2XK5B

Crystal structure of k6-linked diubiquitin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
75
structure length
75
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPQQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Engineered Diubiquitin Synthesis Reveals K29-Isopeptide Specificity of an Otu Deubiquitinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords UBIQUITIN
total genus 18
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2xk5B00
2N4FA 2LGDA 3ZNID 3R7QA 4MM3A 2MW5A 2MP2A 3NZSA 1Q1OA 1L2NA 2O6VB 3V61A 3PSEB 1Z5SB 3Q3FA 2KJRA 2IO0B 2NPTB 5CHFA 4GDLA 5DPTA 2G3QB 3IVFA 4KSLC 4HK2A 5BO4B 5JZEB 2BWES 2LASA 2N9PC 1WZ3A 2D3GA 3A1QA 1NBFC 1UH6A 3LJ3A 4FBJB 1WM2A 5LLIA 1EUVB 2AWTA 2N7DA 3HM6X 4WAAA 3VTVA 1WI0A 4RMAA 1H8CA 2KK8A 4NJ6A 2NVUI 2BWFA 4HPLB 2JXXA 4AJYB 3ZUNA 2IY0B 1V5TA 2JT4B 1WJUA 2NBUA 2KTRA 4HVBA 3N3KB 1TZ1A 2DZJA 4X57B 1WXVA 3LDZE 4GXBA 1WX9A 3L17A 3ZLZA 3W1YA 2DZKA 3A9JA 2IZVB 4KSKC 2K8CA 1UBIA 1KOTA 3PT2B 1IPGA 2GBMA 2HE7A 3C0RB 1LQBA 5EDSA 4FJZA 3U8ZA 2DZIA 3A9KA 2IYDB 1C3TA 1YQBA 3L08A 3M3JA 2RPQA 4I6LB 3DDCB 4KZCA 4MGYE 5D94A 2N7EA 1XD3B 2GMIC 4YL8A 1M94A 1P0RA 5IAAC 1UGMA 4ZRIA 2KMAA 3RYTA 1SGHA 2V3SA 2PE6B 2FCMA 3NY5A 4GDKB 4W9LA 2MBOA 5AZHA 4WWNA 1V9JA 2K25A 2XBBC 3JSVA 3QC8B 5LXIB 4JIOU 3V60A 4EFOA 2KC1A 4JLCA 2M8SA 2NR2A 2M17A 2LGYA 2GBNA 2OOBB 2ZPNA 1WY8A 2MX2A 2KQ7A 4MJSA 3IBEA 1WGRA 4AP4C 5DCNA 4ANWA 1GUAB 4EEWA 2DHZA 4HDOA 2DAJA 3ZO5B 4XX5A 2KMCA 1XT9B 3TBLD 2KDBA 4W9CA 2RR9A 3ML8A 3UIOB 3PTFC 3WIMA 2AL3A 1S1QB 1YIWA 2YLMA 2ZEQA 2K6QA 3AU4A 3H1UA 5FR6A 4DHJB 3B0AA 4PS7A 2VRRB 5KHOA 5JHBA 2KD0A 4W9HA 4PS3A 4GDKA 2RGFA 2MLBA 2CHZA 4I6NB 2ZCCA 5D6JB 2KN5A 2KXJA 2EKEC 2WX1A 1R4MI 5JH5C 2R2QA 3HIZA 1WRDB 2KX3A 5LXHA 3ZNGC 4NQLB 4FA6A 2PE9A 2Y5BB 2HTHA 2N1VA 3AU5A 3L13A 3OAWA 3ZTDA 1WMHB 4NQKE 3ZNZB 2KDFB 3PRPB 2C9WB 2LRUA 2KZRA 4W9EA 3BY4B 3PVLA 3H9DA 3CMMB 4FN2A 2LVQA 3OJ3A 3X0WA 1P98A 2IO1B 2N9XA 1WE7A 3ENEA 3TJPA 1LFDA 2C7MB 4WJNA 3WAMA 4MEMA 2UWQA 2ZJDA 1U4AA 4LDTD 4FULA 2MWSB 2GOWA 2EMTA 3SDLC 4W9KA 1WR6E 3B08A 4HLEA 2JZ3B 2GBRA 4P7IA 4TUUA 3ONSA 3EECA 4G50A 3ZTCA 3ZNHB 4ASWC 4DXAB 2GBJA 3MHSD 4FLHA 4RM9A 5E6NA 2JY6A 3H6NA 1CMXB 1WIAA 1P9DU 2K6DB 3EC8A 1ISNA 3N32A 1D3ZA 3A9KB 4LCDE 5D2MB 2YVCA 2KFJA 3TMPB 3K9PB 2C7HA 3DVNV 1NDDA 1GG3A 4ICVA 2KTFA 1V80A 1V2YA 2D07B 2GBKA 3CF6E 4OVVA 4DK5A 2XK5A 4GOCA 4K1RB 2JVCA 4G3XB 4WWOA 2IO2B 4XC2A 4E3CA 2KWVB 2RSUA 3KUDB 2MBEA 3VH4B 1P3QU 4NJ7A 2Z0DB 4XZ4A 1WE6A 1QZEA 4DHJD 3APFA 3SD5A 1I35A 4FADA 2AYOB 4LDTB 3APCA 1WXSA 3QAQA 2JRIB 1FXTB 3VFKA 3A1QB 1Z2MA 2C7NB 3QIJA 4JQWC 2DENB 2FNJB 2FUHB 1E8XA 3VHTC 2LGXA 4MGZE 3TCAA 5D7GA 3QCAA 2JUOA 4EKUA 1ZKHA 2MBQA 4M8NA 4F7ZA 1E8ZA 1UD7A 3S2AA 4HXDA 2FCQA 5CHVC 2BYFA 3KW5B 2KQSA 3NZUA 3B1LX 2DYMA 3NOBA 4B9KA 3L10B 4II2B 5J18A 1TBEA 2CU1A 2K39A 1GC6A 4FJVB 1E7UA 3PS6A 3OLMD 4MELA 2G4SA 5AZGA 3V62A 3DVGX 1WX7A 2L8JA 1WYWB 2L00B 3PGEA 2PJHA 4JL9A 1S3SG 3RD2A 2NCNA 3GOEA 3WA0A 3ECIA 4DBGA 5DPWA 3A9JB 4DHZE 3VUYA 3K9OB 5TR5A 3ZRFA 3KH0A 3RZWC 3D32A 3HK0A 2K8BA 2DAFA 3U30A 2G4DB 2MSED 3QWZB 2LD9A 4G0NB 4KV2A 1G6JA 2CHWA 2Z0EB 2LJ5A 5IA7A 4W9JA 2KOXA 4W9FA 1E7VA 2N1WA 2O2VB 3IHPC 4HCPB 4KVGB 4GGQA 3VUWA 1RFAA 1YJ1A 4W9GA 2KC2A 5G2NA 2KX0A 3QJZA 3WANA 1RLFA 2KLGA 1V86A 1YX5B 5E6OA 1WR1A 1GNUA 2BPSA 2L0TA 3PLUA 4IM0A 4J6IA 1OEYJ 4LJPB 1E8WA 3RZFA 4DHZB 1OEYA 2I1KA 2LVOA 2M4NA 3H7PB 5DPRA 3VTUA 2RD0A 4IM2A 3IFWB 1YX6B 4FHJA 4F8CB 1WZ0A 3A33B 4MSQB 3VAWA 2KFKA 4AUQC 4II3B 4B6WA 4PYUA 1C1YB 2BYVE 4EZLA 2CR5A 3QX1A 5CHWA 1X1MA 1E5WA 2KO3A 2V4LA 4HDQA 2ZZPB 2KHWB 2MBHA 4TQ1A 2A5UA 3PZDA 3RT3B 2AL6A 5C23A 1F9JA 3GZNI 3IG3A 2DZMA 2BKRB 3Q3JA 4GU2A 2M1MA 2ZCBA 2MBBB 4AOFA 4LJOB 3X23A 3QQ8B 2DYOA 2XK5B 4DWFA 4IC7B 2KWCA 1J0GA 2L76A 3KUZA 4WJOA 4TQ0A 2D2QA 3M62B 4N9F4 3T9LA 4ICUA 3M63B 1L7YA 1XQQA 4GDLB 4M0WB 3VQIA 5KHQA 3UGBB 3PLVA 4M8MA 2LI5A 2NS5A 4WQOB 1GJZA 4DDID 1TGZB 4CO7A 1KLVA 2J0MA 4AJWA 1H4RA 1WXAA 3DBSA 3DOWA 4KDIC 2K1FA 2JZZA 3RCZA 2KWUB 5J2RA 2AEHA 4CYEA 2HD5B 3WAPA 4I6PA 4EOYA 2XEWA 3JSVB 3QA8A 3L54A 4G11A 4BKGA 1E90A 3JW0X 3WALA 3ML9A 1SIFA 4OVUA 2D11A 3AI5A 1P1AA 2NPTA 4ZYNA 3ZIMA 4BBNF 3VUXA 2CHXA 4K7WA 3T8MA 3ZVVA 1A5RA 2J0KA 2IBIB 3DBLI 3PREA 3R3MA 4MGKE 2FCNA 2MP2B 2L7RA 5GMVA 1V5OA 3V6CB 4ANVA 3BINA 3DPDA 2CKHB 2ZNVB 2L05A 2V1YA 2K8HA 5C1ZA 3RULA 5CTRC 4IWPA 1RAXA 4WJQA 4BBNC 4NAWB 3VH3B 2ZPYA 1WGHA 2ASQA 2EMSA 4BOSC 2IY1B 1OQYA 4K7SA 3W1SA 4ZRKA 1ZGUB 2BF8B 2J0JA 3V6EB 1V81A 4URKA 2CS4A 2JF5A 1EO6A 2LRWA 2D10A 4WJPA 4JGHB 2FIDA 2LUEA 3ZKJC 2A4ZA 1VD2A 2PPHA 3L0WB 5JHAA 5L83A 4DDGD 1Q0WB 5J17A 1EF5A 2Z59B 1WM3A 2ZVOA 2JPHA 2IO3B 1WJ4A 2BYEA 3VXWA 4IUMB 3KUCB 4MDKE 2N9EB 4MJSB 1UZXB 3HM3A 2JRHA 4W9IA 4IG7B 4KIKB 3ZW3A 1NI2A 1E8YA 2KDIA 1WJNA 2BGFA 3DVNU 4MGIE 4E71A 5HKHA 2KJHB 1MG8A 3I3TB 2WWZA 4BKTA 2ZNVC 1T0YA 4RM8A 4BKSA 2KANA 2LXCA 2MRPA 3QK0A 3NHEB 2REXA 4NPNA 4A20A 1WMHA 4K7UA 2JWZA 3M95A 4PYZA 5E6PA 3VTWA 2KVRA 2KNBA 3EFUA 3H7PA 1TTNA 1V6EA 3UQAA 1KJTA 1RRBA 2LWPA 4FJYA 4KDLB 4W9DA 3TIXA 3WAOA 2G45B 1WJ6A 1ZW7A 4E74A 2I1JA 3ZRCA 3PRZA 3APDA 1WGGA 2LZ6A 3PV1A 3VDZA 4WWPA 1UBQA 1IP9A 1YD8U 3ZDTA 4BKSD 2DX5B 2FCSA 3DVGY 3OJ4B 1Y8RC 2O2VA 1KM7A 3EHVA 1WH3A 2MQJA 2WX0A 4NY0A 1OGWA 2B3AA 2FAZA 3QARA 4HCNB 3SHQA 3DQVA 3KVFB 4ZRJA 5CX3A 4ZDVA 1WF9A 4AWJA 4GMVA 2LVPA 1V49A 3DBRI 4GB9A 1BT0A 4KZ0A 1VCBA 3ALBA 1WFYA 2O6VD 3N30A 1IYFA 3TL5A 2LXAA 1AARA 1EF1A 2MA9B 2PEAA 3MTNB 3O65B 2KFKB 3R66C 1WX8A 1K8RB 3RUIB 1WXMA 4GIVA 1PQSA 2FIFA 5DPSA 1JRUA 2L3ZA 2W9NA 3ZDMC 2KLCA 2OJRA 5AEKB 2NBWB 2NBVB 4A3OA 3SU8X 4BOZB 1WGDA 4ANXA 3KYCD 4IWQA 4GN1A 3JYUA 4NNJB 4B95A 3PRMB 3R7RA 3MJWA 2C60A 2R2OA 4ANUA 3W1SC 4IWOA 4BVUC 2UYZB 3PHXB 4TKNA 3UQBA 1SE9A 3QHTA 3VVWB 2BKFA 4K81A 3NS8A 1LM8B 4FHKA 2C5LC 2MCNB 2KDEB 3PPAA 1WGYA 1OTRB 1Q5WB 4PS8A 4KIKA 1J8CA 4HWIB 2J7QB 3L16A 4EUTA 3AXCA 4MH0E 3U7DA 3P2BA 1J19A 4NAWA 3UINB 2L0FA 3UIPB 4BFRA 4EZKA 2KTRB 4CHKA 4TV3A 2DYBA 3PHWB 4A3PA 4IW0A 3CSTA 4EZJA 3CSFA 1HE8A 3A4SC 3KYDD 3H7SA 5L95C 5AZFA 3DBHI 3UF8A 2KJ6A 1GC7A 3HHMA 1LXDA 3A4RA 3JVZX 2WYQA 2WDTB 1R4NI 2KKCA 4IM3A 5G55A 2ZVNA 4F1SA 2QHOA 4HPMB 2HJ8A 3DCGA 1I42A 1UELA 4HJKA 3AULA 4MSMB 2M0XA 4GSWA 2O6VA
chains in the Genus database with same CATH superfamily
