K9AA 4BDDA 2QO9A 4JNWA 4MNEA 4BTFA 4EH2A 4MVFA 3LXKA 5A4TA 5FP6A 5EM8A 3F5XA 5HNBA 3KXZA 4JRNA 4EC9A 1BMKA 3C51A 5C8KA 3DS6A 4FZ6A 4OTDA 5E8TA 2PPQA 3DV3A 2ITYA 2XNEA 4D2TA 1TQPA 4XBRA 3QC9A 3L8SA 3QX2A 2VX3A 4HNIA 3MI9A 3UNJA 5FQDC 4O7VA 5T6KA 1YOLA 3V5QA 2HELA 5EM6A 3PUPA 3QUEA 4FTOA 5ETFA 4KIKB 5BYZA 5DH3A 3TL8A 1O6KA 2SRCA 4IACA 3OTUA 3NUSA 4CVAA 3PVGA 3CQWA 5L4QA 1ZAOA 4A9YA 2OSCA 3W2RA 4I23A 2E9OA 3JYAA 5EHYA 2DUVA 5GNKA 1JBPE 3RK7A 2VN9A 3FZPA 3OXZA 4J96A 1F3MC 4UMUA 3A7HA 3QQLA 3ZTXA 3QXOA 3SXRA 4YZBA 4CLJA 4RIYB 4NJDA 1OKYA 2IJMA 1MRVA 2WZJA 1PXNA 4FOBA 1Z5MA 2UW4A 1WCCA 3W55A 3R30A 3HRFA 2EXMA 2ZYBA 3WYXA 3PA5A 5CU4A 5EI8A 4YTIA 2XCHA 2FB8A 3GQLA 4ZAUA 2OXDA 3HUBA 4A9RA 3LIJA 2YAKA 4V01A 4GYIA 4JVGA 4Q9ZA 5A6OA 2J0MB 3S1HA 2VUWA 4MQ1A 3BHYA 2WO6A 2WMSA 4P4CA 2WPAA 4FZAB 3IW4A 3NUPA 3KCFA 3DQWA 3DTCA 5CALA 4CV9A 2ITNA 3IONA 1GZNA 1BX6A 4NW6A 2ERZE 2ITWA 3QHRA 4FMQA 1CKPA 5J1WA 3CKXA 5M08A 4PY1A 1STCE 4EOLA 2BVAA 4PL4A 3ZZEA 3DJ7A 3LJ2A 4ZOGA 5CTPA 2IZTA 3ZONA 3IW8A 3E92A 4CZUA 3QQKA 1A06A 5CAQA 3A7IA 1S9JA 4NZWB 5F95A 3RNYA 5M44A 4XLVA 3PSDA 4BDIA 1QPEA 5HNGA 3TWJA 2IG7A 1YRPA 3CTJA 4CTBA 3KEXA 2J0LA 1P4OA 3MV5A 4AZFA 3EN6A 3P79A 2XRWA 2WMRA 2WTKB 5A3XA 3RK9A 4KB8A 3S00A 4GS6A 3R2YA 4RA4A 5CQWA 5D9HA 3PY1A 4ZSEA 2XEYA 4OTRA 1H25A 2PUIA 4L68A 4E3CA 3T9IA 4GVJA 4IAIA 1H07A 2Z60A 4FT5A 4CYIA 2AC3A 3MY5A 2I0YA 5HIDA 4A4XA 4AS0A 3NYOA 5IF1A 3SA0A 4JR3A 5DWRA 2IWIA 4O0VA 3GU8A 2OGVA 2H8HA 3GBZA 3MA6A 5A4CA 5C8NA 3GT8A 4D2SA 1YQJA 4B6LA 1OECA 4DTKA 4XG8A 3WILA 3P86A 3LFSA 4MKCA 5CU0A 2OFUA 3TTJA 1CDKA 2FYSA 1UU9A 5BYYA 4FKQA 1FGIA 5IKWA 4YTFA 2W5HA 5DNRA 4XG7A 4N70A 5IDNA 3R71A 4TNBA 4BWPA 4JAJA 4LGGA 5M55A 5CI6A 3R7IA 4YR8A 3F5UA 2NNWB 2J0IA 1U54B 1Q8WA 4L7FA 2B54A 2OZAB 4AP7A 3PY3A 3A4PA 3MJ1A 4RFYA 4Z9LA 1H26A 2IW8A 5GJGA 4R8QA 3P9JA 4B8LA 4AW0A 1IAHA 2YDIA 4APPA 3SG8A 5BVFA 2ZMDA 1KE6A 2UZUE 3O17A 4O0TA 4IWOA 4F1OA 4QP8A 3S95A 1JVPP 3E63A 4FT0A 5EW9A 3OT3A 3QFVA 4S30A 3BU5A 2WIHA 2XMYA 4G17A 4V0GB 3RPOA 2Z7RA 5GZ9A 4LGHA 3IW7A 4KWPA 4RVKA 3QCQA 3QYWA 5DRBA 3UOHA 2X6EA 4RIWA 3B2WA 3PG3A 3L9MA 1UKIA 2IVUA 4QQ5A 5DT3A 3RGFA 3LFEA 4BGQA 5E9EA 3BQCA 2RFEA 1PMEA 5K4IA 2VRXA 5EKNA 2EB2A 3QRJA 5AP2A 3ODZX 3F82A 3MB7A 3HV5A 3HZTA 3MSSA 4DH7A 3I6UA 3JVRA 5HIBA 3LMIA 3HV3A 2J2IB 2WKMA 2XRUA 4K33A 4O21A 1APME 5M09A 2PZRA 2XM9A 3F2RA 4FSUA 2H96A 2V7AA 2P4IA 2Q0NA 2O5KA 3COHA 4QPMA 4FF8A 5CXHA 4R6VA 5E8XA 2WTIA 4UZDA 1H1SA 4YJPA 4IX4A 3ACJA 2UZVA 5E8WA 2VZ6A 2QOLA 3CLYA 3DAEA 3TT0A 3VWAA 3QX4A 5HE0A 3ZLXA 5DFPA 4YZNA 4D1SA 3L8XA 5D41A 5IH6A 4J8NA 1H0WA 4RG0A 2J6MA 4RX7A 4AGWA 5IUGA 4GU9A 3R22A 1GIIA 4U44A 3WYYA 1WBPA 3AC8A 3PPKA 2C5NA 3ULIA 2ERKA 2RGPA 3Q3BA 1R39A 2QO2A 3T8OA 4PMTA 4U5JA 4YO4A 1FVVA 4JDIA 2X9EA 3FMJA 4F9WA 4EH9A 5AUUA 3SOCA 3I1AA 2PUNA 4EORA 2HIWA 5AV1A 1U46A 5IQEA 3R7YA 4Y5HA 4V04A 4G5JA 2BTRA 3OT8A 3LJ1A 5FP5A 2X8IA 2YACA 2Y4PA 3R1NA 4HGSA 2RL5A 2UZOA 3UPXA 4ZSAA 2RIOA 5L8LA 4G5PA 4U42A 4K77A 3NEWA 4R7IA 5C03A 3FI4A 4BIEA 4AA4A 4B99A 2IW9A 2WMBA 5HG9A 4XNEA 3VVHA 1VJYA 4GG5A 3OWJA 3QGWA 4U40A 4RQVA 5CYIA 4E6DA 3V5JA 5HX8A 4FE2A 3IW6A 2WMAA 3PE2A 1WBNA 3E88A 4ORKA 3VUTA 1PXPA 4ZIMA 4AGUA 2XCKA 3FWQA 5KMNA 3RM6A 3V5WA 4D4SA 5LMKC 2CGXA 5KMKA 2HK5A 4WSQA 4QOXA 4XV1A 3QCSA 2O2UA 2UUEA 4KBCA 2Y0AA 3TIYA 3HVCA 1SYKA 2W1HA 5DVRA 3D7TA 3W33A 4C3RA 2QO7A 4XRJA 4C0TA 3QTUA 5CEQA 2B4SB 2ZM3A 2PSQA 4UWYA 3PG1A 3EKKA 2WB8A 5J5TA 3AOXA 3HMOA 4ZMFA 3BLHA 4I4FA 5HIEA 3ZO4A 5FXRA 4JI9A 2R0IA 3ZM4A 4QMXA 2GHGA 3PLAE 5LCKA 2QG7A 4MBJA 4CXAA 5EHLA 3RJCA 2C4GA 2Y7JA 3R6XA 4R3RA 4GT4A 4E4MA 4WG3A 3A8XA 2JFLA 1I44A 5I0BA 4BGGA 5CAPA 3T9TA 2O8YA 3RVGA 2YM3A 4OBQA 5IA5A 3NMUF 3ZEWA 3LCOA 4P90A 5E8ZA 3GI3A 3LXPA 3EHAA 3EQPA 4FZDB 4DGNA 3OD6X 2RFDA 2W1FA 3FZOA 4IQ6A 3VBYA 4IE9A 2IW6A 2WTWA 3FZRA 3GUBA 4NIFB 4R1VA 2J50A 3VUGA 2XBJA 3AC1A 1R3CA 3H9FA 2QURA 3IQ7A 4QYGA 4O81A 3E8CA 3FQHA 4IVCA 2Y4IB 4ASDA 4KSQA 4AU8A 4YJQA 4DLIA 4FA2A 4IX6A 3JS2A 2P0CA 4ALWA 3MTFA 1YDRE 5JH6A 3MB6A 3FLSA 2VWXA 5EHOA 4YHFA 2JBOA 4AWIA 3P7AA 1PXMA 3M42A 3SRVB 4C34A 3ID6C 4FICA 3T3VA 1ATPE 3UQGA 4HVSA 4YPSA 4F64A 4QPAA 5AUWA 4U43A 4X2FA 3NIZA 1HCKA 3VN9A 4DEHA 4KD1A 2XKFA 5KE0A 3GQIA 5CEOA 4FODA 4V05A 4YSMA 4FSYA 4BKYA 5L2IA 4FT7A 4IMYA 4Y83A 4RC2A 3PJ3A 2YERA 1J1BA 2R2PA 3U9CA 3QTRA 3VW6A 5B2KA 4A9SA 2BRNA 3A8WA 2I6LA 3PSCA 4YSJA 4CRSA 3KREA 3HGKA 5A54A 4PMMA 3OCGA 4O7WA 4O7ZA 3MFUA 3NVMB 1V0PA 3F9NA 