2MP2A 3MJ5A 2IO0B 4GDLA 2G3QB 1N5XA 2QMTA 4WQMA 2MHJA 1WZ3A 3AMZA 5IKCM 5JXVA 1UH6A 1FFVA 2N9LA 4WAAA 3VTVA 4NJ6A 4USAA 2NVUI 5HFYA 4AJYB 2FE8A 2IY0B 4GXBA 1C77A 3W1YA 5FR3A 4RGTA 1UBIA 1KOTA 2HE7A 1SBBB 1EWCA 4YSZB 3LYYA 2WXKA 1YMHE 5BYRA 2N7EA 4YL8A 1P0RA 2WDVB 5IAAC 3TEWA 3RYTA 4GDKB 3BVZA 4WWNA 3V60A 1V1PB 4BZAA 1I4QA 2M8SA 4C56C 2Q5WD 1WY8A 2MX2A 1N63A 2PTLA 2K5PA 3TEXA 1WGRA 4EEWA 4RF1A 1NEKB 1XT9B 4W9CA 1JW9D 1LO5D 5HHDG 3UIOB 2DLBA 2W54A 2GRIA 5JHBA 4PS3A 3OG5A 2VH1A 2CHZA 5D6JB 2EKEC 1P7FA 1CZPA 1WRDB 1NYQA 2HTHA 2N1VA 4NQKE 3ZGZA 3P4QB 1K51A 3VRAB 3BK2A 4W9EA 3BY4B 3H9DA 3OJ3A 3X0WA 1A70A 2IO1B 1WE7A 1ZXHA 2VZKD 3WAMA 2ACZB 4JWSC 2K22A 2GOWA 1JWBD 1PFDA 1WR6E 3AEDB 2KYWA 1FRRA 3SEBA 1DGJA 3MHSD 5E6NA 1CMXB 1WIAA 2K6DB 3B2FA 1PDXA 3P4SB 4LCDE 3AM9A 3GZNB 3K9PB 1VJKA 3DVNV 1GG3A 2KTFA 3CF6E 2GBKA 4GOCA 4YWGG 3W5UB 1HTQA 4WWOA 2IO2B 3E56A 1F1HA 4E3CA 1SXTA 4ZRQA 5AUKA 4N6EB 4NJ7A 1QZEA 3RFZB 1L0VB 2LHDA 1MHHE 1WXSA 3AE4B 2I38A 2JRIB 2JSVX 4GLSC 1Z2MA 2C7NB 3BWUD 1E8XA 2X38A 3TCAA 4B0MA 3ZJVA 3AEEB 3QCAA 4EKUA 4F7ZA 4HXDA 5CHVC 2BYFA 4N59A 3NZUA 2K39A 3BVMA 1E7UA 5AZGA 2G4SA 1SSNA 1XEEA 3OWEB 1JWSD 3W9CB 1J7AA 2L8JA 1FNWA 1E7PB 2E3TA 2KDMA 4JL9A 1BUIC 4A9AA 4LTUA 5DPWA 3A9JB 4DHZE 3VUYA 3K9OB 3KH0A 4JX1C 4AQ7A 3RZWC 3U30A 2G4DB 2MSED 3AE7B 1P7EA 2INCC 1C4AA 4W9FA 1TJEA 4HROA 1UNSA 4JPSA 2KWDA 3WANA 2KLGA 4C4VB 5E6OA 2L0TA 4J6IA 1OEYJ 4DHZB 4HKZE 1OEYA 3H7PB 3VTUA 1YJIA 1YX6B 3GE3C 1KF6B 1WGKA 3U4EG 4FHJA 3AE6B 3VAWA 3PZ7A 3KLSX 1OQRA 1X1MA 1E5WA 2KO3A 3RT3B 2AL6A 5C23A 3Q3JA 2M1MA 2PMVA 4LJOB 3X23A 2XK5B 4DWFA 2KWCA 4J3OD 2V3NA 3M62B 5KHQA 3VQIA 3NJTA 2J0MA 1TYGB 3DBSA 4KDIC 2K1FA 5J2RA 2QC8A 2KWUB 2AEHA 3RPFC 4EOYA 4I6PA 2XEWA 3B9JA 2YEPB 4S17A 2NMQA 1ZP0B 5E6JA 3AE5B 4ZYNA 3VUXA 3T8MA 3SFEB 1XO3A 3PREA 1V5OA 3V6CB 2ZNVB 4IKGA 2AQ1B 1K50A 2BS3B 4NAWB 1FPYA 2EMSA 1OQYA 4K7SA 1ZGUB 2BF8B 1YNTE 3DHGC 1GPXA 4URKA 3N20C 4WJPA 2HJ1A 4JGHB 1T0QC 3U2SC 3L0WB 5JHAA 2SEBD 1EF5A 1WM3A 4M02A 3W5VB 3IAM1 1MVKA 1WJ4A 4WAFA 3KUCB 2H89B 4MDKE 1UGJA 3Q8CA 4HRSA 4L23A 3ZW3A 3DVNU 1WJNA 2BGFA 5HKHA 4BKTA 2ZNVC 1T0YA 2KANA 2J53A 3NHEB 2REXA 4K7UA 2JWZA 2KVRA 3EFUA 1V6EA 3UQAA 1KJTA 4FJYA 2LWPA 4KDLB 2G45B 1WJ6A 1N62A 1WGGA 1EM7A 2IGHA 3P42A 1YD8U 4DXGA 1ROEA 3BYYB 2JYTA 3QARA 4HCNB 3KVFB 1HZ6A 4GMVA 1D5XC 1WFYA 1PUTA 4AS1A 1TS2A 2MA9B 2PEAA 3O65B 1XXGA 4A90A 2LUMA 4ARCA 4GIVA 2FIFA 2L3ZA 3TSSA 4KGTA 4BOZB 1WGDA 4GN1A 3PRMB 2C60A 3Q8AA 3PHXB 1SE9A 3QHTA 4REZA 2C5LC 4TMAB 1CK1A 1OTRB 3AEFB 3L16A 2WGSA 2GI9A 1J7CA 3FILA 3AXCA 1T5XD 1J19A 3UIPB 4TV3A 3T3OA 1KRHA 3CSTA 2QEJC 1WXQA 2CU3A 2KJ6A 1UF0A 3AB5A 2WDTB 1R4NI 2KKCA 2ZVNA 2JQRB 2QHOA 4HPMB 3DCGA 2VH2A 2BS4B 3FC4A 2MW5A 3NZSA 1JWMD 5MPOA 1Q1OA 1L2NA 2O6VB 3V61A 3ZQ4A 3Q3FA 2BB5A 3IVFA 3NVVA 3R2IA 4HK2A 1F2RC 1OQQA 4RGOS 2D3GA 1NBFC 1YJJA 4FBJB 3RNFC 5LLIA 3NS1A 2GB1A 1EUVB 3HM6X 2N7DA 1WI0A 4RMAA 1H8CA 3FAHA 1JCKB 2JT4B 1WJUA 2KTRA 2DZJA 4C80A 4YTNB 3ZLZA 2DZKA 2IZVB 4KSKC 1SIJA 2GBMA 4OZBA 1LQBA 2WXQA 3HVDA 5EDSA 4FJZA 1XCQL 1YQBA 3L08A 2ZW1A 4I6LB 5C2TB 4KZCA 2ZW0A 1XD3B 4KKIA 1UGMA 2Z8LA 2PE6B 3NY5A 2MBOA 2UU7A 1V1OA 3DBLB 3QC8B 5EE1A 2J52A 4EFOA 4ITKA 4P1CC 2GBNA 1KTKA 4MJSA 1L4ZB 1I4RA 3IBEA 4AP4C 2WXNA 4A6QA 2D3AA 2DAJA 3BK1A 3TBLD 2KDBA 2OJWA 3ML8A 3WIMA 2WXLA 5FR6A 3I63C 3Q2AC 3H1UA 4IDIA 4YTMB 1SB3C 2LFIA 3Q14C 4K3BA 5EE9A 2KN5A 1ET9A 3HIZA 2YEPF 1YN3A 4FA6A 2PE9A 3L13A 3ZTDA 2DBYA 3ABVB 1WMHB 2CJOA 4NJCA 1YN4A 2KDFB 2K9XA 3CMMB 2LVQA 2WHIA 1AN8A 1YQ4B 4LDTD 1L0XB 1Y56A 2MWSB 1TT5B 4XDDA 3Q3MC 3ZNHB 2L32A 3DHIC 2GBJA 5FKAC 1KLUD 3I9V1 3TMPB 2W3SA 1F2RI 1V2YA 2Y5PA 4G3XB 2RSUA 1ZDVA 4DHJD 1XF5L 2XN9C 4C7YA 1I35A 2AYOB 3APCA 4L2YA 1ET6A 4JQWC 2N0SB 2FUHB 2JYEA 1SE2A 3VHTC 2LGXA 4MGZE 4YSYB 5D7GA 1Q10A 3MC9A 1PGXA 1E8ZA 2FCQA 3B1LX 1SE4A 3B2GA 3NOBA 5D3IB 1J7BA 4OW0A 3V62A 3RI7C 4L1BA 3MC0B 2PJHA 1VR9A 2NCNA 3GOEA 3RNGC 3ECIA 2JXTA 2INDC 4DBGA 4N58A 2PVOD 1T0RC 3BZDB 3D32A 4XWTA 2K8BA 4QAYA 2Z0EB 1NYRA 3R8BA 2MJ3A 3EUB2 4W9JA 2KOXA 4NZLB 2N1WA 4WURA 3VUWA 1YJ1A 2KX0A 3RNBC 3KWLA 2BPSA 3PLUA 4PT5A 1E8WA 3RZFA 4MT5A 1MJDA 1IGCA 3IFWB 2AQ3B 4P1BC 1WZ0A 2D3CA 3CIRB 1KFYB 2HTME 4II3B 4PYUA 2BYTA 2BYVE 2CR5A 4P6VF 5BYSA 3ETRA 4M00A 3QX1A 2ZZPB 2M56B 1TKGA 4TQ1A 2PIAA 1FNUA 3IG3A 3GZNI 2DZMA 3AEGB 2BQQA 4KGSA 4AOFA 2KT7A 2QCZA 2DYOA 4IC7B 1I4XA 3KUZA 4WJOA 4TQ0A 2D2QA 1FFUA 3T9LA 4KGRA 5GXGB 4C7ZA 1STEA 3PLVA 2LI5A 2NS5A 1VZ8A 1GJZA 1QKZA 4A8XC 1NVID 2NTTA 4AJWA 1C76A 1H4RA 1RFKA 3DOWA 3WAPA 3KQ4A 4BKGA 2QJLA 1E90A 3TEYA 1SIFA 4OVUA 2D11A 1WYGA 3AI5A 1P1AA 4BBNF 4US9A 1A5RA 2FBWB 1FMAD 2L7RA 3DPDA 3KWVA 2PW9A 2L05A 2K8HA 5CTRC 4BBNC 4PK1A 3EGRA 2V3PA 4BOSC 1IGDA 1TS5A 2V9HA 5C3JB 4CQNA 2LUEA 3ZKJC 1VD2A 5L83A 3DBRB 2K0PA 2ZVOA 2JPHA 2IO3B 2V4IB 3PZ8A 4ZOHC 4W9IA 1FXIA 1NI2A 2MJEA 4MGIE 2KJHB 1T3QA 1ZUD2 4ACFA 4BKSA 2LXCA 5EE0A 2MRPA 1KLVA 1WMHA 3M95A 1I4GA 3H7PA 2KNBA 3TIXA 4W9DA 1ZW7A 4E74A 1ZPSA 3PRZA 3NG0A 2IPKD 3OJ4B 3DWMA 1V49A 3DBRI 4GB9A 2WS3B 2D3BA 1VRAB 3IAS1 3TL5A 2KFKB 1K8RB 3RUIB 3L4PA 1PQSA 5DPSA 2KLCA 3E9SA 2NBVB 4A3OA 3SU8X 4ANXA 4NNJB 5BYQA 3MJWA 3N9YC 3W1SC 1T0SC 2UYZB 1TZOA 3UQBA 4FHKA 1LGRA 2MCNB 2KDEB 3N1YC 1OFFA 4PS8A 1J8CA 3Q8FA 3P2BA 4NAWA 3UINB 2BB6A 2N7JA 2KTRB 4CHKA 4EZKA 1PGBA 2INNE 4EZJA 1L4DB 3CSFA 3H7SA 1SEBD 3IXSA 1QOGA 3GS2A 3A4RA 1WRIA 3NVYA 5G55A 4DQOC 1L5PA 2HJ8A 2J4XA 1UELA 4HJKA 2OHFA 2M0XA 1L6UA 2O6VA 3ZYYX 2LGDA 4MM3A 1K52A 1UWMA 1Z5SB 5DPTA 2I2YA 5BO4B 2LASA 2N9PC 1QLBB 2KQ4X 3AV8A 2AWTA 2KK8A 4RF0A 1TS4A 2BWFA 1D4BA 2Y3AA 1MPEA 2WNMA 1TZ1A 5H8YE 4X57B 4IOIE 1WX9A 2K8CA 3PT2B 2XNAC 2K3UA 3C0RB 1EWYC 2DZIA 3AE2B 1C3TA 4MGYE 2INPE 2ON8A 2V0GA 4MACA 2R61A 4OZAA 3MFGA 1SGHA 3AEBB 1N5WA 2V3SA 4W9LA 4C4VA 5AZHA 1V9JA 2K25A 3GP7A 3JSVA 1C78A 3SR6A 2M17A 2LGYA 1I4PA 2JZPA 1GUAB 2LJIA 3ZO5B 4P16A 4XX5A 2RR9A 4M0WA 2BTEA 2AL3A 2YLMA 3AU4A 4DHJB 3B0AA 2VRRB 2KD0A 4W9HA 2ONQA 1I7HA 1ZXIA 4GDKA 2RGFA 2MLBA 2WU5B 1C79A 3P1MA 2ZCCA 1SF0A 1R4MI 5LXHA 3ZNGC 4K3CA 1RWSA 3SFDB 4NQLB 3Q8BA 3AU5A 3PRPB 2C9WB 2WXRA 3PVLA 1HEZE 5D3DA 1FIQA 1DOYA 2L83A 3TJPA 1MHXA 4RNAA 1DYQA 4MEMA 4UDUC 5FK9C 2ZJDA 1U4AA 4FULA 2PLPA 4H2AA 3SDLC 1JWAD 2Y5CA 2JZ3B 4P7IA 4TUUA 3EECA 2BBCA 4DXAB 1XLPA 4FLHA 4RM9A 2JY6A 1IUEA 3H6NA 1P9DU 1ISNA 1BXTA 3A9KB 3AE3B 1R4MB 2OEDA 1NDDA 4ZHPA 2HDEA 2JWUA 2D07B 4OVVA 4K1RB 2JVCA 1F77A 4OVZA 1N61A 3GE8C 2KWVB 1SE3A 4FXCA 2LHEA 1WE6A 3UI3A 3SD5A 1V97A 1AWDA 3QAQA 1JQ4A 1FXTB 4KKJA 3AEAB 3VFKA 3A1QB 3QIJA 2DENB 2FNJB 3EFCA 3Q69A 4HPPA 3PO0A 4ZRPA 1HA5A 1XLOA 1ZKHA 2MBQA 4M8NA 4R3DA 1C4CA 3KW5B 3NRZA 3P4RB 4DXFA 2KQSA 3ZJUA 1IBXB 2DYMA 2AQ2B 1TBEA 2CU1A 2L52A 4FJVB 4MELA 1XLQA 3OLMD 2EKIA 2H88B 3P63A 1JROA 1WX7A 3PGEA 5LNK1 1S3SG 3ZXVA 5TR5A 2DWQA 4XGAB 3HK0A 2DAFA 4KV2A 2GLSA 2LJ5A 3WCQA 4EE2A 5IA7A 3P4PB 2O2VB 3IHPC 4LNNA 4HCPB 1V1PA 4GGQA 2KC2A 2WU2B 3DHHC 1KH0A 1B9RA 1GNUA 4IM0A 4LJPB 3W2DA 1FCCC 2I1KA 1HTOA 2M4NA 3LB8C 4IM2A 1UUPA 2W3RA 4F8CB 3A33B 4YXDB 4MSQB 1GB4A 4AUQC 4B6WA 4JE3B 5T8IA 3Q8EA 1C1YB 3GB1A 4EZLA 4D2KA 5CHWA 4HKQA 3HVZA 2V4LA 4HDQA 5IP4D 1HQRD 4RCOA 3MHZA 4GU2A 2ZCBA 2MBBB 2RDGA 3RNCC 3QQ8B 5EE3A 2L76A 3CWIA 4N9F4 1L7YA 1XQQA 4GDLB 3FILB 3UGBB 4M8MA 3AE1B 4KX6B 3V05A 4DDID 4WWMA 4C00A 2BW2A 1WXAA 1TY0A 1N6ZA 2JZZA 1QQRA 4XWWA 1FEHA 4CYEA 1VZ6A 3U52E 2TSSA 3ML9A 2WDQB 1CJEA 1MG4A 2MH7A 4XYCA 2LMCA 3MC8A 4RH6A 3ZVVA 1GB1A 2IBIB 2BT6A 4MGKE 2MP2B 5BMGA 2KMMA 3BVGA 2CKHB 1QT9A 2RMMA 3RULA 3O13A 4WJQA 4Q2JA 1WGHA 2ASQA 2QILA 3W1SA 2L1AA 2J0JA 2JF5A 2D10A 2LGIA 2FIDA 2A4ZA 1YN5A 4US8A 3AH7A 3Q3OC 4RGMA 1VZ7A 1D5ZC 5AUIA 1YOVB 4MJSB 2JRHA 4KIKB 1E8YA 4E71A 1JALA 3I3TB 4LNFA 1QILA 4HLEA 2JU6X 4PYZA 5HI1A 1RRBA 3NUHB 3ZRCA 2LZ6A 3PV1A 3VDZA 4WWPA 1UBQA 3ZDTA 2DX5B 1Y8RC 1KM7A 3EHVA 2NTSA 2MQJA 2WX0A 1R4NB 2B3AA 3DQVA 1WF9A 4S0RA 2LVPA 4KZ0A 1BT0A 2O6VD 1WX8A 1L0YB 3R2TA 3VR9B 2OJRA 2WLBA 5AEKB 2NBWB 1E0ZA 2IGDA 3KYCD 4IWQA 3TUOA 4B95A 2JX5A 3R7RA 4MH8A 4B0EA 4IWOA 4BVUC 3VVWB 2BKFA 4K81A 