3UBDA 1Q99A 3E3BX 4FTIA 4TN6A 3ZSGA 2CCHA 4X3FC 4S34A 3NUYA 3OW4A 5AP0A 3PXYA 4BCGA 4O7SA 2W05A 3ORTA 3ZC6A 5EQYA 2ZB1A 5AP7A 3TG1A 3D83A 2LGCA 4QO9A 5CAOA 4IZ7A 3JPVA 3HP2A 1A9UA 3BU3A 4ZZMA 1MRYA 3VQUA 4AW5A 2YWPA 2XKEA 3KXMA 5EK7A 4BDGA 3PXKA 5HTIA 4PNKA 4CD0A 3MYGA 1XJDA 2XK4A 4PPAA 4RFMA 5DBXA 2YM6A 3UG2A 4G6LA 2V5QA 4E4NA 4ZZNA 1GZKA 2W4OA 4A9TA 3COMA 5H3QA 3U6IA 2G15A 3DDPA 3E7VA 5K9IA 2QKWB 2HXLA 3FLYA 1SZMA 4BCFA 2P55A 2QOHA 2Z8CA 5HG8A 4BCPA 5IQDA 4ZMEA 1BLXA 2OXXA 1BL6A 2QODA 3AMYA 4M8TA 5KZ0A 4EH7A 5LMKA 4O84A 4HVIA 4F7NA 3ZCLA 5L6PA 2QHNA 5HO8A 5BMMA 3IOPA 4OAUC 4Z7GA 1W8CA 2UZBA 2GNIA 2VTPA 5ANIA 3RTPA 4ARKA 1YWVA 1WAKA 2B9FA 1JWHA 4APCA 4BDEA 1OKWA 3MH1A 1YI4A 1T45A 3IPHA 4O1OA 4TYHA 1XH9A 3HLLA 3HMPA 4ZTRA 3QQUA 1JLUE 1W83A 5FG8A 4DH8A 5B2LA 1YXTA 5I9VA 3ZRLA 5E8YA 2WMVA 1Q3DA 2BZHB 4EWHA 2Z7QA 2GFSA 1JPAA 2VWVA 3DLSA 2GPHA 4EH4A 4XEYA 1PW2A 2PUUA 2W1EA 3PTGA 3QKLA 4FNWA 3VHEA 4TNDA 1YW2A 4ZP5A 4R78A 2YHVA 4ITJA 3OEFX 5EYCA 2V0DA 2XK8A 3LVPA 4FIEA 4CKIA 3LJ0A 1PXIA 4DFLA 3KMWA 1B6CB 2R3KA 3R9RA 3FQSA 3I6WA 4FL2A 5ANDA 5ETIA 3COIA 3OROA 3FE3A 3LFDA 4ZSJA 2XK6A 3OF0A 3U8WA 3UMXA 4BIBA 3GCVA 2VGPA 2YN8A 4RGJA 5HBEA 3AQVA 4HVDA 5CEMA 4O0SA 4XLIA 4NFNA 3G15A 4X2JA 3WF8A 4C3PA 3I7BA 4NH1A 1ZLTA 4W4VA 4X2NA 1TKIA 2C30A 3NDMA 3QQGA 4B8MA 1IA9A 2WTCA 3R01A 3O50A 3RNIA 1U5RA 4BI1A 2ONLC 2CGWA 5JZJA 4RLLA 2BTSA 4N0SA 2J9MA 2WMTA 3I5NA 4F9CA 2W9FB 2YCSA 4EH5A 4FV3A 4GG7A 2WOTA 3BHVA 4JBVA 2BKKA 5HO6A 3S3IA 3VS6A 4EUTA 5CF5A 1K3AA 3C7QA 2XYUA 5A4LA 3PVBA 5AUZA 3QRIA 5LCJA 5JMSA 4QPSA 4DE4A 4QYEA 5DN3A 2YIYA 4ACHA 4ZJJA 4C4FA 5GZAA 2YCQA 4NKSA 3PZHA 1XH4A 3ZU7A 5IH4A 1FINA 2Y6OA 2VTAA 2WQEA 5H8BA 1H1PA 4M0ZA 2ZJWA 3ROCA 5J7BA 4NYEA 3I5ZA 4ITIA 4MNEB 4I5HA 4O7NA 2XKCA 2J0JA 3OHTA 4DF3A 3FLQA 3FMEA 4Y85A 3FJQE 4MEDA 3CGFA 4LMUA 5CEIA 4GIIA 1OL1A 4AXAA 5EKOA 3K3JA 4BWKA 4RX9A 3LHJA 1JKLA 2BILB 3NGAA 4HPUE 4KIOA 2QU5A 4X7QA 2VTLA 1CTPE 1V0BA 2XIZA 3EN9A 4G3GA 4WD5A 4O7LA 4I0RA 4XP3A 2B9HA 2GNHA 2WFYA 3H3CA 3PIZA 4X6RA 5HKMA 3VBTA 1FGKA 4H58A 3V04A 3DTWA 3FL4A 4OTWA 4YMJA 3Q5IA 5D12A 2QCSA 2RFSA 3BCEA 2UW7A 4FKTA 3P4KA 4BDJA 5GIPE 4F1MA 5E91A 3DXNA 2QOCA 2OKRA 3Q32A 3UIBA 2AUHA 2QR7A 4AT3A 3V8SA 3BE9A 4C35A 1PF8A 4RPVA 3ZO3A 4Y95A 4I5MA 5IG1A 5KHXA 4XG2A 2WTVA 3BELA 3KVWA 3OFMA 4MF1A 4RVTA 3TDWA 3B2TA 5HO7A 1R0PA 3RPVA 5I4NA 4J7BA 3DGKA 3C13A 5JRSA 2V55A 3MVHA 1NW1A 3H9RA 3NUAA 3NVKI 3QL8A 4FI1A 4YPDA 2X81A 3MY1A 1Q5KA 5JSMA 5DE2A 5IA0A 3EZRA 4E5AX 4A9UA 1JQHA 2R3MA 5DT4A 4AZWA 2BHHA 2JKMA 2W9ZB 4YC3A 5CS6A 5J95A 3R73A 4TKSA 3V6SA 3WZEA 4GYGA 5A4QA 3R9OA 3EN5A 3L9NA 2RF9A 3N9XA 3ANRA 4IAAA 5FRIA 3ZEPA 4U8ZA 1XWSA 5HLNA 1JKSA 2XNGA 3W8LA 4FTRA 4CKJA 3D14A 1FMOE 2H9VA 4J71A 2ZM1A 3PIYA 4C7TA 3DLZA 4EC8A 3CE3A 3FLWA 4RRVA 4GKIA 4OLIA 2FGIA 3CGOA 4RJ4A 5JGAA 4XMOA 3LZBA 3THBA 4QQTA 4KNBA 1YXUA 4DH1A 5K0KA 4QRCA 5ANJA 3OUKA 5GJDA 2R3HA 4RVMA 4GCJA 3ALOA 3TZ7A 3ZYAA 4GW8A 3GU7A 3HMIA 5AX3A 3E62A 3RAHA 3MBLA 4FZFB 2VWZA 4BI0A 4KRCA 4TRLA 3F2NA 3OWKA 4CFVA 1R1WA 3QRUA 3GGFA 3NCGA 3TKHA 4GV1A 3TV4A 5HBJA 4HZSA 2YLEA 4CCUA 3T3UA 4KIQA 1MQBA 2R3RA 3FY0A 1IEPA 1KOAA 3CY2A 5KHWA 2CN8A 3WZUA 1FVRA 1GIJA 1M7QA 2A19B 3HX4A 5C4KA 2C3LA 4KIPA 3VW8A 2UVYA 4NK9A 4GFGA 3QD0A 4J52A 2BAQA 3FKLA 2PVYA 4E6AA 4YLKA 5E8VA 2XJ0A 3FMLA 1TQIA 3RKBA 3NUXA 3ZOSA 2OW3A 3EFJA 3IGOA 3QQJA 5ACKA 4ZLYA 4G3DA 1OMWA 1NA7A 4BTJA 4ZS4A 2WQBA 3LFFA 1CM8A 3BZ3A 4C8BA 1YHVA 4CFWA 5AV3A 5HEZA 3UYTA 5AR7A 4QP7A 4FSNA 4B0GA 5CF8A 2DS1A 5J1VA 3IO7A 5E92A 3O71A 2YCFA 3KKVA 3OBJA 3LCDA 3D15A 5HESA 5DRDA 1Q24A 3VF8A 1P14A 5D1JA 4QYYA 2CLQA 4RBLA 3SDJA 4TWNA 4FG7A 3E3PA 4II5A 1M14A 4O6LA 3QLGA 2YM4A 4RIWB 4ZTQA 3SAYA 4FV4A 3ZDUA 4D1ZA 2VTRA 3O7LD 4F63A 4PP9A 4QP1A 3RZBA 4AN2A 3EB0A 3MTLA 2AC5A 2PZ5A 3ZBFA 2F7ZE 5M53A 2R3LA 2FVDA 3Q5ZA 4BFMA 4MXCA 3LE6A 3QWJA 4D9UA 2XF0A 5IISA 2FSLX 4IDVA 5CAUA 4DT9A 3EZVA 3AD5A 4FTNA 1Q8YA 3UZTA 5DGZA 1UNGA 4HVHA 4EYJA 4BHZA 5LMAA 4JIAA 3TNQB 5FBNC 3ZUVA 4LG4A 3WIKA 4NM0A 3QZGA 2XNMA 4NTTA 4DH5A 4TYJA 3C50A 4MHAA 2OG8A 2WQOA 3AD4A 4I93A 1HCLA 2B9JA 2C6EA 2R4BA 4IC7A 2OBJA 5CI7A 2V7OA 1O6YA 2NPQA 2QG5A 4A4LA 2JFMA 2PVLA 2OIDA 2PY3A 4WNKA 2WOUA 1L8TA 3ZLYA 3QZIA 1IG1A 2WIPA 5M4CA 5AADA 3TJDA 3F3TA 5E8SA 3BLRA 5H8EA 2VO3A 5CZHA 4FK3A 4O1PA 4H3BA 3UQCA 4BR3A 1Q41A 1Y6BA 3KL8A 4WOVA 4F9AA 3KK8A 4O0UA 2C6OA 2NP8A 3KXXA 5CEKA 3F5GA 4W8DA 4XH6A 4Q9SA 4KABA 4PP7A 3ATTA 2QU6A 3SOAA 5KKRB 