3NS8A 4YTPB 4LNOA 1Q5WB 1XCTL 4RFBA 4MH0E 3U7DA 3N1XC 4BFRA 3N1ZC 1HXYD 3FKYA 4A3PA 3PHWB 4IW0A 3C8YA 1HE8A 3A4SC 3KYDD 1ESFA 1QOFA 5AZFA 3DBHI 1TS3A 3HHMA 3JVZX 2WYQA 4LNKA 4F1SA 1D6EC 3AECB 3AULA 3URYA 2N4FA 3C19A 1C4PA 3ZNID 3R7QA 3PSEB 2W82A 4TSSA 2KJRA 2B76B 2NPTB 5CHFA 4KSLC 5JZEB 2BWES 3A1QA 1VLBA 2M0AA 3LJ3A 1WM2A 3NZ3A 1R7SA 1ZOYB 1SJHD 4HPLB 2JXXA 3ZUNA 1V5TA 4ARIA 2NBUA 3I5JC 4HVBA 3N3KB 3RN9C 1WXVA 3LDZE 1GAQB 3L17A 3A9JA 1NENB 1IPGA 1ZDXA 3U8ZA 1FM0D 3RNEC 3A9KA 2IYDB 3M3JA 2RPQA 3DDCB 5D94A 2GMIC 1M94A 4ZRIA 2KMAA 1XLNA 2FCMA 4NAMA 2ICIA 2XBBC 5LXIB 5IOIA 4JIOU 2KC1A 4JLCA 2NR2A 4O1NA 2OOBB 2ZPNA 2KQ7A 5DCNA 4ANWA 1PYWD 2DHZA 4HDOA 2KMCA 2M19A 3VR8B 1FCLA 3PTFC 1S1QB 1YIWA 2ZEQA 3AN1A 2K6QA 2G9HD 1WSPA 4PS7A 2QIEB 5KHOA 1RM6C 4I6NB 2KXJA 2WX1A 1E9MA 5JH5C 2R2QA 2KX3A 1AYFA 1NI3A 2Y5BB 1C9FA 3OAWA 3ZNZB 2N9KA 4RGNA 2LRUA 2KZRA 1JWUD 4ZHOA 4FN2A 2WXGA 1P98A 2N9XA 3ENEA 1LFDA 2C7MB 4WJNA 2WXJA 2UWQA 2RPVA 1WWTA 2EMTA 1FNVA 4W9KA 3B08A 2GBRA 4ASWC 3ZTCA 3ONSA 4G50A 1DOXA 2WP9B 1D3ZA 3EC8A 3N32A 5D2MB 2YVCA 2KFJA 2C7HA 1HZ5A 4ICVA 1V80A 1MI0A 4DK5A 2XK5A 1TKYA 4XC2A 3BYTB 3KUDB 2MBEA 3VH4B 1P3QU 3DWGC 4LK0M 2Z0DB 4XZ4A 3APFA 3U7ZA 5BMIA 2IDYA 4FADA 3Q6BA 4LDTB 1D5MC 1UWXA 2KAJA 3BIID 1YQ3B 2KVZA 1CQVA 3MP9A 1M4VA 1K53A 1QF6A 2JUOA 2WXHA 4OHJA 1UD7A 3S2AA 1RYJA 4B9KA 1MFWA 3L10B 4II2B 5J18A 4JWUC 5IO9A 4WIPA 1GC6A 3PS6A 3DVGX 1WYWB 2L00B 3J9CA 4OZCA 3AE9B 3RD2A 3WA0A 1ACCA 2WXIA 5H92C 3NVWA 4XDCA 1N60A 3ZRFA 1V8CA 5IN7A 3QWZB 1ZE3D 2LD9A 4G0NB 4HEA1 1G6JA 2CHWA 1TIFA 4LLGM 1E7VA 4KVGB 1E6EB 1RFAA 2WXPA 4W9GA 5G2NA 2EELA 3QJZA 4WH4A 1RLFA 1V86A 1YX5B 2RDHA 1WR1A 2LVOA 5DPRA 4YT0B 2RD0A 2WQYB 3ZXRA 3AE8B 2KFKA 2WXMA 2AX5A 1B1ZA 2KHWB 2MBHA 2A5UA 3PZDA 3TEZA 5I4DA 2VZKB 1F9JA 2BKRB 1VDVA 1TKEA 3I57A 1FO4A 2CJNA 1J0GA 1JMLA 3RNAC 2PKOA 4A55A 4ICUA 3M63B 1SJED 4M0WB 1BMLC 3DBHB 4WQOB 2J42A 3T3NA 4XE0A 1TGZB 4CO7A 3RMKC 1QOBA 3RCZA 1F0ZA 2HD5B 5HG2A 3JSVB 3QA8A 3L54A 4G11A 4BAXA 2KACA 3WALA 3JW0X 2NPTA 3ZIMA 3H8HA 2CHXA 4K7WA 2J0KA 3HRDD 3DBLI 3R3MA 5GMVA 2FCNA 5TSSA 4ANVA 3ZJTA 3BINA 1EU4A 2W55A 2V1YA 5C1ZA 2D5GA 4IWPA 1ENFA 1RAXA 3VH3B 2ZPYA 2IY1B 4ZRKA 2WXFA 3V6EB 1V81A 2CS4A 1EO6A 2LRWA 2BS2B 2WXOA 2PPHA 4DDGD 1Q0WB 5J17A 2Z59B 3LXFA 3IT6B 2BYEA 3VXWA 4IUMB 1I4HA 2N9EB 1UZXB 3HM3A 4IG7B 2KN4A 2KDIA 2PVGC 1MG8A 2WWZA 4MM3B 4RM8A 3QK0A 1QOAA 4NPNA 4A20A 4YSXB 5E6PA 3VTWA 1TTNA 1F52A 2DNFA 3WAOA 3NVZA 2G1EA 2E6XA 4ZYSA 2I1JA 3APDA 2IGGA 1IP9A 3HUIA 3Q3NC 4BKSD 3IT4B 2FCSA 3DVGY 5G5GA 2O2VA 2MEKA 4LNIA 3V3XA 1WH3A 4NY0A 1OGWA 2FAZA 3SHQA 4ZDVA 4ZRJA 5CX3A 3EA6A 4AWJA 1VCBA 2LEKA 3ALBA 3N30A 1IYFA 2LXAA 1AARA 1EF1A 3R66C 3MTNB 1WXMA 2SAKA 1JRUA 1TY2A 2W9NA 1E10A 3ZDMC 4M01A 3VRBB 1FD6A 3JYUA 2MJDA 2R2OA 4ANUA 1GOZA 1IBXA 4TKNA 1LM8B 3PPAA 2BVCA 2QDFA 1WGYA 2RDBC 1T6BX 4KIKA 4HWIB 1PGAA 2FUG1 2J7QB 2LGSA 4EUTA 2QSDA 2L0FA 5G5HA 4HJGE 2X8XX 5BMHA 2DYBA 2WDRB 1FRDA 1AW7A 1DOIA 1EU3A 5L95C 2IJ0A 1FXAA 3UF8A 1GC7A 1LXDA 1KLGD 4IM3A 1JRPA 1L6VA 1I42A 4MSMB 4GSWA
chains in the Genus database with same CATH topology
2N4FA 2LGDA 3ZNID 3R7QA 4MM3A 2MW5A 2MP2A 3NZSA 1Q1OA 1L2NA 2O6VB 3V61A 3PSEB 1Z5SB 3Q3FA 2KJRA 2IO0B 2NPTB 5CHFA 4GDLA 5DPTA 2G3QB 3IVFA 4KSLC 4HK2A 5BO4B 5JZEB 2BWES 2LASA 2N9PC 1WZ3A 2D3GA 3A1QA 1NBFC 1UH6A 3LJ3A 4FBJB 1WM2A 5LLIA 1EUVB 2AWTA 2N7DA 3HM6X 4WAAA 3VTVA 1WI0A 4RMAA 1H8CA 2KK8A 4NJ6A 2NVUI 2BWFA 4HPLB 2JXXA 4AJYB 3ZUNA 2IY0B 1V5TA 2JT4B 1WJUA 2NBUA 2KTRA 4HVBA 3N3KB 1TZ1A 2DZJA 4X57B 1WXVA 3LDZE 4GXBA 1WX9A 3L17A 3ZLZA 3W1YA 2DZKA 3A9JA 2IZVB 4KSKC 2K8CA 1UBIA 1KOTA 3PT2B 1IPGA 2GBMA 2HE7A 3C0RB 1LQBA 5EDSA 4FJZA 3U8ZA 2DZIA 3A9KA 2IYDB 1C3TA 1YQBA 3L08A 3M3JA 2RPQA 4I6LB 3DDCB 4KZCA 4MGYE 5D94A 2N7EA 1XD3B 2GMIC 4YL8A 1M94A 1P0RA 5IAAC 1UGMA 4ZRIA 2KMAA 3RYTA 1SGHA 2V3SA 2PE6B 2FCMA 3NY5A 4GDKB 4W9LA 2MBOA 5AZHA 4WWNA 1V9JA 2K25A 2XBBC 3JSVA 3QC8B 5LXIB 4JIOU 3V60A 4EFOA 2KC1A 4JLCA 2M8SA 2NR2A 2M17A 2LGYA 2GBNA 2OOBB 2ZPNA 1WY8A 2MX2A 2KQ7A 4MJSA 3IBEA 1WGRA 4AP4C 5DCNA 4ANWA 1GUAB 4EEWA 2DHZA 4HDOA 2DAJA 3ZO5B 4XX5A 2KMCA 1XT9B 3TBLD 2KDBA 4W9CA 2RR9A 3ML8A 3UIOB 3PTFC 3WIMA 2AL3A 1S1QB 1YIWA 2YLMA 2ZEQA 2K6QA 3AU4A 3H1UA 5FR6A 4DHJB 3B0AA 4PS7A 2VRRB 5KHOA 5JHBA 2KD0A 4W9HA 4PS3A 4GDKA 2RGFA 2MLBA 2CHZA 4I6NB 2ZCCA 5D6JB 2KN5A 2KXJA 2EKEC 2WX1A 1R4MI 5JH5C 2R2QA 3HIZA 1WRDB 2KX3A 5LXHA 3ZNGC 4NQLB 4FA6A 2PE9A 2Y5BB 2HTHA 2N1VA 3AU5A 3L13A 3OAWA 3ZTDA 1WMHB 4NQKE 3ZNZB 2KDFB 3PRPB 2C9WB 2LRUA 2KZRA 4W9EA 3BY4B 3PVLA 3H9DA 3CMMB 4FN2A 2LVQA 3OJ3A 3X0WA 1P98A 2IO1B 2N9XA 1WE7A 3ENEA 3TJPA 1LFDA 2C7MB 4WJNA 3WAMA 4MEMA 2UWQA 2ZJDA 1U4AA 4LDTD 4FULA 2MWSB 2GOWA 2EMTA 3SDLC 4W9KA 1WR6E 3B08A 4HLEA 2JZ3B 2GBRA 4P7IA 4TUUA 3ONSA 3EECA 4G50A 3ZTCA 3ZNHB 4ASWC 4DXAB 2GBJA 3MHSD 4FLHA 4RM9A 5E6NA 2JY6A 3H6NA 1CMXB 1WIAA 1P9DU 2K6DB 3EC8A 1ISNA 3N32A 1D3ZA 3A9KB 4LCDE 5D2MB 2YVCA 2KFJA 3TMPB 3K9PB 2C7HA 3DVNV 1NDDA 1GG3A 4ICVA 2KTFA 1V80A 1V2YA 2D07B 2GBKA 3CF6E 4OVVA 4DK5A 2XK5A 4GOCA 4K1RB 2JVCA 4G3XB 4WWOA 2IO2B 4XC2A 4E3CA 2KWVB 2RSUA 3KUDB 2MBEA 3VH4B 1P3QU 4NJ7A 2Z0DB 4XZ4A 1WE6A 1QZEA 4DHJD 3APFA 3SD5A 1I35A 4FADA 2AYOB 4LDTB 3APCA 1WXSA 3QAQA 2JRIB 1FXTB 3VFKA 3A1QB 1Z2MA 2C7NB 3QIJA 4JQWC 2DENB 2FNJB 2FUHB 1E8XA 3VHTC 2LGXA 4MGZE 3TCAA 5D7GA 3QCAA 2JUOA 4EKUA 1ZKHA 2MBQA 4M8NA 4F7ZA 1E8ZA 1UD7A 3S2AA 4HXDA 2FCQA 5CHVC 2BYFA 3KW5B 2KQSA 3NZUA 3B1LX 2DYMA 3NOBA 4B9KA 3L10B 4II2B 5J18A 1TBEA 2CU1A 2K39A 1GC6A 4FJVB 1E7UA 3PS6A 3OLMD 4MELA 2G4SA 5AZGA 3V62A 3DVGX 1WX7A 2L8JA 1WYWB 2L00B 3PGEA 2PJHA 4JL9A 1S3SG 3RD2A 2NCNA 3GOEA 3WA0A 3ECIA 4DBGA 5DPWA 3A9JB 4DHZE 3VUYA 3K9OB 5TR5A 3ZRFA 3KH0A 3RZWC 3D32A 3HK0A 2K8BA 2DAFA 3U30A 2G4DB 2MSED 3QWZB 2LD9A 4G0NB 4KV2A 1G6JA 2CHWA 2Z0EB 2LJ5A 5IA7A 4W9JA 2KOXA 4W9FA 1E7VA 2N1WA 2O2VB 3IHPC 4HCPB 4KVGB 4GGQA 3VUWA 1RFAA 1YJ1A 4W9GA 2KC2A 5G2NA 2KX0A 3QJZA 3WANA 1RLFA 2KLGA 1V86A 1YX5B 5E6OA 1WR1A 1GNUA 2BPSA 2L0TA 3PLUA 4IM0A 4J6IA 1OEYJ 4LJPB 1E8WA 3RZFA 4DHZB 1OEYA 2I1KA 2LVOA 2M4NA 3H7PB 5DPRA 3VTUA 2RD0A 4IM2A 3IFWB 1YX6B 4FHJA 4F8CB 1WZ0A 3A33B 4MSQB 3VAWA 2KFKA 4AUQC 4II3B 4B6WA 4PYUA 1C1YB 2BYVE 4EZLA 2CR5A 3QX1A 5CHWA 1X1MA 1E5WA 2KO3A 2V4LA 4HDQA 2ZZPB 2KHWB 2MBHA 4TQ1A 2A5UA 3PZDA 3RT3B 2AL6A 5C23A 1F9JA 3GZNI 3IG3A 2DZMA 2BKRB 3Q3JA 4GU2A 2M1MA 2ZCBA 2MBBB 4AOFA 4LJOB 3X23A 3QQ8B 2DYOA 2XK5B 4DWFA 4IC7B 2KWCA 1J0GA 2L76A 3KUZA 4WJOA 4TQ0A 2D2QA 3M62B 4N9F4 3T9LA 4ICUA 3M63B 1L7YA 1XQQA 4GDLB 4M0WB 3VQIA 5KHQA 3UGBB 3PLVA 4M8MA 2LI5A 2NS5A 4WQOB 1GJZA 4DDID 1TGZB 4CO7A 1KLVA 2J0MA 4AJWA 1H4RA 1WXAA 3DBSA 3DOWA 4KDIC 2K1FA 2JZZA 3RCZA 2KWUB 5J2RA 2AEHA 4CYEA 2HD5B 3WAPA 4I6PA 4EOYA 2XEWA 3JSVB 3QA8A 3L54A 4G11A 4BKGA 1E90A 3JW0X 3WALA 3ML9A 1SIFA 4OVUA 2D11A 3AI5A 1P1AA 2NPTA 4ZYNA 3ZIMA 4BBNF 3VUXA 2CHXA 4K7WA 3T8MA 3ZVVA 1A5RA 2J0KA 2IBIB 3DBLI 3PREA 3R3MA 4MGKE 2FCNA 2MP2B 2L7RA 5GMVA 1V5OA 3V6CB 4ANVA 3BINA 3DPDA 2CKHB 2ZNVB 2L05A 2V1YA 2K8HA 5C1ZA 3RULA 5CTRC 4IWPA 1RAXA 4WJQA 4BBNC 4NAWB 3VH3B 2ZPYA 1WGHA 2ASQA 2EMSA 4BOSC 2IY1B 1OQYA 4K7SA 3W1SA 4ZRKA 1ZGUB 2BF8B 2J0JA 3V6EB 1V81A 4URKA 2CS4A 2JF5A 1EO6A 2LRWA 2D10A 4WJPA 4JGHB 2FIDA 2LUEA 3ZKJC 2A4ZA 1VD2A 2PPHA 3L0WB 5JHAA 5L83A 4DDGD 1Q0WB 5J17A 1EF5A 2Z59B 1WM3A 2ZVOA 2JPHA 2IO3B 1WJ4A 2BYEA 3VXWA 4IUMB 3KUCB 4MDKE 2N9EB 4MJSB 1UZXB 3HM3A 2JRHA 4W9IA 4IG7B 4KIKB 3ZW3A 1NI2A 1E8YA 2KDIA 1WJNA 2BGFA 3DVNU 4MGIE 4E71A 5HKHA 2KJHB 1MG8A 3I3TB 2WWZA 4BKTA 2ZNVC 1T0YA 4RM8A 4BKSA 2KANA 2LXCA 2MRPA 3QK0A 3NHEB 2REXA 4NPNA 4A20A 1WMHA 4K7UA 2JWZA 3M95A 4PYZA 5E6PA 3VTWA 2KVRA 2KNBA 3EFUA 3H7PA 1TTNA 1V6EA 3UQAA 1KJTA 1RRBA 2LWPA 4FJYA 4KDLB 4W9DA 3TIXA 3WAOA 2G45B 1WJ6A 1ZW7A 4E74A 2I1JA 3ZRCA 3PRZA 3APDA 1WGGA 2LZ6A 3PV1A 3VDZA 4WWPA 1UBQA 1IP9A 1YD8U 3ZDTA 4BKSD 2DX5B 2FCSA 3DVGY 3OJ4B 1Y8RC 2O2VA 1KM7A 3EHVA 1WH3A 2MQJA 2WX0A 4NY0A 1OGWA 2B3AA 2FAZA 3QARA 4HCNB 3SHQA 3DQVA 3KVFB 4ZRJA 5CX3A 4ZDVA 1WF9A 4AWJA 4GMVA 2LVPA 1V49A 3DBRI 4GB9A 1BT0A 4KZ0A 1VCBA 3ALBA 1WFYA 2O6VD 3N30A 1IYFA 3TL5A 2LXAA 1AARA 1EF1A 2MA9B 2PEAA 3MTNB 3O65B 2KFKB 3R66C 1WX8A 1K8RB 3RUIB 1WXMA 4GIVA 1PQSA 2FIFA 5DPSA 1JRUA 2L3ZA 2W9NA 3ZDMC 2KLCA 2OJRA 5AEKB 2NBWB 2NBVB 4A3OA 3SU8X 4BOZB 1WGDA 4ANXA 3KYCD 4IWQA 4GN1A 3JYUA 4NNJB 4B95A 3PRMB 3R7RA 3MJWA 2C60A 2R2OA 4ANUA 3W1SC 4IWOA 4BVUC 2UYZB 3PHXB 4TKNA 3UQBA 1SE9A 3QHTA 3VVWB 2BKFA 4K81A 3NS8A 1LM8B 4FHKA 2C5LC 2MCNB 2KDEB 3PPAA 1WGYA 1OTRB 1Q5WB 4PS8A 4KIKA 1J8CA 4HWIB 2J7QB 3L16A 4EUTA 3AXCA 4MH0E 3U7DA 3P2BA 1J19A 4NAWA 3UINB 2L0FA 3UIPB 4BFRA 4EZKA 2KTRB 4CHKA 4TV3A 2DYBA 3PHWB 4A3PA 4IW0A 3CSTA 4EZJA 3CSFA 1HE8A 3A4SC 3KYDD 3H7SA 5L95C 5AZFA 3DBHI 3UF8A 2KJ6A 1GC7A 3HHMA 1LXDA 3A4RA 3JVZX 2WYQA 2WDTB 1R4NI 2KKCA 4IM3A 5G55A 2ZVNA 4F1SA 2QHOA 4HPMB 2HJ8A 3DCGA 1I42A 1UELA 4HJKA 3AULA 4MSMB 2M0XA 4GSWA 2O6VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N4F A;  2LGD A;  3ZNI D;  3R7Q A;  4MM3 A;  2MW5 A;  2MP2 A;  3NZS A;  1Q1O A;  1L2N A;  2O6V B;  3V61 A;  3PSE B;  1Z5S B;  3Q3F A;  2KJR A;  2IO0 B;  2NPT B;  5CHF A;  4GDL A;  5DPT A;  2G3Q B;  3IVF A;  4KSL C;  4HK2 A;  5BO4 B;  5JZE B;  2BWE S;  2LAS A;  2N9P C;  1WZ3 A;  2D3G A;  3A1Q A;  1NBF C;  1UH6 A;  3LJ3 A;  4FBJ B;  1WM2 A;  5LLI A;  1EUV B;  2AWT A;  2N7D A;  3HM6 X;  4WAA A;  3VTV A;  1WI0 A;  4RMA A;  1H8C A;  2KK8 A;  4NJ6 A;  2NVU I;  2BWF A;  4HPL B;  2JXX A;  4AJY B;  3ZUN A;  2IY0 B;  1V5T A;  2JT4 B;  1WJU A;  2NBU A;  2KTR A;  4HVB A;  3N3K B;  1TZ1 A;  2DZJ A;  4X57 B;  1WXV A;  3LDZ E;  4GXB A;  1WX9 A;  3L17 A;  3ZLZ A;  3W1Y A;  2DZK A;  3A9J A;  2IZV B;  4KSK C;  2K8C A;  1UBI A;  1KOT A;  3PT2 B;  1IPG A;  2GBM A;  2HE7 A;  3C0R B;  1LQB A;  5EDS A;  4FJZ A;  3U8Z A;  2DZI A;  3A9K A;  2IYD B;  1C3T A;  1YQB A;  3L08 A;  3M3J A;  2RPQ A;  4I6L B;  3DDC B;  4KZC A;  4MGY E;  5D94 A;  2N7E A;  1XD3 B;  2GMI C;  4YL8 A;  1M94 A;  1P0R A;  5IAA C;  1UGM A;  4ZRI A;  2KMA A;  3RYT A;  1SGH A;  2V3S A;  2PE6 B;  2FCM A;  3NY5 A;  4GDK B;  4W9L A;  2MBO A;  5AZH A;  4WWN A;  1V9J A;  2K25 A;  2XBB C;  3JSV A;  3QC8 B;  5LXI B;  4JIO U;  3V60 A;  4EFO A;  2KC1 A;  4JLC A;  2M8S A;  2NR2 A;  2M17 A;  2LGY A;  2GBN A;  2OOB B;  2ZPN A;  1WY8 A;  2MX2 A;  2KQ7 A;  4MJS A;  3IBE A;  1WGR A;  4AP4 C;  5DCN A;  4ANW A;  1GUA B;  4EEW A;  2DHZ A;  4HDO A;  2DAJ A;  3ZO5 B;  4XX5 A;  2KMC A;  1XT9 B;  3TBL D;  2KDB A;  4W9C A;  2RR9 A;  3ML8 A;  3UIO B;  3PTF C;  3WIM A;  2AL3 A;  1S1Q B;  1YIW A;  2YLM A;  2ZEQ A;  2K6Q A;  3AU4 A;  3H1U A;  5FR6 A;  4DHJ B;  3B0A A;  4PS7 A;  2VRR B;  5KHO A;  5JHB A;  2KD0 A;  4W9H A;  4PS3 A;  4GDK A;  2RGF A;  2MLB A;  2CHZ A;  4I6N B;  2ZCC A;  5D6J B;  2KN5 A;  2KXJ A;  2EKE C;  2WX1 A;  1R4M I;  5JH5 C;  2R2Q A;  3HIZ A;  1WRD B;  2KX3 A;  5LXH A;  3ZNG C;  4NQL B;  4FA6 A;  2PE9 A;  2Y5B B;  2HTH A;  2N1V A;  3AU5 A;  3L13 A;  3OAW A;  3ZTD A;  1WMH B;  4NQK E;  3ZNZ B;  2KDF B;  3PRP B;  2C9W B;  2LRU A;  2KZR A;  4W9E A;  3BY4 B;  3PVL A;  3H9D A;  3CMM B;  4FN2 A;  2LVQ A;  3OJ3 A;  3X0W A;  1P98 A;  2IO1 B;  2N9X A;  1WE7 A;  3ENE A;  3TJP A;  1LFD A;  2C7M B;  4WJN A;  3WAM A;  4MEM A;  2UWQ A;  2ZJD A;  1U4A A;  4LDT D;  4FUL A;  2MWS B;  2GOW A;  2EMT A;  3SDL C;  4W9K A;  1WR6 E;  3B08 A;  4HLE A;  2JZ3 B;  2GBR A;  4P7I A;  4TUU A;  3ONS A;  3EEC A;  4G50 A;  3ZTC A;  3ZNH B;  4ASW C;  4DXA B;  2GBJ A;  3MHS D;  4FLH A;  4RM9 A;  5E6N A;  2JY6 A;  3H6N A;  1CMX B;  1WIA A;  1P9D U;  2K6D B;  3EC8 A;  1ISN A;  3N32 A;  1D3Z A;  3A9K B;  4LCD E;  5D2M B;  2YVC A;  2KFJ A;  3TMP B;  3K9P B;  2C7H A;  3DVN V;  1NDD A;  1GG3 A;  4ICV A;  2KTF A;  1V80 A;  1V2Y A;  2D07 B;  2GBK A;  3CF6 E;  4OVV A;  4DK5 A;  2XK5 A;  4GOC A;  4K1R B;  2JVC A;  4G3X B;  4WWO A;  2IO2 B;  4XC2 A;  4E3C A;  2KWV B;  2RSU A;  3KUD B;  2MBE A;  3VH4 B;  1P3Q U;  4NJ7 A;  2Z0D B;  4XZ4 A;  1WE6 A;  1QZE A;  4DHJ D;  3APF A;  3SD5 A;  1I35 A;  4FAD A;  2AYO B;  4LDT B;  3APC A;  1WXS A;  3QAQ A;  2JRI B;  1FXT B;  3VFK A;  3A1Q B;  1Z2M A;  2C7N B;  3QIJ A;  4JQW C;  2DEN B;  2FNJ B;  2FUH B;  1E8X A;  3VHT C;  2LGX A;  4MGZ E;  3TCA A;  5D7G A;  3QCA A;  2JUO A;  4EKU A;  1ZKH A;  2MBQ A;  4M8N A;  4F7Z A;  1E8Z A;  1UD7 A;  3S2A A;  4HXD A;  2FCQ A;  5CHV C;  2BYF A;  3KW5 B;  2KQS A;  3NZU A;  3B1L X;  2DYM A;  3NOB A;  4B9K A;  3L10 B;  4II2 B;  5J18 A;  1TBE A;  2CU1 A;  2K39 A;  1GC6 A;  4FJV B;  1E7U A;  3PS6 A;  3OLM D;  4MEL A;  2G4S A;  5AZG A;  3V62 A;  3DVG X;  1WX7 A;  2L8J A;  1WYW B;  2L00 B;  3PGE A;  2PJH A;  4JL9 A;  1S3S G;  3RD2 A;  2NCN A;  3GOE A;  3WA0 A;  3ECI A;  4DBG A;  5DPW A;  3A9J B;  4DHZ E;  3VUY A;  3K9O B;  5TR5 A;  3ZRF A;  3KH0 A;  3RZW C;  3D32 A;  3HK0 A;  2K8B A;  2DAF A;  3U30 A;  2G4D B;  2MSE D;  3QWZ B;  2LD9 A;  4G0N B;  4KV2 A;  1G6J A;  2CHW A;  2Z0E B;  2LJ5 A;  5IA7 A;  4W9J A;  2KOX A;  4W9F A;  1E7V A;  2N1W A;  2O2V B;  3IHP C;  4HCP B;  4KVG B;  4GGQ A;  3VUW A;  1RFA A;  1YJ1 A;  4W9G A;  2KC2 A;  5G2N A;  2KX0 A;  3QJZ A;  3WAN A;  1RLF A;  2KLG A;  1V86 A;  1YX5 B;  5E6O A;  1WR1 A;  1GNU A;  2BPS A;  2L0T A;  3PLU A;  4IM0 A;  4J6I A;  1OEY J;  4LJP B;  1E8W A;  3RZF A;  4DHZ B;  1OEY A;  2I1K A;  2LVO A;  2M4N A;  3H7P B;  5DPR A;  3VTU A;  2RD0 A;  4IM2 A;  3IFW B;  1YX6 B;  4FHJ A;  4F8C B;  1WZ0 A;  3A33 B;  4MSQ B;  3VAW A;  2KFK A;  4AUQ C;  4II3 B;  4B6W A;  4PYU A;  1C1Y B;  2BYV E;  4EZL A;  2CR5 A;  3QX1 A;  5CHW A;  1X1M A;  1E5W A;  2KO3 A;  2V4L A;  4HDQ A;  2ZZP B;  2KHW B;  2MBH A;  4TQ1 A;  2A5U A;  3PZD A;  3RT3 B;  2AL6 A;  5C23 A;  1F9J A;  3GZN I;  3IG3 A;  2DZM A;  2BKR B;  3Q3J A;  4GU2 A;  2M1M A;  2ZCB A;  2MBB B;  4AOF A;  4LJO B;  3X23 A;  3QQ8 B;  2DYO A;  2XK5 B;  4DWF A;  4IC7 B;  2KWC A;  1J0G A;  2L76 A;  3KUZ A;  4WJO A;  4TQ0 A;  2D2Q A;  3M62 B;  4N9F 4;  3T9L A;  4ICU A;  3M63 B;  1L7Y A;  1XQQ A;  4GDL B;  4M0W B;  3VQI A;  5KHQ A;  3UGB B;  3PLV A;  4M8M A;  2LI5 A;  2NS5 A;  4WQO B;  1GJZ A;  4DDI D;  1TGZ B;  4CO7 A;  1KLV A;  2J0M A;  4AJW A;  1H4R A;  1WXA A;  3DBS A;  3DOW A;  4KDI C;  2K1F A;  2JZZ A;  3RCZ A;  2KWU B;  5J2R A;  2AEH A;  4CYE A;  2HD5 B;  3WAP A;  4I6P A;  4EOY A;  2XEW A;  3JSV