1PXKA 2UVZA 4WBOA 4J95A 4Y73A 2A4LA 1OIYA 3D0EA 3NUNA 2NRUA 2UW0A 4UMTA 4DG3E 5E1SA 2QVSE 1AGWA 3ODYX 3C0GA 3KU2A 4ZJIA 1JKTA 3G0FA 4CTCA 5HQ0A 1H1QA 3QTIA 1YVJA 3F66A 3KB7A 4HCVA 4LL5A 3MIYA 1Y8GA 4NTSA 4XS2A 4BZDA 5L6OA 1Z9XA 3QTQA 5AM6A 3NNUA 5J8IA 2X7GA 4JX3A 3UVPA 5EI2A 4FKUA 1WBWA 3HMMA 4QQCA 4O82A 2C69A 1Q8TA 3MN3A 1TVOA 3FLZA 3W2OA 4DEBA 4EH8A 5LVOA 4RWLA 1WMKA 2CKQA 4BC6A 2OI4X 2GFCA 3C4WA 2XS0A 5D11A 1G5SA 4RA5A 4JLCA 3ORZA 4GMYA 3D7TB 3QALE 3VJOA 5CENA 3ZZWA 3LOKA 2ITXA 4I6HA 3POZA 3K3IA 3MGYA 4LOOA 3N4UA 1ZYLA 2G2IA 4MXZA 4ZTNA 3PXQA 3TUDA 2GS6A 4TY1A 3D4QA 3A99A 3F61A 3COKA 3R1QA 3BIZA 4YZCA 4YURA 3CJFA 3CQUA 2BUJA 4FKIA 2DWBA 3TCPA 5IA2A 5DOSA 4LM5A 3UNZA 2YWVA 5AM7A 3QZHA 4ASZA 3ITZA 2YEXA 4L3PA 1Q8UA 2BRBA 4FVQA 5DG5A 4D9TA 2W1GA 3ORMA 4G6NA 4OTHA 4XCUA 3AC2A 3GCPA 4IAKA 3RZFA 3UG1A 4USEA 1MUOA 2VAGA 4M7IA 4F0IA 4O38A 1H00A 4AUAA 3I0QA 4YU2A 4UN0C 5H8GA 1VYWA 4BHNA 4IM0A 4QTBA 4WKQA 3O2MA 3FC1X 4BZNA 1REJA 1QPJA 2OK1A 4L52A 4ITHA 4BCJA 3WF5A 3E5AA 4Y46A 5AUYA 2BCJA 2JC6A 5EW3A 4F6WA 2CPKE 5I3OA 5DEYA 5A6NA 2ZDTA 4FKPA 3I4BA 2OF4A 3FKOA 3NUUA 1S9IA 4MF0A 2IVSA 1OZ1A 4XHKB 3TJCA 3UOJA 3MY0A 4C2WA 4U0IA 4CZYB 2UZNA 3V5LA 4DC2A 5CASA 3I81A 4ZSLA 1QCFA 3IOKA 4PDPA 4ZLOA 5BUIA 4LRKA 2UZTA 3LLTA 4YUQA 3DBDA 5DLSA 3D5XA 4FNYA 4JXFA 3UTOA 5CVHA 2ETRA 3TEIA 3KULB 3WIGA 2Q83A 2BDJA 4PDYA 1KE5A 2YIRA 4IWQA 3TN8A 4M0YA 3CEKA 1UU3A 4G31A 3UQFA 5GJFA 4FC0A 4A07A 2GCDA 4FNZA 3RBWA 5ITAA 5HVJA 3M2WA 2JLDA 4WUNA 3OXTA 4FG9A 1LEZA 1YI6A 4WT6A 2QD9A 2HW7A 3D2KA 5CU2A 3GXLA 4PWNA 4BI2A 3G90X 4TYEA 5AV0A 4LOQA 3VIDA 1NVSA 5EYKA 3U4UA 1FOTA 1ZRZA 4L53A 4YJOA 4QMWA 5A4EA 4PMSA 2GQSA 4IX5A 4IADA 4UWCA 5BNJA 3UP7A 5DR2A 4I20A 2WD1A 2WU7A 1O9UA 2EXCX 3IECA 4FTUA 4ACCA 3PWDA 4PNIA 4YHJA 3PJ1A 3ZDIA 3EH9A 4BYJA 1YDTE 4ERKA 4IEBA 5HVYA 3DK6A 1G3NA 3RALA 2VWYA 5LARA 4M15A 3NYVA 4UMRA 5TOZA 4RZWA 5FEQA 4WNOA 3LQ5A 3NR9A 2QNJA 4F9BA 2XUUA 4EOQA 4QYFA 3DXPA 3VULA 3VS1A 4HCUA 2QLUA 2WMXA 2XJ2A 1KV1A 5EQEA 4M66A 3BYOA 3Q9YA 4QMVA 5JT2A 4IVAA 1B38A 1UKHA 4BICA 4TYHB 2JIUA 3KY2A 5L2SA 3FBVA 3ATSA 1OPKA 3BBTB 1OVEA 1QPDA 2EUFB 4JX7A 2VV9A 3AC3A 4JIKA 4C02A 5IPJA 4QP6A 5GIOE 4OBOA 3W2CA 4ZLZA 3ULZA 4CMOA 4NKAA 1P4FA 3TZ8A 1YWRA 5K4JA 3EYHA 3II5A 3QTXA 4KKHA 4E93A 4PV0A 2AYPA 3A60A 4OUCA 3BV3A 3IDCA 2VTTA 4NUSA 5IQFA 4IXPA 2X6DA 5KNJA 4XOZA 2VO7A 3DT1A 2BDWA 2E9UA 2R3FA 4JBQA 4O22A 1OL7A 1DI9A 2ITOA 2A1AB 1WVWA 5I9UA 2UW9A 4H39A 2ZDUA 2CKEA 3PRIA 4MYGA 1WVYA 5KBQA 2OJGA 2W1IA 3R2BA 4IB3A 5JQ5A 3P1AA 3FYJX 4O6EA 2PMLX 3NS9A 4BDFA 3W2SA 4P5QA 2C3KA 4FKSA 3PXRA 1F5QA 3NYNA 4FT9A 3RK5A 1LPUA 1WBSA 5BVNA 3C4XA 4RWIA 2XNPA 3OOGA 4YZMA 2X2LA 3KRRA 4IB0A 3FL5A 4MH7A 4IH8A 3SQQA 2WTKC 2JDRA 5HCYA 4U81A 4IANA 4U45A 4UMQA 4YTCA 4DEDA 1FPUA 4EQUA 1HOWA 4EOIA 4Z3VA 4ANMA 4XP0A 3QKKA 4TWPA 3ZH8A 4AG8A 3OY3A 1WBVA 4H3PA 3RM7A 1W98A 5CLPA 4ZXTA 4CQGA 3KC3A 4U80A 3MWUA 5CU6A 3NZ0A 5ANOA 3BHTA 3Q4TA 1H28A 4FIJA 4H1MA 3FMDA 2VTOA 2ZM4A 4BIDA 4D4VA 3C9WA 4FBXA 3BWFA 1BL7A 3WI6A 4L42A 2W5AA 5JEBA 4I22A 3BU6A 4X3FB 5D10A 2A2AA 2BRHA 3DBFA 3BYSA 4XX9A 4O7TA 4RJ7A 3KVXA 3AT3A 4MQ2A 2YFXA 3VBVA 4EHVA 1VZOA 3F7WA 4TL0A 3VS7A 4ANSA 2PVKA 4UX9A 2R3OA 3WF6A 4XOYA 3TACA 5HORA 4YJRA 1JAMA 5IEYA 4U3YA 2VWUA 4DEAA 1OGUA 2R3GA 3OG7A 5F20A 5BYLA 2X39A 3BYMA 4RFZA 5AAFA 3C4EA 5L8KA 4MWHA 5FEEA 1URWA 3RPYA 4EOSA 1QMZA 5EDRA 5CT0A 2QC6A 3ORNA 1G8SA 2NO3A 3HV4A 5E90A 3KRLA 3GB2A 3PVUA 4O0XA 4F08A 2P33A 1ZZLA 1AQ1A 1E1VA 3DK7A 4QMMA 1OPJA 2F2CB 5C27A 4AFJA 3DK3A 1H24A 4I24A 3VO3A 3R7OA 2OFVA 4G9CA 4FSMA 2NRYA 2YM7A 4PRJA 5CQUA 3SX9A 2J7TA 1FVTA 4TWCA 3BV2A 4FIFA 5AP4A 2C5XA 1CMKE 4B9DA 5IQGA 2JKOA 1LP4A 2OF2A 2HY0A 1OI9A 1PMUA 3OUNB 2V62A 5A14A 5IEXA 4D2PA 3ZM9A 4PDSA 3FMHA 2C1AA 5I9XA 3MVJA 3G9LX 4Q2AA 3EFWA 3F3VA 2GNFA 4G3CA 4QP4A 2XP2A 4JOAA 5CVFA 2GS7A 3OEZA 4XYFA 1H1WA 1LUFA 3WF7A 1M2PA 3HA8A 3VF9A 4AZTA 1M7NA 2RG5A 4FV7A 2R0UA 1J7LA 2VWIA 4O2ZA 4DGMA 1M52A 1Q61A 3EN7A 4R77A 5DIAA 3U55A 3EQDA 5T68A 3OWLA 2YJRA 4TZRA 5J87A 1W84A 1YKRA 3DBEA 4DGGA 4K18A 4XBUA 5FXSA 2PMOX 3QKMA 3P7BA 4FTJA 2X8DA 4AZEA 5KO1A 2PTKA 1YHSA 5B0XA 3UYSA 4DFZE 5J7HA 3NX8A 1BI8A 4JQEA 4YJNA 4MD7E 3KULA 3MA3A 3BQRA 3RAWA 3MJ2A 1G8AA 2UW5A 5M4IA 3NNWA 5FD2A 3B8RA 4PX6A 4HGLA 3R9NA 3VS3A 3G6GA 3LM5A 3Q9XA 2XK7A 4BRXA 5LMBA 2ITTA 2J5EA 5KMIA 4CFNA 4HGEA 4G9RA 4LMNA 3R1SA 2R3PA 4GT5A 3DOGA 4W9XA 4YLLA 4AA0A 4I6QA 1NXKA 4NW5A 1PMNA 5KCVA 3CBLA 3TNWA 2ESMA 