B;  3QA8 A;  3L54 A;  4G11 A;  4BKG A;  1E90 A;  3JW0 X;  3WAL A;  3ML9 A;  1SIF A;  4OVU A;  2D11 A;  3AI5 A;  1P1A A;  2NPT A;  4ZYN A;  3ZIM A;  4BBN F;  3VUX A;  2CHX A;  4K7W A;  3T8M A;  3ZVV A;  1A5R A;  2J0K A;  2IBI B;  3DBL I;  3PRE A;  3R3M A;  4MGK E;  2FCN A;  2MP2 B;  2L7R A;  5GMV A;  1V5O A;  3V6C B;  4ANV A;  3BIN A;  3DPD A;  2CKH B;  2ZNV B;  2L05 A;  2V1Y A;  2K8H A;  5C1Z A;  3RUL A;  5CTR C;  4IWP A;  1RAX A;  4WJQ A;  4BBN C;  4NAW B;  3VH3 B;  2ZPY A;  1WGH A;  2ASQ A;  2EMS A;  4BOS C;  2IY1 B;  1OQY A;  4K7S A;  3W1S A;  4ZRK A;  1ZGU B;  2BF8 B;  2J0J A;  3V6E B;  1V81 A;  4URK A;  2CS4 A;  2JF5 A;  1EO6 A;  2LRW A;  2D10 A;  4WJP A;  4JGH B;  2FID A;  2LUE A;  3ZKJ C;  2A4Z A;  1VD2 A;  2PPH A;  3L0W B;  5JHA A;  5L83 A;  4DDG D;  1Q0W B;  5J17 A;  1EF5 A;  2Z59 B;  1WM3 A;  2ZVO A;  2JPH A;  2IO3 B;  1WJ4 A;  2BYE A;  3VXW A;  4IUM B;  3KUC B;  4MDK E;  2N9E B;  4MJS B;  1UZX B;  3HM3 A;  2JRH A;  4W9I A;  4IG7 B;  4KIK B;  3ZW3 A;  1NI2 A;  1E8Y A;  2KDI A;  1WJN A;  2BGF A;  3DVN U;  4MGI E;  4E71 A;  5HKH A;  2KJH B;  1MG8 A;  3I3T B;  2WWZ A;  4BKT A;  2ZNV C;  1T0Y A;  4RM8 A;  4BKS A;  2KAN A;  2LXC A;  2MRP A;  3QK0 A;  3NHE B;  2REX A;  4NPN A;  4A20 A;  1WMH A;  4K7U A;  2JWZ A;  3M95 A;  4PYZ A;  5E6P A;  3VTW A;  2KVR A;  2KNB A;  3EFU A;  3H7P A;  1TTN A;  1V6E A;  3UQA A;  1KJT A;  1RRB A;  2LWP A;  4FJY A;  4KDL B;  4W9D A;  3TIX A;  3WAO A;  2G45 B;  1WJ6 A;  1ZW7 A;  4E74 A;  2I1J A;  3ZRC A;  3PRZ A;  3APD A;  1WGG A;  2LZ6 A;  3PV1 A;  3VDZ A;  4WWP A;  1UBQ A;  1IP9 A;  1YD8 U;  3ZDT A;  4BKS D;  2DX5 B;  2FCS A;  3DVG Y;  3OJ4 B;  1Y8R C;  2O2V A;  1KM7 A;  3EHV A;  1WH3 A;  2MQJ A;  2WX0 A;  4NY0 A;  1OGW A;  2B3A A;  2FAZ A;  3QAR A;  4HCN B;  3SHQ A;  3DQV A;  3KVF B;  4ZRJ A;  5CX3 A;  4ZDV A;  1WF9 A;  4AWJ A;  4GMV A;  2LVP A;  1V49 A;  3DBR I;  4GB9 A;  1BT0 A;  4KZ0 A;  1VCB A;  3ALB A;  1WFY A;  2O6V D;  3N30 A;  1IYF A;  3TL5 A;  2LXA A;  1AAR A;  1EF1 A;  2MA9 B;  2PEA A;  3MTN B;  3O65 B;  2KFK B;  3R66 C;  1WX8 A;  1K8R B;  3RUI B;  1WXM A;  4GIV A;  1PQS A;  2FIF A;  5DPS A;  1JRU A;  2L3Z A;  2W9N A;  3ZDM C;  2KLC A;  2OJR A;  5AEK B;  2NBW B;  2NBV B;  4A3O A;  3SU8 X;  4BOZ B;  1WGD A;  4ANX A;  3KYC D;  4IWQ A;  4GN1 A;  3JYU A;  4NNJ B;  4B95 A;  3PRM B;  3R7R A;  3MJW A;  2C60 A;  2R2O A;  4ANU A;  3W1S C;  4IWO A;  4BVU C;  2UYZ B;  3PHX B;  4TKN A;  3UQB A;  1SE9 A;  3QHT A;  3VVW B;  2BKF A;  4K81 A;  3NS8 A;  1LM8 B;  4FHK A;  2C5L C;  2MCN B;  2KDE B;  3PPA A;  1WGY A;  1OTR B;  1Q5W B;  4PS8 A;  4KIK A;  1J8C A;  4HWI B;  2J7Q B;  3L16 A;  4EUT A;  3AXC A;  4MH0 E;  3U7D A;  3P2B A;  1J19 A;  4NAW A;  3UIN B;  2L0F A;  3UIP B;  4BFR A;  4EZK A;  2KTR B;  4CHK A;  4TV3 A;  2DYB A;  3PHW B;  4A3P A;  4IW0 A;  3CST A;  4EZJ A;  3CSF A;  1HE8 A;  3A4S C;  3KYD D;  3H7S A;  5L95 C;  5AZF A;  3DBH I;  3UF8 A;  2KJ6 A;  1GC7 A;  3HHM A;  1LXD A;  3A4R A;  3JVZ X;  2WYQ A;  2WDT B;  1R4N I;  2KKC A;  4IM3 A;  5G55 A;  2ZVN A;  4F1S A;  2QHO A;  4HPM B;  2HJ8 A;  3DCG A;  1I42 A;  1UEL A;  4HJK A;  3AUL A;  4MSM B;  2M0X A;  4GSW A;  2O6V A; 
#chains in the Genus database with same CATH topology
 2MP2 A;  3MJ5 A;  2IO0 B;  4GDL A;  2G3Q B;  1N5X A;  2QMT A;  4WQM A;  2MHJ A;  1WZ3 A;  3AMZ A;  5IKC M;  5JXV A;  1UH6 A;  1FFV A;  2N9L A;  4WAA A;  3VTV A;  4NJ6 A;  4USA A;  2NVU I;  5HFY A;  4AJY B;  2FE8 A;  2IY0 B;  4GXB A;  1C77 A;  3W1Y A;  5FR3 A;  4RGT A;  1UBI A;  1KOT A;  2HE7 A;  1SBB B;  1EWC A;  4YSZ B;  3LYY A;  2WXK A;  1YMH E;  5BYR A;  2N7E A;  4YL8 A;  1P0R A;  2WDV B;  5IAA C;  3TEW A;  3RYT A;  4GDK B;  3BVZ A;  4WWN A;  3V60 A;  1V1P B;  4BZA A;  1I4Q A;  2M8S A;  4C56 C;  2Q5W D;  1WY8 A;  2MX2 A;  1N63 A;  2PTL A;  2K5P A;  3TEX A;  1WGR A;  4EEW A;  4RF1 A;  1NEK B;  1XT9 B;  4W9C A;  1JW9 D;  1LO5 D;  5HHD G;  3UIO B;  2DLB A;  2W54 A;  2GRI A;  5JHB A;  4PS3 A;  3OG5 A;  2VH1 A;  2CHZ A;  5D6J B;  2EKE C;  1P7F A;  1CZP A;  1WRD B;  1NYQ A;  2HTH A;  2N1V A;  4NQK E;  3ZGZ A;  3P4Q B;  1K51 A;  3VRA B;  3BK2 A;  4W9E A;  3BY4 B;  3H9D A;  3OJ3 A;  3X0W A;  1A70 A;  2IO1 B;  1WE7 A;  1ZXH A;  2VZK D;  3WAM A;  2ACZ B;  4JWS C;  2K22 A;  2GOW A;  1JWB D;  1PFD A;  1WR6 E;  3AED B;  2KYW A;  1FRR A;  3SEB A;  1DGJ A;  3MHS D;  5E6N A;  1CMX B;  1WIA A;  2K6D B;  3B2F A;  1PDX A;  3P4S B;  4LCD E;  3AM9 A;  3GZN B;  3K9P B;  1VJK A;  3DVN V;  1GG3 A;  2KTF A;  3CF6 E;  2GBK A;  4GOC A;  4YWG G;  3W5U B;  1HTQ A;  4WWO A;  2IO2 B;  3E56 A;  1F1H A;  4E3C A;  1SXT A;  4ZRQ A;  5AUK A;  4N6E B;  4NJ7 A;  1QZE A;  3RFZ B;  1L0V B;  2LHD A;  1MHH E;  1WXS A;  3AE4 B;  2I38 A;  2JRI B;  2JSV X;  4GLS C;  1Z2M A;  2C7N B;  3BWU D;  1E8X A;  2X38 A;  3TCA A;  4B0M A;  3ZJV A;  3AEE B;  3QCA A;  4EKU A;  4F7Z A;  4HXD A;  5CHV C;  2BYF A;  4N59 A;  3NZU A;  2K39 A;  3BVM A;  1E7U A;  5AZG A;  2G4S A;  1SSN A;  1XEE A;  3OWE B;  1JWS D;  3W9C B;  1J7A A;  2L8J A;  1FNW A;  1E7P B;  2E3T A;  2KDM A;  4JL9 A;  1BUI C;  4A9A A;  4LTU A;  5DPW A;  3A9J B;  4DHZ E;  3VUY A;  3K9O B;  3KH0 A;  4JX1 C;  4AQ7 A;  3RZW C;  3U30 A;  2G4D B;  2MSE D;  3AE7 B;  1P7E A;  2INC C;  1C4A A;  4W9F A;  1TJE A;  4HRO A;  1UNS A;  4JPS A;  2KWD A;  3WAN A;  2KLG A;  4C4V B;  5E6O A;  2L0T A;  4J6I A;  1OEY J;  4DHZ B;  4HKZ E;  1OEY A;  3H7P B;  3VTU A;  1YJI A;  1YX6 B;  3GE3 C;  1KF6 B;  1WGK A;  3U4E G;  4FHJ A;  3AE6 B;  3VAW A;  3PZ7 A;  3KLS X;  1OQR A;  1X1M A;  1E5W A;  2KO3 A;  3RT3 B;  2AL6 A;  5C23 A;  3Q3J A;  2M1M A;  2PMV A;  4LJO B;  3X23 A;  2XK5 B;  4DWF A;  2KWC A;  4J3O D;  2V3N A;  3M62 B;  5KHQ A;  3VQI A;  3NJT A;  2J0M A;  1TYG B;  3DBS A;  4KDI C;  2K1F A;  5J2R A;  2QC8 A;  2KWU B;  2AEH A;  3RPF C;  4EOY A;  4I6P A;  2XEW A;  3B9J A;  2YEP B;  4S17 A;  2NMQ A;  1ZP0 B;  5E6J A;  3AE5 B;  4ZYN A;  3VUX A;  3T8M A;  3SFE B;  1XO3 A;  3PRE A;  1V5O A;  3V6C B;  2ZNV B;  4IKG A;  2AQ1 B;  1K50 A;  2BS3 B;  4NAW B;  1FPY A;  2EMS A;  1OQY A;  4K7S A;  1ZGU B;  2BF8 B;  1YNT E;  3DHG C;  1GPX A;  4URK A;  3N20 C;  4WJP A;  2HJ1 A;  4JGH B;  1T0Q C;  3U2S C;  3L0W B;  5JHA A;  2SEB D;  1EF5 A;  1WM3 A;  4M02 A;  3W5V B;  3IAM 1;  1MVK A;  1WJ4 A;  4WAF A;  3KUC B;  2H89 B;  4MDK E;  1UGJ A;  3Q8C A;  4HRS A;  4L23 A;  3ZW3 A;  3DVN U;  1WJN A;  2BGF A;  5HKH A;  4BKT A;  2ZNV C;  1T0Y A;  2KAN A;  2J53 A;  3NHE B;  2REX A;  4K7U A;  2JWZ A;  2KVR A;  3EFU A;  1V6E A;  3UQA A;  1KJT A;  4FJY A;  2LWP A;  4KDL B;  2G45 B;  1WJ6 A;  1N62 A;  1WGG A;  1EM7 A;  2IGH A;  3P42 A;  1YD8 U;  4DXG A;  1ROE A;  3BYY B;  2JYT A;  3QAR A;  4HCN B;  3KVF B;  1HZ6 A;  4GMV A;  1D5X C;  1WFY A;  1PUT A;  4AS1 A;  1TS2 A;  2MA9 B;  2PEA A;  3O65 B;  1XXG A;  4A90 A;  2LUM A;  4ARC A;  4GIV A;  2FIF A;  2L3Z A;  3TSS A;  4KGT A;  4BOZ B;  1WGD A;  4GN1 A;  3PRM B;  2C60 A;  3Q8A A;  3PHX B;  1SE9 A;  3QHT A;  4REZ A;  2C5L C;  4TMA B;  1CK1 A;  1OTR B;  3AEF B;  3L16 A;  2WGS A;  2GI9 A;  1J7C A;  3FIL A;  3AXC A;  