2W4JA 2CLXA 4MXAA 2F7XE 5H2UA 3SXSA 3QYZA 2CGVA 3DBCA 4Q5EA 3D5WA 5CX9A 1ZOGA 3I7CA 3W2PA 1XH8A 2BAJA 2WTDA 1YOJA 2C3JA 3FMKA 5CSHA 4JDHA 3R9HA 5L3AA 1OIQA 4BDCA 3UE4A 2OJ9A 2R3JA 2WMQA 4YTHA 3O96A 2UVXA 5JN2A 2O63A 4RT7A 3HECA 3OP5A 2CCIA 4R3PA 3ZFXA 3MFTA 4U9AA 4F09A 2XNNA 2CGUA 3L1SA 3GOPA 3KMMA 4WRGA 4IFGA 2F4JA 4UY9A 3ZHPC 3RPRA 2OJIA 4QQJA 4GK4A 4GVAA 4CFFA 3OC1A 4AGDA 3ZRMA 5D7AA 4A4OA 1YI3A 2Z7SA 5KUPA 2PMIA 4WSYA 1GNGA 3CCNA 4ENXA 4CV8A 4KSPA 4PPCA 1REKA 3EJ1A 4RLKA 4NSTA 5HCXA 2GQGA 3Q6UA 4OAVB 4CYJA 1OBDA 1ZXEA 4ZTLA 4G16A 3R1YA 3LKMA 3BWJA 3Q9ZA 3ZFYA 4EL9A 4QTDA 5CZIA 4DA5A 4ACMA 3MVMA 1SNUA 3PJ2A 4R3CA 3VRYA 5JFSA 2XK3A 4ASEA 2GDOA 2ZAZA 5AP6A 5FBOA 5FWKK 3ZSHA 4HPTE 4MXYA 5E8UA 5EW8A 2C6KA 3QA0A 2E9PA 2W96B 3KXNA 4ZY4A 3M1SA 4QMPA 2OIBA 4QTCA 5DHJA 2C6TA 4NM7A 4F7LA 3R8ZA 2QR8A 5EH0A 2ZV7A 1PHKA 3FSFA 1L3RE 3G6HA 4IZAA 4C33A 1DI8A 4MX9A 2X8EA 3ET7A 5EOBA 3AG9A 2IZSA 2CJMA 3PE1A 4KKGA 4KS8A 4P5ZA 4C4HA 5KMLA 3MESA 4USFA 4LYNA 4CG9A 2YJSA 3QQFA 4ZTHA 3HL7A 3ORXA 4ANOA 3O8PA 4IDTA 4XG3A 2C0TA 2R3QA 2W17A 3KN5A 4FKLA 4K9YA 4QMYA 3VJNA 3C0IA 4EOMA 4HGTA 4S33A 4AOTA 3QU0A 2BMCA 3CPCA 4C4GA 4FEXA 2GNJA 2UZEA 2XEZA 3KRJA 4XG9A 4C61A 4DFNA 5DYJA 4TWOA 3RAIA 4IX3A 2WXVA 3WF9A 5AX9A 2BR1A 3DA6A 3O7LB 3FPMA 4I41A 4M67A 5GHVA 1LR4A 4C37A 4GK3A 3VBWA 3BGZA 3PFQA 3PDTA 4H05A 2OU7A 3V8TA 5DI1A 2Z02A 4R1YA 4RIXA 3IDPA 2FH9A 3PLSA 3RP9A 3UDBA 4FVPA 5HG5A 3QD2B 4X3FA 3ZXTA 4IAZA 3L9PA 4K0YA 3FPQA 3KQ7A 2GU8A 4IJ9A 4HYHA 3RINA 4EJNA 4F7JA 3QCYA 4BCMA 1FMKA 3NW5A 5ANGA 5FLFA 5CAVA 1SM2A 4DEEA 4PPBA 2YIQA 2XB7A 4D4RA 3V5TA 5AUTA 2C6IA 5IMXA 5TR6A 5HCZA 4FVRA 4AE9A 4CRLA 3VRZA 2XK9A 3DFCB 2BDFA 3U54A 4RJ8A 3UZPA 5L2TA 2JIIA 4DG0E 2BRMA 1GIHA 3BPRA 1H08A 5BUEA 4FV6A 5F94A 2I0HA 2RFNA 5C01A 3LXLA 3GEQA 3LFBA 3P23A 4JAIA 1WFCA 4EUUA 1XBAA 4FOCA 2OIQA 3R8VA 3TZ9A 1GZOA 2PVMA 3PA4A 5EG3A 5KMMA 2R3IA 2Z7LA 4YC6A 2WGJA 4D2RA 3U9NA 4IIRA 2HZIA 5DMZA 4EYMA 4AW1A 3HDMA 4DGLC 3DAKA 2OH4A 3UIUA 5DR9A 3LAUA 3ZO1A 2I0EA 3WBLA 4IC8A 3U4WA 3OMVA 3H30A 1UWHA 3NYXA 2UW6A 2W1DA 4P2KA 4E6CA 3LFCA 4YNOA 3A61A 5IQAA 2XBAA 1W0XC 1UU8A 5AR8A 3VUMA 3H9OA 1IASA 2B55A 4UEUA 5FM3A 2WEVA 2X2MA 3VUKA 4A7CA 4PF4A 3NW7A 3MPMA 4JJRA 1LEWA 3MFRA 5EYMA 5AJQA 4DGOA 1O6LA 3BKBA 2B9IA 2REIA 3R02A 4UMPA 5CNOA 5M51A 4ZEGA 3GC0A 4DINA 4EBWA 3IG7A 2WHBA 4F0FA 5AP5A 3PSBA 3GP0A 4OR5A 3FV8A 3OXIA 4I0SA 4BVUA 5FUTA 4I6BA 4HVGA 3ZS5A 2ITUA 4BY9E 2X9FA 3W8QA 4M69A 4FGRA 2J51A 3JVSA 4A06A 2ONLA 3DJ6A 4KS7A 3Q6WA 4RC4A 2PE0A 3TUBA 3U6JA 2W1ZA 1X8BA 2JAVA 4FTMA 5C1QB 1UNHA 5DA3A 4EONA 2YABA 3NPCA 3QTSA 4ANLA 4E5WA 4HYSA 3TXOA 4O0YA 1QL6A 4JDJA 3REPA 4DCEA 2OO8X 3HA6A 2Y6MA 3PY0A 2ZV9A 3ZFMA 4QMQA 4ZJVA 4YZDA 4EK5A 2WMUA 2G2HA 5AIRA 4D0WA 3N4VA 3ZSIA 2PZIA 5AIKA 3JR1A 4JRVA 3C4CA 5CSWA 3TKIA 4WA9A 5I5ZA 4AA5A 3WARA 3QC4A 2JBPA 4O27B 1OPLA 4Y72A 2KTYA 3S4QA 4M68A 4ZS0A 3DAJA 3ROYA 4FGBA 3QRKA 4QNAA 3BYVA 4FSRA 4GUBA 1ZY5A 5CSVA 3V6RA 3KF4A 4N57A 3L9LA 2PUPA 5BVWA 3DB8A 3NNVA 4CMUA 4O0RA 1XKKA 3HAVA 4F65A 5ANKA 1GZ8A 4GK2A 5IA3A 2F2UA 3Q53A 1OBGA 2XYNA 1H0VA 3UODA 4C38A 3UC3A 1P5EA 4YZ9A 3HKOA 3MDYA 4FUYA 1XR1A 3SLSA 5IZFA 1OIUA 4PUZA 3Q4UA 4EHGA 4AN9A 1OUYA 1GAGA 3SG9A 3Q52A 4E4LA 3W16A 3HP5A 3PXZA 4YBJA 3CJGA 5AP3A 4RC3A 5LXMA 3DY7A 3N51A 4ZK5A 1YXSA 3SW4A 2BRGA 4E20A 3AXWA 3MH2A 4RIOA 4YLJA 4D58A 4PMPA 2C47A 4FV8A 3ORLA 2VX1A 3L8PA 2OICA 2A0CX 3L8VA 4H36A 2CN5A 5CEPA 3R00A 4BDBA 2YIWA 3ERKA 2XNOA 4X2GA 2FSMX 3V3VA 3CS9A 1R0EA 1J7UA 2DYLA 3RCDA 1UVRA 4K2RA 4WNPA 5E4HA 4FEUA 1UNLA 3S2PA 4DFBA 3E93A 4BDAA 3LQ3A 3PJ8A 2HXQA 4DFXE 5JRQA 3H4JA 4I94A 4GFMA 4DG2E 3E8EA 3HRCA 3OCSA 1RQQA 3AT4A 3F69A 3CP9A 4ENYA 4OTQA 3VS5A 4AFEA 4K6ZA 4FTCA 3AC5A 1XBCA 3SD0A 3QTZA 4ANBA 5M4UA 2X2KA 4L44A 3EQBA 3RWQA 2H6DA 5HU3A 3SW7A 4CZTA 3C4ZA 3EMGA 4BKZA 5AR2A 4FKOA 4QMSA 3QLFA 3DZOA 1F0QA 2IVVA 4WG5A 4W4YA 3R63A 5KZIA 3Q9WA 2XIRA 5FEDA 4W4XA 4O96A 4EK3A 1YXVA 2O3PA 3R04A 4AT5A 3FQEA 3R83A 4DAWA 3K5VA 4FV9A 1XH6A 3PP1A 4AF3A 5HD7A 2Z2WA 3D94A 4L3JA 4LI5A 4FTKA 2B52A 1YOMA 4GUEA 1E1XA 2I40A 3SV0A 4MAOA 3ORPA 4KBKA 3WZJA 1YDSE 3QD4A 2HWPA 2CMWA 2PVFA 3AMAA 2PE1A 3PXFA 5KBRA 5JGBA 4CSVA 3CXWA 4KAOA 4DITA 3QXPA 4FIGA 5IQHA 4MCVA 2VTSA 3NNXA 3JUHA 4EOJA 3UPZA 2G9XA 2ITPA 4HYUA 5L2QA 5LVNA 2BZKB 2C5VA 2GHMA 4NWMA 4BYIA 5AP1A 2QOFA 2I1MA 3B8QA 3GENA 3NRMA 4O83A 2QOKA 4AOJA 5JQ8A 3EFLA 2CKPA 4WO5A 4J97A 4MWIA 4I1ZA 5M07A 4FIHA 4L67A 3W10A 4FX3A 3V01A 1J1CA 5K0XA 3UO5A 4RJ6A 2UV2A 3ZRKA 4KINA 2OWBA 3VNTA 4EI4A 4YP8A 3FAAA 3H0YA 3ORKA 4MD8E 3UJGA 2VTHA 4O0WA 4LV8A 4L7SA 4R5SA 3QZFA 1H8FA 5CT7A 3BX5A 2O64A 1OKVA 4IBMA 4DT8A 3GC8A 3Q2JA 3AT2A 2GTNA 4JBPA 4JS8A 4JL9A 4ONAA 4QTAA 5H9BA 5HI2A 3R0TA 1PRYA 3FHRA 4L43A 4M84A 3RAKA 3W1FA 4IZ5A 4D5KA 4EWQA 1PYXA 2BROA 5L6WL 5L2WA 3FC2A 4TPTA 2Q0BA 2XIXA 4FL3A 2HY81 4QP3A 3AGLA 4GH2A 3Q60A 4LUDA 3F6XA 4EOOA 3ENHA 3BLQA 4X0MA 4L00A 1TQMA 2VX0A 5ETAA 5BMSA 2ETKA 3GC9A 3Q4CA 3BHUA 4D28A 2WEIA 3LFAA 4AGCA 3LMHA 1BYGA 1ZZ2A 4USDA 1BKXA 3WOWA 4G1WA 4W8EA 1U5QA 2G01A 1DM2A 4E7WA 3E64A 4ZTSA 4S2ZA 4IB5A 3A62A 3G33A 4E8AA 4DBNA 4CCBA 5HG7A 4IAFA 5IH5A 2BKZA 4GU6A 1UA2A 2W1CA 4TTHB 1I09A 3I0OA 5HD4A 5BVOA 5CANA 4BCQA 3F2AA 4DN5A 4H3QA 4DEGA 3FZSA 2QHMA 5AR4A 2WMWA 3EOCA 4MK0A 2H34A 1UV5A 1ZMVA 2WQNA 3CD8A 3QCXA 4FZ7A 5JK3A 3DNDA 5M4FA 2PMNX 4L9IA 4F6UA 3CY3A 1ZYDA 2C3IB 2O0UA 3EIDA 3DU8A 2PYWA 4FTTA 2BFYA 3CTHA 4C59A 4KBAA 3R8LA 2GTMA 4QMTA 4E26A 3HEGA 4GFOA 3TKUA 4PL3A 1KWPA 5HVKA 3K2LA 3LLAA 4N6YA 2YA9A 4OTPA 3O23A 4TW9A 4W9WA 4WNMA 4IW0A 4ZZOA 5IQIA 4CT1A 3ZLWA 4O7YA 4X21A 4BCIA 4D4YA 4OTGA 1VR2A 1E9HA 3TNIA 3M11A 4AZSA 5I9WA 3LMGA 3LQ8A 3KMUA 4D0XA 3V8WA 3V51A 3NIEA 4QTEA 2B53A 5LWNA 4AT4A 4GJ2A 5I9YA 3P7CA 4R7BA 1CKIA 3UO6A 4RX5A 5I9ZA 5KKRC 3CSVA 1FQ1B 4FTAA 4AOIA 4XV3A 3TIZA 3DCVA 2JKQA 3GU5A 3ETAA 5AA8A 4NT4A 3TNPC 1JKKA 5E1EA 4BGHA 3F7ZA 3UVRA 3QUPA 1PMVA 5LWMA 4O7RA 2G1TA 3P08A 2DQ7X 4L3LA 3BYUA 2VO6A 4U6RA 4NU1A 1ZMUA 4FKRA 4IVBA 4QNYA 3DPKA 2OJJA 4YBKA 4OT6A 3VHKA 4CQEA 3OCTA 1Q97A 4NM3A 2IPXA 3PWYA 3PZEA 4IHPA 4QYHA 3MIAA 5G1XA 4NFMA 3W18A 4IAYA 3CD3A 5FM2A 2C6MA 2VTMA 4XV2A 4E6QA 1Y57A 4I4EA 4F6SA 2YDKA 3SGCA 3A2CA 4L6QA 1KE7A 3KA0A 4IM3A 1NY3A 4FEVA 5JFWA 5HICA 4RQKA 3RCJA 2PHKA 2VTIA 2WTJA 4G3EA 3D7ZA 3RPSA 3QAME 3ZMMA 4DLJA 2PULA 2XA4A 4KUJA 2W4KA 2VD5A 4LRMA 3VUDA 2IZUA 3DKFA 3POOA 5FDXA 2EVAA 2JDOA 3AGMA 3TM0A 3G2FA 4IB1A 4GL9A 3E8DA 5EYDA 4ID7A 3BGQA 4BL1A 2VU3A 3UIXA 1SNXA 3UMWA 2R64A 1H1RA 3FEGA 2B7AA 3KXGA 5LJJA 2B1PA 4N6ZA 5TO8A 5KMJA 4JQ7A 3O8TA 3UIMA 4Z7HA 2V22A 4RJ3A 4RZVA 2J0KA 2QOQA 4CG8A 4BCOA 3NCZA 1Z57A 5HLPA 4EQMA 3OS3A 4HCTA 4E4XA 3EWHA 2P3GX 5C26A 5LQFA 3D5VA 4QMZA 3GOKA 2X4ZA 4DEIA 5C9CA 3K54A 2VTJA 4ANNA 3TV6A 3PYYA 3F88A 4M12A 1YHWA 2XJ1A 3AD6A 4S32A 4O2PA 5BPYA 3HNGA 2CNQA 3CQEA 2JDSA 2HCKA 5TE0A 3GC7A 3MVLA 5L8JA 2OLCA 4FSZA 1ZYJA 4BTKA 2O65A 4I3ZA 4TT7A 5CU3A 5EDQA 4NJ3A 4ANQA 2GMXA 2VWWA 3FHIA 3QQHA 3Q96A 4C2VA 2CNUA 3C4FA 1SVHA 2VTNA 3CTQA 4RIXB 5FTQA 4E5BA 1XQZA 5LVMA 4P7EA 5CVGA 5ICPA 5EM5A 2I7QA 1EH4A 2C0OA 2I0VA 1JSTA 3IKAA 3GU4A 3Q4ZA 3VS4A 5BX0A 4GRBA 4DTAA 1U59A 2PVRA 3DKOA 5HE1A 1IA8A 2C5OA 2EWAA 2PVHA 2YAAA 3UC4A 1URCA 2HYYA 1ZWSA 3QRTA 2W06A 3WZDA 2ITZA 1PXOA 3R7VA 5A46A 3GVUA 3V5PA 1ZMWA 3DZQA 4UV0A 5JFVA 4RVLA 4EZ3A 3DFAA 5EOLA 3G51A 3TI1A 1NVRA 5HTCA 1RDQE 3FI8A 2C6LA 4FSTA 2VNWA 5HGIA 5IEVA 4WIHA 4BCNA 4O91A 1M17A 1GJOA 1NT2A 2WELA 5HU9A 4PDOA 4KIKA 5AV2A 2QONA 4WBBB 2PE2A 1W7HA 4BN1A 4OBPA 4KRDA 4R5YA 5J9ZA 3HRBA 4UYAA 3CPBA 4PL5A 3H10A 3CC6A 4RX8A 4F99A 1XBBA 5ETCA 2CDZA 3D9VA 3GFWA 1V1KA 2QLQA 3KRXA 2ZOQA 4GIHA 2OXYA 2G2FA 4DH3A 3E8NA 4BF2A 4RIYA 4EKLA 1KOBA 2YIXA 4J98A 5I3RA 3ZXZA 5LVPA 2XKDA 5HBHA 4JG8A 1Q62A 1FBNA 4PQNA 4FG8A 4E73A 3SVVA 1OUKA 4FSQA 3JY9A 4BCKA 4EBVA 2ETMA 3AC4A 3TUCA 4F4PA 4NL0A 1XH7A 4L45A 3BE2A 1XO2B 3OBGA 3DQXA 5B2MA 2HZ0A 1M2RA 3NLBA 4OT5A 3F5PA 2C5YA 1PKDA 3MFSA 5J79A 2BPMA 3MH0A 3E7OA 5ANEA 3IW5A 4IM2A 4QD6A 3R21A 4K1BA 3QUDA 3W2QA 3FMMA 5HLWA 4BWXA 2C6DA 1XHAA 2W7XA 5K3YA 5K5NA 3G9NA 4EZ7A 1KE8A 2JIVA 4FKWA 5M57A 2Y9QA 4UZHA 1DAYA 3MPAA 5KX8A 3I60A 4HYIA 5G6VA 2BFXA 2FUMA 3R28A 1OL5A 4QMOA 3SC1A 4J1RA 4YGAA 3EFKA 1V0OA 3GCUA 3EQFA 4QT1A 4YJTA 4AW2A 2JAMA 3DB6A 4XG6A 4M69B 5HHWA 4BKJA 2W5BA 4EKKA 3W32A 5AAEA 4MNFA 4KA3A 4EH3A 2R7IA 1OIRA 5K5XA 2CNVA 2QOBA 3O0GA 2YZAA 5IQCA 4I6FA 4FV5A 1Y8YA 2QQ7A 2BHEA 4CFXA 2ZMCA 4FYOA 2P2IA 4JBOA 5FGKA 1PJKA 3UNKA 2BIYA 2KULA 4FNXA 4EK8A 3O51A 1RW8A 4AX8A 2ACXA 3FKNA 3ZUUA 5BUJA 4C57A 3E87A 3EL8A 5AMNA 4JT3A 1J3HA 2CKOA 5M06A 3TNHA 3KFAA 2PVNA 5DT0A 4B4LA 4D1XA 4R7HA
chains in the Genus database with same CATH superfamily