1T5X D;  1J19 A;  3UIP B;  4TV3 A;  3T3O A;  1KRH A;  3CST A;  2QEJ C;  1WXQ A;  2CU3 A;  2KJ6 A;  1UF0 A;  3AB5 A;  2WDT B;  1R4N I;  2KKC A;  2ZVN A;  2JQR B;  2QHO A;  4HPM B;  3DCG A;  2VH2 A;  2BS4 B;  3FC4 A;  2MW5 A;  3NZS A;  1JWM D;  5MPO A;  1Q1O A;  1L2N A;  2O6V B;  3V61 A;  3ZQ4 A;  3Q3F A;  2BB5 A;  3IVF A;  3NVV A;  3R2I A;  4HK2 A;  1F2R C;  1OQQ A;  4RGO S;  2D3G A;  1NBF C;  1YJJ A;  4FBJ B;  3RNF C;  5LLI A;  3NS1 A;  2GB1 A;  1EUV B;  3HM6 X;  2N7D A;  1WI0 A;  4RMA A;  1H8C A;  3FAH A;  1JCK B;  2JT4 B;  1WJU A;  2KTR A;  2DZJ A;  4C80 A;  4YTN B;  3ZLZ A;  2DZK A;  2IZV B;  4KSK C;  1SIJ A;  2GBM A;  4OZB A;  1LQB A;  2WXQ A;  3HVD A;  5EDS A;  4FJZ A;  1XCQ L;  1YQB A;  3L08 A;  2ZW1 A;  4I6L B;  5C2T B;  4KZC A;  2ZW0 A;  1XD3 B;  4KKI A;  1UGM A;  2Z8L A;  2PE6 B;  3NY5 A;  2MBO A;  2UU7 A;  1V1O A;  3DBL B;  3QC8 B;  5EE1 A;  2J52 A;  4EFO A;  4ITK A;  4P1C C;  2GBN A;  1KTK A;  4MJS A;  1L4Z B;  1I4R A;  3IBE A;  4AP4 C;  2WXN A;  4A6Q A;  2D3A A;  2DAJ A;  3BK1 A;  3TBL D;  2KDB A;  2OJW A;  3ML8 A;  3WIM A;  2WXL A;  5FR6 A;  3I63 C;  3Q2A C;  3H1U A;  4IDI A;  4YTM B;  1SB3 C;  2LFI A;  3Q14 C;  4K3B A;  5EE9 A;  2KN5 A;  1ET9 A;  3HIZ A;  2YEP F;  1YN3 A;  4FA6 A;  2PE9 A;  3L13 A;  3ZTD A;  2DBY A;  3ABV B;  1WMH B;  2CJO A;  4NJC A;  1YN4 A;  2KDF B;  2K9X A;  3CMM B;  2LVQ A;  2WHI A;  1AN8 A;  1YQ4 B;  4LDT D;  1L0X B;  1Y56 A;  2MWS B;  1TT5 B;  4XDD A;  3Q3M C;  3ZNH B;  2L32 A;  3DHI C;  2GBJ A;  5FKA C;  1KLU D;  3I9V 1;  3TMP B;  2W3S A;  1F2R I;  1V2Y A;  2Y5P A;  4G3X B;  2RSU A;  1ZDV A;  4DHJ D;  1XF5 L;  2XN9 C;  4C7Y A;  1I35 A;  2AYO B;  3APC A;  4L2Y A;  1ET6 A;  4JQW C;  2N0S B;  2FUH B;  2JYE A;  1SE2 A;  3VHT C;  2LGX A;  4MGZ E;  4YSY B;  5D7G A;  1Q10 A;  3MC9 A;  1PGX A;  1E8Z A;  2FCQ A;  3B1L X;  1SE4 A;  3B2G A;  3NOB A;  5D3I B;  1J7B A;  4OW0 A;  3V62 A;  3RI7 C;  4L1B A;  3MC0 B;  2PJH A;  1VR9 A;  2NCN A;  3GOE A;  3RNG C;  3ECI A;  2JXT A;  2IND C;  4DBG A;  4N58 A;  2PVO D;  1T0R C;  3BZD B;  3D32 A;  4XWT A;  2K8B A;  4QAY A;  2Z0E B;  1NYR A;  3R8B A;  2MJ3 A;  3EUB 2;  4W9J A;  2KOX A;  4NZL B;  2N1W A;  4WUR A;  3VUW A;  1YJ1 A;  2KX0 A;  3RNB C;  3KWL A;  2BPS A;  3PLU A;  4PT5 A;  1E8W A;  3RZF A;  4MT5 A;  1MJD A;  1IGC A;  3IFW B;  2AQ3 B;  4P1B C;  1WZ0 A;  2D3C A;  3CIR B;  1KFY B;  2HTM E;  4II3 B;  4PYU A;  2BYT A;  2BYV E;  2CR5 A;  4P6V F;  5BYS A;  3ETR A;  4M00 A;  3QX1 A;  2ZZP B;  2M56 B;  1TKG A;  4TQ1 A;  2PIA A;  1FNU A;  3IG3 A;  3GZN I;  2DZM A;  3AEG B;  2BQQ A;  4KGS A;  4AOF A;  2KT7 A;  2QCZ A;  2DYO A;  4IC7 B;  1I4X A;  3KUZ A;  4WJO A;  4TQ0 A;  2D2Q A;  1FFU A;  3T9L A;  4KGR A;  5GXG B;  4C7Z A;  1STE A;  3PLV A;  2LI5 A;  2NS5 A;  1VZ8 A;  1GJZ A;  1QKZ A;  4A8X C;  1NVI D;  2NTT A;  4AJW A;  1C76 A;  1H4R A;  1RFK A;  3DOW A;  3WAP A;  3KQ4 A;  4BKG A;  2QJL A;  1E90 A;  3TEY A;  1SIF A;  4OVU A;  2D11 A;  1WYG A;  3AI5 A;  1P1A A;  4BBN F;  4US9 A;  1A5R A;  2FBW B;  1FMA D;  2L7R A;  3DPD A;  3KWV A;  2PW9 A;  2L05 A;  2K8H A;  5CTR C;  4BBN C;  4PK1 A;  3EGR A;  2V3P A;  4BOS C;  1IGD A;  1TS5 A;  2V9H A;  5C3J B;  4CQN A;  2LUE A;  3ZKJ C;  1VD2 A;  5L83 A;  3DBR B;  2K0P A;  2ZVO A;  2JPH A;  2IO3 B;  2V4I B;  3PZ8 A;  4ZOH C;  4W9I A;  1FXI A;  1NI2 A;  2MJE A;  4MGI E;  2KJH B;  1T3Q A;  1ZUD 2;  4ACF A;  4BKS A;  2LXC A;  5EE0 A;  2MRP A;  1KLV A;  1WMH A;  3M95 A;  1I4G A;  3H7P A;  2KNB A;  3TIX A;  4W9D A;  1ZW7 A;  4E74 A;  1ZPS A;  3PRZ A;  3NG0 A;  2IPK D;  3OJ4 B;  3DWM A;  1V49 A;  3DBR I;  4GB9 A;  2WS3 B;  2D3B A;  1VRA B;  3IAS 1;  3TL5 A;  2KFK B;  1K8R B;  3RUI B;  3L4P A;  1PQS A;  5DPS A;  2KLC A;  3E9S A;  2NBV B;  4A3O A;  3SU8 X;  4ANX A;  4NNJ B;  5BYQ A;  3MJW A;  3N9Y C;  3W1S C;  1T0S C;  2UYZ B;  1TZO A;  3UQB A;  4FHK A;  1LGR A;  2MCN B;  2KDE B;  3N1Y C;  1OFF A;  4PS8 A;  1J8C A;  3Q8F A;  3P2B A;  4NAW A;  3UIN B;  2BB6 A;  2N7J A;  2KTR B;  4CHK A;  4EZK A;  1PGB A;  2INN E;  4EZJ A;  1L4D B;  3CSF A;  3H7S A;  1SEB D;  3IXS A;  1QOG A;  3GS2 A;  3A4R A;  1WRI A;  3NVY A;  5G55 A;  4DQO C;  1L5P A;  2HJ8 A;  2J4X A;  1UEL A;  4HJK A;  2OHF A;  2M0X A;  1L6U A;  2O6V A;  3ZYY X;  2LGD A;  4MM3 A;  1K52 A;  1UWM A;  1Z5S B;  5DPT A;  2I2Y A;  5BO4 B;  2LAS A;  2N9P C;  1QLB B;  2KQ4 X;  3AV8 A;  2AWT A;  2KK8 A;  4RF0 A;  1TS4 A;  2BWF A;  1D4B A;  2Y3A A;  1MPE A;  2WNM A;  1TZ1 A;  5H8Y E;  4X57 B;  4IOI E;  1WX9 A;  2K8C A;  3PT2 B;  2XNA C;  2K3U A;  3C0R B;  1EWY C;  2DZI A;  3AE2 B;  1C3T A;  4MGY E;  2INP E;  2ON8 A;  2V0G A;  4MAC A;  2R61 A;  4OZA A;  3MFG A;  1SGH A;  3AEB B;  1N5W A;  2V3S A;  4W9L A;  4C4V A;  5AZH A;  1V9J A;  2K25 A;  3GP7 A;  3JSV A;  1C78 A;  3SR6 A;  2M17 A;  2LGY A;  1I4P A;  2JZP A;  1GUA B;  2LJI A;  3ZO5 B;  4P16 A;  4XX5 A;  2RR9 A;  4M0W A;  2BTE A;  2AL3 A;  2YLM A;  3AU4 A;  4DHJ B;  3B0A A;  2VRR B;  2KD0 A;  4W9H A;  2ONQ A;  1I7H A;  1ZXI A;  4GDK A;  2RGF A;  2MLB A;  2WU5 B;  1C79 A;  3P1M A;  2ZCC A;  1SF0 A;  1R4M I;  5LXH A;  3ZNG C;  4K3C A;  1RWS A;  3SFD B;  4NQL B;  3Q8B A;  3AU5 A;  3PRP B;  2C9W B;  2WXR A;  3PVL A;  1HEZ E;  5D3D A;  1FIQ A;  1DOY A;  2L83 A;  3TJP A;  1MHX A;  4RNA A;  1DYQ A;  4MEM A;  4UDU C;  5FK9 C;  2ZJD A;  1U4A A;  4FUL A;  2PLP A;  4H2A A;  3SDL C;  1JWA D;  2Y5C A;  2JZ3 B;  4P7I A;  4TUU A;  3EEC A;  2BBC A;  4DXA B;  1XLP A;  4FLH A;  4RM9 A;  2JY6 A;  1IUE A;  3H6N A;  1P9D U;  1ISN A;  1BXT A;  3A9K B;  3AE3 B;  1R4M B;  2OED A;  1NDD A;  4ZHP A;  2HDE A;  2JWU A;  2D07 B;  4OVV A;  4K1R B;  2JVC A;  1F77 A;  4OVZ A;  1N61 A;  3GE8 C;  2KWV B;  1SE3 A;  4FXC A;  2LHE A;  1WE6 A;  3UI3 A;  3SD5 A;  1V97 A;  1AWD A;  3QAQ A;  1JQ4 A;  1FXT B;  4KKJ A;  3AEA B;  3VFK A;  3A1Q B;  3QIJ A;  2DEN B;  2FNJ B;  3EFC A;  3Q69 A;  4HPP A;  3PO0 A;  4ZRP A;  1HA5 A;  1XLO A;  1ZKH A;  2MBQ A;  4M8N A;  4R3D A;  1C4C A;  3KW5 B;  3NRZ A;  3P4R B;  4DXF A;  2KQS A;  3ZJU A;  1IBX B;  2DYM A;  2AQ2 B;  1TBE A;  2CU1 A;  2L52 A;  4FJV B;  4MEL A;  1XLQ A;  3OLM D;  2EKI A;  2H88 B;  3P63 A;  1JRO A;  1WX7 A;  3PGE A;  5LNK 1;  1S3S G;  3ZXV A;  5TR5 A;  2DWQ A;  4XGA B;  3HK0 A;  2DAF A;  4KV2 A;  2GLS A;  2LJ5 A;  3WCQ A;  4EE2 A;  5IA7 A;  3P4P B;  2O2V B;  3IHP C;  4LNN A;  4HCP B;  1V1P A;  4GGQ A;  2KC2 A;  2WU2 B;  3DHH C;  1KH0 A;  1B9R A;  1GNU A;  4IM0 A;  4LJP B;  3W2D A;  1FCC C;  2I1K A;  1HTO A;  2M4N A;  3LB8 C;  4IM2 A;  1UUP A;  2W3R A;  4F8C B;  3A33 B;  4YXD B;  4MSQ B;  1GB4 A;  4AUQ C;  4B6W A;  4JE3 B;  5T8I A;  3Q8E A;  1C1Y B;  3GB1 A;  4EZL A;  4D2K A;  5CHW A;  4HKQ A;  3HVZ A;  2V4L A;  4HDQ A;  5IP4 D;  1HQR D;  4RCO A;  3MHZ A;  4GU2 A;  2ZCB A;  2MBB B;  2RDG A;  3RNC C;  3QQ8 B;  5EE3 A;  2L76 A;  3CWI A;  4N9F 4;  1L7Y A;  1XQQ A;  4GDL B;  3FIL B;  3UGB B;  4M8M A;  3AE1 B;  4KX6 B;  3V05 A;  4DDI D;  4WWM A;  4C00 A;  2BW2 A;  1WXA A;  1TY0 A;  1N6Z A;  2JZZ A;  1QQR A;  4XWW A;  1FEH A;  4CYE A;  1VZ6 A;  3U52 E;  2TSS A;  3ML9 A;  2WDQ B;  1CJE A;  1MG4 A;  2MH7 A;  4XYC A;  2LMC A;  3MC8 A;  4RH6 A;  3ZVV A;  1GB1 A;  2IBI B;  2BT6 A;  4MGK E;  2MP2 B;  5BMG A;  2KMM A;  3BVG A;  2CKH B;  1QT9 A;  2RMM A;  3RUL A;  3O13 A;  4WJQ A;  4Q2J A;  1WGH A;  2ASQ A;  2QIL A;  3W1S A;  2L1A A;  2J0J A;  2JF5 A;  2D10 A;  2LGI A;  2FID A;  2A4Z A;  1YN5 A;  4US8 A;  3AH7 A;  3Q3O C;  4RGM A;  1VZ7 A;  1D5Z C;  5AUI A;  1YOV B;  4MJS B;  2JRH A;  4KIK B;  1E8Y A;  4E71 A;  1JAL A;  3I3T B;  4LNF A;  1QIL A;  4HLE A;  2JU6 X;  4PYZ A;  5HI1 A;  1RRB A;  3NUH B;  3ZRC A;  2LZ6 A;  3PV1 A;  3VDZ A;  4WWP A;  1UBQ A;  3ZDT A;  2DX5 B;  1Y8R C;  1KM7 A;  3EHV A;  2NTS A;  2MQJ A;  2WX0 A;  1R4N B;  2B3A A;  3DQV A;  1WF9 A;  4S0R A;  2LVP A;  4KZ0 A;  1BT0 A;  2O6V D;  1WX8 A;  1L0Y B;  3R2T A;  3VR9 B;  2OJR A;  2WLB A;  5AEK B;  2NBW B;  1E0Z A;  2IGD A;  3KYC D;  4IWQ A;  3TUO A;  4B95 A;  2JX5 A;  3R7R A;  4MH8 A;  4B0E A;  4IWO A;  4BVU C;  3VVW B;  2BKF A;  4K81 A;  3NS8 A;  4YTP B;  4LNO A;  1Q5W B;  1XCT L;  4RFB A;  4MH0 E;  3U7D A;  3N1X C;  4BFR A;  3N1Z C;  1HXY D;  3FKY A;  4A3P A;  3PHW B;  4IW0 A;  3C8Y A;  1HE8 A;  3A4S C;  3KYD D;  1ESF A;  1QOF A;  5AZF A;  3DBH I;  1TS3 A;  3HHM A;  3JVZ X;  2WYQ A;  4LNK A;  4F1S A;  1D6E C;  3AEC B;  3AUL A;  3URY A;  2N4F A;  3C19 A;  1C4P A;  3ZNI D;  3R7Q A;  3PSE B;  2W82 A;  4TSS A;  2KJR A;  2B76 B;  2NPT B;  5CHF A;  4KSL C;  5JZE B;  2BWE S;  3A1Q A;  1VLB A;  2M0A A;  3LJ3 A;  1WM2 A;  3NZ3 A;  1R7S A;  1ZOY B;  1SJH D;  4HPL B;  2JXX A;  3ZUN A;  1V5T A;  4ARI A;  2NBU A;  3I5J C;  4HVB A;  3N3K B;  3RN9 C;  1WXV A;  3LDZ E;  1GAQ B;  3L17 A;  3A9J A;  1NEN B;  1IPG A;  1ZDX A;  3U8Z A;  1FM0 D;  3RNE C;  3A9K A;  2IYD B;  3M3J A;  2RPQ A;  3DDC B;  5D94 A;  2GMI C;  1M94 A;  4ZRI A;  2KMA A;  1XLN A;  2FCM A;  4NAM A;  2ICI A;  2XBB C;  5LXI B;  5IOI A;  4JIO U;  2KC1 A;  4JLC A;  2NR2 A;  4O1N A;  2OOB B;  2ZPN A;  2KQ7 A;  5DCN A;  4ANW A;  1PYW D;  2DHZ A;  4HDO A;  2KMC A;  2M19 A;  3VR8 B;  1FCL A;  3PTF C;  1S1Q B;  1YIW A;  2ZEQ A;  3AN1 A;  2K6Q A;  2G9H D;  1WSP A;  4PS7 A;  2QIE B;  5KHO A;  1RM6 C;  4I6N B;  2KXJ A;  2WX1 A;  1E9M A;  5JH5 C;  2R2Q A;  2KX3 A;  1AYF A;  1NI3 A;  2Y5B B;  1C9F A;  3OAW A;  3ZNZ B;  2N9K A;  4RGN A;  2LRU A;  2KZR A;  1JWU D;  4ZHO A;  4FN2 A;  2WXG A;  1P98 A;  2N9X A;  3ENE A;  1LFD A;  2C7M B;  4WJN A;  2WXJ A;  2UWQ A;  2RPV A;  1WWT A;  2EMT A;  1FNV A;  4W9K A;  3B08 A;  2GBR A;  4ASW C;  3ZTC A;  3ONS A;  4G50 A;  1DOX A;  2WP9 B;  1D3Z A;  3EC8 A;  3N32 A;  5D2M B;  2YVC A;  2KFJ A;  2C7H A;  1HZ5 A;  4ICV A;  1V80 A;  1MI0 A;  4DK5 A;  2XK5 A;  1TKY A;  4XC2 A;  3BYT B;  3KUD B;  2MBE A;  3VH4 B;  1P3Q U;  3DWG C;  4LK0 M;  2Z0D B;  4XZ4 A;  3APF A;  3U7Z A;  5BMI A;  2IDY A;  4FAD A;  3Q6B A;  4LDT B;  1D5M C;  1UWX A;  2KAJ A;  3BII D;  1YQ3 B;  2KVZ A;  1CQV A;  3MP9 A;  1M4V A;  1K53 A;  1QF6 A;  2JUO A;  2WXH A;  4OHJ A;  1UD7 A;  3S2A A;  1RYJ A;  4B9K A;  1MFW A;  3L10 B;  4II2 B;  5J18 A;  4JWU C;  5IO9 A;  4WIP A;  1GC6 A;  3PS6 A;  3DVG X;  1WYW B;  2L00 B;  3J9C A;  4OZC A;  3AE9 B;  3RD2 A;  3WA0 A;  1ACC A;  2WXI A;  5H92 C;  3NVW A;  4XDC A;  1N60 A;  3ZRF A;  1V8C A;  5IN7 A;  3QWZ B;  1ZE3 D;  2LD9 A;  4G0N B;  4HEA 1;  1G6J A;  2CHW A;  1TIF A;  4LLG M;  1E7V A;  4KVG B;  1E6E B;  1RFA A;  2WXP A;  4W9G A;  5G2N A;  2EEL A;  3QJZ A;  4WH4 A;  1RLF A;  1V86 A;  1YX5 B;  2RDH A;  1WR1 A;  2LVO A;  5DPR A;  4YT0 B;  2RD0 A;  2WQY B;  3ZXR A;  3AE8 B;  2KFK A;  2WXM A;  2AX5 A;  1B1Z A;  2KHW B;  2MBH A;  2A5U A;  3PZD A;  3TEZ A;  5I4D A;  2VZK B;  1F9J A;  2BKR B;  1VDV A;  1TKE A;  3I57 A;  1FO4 A;  2CJN A;  1J0G A;  1JML A;  3RNA C;  2PKO A;  4A55 A;  4ICU A;  3M63 B;  1SJE D;  4M0W B;  1BML C;  3DBH B;  4WQO B;  2J42 A;  3T3N A;  4XE0 A;  1TGZ B;  4CO7 A;  3RMK C;  1QOB A;  3RCZ A;  1F0Z A;  2HD5 B;  5HG2 A;  3JSV B;  3QA8 A;  3L54 A;  4G11 A;  4BAX A;  2KAC A;  3WAL A;  3JW0 X;  2NPT A;  3ZIM A;  3H8H A;  2CHX A;  4K7W A;  2J0K A;  3HRD D;  3DBL I;  3R3M A;  5GMV A;  2FCN A;  5TSS A;  4ANV A;  3ZJT A;  3BIN A;  1EU4 A;  2W55 A;  2V1Y A;  5C1Z A;  2D5G A;  4IWP A;  1ENF A;  1RAX A;  3VH3 B;  2ZPY A;  2IY1 B;  4ZRK A;  2WXF A;  3V6E B;  1V81 A;  2CS4 A;  1EO6 A;  2LRW A;  2BS2 B;  2WXO A;  2PPH A;  4DDG D;  1Q0W B;  5J17 A;  2Z59 B;  3LXF A;  3IT6 B;  2BYE A;  3VXW A;  4IUM B;  1I4H A;  2N9E B;  1UZX B;  3HM3 A;  4IG7 B;  2KN4 A;  2KDI A;  2PVG C;  1MG8 A;  2WWZ A;  4MM3 B;  4RM8 A;  3QK0 A;  1QOA A;  4NPN A;  4A20 A;  4YSX B;  5E6P A;  3VTW A;  1TTN A;  1F52 A;  2DNF A;  3WAO A;  3NVZ A;  2G1E A;  2E6X A;  4ZYS A;  2I1J A;  3APD A;  2IGG A;  1IP9 A;  3HUI A;  3Q3N C;  4BKS D;  3IT4 B;  2FCS A;  3DVG Y;  5G5G A;  2O2V A;  2MEK A;  4LNI A;  3V3X A;  1WH3 A;  4NY0 A;  1OGW A;  2FAZ A;  3SHQ A;  4ZDV A;  4ZRJ A;  5CX3 A;  3EA6 A;  4AWJ A;  1VCB A;  2LEK A;  3ALB A;  3N30 A;  1IYF A;  2LXA A;  1AAR A;  1EF1 A;  3R66 C;  3MTN B;  1WXM A;  2SAK A;  1JRU A;  1TY2 A;  2W9N A;  1E10 A;  3ZDM C;  4M01 A;  3VRB B;  1FD6 A;  3JYU A;  2MJD A;  2R2O A;  4ANU A;  1GOZ A;  1IBX A;  4TKN A;  1LM8 B;  3PPA A;  2BVC A;  2QDF A;  1WGY A;  2RDB C;  1T6B X;  4KIK A;  4HWI B;  1PGA A;  2FUG 1;  2J7Q B;  2LGS A;  4EUT A;  2QSD A;  2L0F A;  5G5H A;  4HJG E;  2X8X X;  5BMH A;  2DYB A;  2WDR B;  1FRD A;  1AW7 A;  1DOI A;  1EU3 A;  5L95 C;  2IJ0 A;  1FXA A;  3UF8 A;  1GC7 A;  1LXD A;  1KLG D;  4IM3 A;  1JRP A;  1L6V A;  1I42 A;  4MSM B;  4GSW A; 
#chains in the Genus database with same CATH homology
 2N4F A;  2LGD A;  3ZNI D;  3R7Q A;  4MM3 A;  2MW5 A;  2MP2 A;  3NZS A;  1Q1O A;  1L2N A;  2O6V B;  3V61 A;  3PSE B;  1Z5S B;  3Q3F A;  2KJR A;  2IO0 B;  2NPT B;  5CHF A;  4GDL A;  5DPT A;  2G3Q B;  3IVF A;  4KSL C;  4HK2 A;  5BO4 B;  5JZE B;  2BWE S;  2LAS A;  2N9P C;  1WZ3 A;  2D3G A;  3A1Q A;  1NBF C;  1UH6 A;  3LJ3 A;  4FBJ B;  1WM2 A;  5LLI A;  1EUV B;  2AWT A;  2N7D A;  3HM6 X;  4WAA A;  3VTV A;  1WI0 A;  4RMA A;  1H8C A;  2KK8 A;  4NJ6 A;  2NVU I;  2BWF A;  4HPL B;  2JXX A;  4AJY B;  3ZUN A;  2IY0 B;  1V5T A;  2JT4 B;  1WJU A;  2NBU A;  2KTR A;  4HVB A;  3N3K B;  1TZ1 A;  2DZJ A;  4X57 B;  1WXV A;  3LDZ E;  4GXB A;  1WX9 A;  3L17 A;  3ZLZ A;  3W1Y A;  2DZK A;  3A9J A;  2IZV B;  4KSK C;  2K8C A;  1UBI A;  1KOT A;  3PT2 B;  1IPG A;  2GBM A;  2HE7 A;  3C0R B;  1LQB A;  5EDS A;  4FJZ A;  3U8Z A;  2DZI A;  3A9K A;  2IYD B;  1C3T A;  1YQB A;  3L08 A;  3M3J A;  2RPQ A;  4I6L B;  3DDC B;  4KZC A;  4MGY E;  5D94 A;  2N7E A;  1XD3 B;  2GMI C;  4YL8 A;  1M94 A;  1P0R A;  5IAA C;  1UGM A;  4ZRI A;  2KMA A;  3RYT A;  1SGH A;  2V3S A;  2PE6 B;  2FCM A;  3NY5 A;  4GDK B;  4W9L A;  2MBO A;  5AZH A;  4WWN A;  1V9J A;  2K25 A;  2XBB C;  3JSV A;  3QC8 B;  5LXI B;  4JIO U;  3V60 A;  4EFO A;  2KC1 A;  4JLC A;  2M8S A;  2NR2 A;  2M17 A;  2LGY A;  2GBN A;  2OOB B;  2ZPN A;  1WY8 A;  2MX2 A;  2KQ7 A;  4MJS A;  3IBE A;  1WGR A;  4AP4 C;  5DCN A;  4ANW A;  1GUA B;  4EEW A;  2DHZ A;  4HDO A;  2DAJ A;  3ZO5 B;  4XX5 A;  2KMC A;  1XT9 B;  3TBL D;  2KDB A;  4W9C A;  2RR9 A;  3ML8 A;  3UIO B;  3PTF C;  3WIM A;  2AL3 A;  1S1Q B;  1YIW A;  2YLM A;  2ZEQ A;  2K6Q A;  3AU4 A;  3H1U A;  5FR6 A;  4DHJ B;  3B0A A;  4PS7 A;  2VRR B;  5KHO A;  5JHB A;  2KD0 A;  4W9H A;  4PS3 A;  4GDK A;  2RGF A;  2MLB A;  2CHZ A;  4I6N B;  2ZCC A;  5D6J B;  2KN5 A;  2KXJ A;  2EKE C;  2WX1 A;  1R4M I;  5JH5 C;  2R2Q A;  3HIZ A;  1WRD B;  2KX3 A;  5LXH A;  3ZNG C;  4NQL B;  4FA6 A;  2PE9 A;  2Y5B B;  2HTH A;  2N1V A;  3AU5 A;  3L13 A;  3OAW A;  3ZTD A;  1WMH B;  4NQK E;  3ZNZ B;  2KDF B;  3PRP B;  2C9W B;  2LRU A;  2KZR A;  4W9E A;  3BY4 B;  3PVL A;  3H9D A;  3CMM B;  4FN2 A;  2LVQ A;  3OJ3 A;  3X0W A;  1P98 A;  2IO1 B;  2N9X A;  1WE7 A;  3ENE A;  3TJP A;  1LFD A;  2C7M B;  4WJN A;  3WAM A;  4MEM A;  2UWQ A;  2ZJD A;  1U4A A;  4LDT D;  4FUL A;  2MWS B;  2GOW A;  2EMT A;  3SDL C;  4W9K A;  1WR6 E;  3B08 A;  4HLE A;  2JZ3 B;  2GBR A;  4P7I A;  4TUU A;  3ONS A;  3EEC A;  4G50 A;  3ZTC A;  3ZNH B;  4ASW C;  4DXA B;  2GBJ A;  3MHS D;  4FLH A;  4RM9 A;  5E6N A;  2JY6 A;  3H6N A;  1CMX B;  1WIA A;  1P9D U;  2K6D B;  3EC8 A;  1ISN A;  3N32 A;  1D3Z A;  3A9K B;  4LCD E;  5D2M B;  2YVC A;  2KFJ A;  3TMP B;  3K9P B;  2C7H A;  3DVN V;  1NDD A;  1GG3 A;  4ICV A;  2KTF A;  1V80 A;  1V2Y A;  2D07 B;  2GBK A;  3CF6 E;  4OVV A;  4DK5 A;  2XK5 A;  4GOC A;  4K1R B;  2JVC A;  4G3X B;  4WWO A;  2IO2 B;  4XC2 A;  4E3C A;  2KWV B;  2RSU A;  3KUD B;  2MBE A;  3VH4 B;  1P3Q U;  4NJ7 A;  2Z0D B;  4XZ4 A;  1WE6 A;  1QZE A;  4DHJ D;  3APF A;  3SD5 A;  1I35 A;  4FAD A;  2AYO B;  4LDT B;  3APC A;  1WXS A;  3QAQ A;  2JRI B;  1FXT B;  3VFK A;  3A1Q B;  1Z2M A;  2C7N B;  3QIJ A;  4JQW C;  2DEN B;  2FNJ B;  2FUH B;  1E8X A;  3VHT C;  2LGX A;  4MGZ E;  3TCA A;  5D7G A;  3QCA A;  2JUO A;  4EKU A;  1ZKH A;  2MBQ A;  4M8N A;  4F7Z A;  1E8Z A;  1UD7 A;  3S2A A;  4HXD A;  2FCQ A;  5CHV C;  2BYF A;  3KW5 B;  2KQS A;  3NZU A;  3B1L X;  2DYM A;  3NOB A;  4B9K A;  3L10 B;  4II2 B;  5J18 A;  1TBE A;  2CU1 A;  2K39 A;  1GC6 A;  4FJV B;  1E7U A;  3PS6 A;  3OLM D;  4MEL A;  2G4S A;  5AZG A;  3V62 A;  3DVG X;  1WX7 A;  2L8J A;  1WYW B;  2L00 B;  3PGE A;  2PJH A;  4JL9 A;  1S3S G;  3RD2 A;  2NCN A;  3GOE A;  3WA0 A;  3ECI A;  4DBG A;  5DPW A;  3A9J B;  4DHZ E;  3VUY A;  3K9O B;  5TR5 A;  3ZRF A;  3KH0 A;  3RZW C;  3D32 A;  3HK0 A;  2K8B A;  2DAF A;  3U30 A;  2G4D B;  2MSE D;  3QWZ B;  2LD9 A;  4G0N B;  4KV2 A;  1G6J A;  2CHW A;  2Z0E B;  2LJ5 A;  5IA7 A;  4W9J A;  2KOX A;  4W9F A;  1E7V A;  2N1W A;  2O2V B;  3IHP C;  4HCP B;  4KVG B;  4GGQ A;  3VUW A;  1RFA A;  1YJ1 A;  4W9G A;  2KC2 A;  5G2N A;  2KX0 A;  3QJZ A;  3WAN A;  1RLF A;  2KLG A;  1V86 A;  1YX5 B;  5E6O A;  1WR1 A;  1GNU A;  2BPS A;  2L0T A;  3PLU A;  4IM0 A;  4J6I A;  1OEY J;  4LJP B;  1E8W A;  3RZF A;  4DHZ B;  1OEY A;  2I1K A;  2LVO A;  2M4N A;  3H7P B;  5DPR A;  3VTU A;  2RD0 A;  4IM2 A;  3IFW B;  1YX6 B;  4FHJ A;  4F8C B;  1WZ0 A;  3A33 B;  4MSQ B;  3VAW A;  2KFK A;  4AUQ C;  4II3 B;  4B6W A;  4PYU A;  1C1Y B;  2BYV E;  4EZL A;  2CR5 A;  3QX1 A;  5CHW A;  1X1M A;  1E5W A;  2KO3 A;  2V4L A;  4HDQ A;  2ZZP B;  2KHW B;  2MBH A;  4TQ1 A;  2A5U A;  3PZD A;  3RT3 B;  2AL6 A;  5C23 A;  1F9J A;  3GZN I;  3IG3 A;  2DZM A;  2BKR B;  3Q3J A;  4GU2 A;  2M1M A;  2ZCB A;  2MBB B;  4AOF A;  4LJO B;  3X23 A;  3QQ8 B;  2DYO A;  2XK5 B;  4DWF A;  4IC7 B;  2KWC A;  1J0G A;  2L76 A;  3KUZ A;  4WJO A;  4TQ0 A;  2D2Q A;  3M62 B;  4N9F 4;  3T9L A;  4ICU A;  3M63 B;  1L7Y A;  1XQQ A;  4GDL B;  4M0W B;  3VQI A;  5KHQ A;  3UGB B;  3PLV A;  4M8M A;  2LI5 A;  2NS5 A;  4WQO B;  1GJZ A;  4DDI D;  1TGZ B;  4CO7 A;  1KLV A;  2J0M A;  4AJW A;  1H4R A;  1WXA A;  3DBS A;  3DOW A;  4KDI C;  2K1F A;  2JZZ A;  3RCZ A;  2KWU B;  5J2R A;  2AEH A;  4CYE A;  2HD5 B;  3WAP A;  4I6P A;  4EOY A;  2XEW A;  3JSV B;  3QA8 A;  3L54 A;  4G11 A;  4BKG A;  1E90 A;  3JW0 X;  3WAL A;  3ML9 A;  1SIF A;  4OVU A;  2D11 A;  3AI5 A;  1P1A A;  2NPT A;  4ZYN A;  3ZIM A;  4BBN F;  3VUX A;  2CHX A;  4K7W A;  3T8M A;  3ZVV A;  1A5R A;  2J0K A;  2IBI B;  3DBL I;  3PRE A;  3R3M A;  4MGK E;  2FCN A;  2MP2 B;  2L7R A;  5GMV A;  1V5O A;  3V6C B;  4ANV A;  3BIN A;  3DPD A;  2CKH B;  2ZNV B;  2L05 A;  2V1Y A;  2K8H A;  5C1Z A;  3RUL A;  5CTR C;  4IWP A;  1RAX A;  4WJQ A;  4BBN C;  4NAW B;  3VH3 B;  2ZPY A;  1WGH A;  2ASQ A;  2EMS A;  4BOS C;  2IY1 B;  1OQY A;  4K7S A;  3W1S A;  4ZRK A;  1ZGU B;  2BF8 B;  2J0J A;  3V6E B;  1V81 A;  4URK A;  2CS4 A;  2JF5 A;  1EO6 A;  2LRW A;  2D10 A;  4WJP A;  4JGH B;  2FID A;  2LUE A;  3ZKJ C;  2A4Z A;  1VD2 A;  2PPH A;  3L0W B;  5JHA A;  5L83 A;  4DDG D;  1Q0W B;  5J17 A;  1EF5 A;  2Z59 B;  1WM3 A;  2ZVO A;  2JPH A;  2IO3 B;  1WJ4 A;  2BYE A;  3VXW A;  4IUM B;  3KUC B;  4MDK E;  2N9E B;  4MJS B;  1UZX B;  3HM3 A;  2JRH A;  4W9I A;  4IG7 B;  4KIK B;  3ZW3 A;  1NI2 A;  1E8Y A;  2KDI A;  1WJN A;  2BGF A;  3DVN U;  4MGI E;  4E71 A;  5HKH A;  2KJH B;  1MG8 A;  3I3T B;  2WWZ A;  4BKT A;  2ZNV C;  1T0Y A;  4RM8 A;  4BKS A;  2KAN A;  2LXC A;  2MRP A;  3QK0 A;  3NHE B;  2REX A;  4NPN A;  4A20 A;  1WMH A;  4K7U A;  2JWZ A;  3M95 A;  4PYZ A;  5E6P A;  3VTW A;  2KVR A;  2KNB A;  3EFU A;  3H7P A;  1TTN A;  1V6E A;  3UQA A;  1KJT A;  1RRB A;  2LWP A;  4FJY A;  4KDL B;  4W9D A;  3TIX A;  3WAO A;  2G45 B;  1WJ6 A;  1ZW7 A;  4E74 A;  2I1J A;  3ZRC A;  3PRZ A;  3APD A;  1WGG A;  2LZ6 A;  3PV1 A;  3VDZ A;  4WWP A;  1UBQ A;  1IP9 A;  1YD8 U;  3ZDT A;  4BKS D;  2DX5 B;  2FCS A;  3DVG Y;  3OJ4 B;  1Y8R C;  2O2V A;  1KM7 A;  3EHV A;  1WH3 A;  2MQJ A;  2WX0 A;  4NY0 A;  1OGW A;  2B3A A;  2FAZ A;  3QAR A;  4HCN B;  3SHQ A;  3DQV A;  3KVF B;  4ZRJ A;  5CX3 A;  4ZDV A;  1WF9 A;  4AWJ A;  4GMV A;  2LVP A;  1V49 A;  3DBR I;  4GB9 A;  1BT0 A;  4KZ0 A;  1VCB A;  3ALB A;  1WFY A;  2O6V D;  3N30 A;  1IYF A;  3TL5 A;  2LXA A;  1AAR A;  1EF1 A;  2MA9 B;  2PEA A;  3MTN B;  3O65 B;  2KFK B;  3R66 C;  1WX8 A;  1K8R B;  3RUI B;  1WXM A;  4GIV A;  1PQS A;  2FIF A;  5DPS A;  1JRU A;  2L3Z A;  2W9N A;  3ZDM C;  2KLC A;  2OJR A;  5AEK B;  2NBW B;  2NBV B;  4A3O A;  3SU8 X;  4BOZ B;  1WGD A;  4ANX A;  3KYC D;  4IWQ A;  4GN1 A;  3JYU A;  4NNJ B;  4B95 A;  3PRM B;  3R7R A;  3MJW A;  2C60 A;  2R2O A;  4ANU A;  3W1S C;  4IWO A;  4BVU C;  2UYZ B;  3PHX B;  4TKN A;  3UQB A;  1SE9 A;  3QHT A;  3VVW B;  2BKF A;  4K81 A;  3NS8 A;  1LM8 B;  4FHK A;  2C5L C;  2MCN B;  2KDE B;  3PPA A;  1WGY A;  1OTR B;  1Q5W B;  4PS8 A;  4KIK A;  1J8C A;  4HWI B;  2J7Q B;  3L16 A;  4EUT A;  3AXC A;  4MH0 E;  3U7D A;  3P2B A;  1J19 A;  4NAW A;  3UIN B;  2L0F A;  3UIP B;  4BFR A;  4EZK A;  2KTR B;  4CHK A;  4TV3 A;  2DYB A;  3PHW B;  4A3P A;  4IW0 A;  3CST A;  4EZJ A;  3CSF A;  1HE8 A;  3A4S C;  3KYD D;  3H7S A;  5L95 C;  5AZF A;  3DBH I;  3UF8 A;  2KJ6 A;  1GC7 A;  3HHM A;  1LXD A;  3A4R A;  3JVZ X;  2WYQ A;  2WDT B;  1R4N I;  2KKC A;  4IM3 A;  5G55 A;  2ZVN A;  4F1S A;  2QHO A;  4HPM B;  2HJ8 A;  3DCG A;  1I42 A;  1UEL A;  4HJK A;  3AUL A;  4MSM B;  2M0X A;  4GSW A;  2O6V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...