3UZRA 2WQMA 4RWKA 4BBFA 2ZV2A 4M97A 2HWOA 2RSVA 4C4EA 4ZY5A 5T3QA 2F57A 4GKHA 2VO0A 4FK6A 4BTMA 1KSWA 2XM8A 5EQPA 3FLNC 4X3JA 2HENA 4EK6A 3OCBA 2YM8A 4CFUA 4I6LA 3KGAA 3GU6A 5IU2A 3PIXA 3QWKA 3ENMA 4FIIA 4C4JA 2EXEA 4LUEA 4U3ZA 3RHKA 2ITVA 4UB7A 4CMTA 4EH6A 3TTIA 3AKLA 5AFVA 5J9YA 5FTGA 1U54A 1KV2A 4XRLA 3ZBXA 2XH5A 4Z55A 1VYZA 1RJBA 2OZAA 2XVDA 2Y8OA 3LFQA 4W4WA 3AMBA 4MD9E 2HW6A 5HNIX 4QP2A 2GNGA 2WNTA 4ACDA 5IUIA 4J53A 2IZRA 2R3NA 5BVKA 2W0JA 3HV6A 5EDPA 5IA1A 3BGPA 3FI3A 4FKVA 2E9NA 4UWBA 4FKJA 2BZIB 5CSPA 1T46A 3DNEA 3QBNA 5F4NA 3U6HA 3EKNA 4L46A 1SVGA 4V0GA 3VS0A 3HUCA 4G6OA 3LW0A 4HZRA 1JSUA 3R7GA 5BQ0A 1SVEA 4KKEA 4K8AA 4EEVA 3GFEA 3IDBA 5C8MA 1OL2A 2OZOA 5AEPA 4M14A 4UBAA 2VNYA 4FSWA 4D2VA 1P2AA 2GS2A 3LXNA 3EQRA 4F7SA 4NCTC 3NFGB 3K5UA 4IFCA 3FDNA 4PTGA 4LV5A 4YNEA 3R9DA 5HE2A 3NWWA 4IJPA 3FY2A 4CT2A 5AR3A 3GCSA 5HOAA 2J4ZA 4L01A 3PVWA 1PY5A 1UU7A 2X4FA 2Y4IC 4OTFA 1B39A 2W99B 3UVQA 4BBEA 4F9YA 2YZLA 3SKCA 4RWJA 4FRFA 1WBOA 1U4DA 5TF9A 4I5PA 3C5IA 3S0OA 2X1NA 4OTIA 4UXLA 2R7BA 1PXLA 5JFXA 2QKRA 3MS9A 4UYNA 1JNKA 4I21A 4QP9A 2P2HA 2PL0A 4H1JA 4DHFA 2ITQA 4U41A 4UXQA 3NSZA 3OZ6A 5E7RA 1ZOEA 4DFUA 3C0HA 3NAYA 2F9GA 3KRWA 3VBQA 5AV4A 3W0MA 4ALUA 4U79A 2BIKB 3RHXA 5HE3A 4ERWA 4EZ5A 2VGOA 2UZWE 4U97A 3QTWA 1OKZA 1OM1A 3EQHA 4EHEA 3EQIA 4F70A 1OB3A 2PK9A 1WBTA 3ZLSA 1QPCA 2WAJA 3KCKA 3CR0A 2XIYA 3KK9A 5CSXA 2R9SA 3VUHA 3QA8A 3DDQA 3GCQA 2OJFE 1RE8A 4FV0A 2AEGA 3UP2A 2YM5A 3A4OX 3BRBA 2BALA 1JOWB 3Q2MA 3IK3A 2ZB0A 4GEOA 4MTAA 3LCKA 2J90A 3VBXA 3R7EA 1IAJA 3BEGA 4IWPA 4UALA 2CHLA 1UWJA 4K11A 4LQMA 4PTEA 3P5KA 3VC4A 3VUIA 4C36A 4C62A 5CWZA 4JQ8A 4BDHA 1ZARA 4AACA 4DTBA 5C4LA 1Y91A 3VAPA 1IR3A 5CF6A 1R78A 2BZJA 3ORIA 5CY3A 5AAGA 2GSFA 1G8KA 4LV7A 4GT3A 2IVTA 1IRKA 5JKGA 4DFYA 4I5CA 4XJ0A 3WE4A 3HDNA 1SMHA 3O8UA 3PA3A 4MXXA 3NAXA 1Q8ZA 3FZTA 3PP0A 3C5UA 3PPZA 3C1XA 4Q5HA 3ZUTA 4B7TA 3OVVA 4BBMA 4HOKA 5M56A 5EM7A 3F3UA 3FUPA 4CFMA 3H0ZA 3QF9A 4AQCA 1WZYA 2PWLA 3KN6A 4HJOA 4LOPA 3IS5A 5AR5A 4CEGA 3FYKX 4LFIA 5AWMA 3SHEA 5GZ8A 3Q04A 5TKDA 2YLFA 3ZC5A 2BAKA 3DJ5A 1ZYCA 4M3QA 3W0OA 5CNNA 3R8PA 4DCAA 2C0IA 1PXJA 1MQ4A 3F3WA 4CKRA 2X7OA 3A7FA 5F1ZA 4HNFA 3SXFA 5F9EA 1ND4A 3QD3A 1YXXA 2UW3A 3OWPA 3MPTA 4FV1A 1GY3A 4Y5QA 1H27A 4YJVA 4ASXA 3UO4A 4FUXA 4JG7A 2CSNA 4IVDA 4NCTA 4GJ3A 5DR6A 3ANQA 3G0EA 1Y6AA 2IN6A 2YITA 3BI6A 2WU6A 4NIFA 4FEQA 3N4TA 3UDSA 2JITA 2ZVAA 3DKGA 3FSKA 5JZNA 4BB4A 3MH3A 4XP2A 2FSTX 2RKUA 3TDVA 5J5SA 4G34A 1ZYSA 3D2IA 3A7JA 4E1ZA 4QMNA 3LPBA 5BVEA 2E2BA 2UW8A 3FXXA 4J99A 4C4IA 4NEUA 5A9UA 3D5UA 3BHHA 4WHZA 1GOLA 3WE8A 4ALVA 2JD5A 3SRVA 1Q3WA 3QHWA 5EI6A 3TV7A 4O86A 3HMNA 5IQBA 3RWPA 2RG6A 3LFNA 4LGDA 2JDVA 5IDPA 4I92A 5ACBC 4ACGA 2X7FA 3JY0A 3KXHA 2VWBA 4MBLA 4AE6A 2HZ4A 3EN4A 4GSBA 4YHTA 5LOHA 5JGDA 1KUTA 2XZSA 4G3FA 4EOPA 5IUHA 1DS5A 3P78A 3U51A 3A7GA 5AUVA 1Q4LA 2GNLA 4PTCA 3CKWA 1J7IA 2R5TA 3FXWA 5HX6A 3ACKA 5FTOA 3HAMA 4QMUA 4BCHA 2FO0A 4CGAA 2HZNA 3ZO2A 4WUAA 4NM5A 3PRFA 3NW6A 4YO6A 2EU9A 3UDTA 3LCSA 4C3FA 1CKJA 2JGZA 1NVQA 3DKCA 4WRSA 4D55A 3VQHA 4FEWA 2PVJA 4YJSA 4AZVA 2YISA 2LAVA 5DPVA 3OY1A 2FSOX 1PYEA 2JDTA 2XIKA 3KF7A 4FKGA 3R8UA 1KE9A 4G2FA 2QOOA 5J9LA 5TT7A 1BUHA 3EQCA 3HV7A 3MW1A 1DAWA 3EQGA 3QGYA 4ZSGA 4FR4A 3DXQA 2E9VA 3I79A 3OTVA 4IWDA 3UGCA 1JSVA 4TYGA 4U7ZA 4BZOA 4M13A 4CLIA 3TZMA 2UZDA 4DYMA 1BI7A 2F49A 5D7VA 5BVDA 3RMFA 4HW7A 4FTQA 4JDKA 4LL0A 4D2WA 3FMNA 4AN3A 5CXZA 5GINE 5LVLA 4YJUA 5CF4A 4N4SA 4EK4A 2ZV8A 3UOKA 4J8MA 4TYIA 3OW3A 3F3ZA 4JR7A 4IZYA 4OGRA 2OH0E 1H01A 1ZY4A 4XG4A 4F1TA 2IO6A 3BEAA 4FT3A 4RJ5A 2YDJA 4WG4A 3R8MA 3U87A 3LM0A 4CNHA 1MRUA 2GHLA 5B7VA 3ALNA 4I0TA 4Y8DA 4EJ7A 3CIKA 3GNIB 3VS2A 2QI8A 1AD5A 4MXOA 2A27A 2YCRA 4X2KA 4EQCA 1OITA 1ZOHA 4RMZA 5HZNA 3FZ1A 3LCTA 2F7EE 4LRJA 2B0QA 2QOIA 3R7UA 4FV2A 4TXCA 2XNBA 1CSNA 1K2PA 1VEBA 2JEDA 5AUXA 2PU8A 3BBWA 3PJCA 1WVXA 5DEWA 4MBIA 4RSSA 3G5DA 2PZYA 4F0GA 3PPJA 3EL7A 4DBXA 5HTBA 2EB3A 1OL6A 3DBQA 4BJJB 2VTQA 3HYHA 2PZPA 4ZY6A 4QMLA 4JG6A 4ZTMA 2HOGA 4BDKA 4YC8A 1YWNA 3P0MA 4FTLA 3UOLA 1ERKA 4C58A 1W82A 3ELJA 4FL1A 4O4EA 3JXWA 4L8MA 5IA4A 4D5HA 3IGGA 3FXZA 2UZLA 3OOMA 5FDPA 4XV9A 5KMOA 5EFQA 4XUFA 5AA9A 1MP8A 2C68A 1J91A 3WZKA 2GQRA 5FXQA 2HAKA 5IMEA 1A48A 4Z16A 4FYNA 4AAAA 1XH5A 2FA2A 4EOKA 4S31A 2J5FA 2JKKA 4OW8A 3FI2A 2X0GA 1PKGA 1H4LA 4X6QC 1M2QA 3RI1A 2C1BA 3EYGA 4O4BB 4EHZA 1K9AA 4BDDA 2QO9A 4JNWA 4MNEA 4BTFA 4EH2A 4MVFA 3LXKA 5A4TA 5FP6A 5EM8A 3F5XA 5HNBA 3KXZA 4JRNA 4EC9A 1BMKA 3C51A 5C8KA 3DS6A 4FZ6A 4OTDA 5E8TA 2PPQA 2XARA 3DV3A 2ITYA 2XNEA 4D2TA 1TQPA 4XBRA 3QC9A 3L8SA 3QX2A 2VX3A 4HNIA 3MI9A 3UNJA 5FQDC 4O7VA 5T6KA 1YOLA 3V5QA 2HELA 5EM6A 3PUPA 3QUEA 4FTOA 5ETFA 4KIKB 5BYZA 5DH3A 3TL8A 1O6KA 2SRCA 4IACA 3OTUA 3NUSA 4CVAA 3PVGA 3CQWA 5L4QA 1ZAOA 4A9YA 2OSCA 3W2RA 4I23A 2E9OA 3JYAA 5EHYA 2DUVA 5GNKA 1JBPE 3RK7A 2VN9A 3FZPA 3OXZA 4J96A 1F3MC 4UMUA 3A7HA 3QQLA 3ZTXA 3QXOA 3SXRA 4YZBA 4CLJA 4RIYB 4NJDA 1OKYA 2IJMA 1MRVA 2WZJA 1PXNA 4FOBA 4F78A 1Z5MA 1W2CA 2UW4A 1WCCA 3W55A 3R30A 3HRFA 2EXMA 2ZYBA 3WYXA 3PA5A 5CU4A 5EI8A 4YTIA 2XCHA 2FB8A 3GQLA 4ZAUA 2OXDA 3HUBA 4A9RA 3LIJA 2YAKA 4V01A 4GYIA 4JVGA 4Q9ZA 5A6OA 2J0MB 3S1HA 2VUWA 4MQ1A 3BHYA 2WO6A 2WMSA 4P4CA 2WPAA 4FZAB 3IW4A 3NUPA 3KCFA 3DQWA 3DTCA 5CALA 4CV9A 2ITNA 3IONA 1GZNA 1BX6A 4NW6A 2ERZE 2ITWA 3QHRA 4FMQA 1CKPA 5J1WA 3CKXA 5M08A 4PY1A 1STCE 4EOLA 2BVAA 4PL4A 3ZZEA 3DJ7A 3LJ2A 4ZOGA 5CTPA 2IZTA 3ZONA 3IW8A 3E92A 4CZUA 3QQKA 1A06A 5CAQA 3A7IA 1S9JA 2AQXA 4NZWB 5F95A 3RNYA 5M44A 4XLVA 3PSDA 4BDIA 1QPEA 5HNGA 3TWJA 2IG7A 1YRPA 3CTJA 4CTBA 3KEXA 2J0LA 1P4OA 3MV5A 4AZFA 3EN6A 3P79A 2XRWA 2WMRA 2WTKB 5A3XA 3RK9A 4KB8A 3S00A 4GS6A 3R2YA 4RA4A 5CQWA 5D9HA 3PY1A 4ZSEA 2XEYA 4OTRA 1H25A 2PUIA 4L68A 4E3CA 3T9IA 4GVJA 4IAIA 1H07A 2Z60A 4FT5A 4CYIA 2AC3A 3MY5A 2I0YA 5HIDA 4A4XA 4AS0A 3NYOA 5IF1A 3SA0A 4JR3A 5DWRA 2IWIA 4O0VA 3GU8A 2OGVA 2H8HA 3GBZA 3MA6A 5A4CA 5C8NA 3GT8A 4D2SA 1YQJA 4B6LA 1OECA 4DTKA 4XG8A 3WILA 3P86A 3LFSA 4MKCA 5CU0A 2OFUA 3TTJA 1CDKA 2FYSA 1UU9A 5BYYA 4FKQA 1FGIA 5IKWA 4YTFA 2W5HA 5DNRA 4XG7A 4N70A 5IDNA 3R71A 4TNBA 4BWPA 4JAJA 4LGGA 5M55A 5CI6A 3R7IA 4YR8A 3F5UA 2NNWB 2J0IA 1U54B 2XALA 1Q8WA 4L7FA 2B54A 2OZAB 4AP7A 3PY3A 3A4PA 3MJ1A 4RFYA 4Z9LA 1H26A 2IW8A 5GJGA 4R8QA 3P9JA 4B8LA 4AW0A 1IAHA 2YDIA 4APPA 3SG8A 5BVFA 2ZMDA 1KE6A 2UZUE 3O17A 4O0TA 4IWOA 4F1OA 4QP8A 3S95A 1JVPP 3E63A 4FT0A 5EW9A 3OT3A 3QFVA 4S30A 3BU5A 2WIHA 2XMYA 4G17A 4V0GB 3RPOA 2Z7RA 5GZ9A 4LGHA 3IW7A 4KWPA 4RVKA 3QCQA 3QYWA 5DRBA 3UOHA 2X6EA 4RIWA 3B2WA 3PG3A 3L9MA 1UKIA 2IVUA 4QQ5A 5DT3A 3RGFA 3LFEA 4BGQA 5E9EA 3BQCA 2RFEA 1PMEA 5K4IA 2VRXA 5EKNA 2EB2A 4QEBA 3QRJA 5AP2A 3ODZX 3F82A 3MB7A 3HV5A 3HZTA 3MSSA 4DH7A 3I6UA 3JVRA 5HIBA 3LMIA 3HV3A 2J2IB 2WKMA 2XRUA 4K33A 4O21A 1APME 5M09A 1ST0A 2PZRA 2XM9A 3F2RA 4FSUA 2H96A 2V7AA 2P4IA 2Q0NA 2O5KA 3COHA 4QPMA 4FF8A 5CXHA 4R6VA 5E8XA 2WTIA 4UZDA 1H1SA 4YJPA 4IX4A 3ACJA 2UZVA 5E8WA 2VZ6A 2QOLA 3CLYA 3DAEA 3TT0A 3VWAA 3QX4A 5HE0A 3ZLXA 5DFPA 4YZNA 4D1SA 3L8XA 5D41A 5IH6A 4J8NA 1H0WA 4RG0A 2J6MA 4RX7A 4AGWA 5IUGA 4GU9A 3R22A 1GIIA 4U44A 3WYYA 1WBPA 3AC8A 3PPKA 2C5NA 3ULIA 2ERKA 2RGPA 3Q3BA 1R39A 2QO2A 3T8OA 4PMTA 4U5JA 4YO4A 1FVVA 4JDIA 2X9EA 3FMJA 4F9WA 4EH9A 5AUUA 3SOCA 3I1AA 2PUNA 4EORA 2HIWA 5AV1A 1U46A 5IQEA 3R7YA 4Y5HA 4V04A 4G5JA 2BTRA 3OT8A 3LJ1A 5FP5A 2X8IA 2YACA 2Y4PA 3R1NA 4HGSA 2RL5A 2UZOA 3UPXA 4ZSAA 2RIOA 5L8LA 4G5PA 4U42A 4K77A 3NEWA 4R7IA 5C03A 3FI4A 4BIEA 4AA4A 4B99A 2IW9A 2WMBA 5HG9A 4XNEA 3VVHA 1VJYA 4GG5A 3OWJA 3QGWA 4U40A 4RQVA 5CYIA 4E6DA 3V5JA 5HX8A 4FE2A 3IW6A 2WMAA 3PE2A 1WBNA 3E88A 4ORKA 3VUTA 1PXPA 4ZIMA 4AGUA 2XCKA 3FWQA 5KMNA 3RM6A 3V5WA 4D4SA 5LMKC 2CGXA 5KMKA 2HK5A 4WSQA 4QOXA 4XV1A 3QCSA 2O2UA 2UUEA 4KBCA 2Y0AA 3TIYA 3HVCA 1SYKA 2W1HA 5DVRA 3D7TA 3W33A 4C3RA 2QO7A 4XRJA 4C0TA 3QTUA 5CEQA 2B4SB 2ZM3A 2PSQA 4UWYA 3PG1A 3EKKA 2WB8A 5J5TA 3AOXA 3HMOA 4ZMFA 3BLHA 4I4FA 5HIEA 3ZO4A 5FXRA 4JI9A 2R0IA 3ZM4A 4QMXA 2GHGA 3PLAE 5LCKA 2QG7A 4MBJA 4CXAA 5EHLA 3RJCA 2C4GA 2Y7JA 3R6XA 4R3RA 4GT4A 4E4MA 4WG3A 3A8XA 2JFLA 1I44A 5I0BA 4BGGA 5CAPA 3T9TA 2O8YA 3W0PA 3RVGA 2YM3A 4OBQA 5IA5A 3NMUF 3ZEWA 3LCOA 4P90A 5E8ZA 3GI3A 3LXPA 3EHAA 3EQPA 4FZDB 4DGNA 3OD6X 2RFDA 2W1FA 3FZOA 4IQ6A 3VBYA 4IE9A 2IW6A 2WTWA 3FZRA 3GUBA 4NIFB 4R1VA 2J50A 3VUGA 2XBJA 3AC1A 1R3CA 3H9FA 2QURA 3IQ7A 4QYGA 4O81A 3E8CA 3FQHA 4IVCA 2Y4IB 4ASDA 4KSQA 4AU8A 4YJQA 4DLIA 4FA2A 4IX6A 3JS2A 2P0CA 4ALWA 3MTFA 1YDRE 5JH6A 3MB6A 3FLSA 2VWXA 5EHOA 4YHFA 2JBOA 4AWIA 3P7AA 1PXMA 3M42A 3SRVB 4C34A 3ID6C 4FICA 3T3VA 1ATPE 3UQGA 4HVSA 4YPSA 4F64A 4QPAA 5AUWA 4U43A 4X2FA 2X0PA 1HCKA 3NIZA 3VN9A 4DEHA 4KD1A 2XKFA 5KE0A 3GQIA 5CEOA 4FODA 4V05A 4YSMA 4FSYA 4BKYA 5L2IA 4FT7A 4IMYA 4Y83A 4RC2A 3PJ3A 2YERA 1J1BA 2R2PA 3U9CA 3QTRA 3VW6A 5B2KA 4A9SA 2BRNA 3A8WA 2I6LA 3PSCA 4YSJA 4CRSA 3KREA 3HGKA 5A54A 4PMMA 3OCGA 4O7WA 4O7ZA 3W0RA 3MFUA 3NVMB 1V0PA 3F9NA 3UBDA 1Q99A 3E3BX 4FTIA 4TN6A 3ZSGA 2CCHA 4X3FC 4S34A 3NUYA 3OW4A 5AP0A 3PXYA 4BCGA 4O7SA 4AAYA 2W05A 3ORTA 3ZC6A 5EQYA 2ZB1A 5AP7A 3TG1A 3D83A 2LGCA 4QO9A 5CAOA 4IZ7A 3JPVA 3HP2A 1A9UA 3BU3A 4ZZMA 3BL9A 1MRYA 3VQUA 4AW5A 2YWPA 2XKEA 3KXMA 5EK7A 4BDGA 3PXKA 5HTIA 4PNKA 4CD0A 3MYGA 1XJDA 2XK4A 4PPAA 4RFMA 5DBXA 2YM6A 3UG2A 4G6LA 2V5QA 4E4NA 4ZZNA 1GZKA 2W4OA 4A9TA 3COMA 5H3QA 3U6IA 2G15A 3DDPA 3E7VA 5K9IA 2QKWB 2HXLA 3FLYA 1SZMA 4BCFA 2P55A 2QOHA 2Z8CA 5HG8A 4BCPA 5IQDA 4ZMEA 1BLXA 2OXXA 1BL6A 2QODA 3AMYA 4M8TA 5KZ0A 4EH7A 5LMKA 4O84A 4HVIA 4F7NA 3ZCLA 5L6PA 2QHNA 5HO8A 5BMMA 3IOPA 4OAUC 4Z7GA 1W8CA 2UZBA 2GNIA 2VTPA 5ANIA 3RTPA 4ARKA 1YWVA 1WAKA 2B9FA 1JWHA 4APCA 4BDEA 1OKWA 3MH1A 1YI4A 1T45A 3IPHA 4O1OA 4TYHA 1XH9A 3HLLA 3HMPA 4ZTRA 3QQUA 1JLUE 1W83A 5FG8A 4DH8A 5B2LA 1YXTA 5I9VA 3ZRLA 5E8YA 2WMVA 1Q3DA 2BZHB 4EWHA 2Z7QA 2GFSA 1JPAA 2VWVA 3DLSA 2GPHA 4EH4A 4XEYA 1PW2A 2PUUA 2W1EA 3PTGA 3QKLA 4FNWA 3VHEA 4TNDA 1YW2A 4ZP5A 4R78A 2YHVA 4ITJA 3OEFX 5EYCA 2V0DA 2XK8A 3LVPA 4FIEA 4CKIA 3LJ0A 1PXIA 4DFLA 3KMWA 1B6CB 2R3KA 3R9RA 3FQSA 3I6WA 4FL2A 5ANDA 5ETIA 3COIA 3OROA 3FE3A 3LFDA 4ZSJA 2XK6A 3OF0A 3U8WA 3UMXA 4BIBA 3GCVA 2VGPA 2YN8A 4RGJA 5HBEA 3AQVA 4HVDA 5CEMA 4O0SA 4XLIA 4NFNA 3G15A 4X2JA 3WF8A 4C3PA 3I7BA 4NH1A 1ZLTA 4W4VA 4X2NA 1TKIA 2C30A 3NDMA 3QQGA 4B8MA 1IA9A 2WTCA 3R01A 3O50A 3RNIA 1U5RA 4BI1A 2ONLC 2CGWA 5JZJA 4RLLA 2BTSA 4N0SA 2J9MA 2WMTA 3I5NA 4F9CA 2W9FB 2YCSA 4EH5A 4FV3A 4GG7A 2WOTA 3BHVA 4JBVA 3UDZA 2BKKA 5HO6A 3S3IA 3VS6A 4EUTA 5CF5A 1K3AA 3C7QA 2XYUA 5A4LA 3PVBA 5AUZA 3QRIA 5LCJA 5JMSA 4QPSA 4DE4A 4QYEA 5DN3A 2YIYA 4ACHA 4ZJJA 4C4FA 5GZAA 2YCQA 4NKSA 3PZHA 1XH4A 3ZU7A 3TYKA 5IH4A 1FINA 2Y6OA 2VTAA 2WQEA 5H8BA 1H1PA 4M0ZA 2ZJWA 3ROCA 5J7BA 4NYEA 3I5ZA 4ITIA 4MNEB 4I5HA 4O7NA 2XKCA 2J0JA 3OHTA 4DF3A 3FLQA 3FMEA 4Y85A 3FJQE 4MEDA 3CGFA 4LMUA 5CEIA 4GIIA 1OL1A 4AXAA 5EKOA 3K3JA 4BWKA 4RX9A 3LHJA 1JKLA 2BILB 3NGAA 4HPUE 4KIOA 2QU5A 4X7QA 2VTLA 1CTPE 1V0BA 2XIZA 3EN9A 4G3GA 4WD5A 4O7LA 4I0RA 4XP3A 2B9HA 2GNHA 2WFYA 3H3CA 3PIZA 4X6RA 5HKMA 3VBTA 1FGKA 4H58A 3V04A 3DTWA 3FL4A 4OTWA 4YMJA 3Q5IA 5D12A 2QCSA 2RFSA 3BCEA 2UW7A 4FKTA 3P4KA 4BDJA 5GIPE 4F1MA 5E91A 3DXNA 2QOCA 2OKRA 3Q32A 3UIBA 2AUHA 2QR7A 4AT3A 3V8SA 3BE9A 4C35A 1PF8A 4RPVA 3ZO3A 4Y95A 4I5MA 5IG1A 5KHXA 4XG2A 2WTVA 3BELA 3KVWA 3OFMA 4MF1A 4RVTA 3TDWA 3B2TA 5HO7A 1R0PA 3RPVA 5I4NA 4J7BA 3DGKA 3C13A 5JRSA 2V55A 3MVHA 1NW1A 3H9RA 3NUAA 3NVKI 3QL8A 4FI1A 4YPDA 2X81A 3MY1A 1Q5KA 5JSMA 5DE2A 5IA0A 3EZRA 4E5AX 4A9UA 1JQHA 2R3MA 5DT4A 4AZWA 2BHHA 2JKMA 2W9ZB 4YC3A 5CS6A 5J95A 3R73A 4TKSA 3V6SA 3WZEA 4GYGA 5A4QA 3R9OA 3EN5A 3L9NA 2RF9A 3N9XA 3ANRA 4IAAA 5FRIA 3ZEPA 4U8ZA 1XWSA 5HLNA 1JKSA 2XNGA 3W8LA 4FTRA 4CKJA 3D14A 1FMOE 2H9VA 4J71A 2ZM1A 3PIYA 1W2FA 4C7TA 3DLZA 4EC8A 3CE3A 3FLWA 4RRVA 4GKIA 4OLIA 2FGIA 3CGOA 4RJ4A 5JGAA 4XMOA 3LZBA 3THBA 4QQTA 4KNBA 1YXUA 4DH1A 5K0KA 4QRCA 5ANJA 3OUKA 5GJDA 2R3HA 4RVMA 4GCJA 3ALOA 3TZ7A 3ZYAA 4GW8A 3GU7A 3HMIA 5AX3A 3E62A 3RAHA 3MBLA 4FZFB 2VWZA 2ZFYA 4BI0A 4KRCA 4TRLA 3F2NA 3OWKA 4CFVA 1R1WA 3QRUA 3GGFA 3NCGA 3TKHA 4GV1A 3TV4A 5HBJA 4HZSA 2YLEA 4CCUA 3T3UA 4KIQA 1MQBA 2R3RA 3FY0A 1IEPA 1KOAA 3CY2A 5KHWA 2CN8A 3WZUA 1FVRA 1GIJA 1M7QA 2A19B 3HX4A 5C4KA 2C3LA 4KIPA 3VW8A 2UVYA 4NK9A 4GFGA 3QD0A 4J52A 2BAQA 3FKLA 2PVYA 4E6AA 4YLKA 5E8VA 2XJ0A 3FMLA 1TQIA 3RKBA 3NUXA 3ZOSA 2OW3A 3EFJA 3IGOA 3QQJA 5ACKA 2XAOA 4ZLYA 4G3DA 1OMWA 1NA7A 4BTJA 4ZS4A 2WQBA 3LFFA 1CM8A 3BZ3A 4C8BA 1YHVA 4CFWA 5AV3A 5HEZA 3UYTA 5AR7A 4QP7A 4FSNA 4B0GA 5CF8A 2DS1A 5J1VA 3IO7A 5E92A 1W2DA 3O71A 2YCFA 3KKVA 3OBJA 3LCDA 3D15A 5HESA 5DRDA 1Q24A 3VF8A 1P14A 5D1JA 4QYYA 2CLQA 4RBLA 3SDJA 4TWNA 4FG7A 3E3PA 4II5A 1M14A 4O6LA 3QLGA 2YM4A 4RIWB 4ZTQA 3SAYA 4FV4A 3ZDUA 4D1ZA 2VTRA 3O7LD 4F63A 4PP9A 4QP1A 3RZBA 4AN2A 3EB0A 3TMOA 3MTLA 2AC5A 2PZ5A 3ZBFA 2F7ZE 5M53A 2R3LA 2FVDA 3Q5ZA 4BFMA 4MXCA 3LE6A 3QWJA 4D9UA 2XF0A 5IISA 2FSLX 4IDVA 5CAUA 4DT9A 3EZVA 3AD5A 4FTNA 1Q8YA 2X0OA 3UZTA 5DGZA 1UNGA 4HVHA 4EYJA 4BHZA 5LMAA 4JIAA 3TNQB 5FBNC 3ZUVA 4LG4A 3WIKA 4NM0A 3QZGA 2XNMA 4NTTA 4DH5A 4TYJA 3C50A 4DHIB 4MHAA 2OG8A 2WQOA 3AD4A 4I93A 1HCLA 2B9JA 2C6EA 2R4BA 4IC7A 2OBJA 5CI7A 2V7OA 1O6YA 2NPQA 2QG5A 4A4LA 2JFMA 2PVLA 2OIDA 2PY3A 4WNKA 2WOUA 1L8TA 3ZLYA 3QZIA 1IG1A 2WIPA 5M4CA 5AADA 3TJDA 3F3TA 5E8SA 3BLRA 5H8EA 2VO3A 5CZHA 4FK3A 4O1PA 4H3BA 3UQCA 4BR3A 1Q41A 1Y6BA 3KL8A 4WOVA 4F9AA 3KK8A 4O0UA 2C6OA 2NP8A 3KXXA 5CEKA 3F5GA 4W8DA 4XH6A 4Q9SA 4KABA 4PP7A 3ATTA 2QU6A 3SOAA 5KKRB 1PXKA 2UVZA 4WBOA 4J95A 4Y73A 2A4LA 1OIYA 3D0EA 3NUNA 2NRUA 2UW0A 4UMTA 4DG3E 5E1SA 2QVSE 1AGWA 3ODYX 3C0GA 3KU2A 4ZJIA 4QDEA 1JKTA 3G0FA 4CTCA 5HQ0A 1H1QA 3QTIA 1YVJA 3F66A 3KB7A 4HCVA 4LL5A 3MIYA 1Y8GA 4NTSA