2XK5B

Crystal structure of k6-linked diubiquitin
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
75
structure length
75
Chain Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPQQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUITIN
publication title Engineered Diubiquitin Synthesis Reveals K29-Isopeptide Specificity of an Otu Deubiquitinase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 18
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2010-07-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2xk5B00
4HK2A 2LGYA 2I1JA 4PS8A 4G50A 2M17A 4W9CA 1RRBA 2MCNB 1WJ4A 3ZDTA 2JZZA 2ZZPB 2LVPA 2LGDA 2KQSA 3KUZA 1YQBA 3RZWC 3TJPA 3DBHI 2BGFA 3N30A 3M62B 4DDGD 2JF5A 4EZKA 4HDOA 2LWPA 1IPGA 2ZPYA 2FCQA 2NCNA 3CSFA 2JT4B 3QQ8B 4KZCA 4MJSB 3UF8A 4BOSC 3VVWB 3IG3A 4M0WB 1J8CA 1YIWA 2JVCA 2KC2A 2ZCBA 4FLHA 4NJ6A 3MHSD 3SD5A 2M4NA 3JSVB 4WJQA 2JWZA 4LJPB 2DAFA 2XEWA 2MP2B 1GC6A 1WR6E 3RT3B 2G4SA 4X57B 4E71A 4IWOA 1WGRA 1WXSA 2IO0B 5JHBA 4MGIE 2IO2B 3ZNHB 1WRDB 3MJWA 4MSMB 3QIJA 4IM2A 3V62A 3VTUA 2IBIB 4AOFA 1VD2A 3QX1A 5CHFA 2KLGA 2L7RA 2KLCA 3M3JA 3VQIA 2ZVOA 3PRZA 3QHTA 4KIKB 3LJ3A 2FIDA 3ZIMA 1E8WA 2CHWA 2IYDB 2HD5B 4IWQA 1KLVA 1P9DU 1WF9A 3ZTCA 1TGZB 3VAWA 4EZLA 1Z5SB 4EOYA 1GC7A 1WR1A 3SDLC 4KDIC 3VH3B 3NHEB 2MBOA 3VUXA 2KVRA 4BKGA 4GN1A 2BPSA 2XK5B 3ZNZB 3ZVVA 3B08A 3KVFB 1ZGUB 2K6DB 1KJTA 1ZKHA 1WIAA 2G3QB 2RPQA 3AU5A 4FJVB 5E6PA 1IP9A 4K81A 5TR5A 3PTFC 3A1QB 3SHQA 1OEYJ 2FCMA 4K7UA 5DCNA 1XD3B 4TKNA 2KC1A 5L83A 4K7WA 2HTHA 1WM2A 1Y8RC 5JZEB 1V5TA 3WAMA 3SU8X 1E5WA 3M95A 1UH6A 2FAZA 3DBSA 3ML9A 5KHOA 5C1ZA 1WX7A 3L17A 5KHQA 3ZKJC 4MDKE 1TZ1A 2KN5A 3HM6X 1V6EA 1P3QU 2G4DB 1WYWB 3A33B 3N3KB 4HWIB 1IYFA 2C9WB 4ZRIA 1WX8A 4GGQA 2LXCA 2WYQA 4DHJD 4HLEA 4XC2A 1WMHA 2W9NA 2L05A 3QARA 2L00B 3QAQA 3JVZX 4LCDE 2NBUA 3HK0A 3HM3A 2KWVB 4W9EA 3PLUA 2K8BA 3DDCB 4KSLC 2V3SA 4LJOB 4CO7A 2AEHA 2PE6B 3RZFA 2NR2A 4DHJB 3PRMB 3ENEA 1EF5A 1LM8B 1TTNA 4LDTB 3RYTA 4GDKA 3IVFA 3U7DA 4GXBA 1P0RA 2R2OA 4RMAA 1P98A 2KDEB 3GZNI 4ANXA 3UIOB 3DCGA 2J0KA 2N4FA 4BBNC 5E6OA 1V49A 3B1LX 4FHKA 4M8NA 2KMCA 1LQBA 3TBLD 4F8CB 1E7UA 1WZ0A 4W9LA 1UGMA 3KUCB 1WGYA 3PHXB 2L3ZA 4GDLA 4WAAA 2MA9B 4KZ0A 1I42A 3PHWB 2QHOA 2D3GA 3V6CB 4JGHB 1WFYA 2LJ5A 2PPHA 2A5UA 1I35A 2KO3A 4HCPB 2DYOA 2FUHB 3L10B 2KJ6A 2KX0A 1WI0A 4FADA 2JZ3B 3UQBA 1EUVB 3RD2A 3TCAA 2O2VA 4XX5A 3PLVA 2KK8A 2JY6A 4FA6A 1ZW7A 2GOWA 2VRRB 5G55A 4GU2A 1Z2MA 5J17A 3AU4A 3L16A 2C5LC 1V80A 1GNUA 1Q0WB 3IHPC 4FHJA 1Q5WB 1E8YA 1V5OA 4XZ4A 5AEKB 1UBQA 4A3PA 1SIFA 2KFKA 2LI5A 3QA8A 3KH0A 2ZNVB 3DQVA 3BINA 3PZDA 3WAPA 4NAWB 4F1SA 3APFA 1NI2A 2KTRB 2KD0A 2LD9A 5L95C 2N7EA 4M8MA 3A9KA 4MGZE 2WX1A 2ZVNA 2L8JA 1C1YB 5CHWA 4B9KA 1UBIA 1R4NI 3A9JA 2JRHA 2DHZA 4DWFA 4JQWC 4G3XB 3R66C 3UINB 2Z0EB 3PPAA 4PYZA 2EMTA 3ZTDA 3X0WA 3PGEA 4NQLB 2O6VB 4WJNA 1V86A 3H7PB 1WE7A 4PS7A 3RUIB 4DHZE 2BYVE 3H9DA 1RLFA 2KHWB 2MSED 5AZHA 4EZJA 5J18A 2MRPA 3PSEB 3QWZB 5E6NA 1X1MA 5GMVA 2PEAA 3ZW3A 4E74A 3JYUA 4PS3A 4W9IA 4IG7B 4A20A 5AZGA 4ICUA 4P7IA 1TBEA 2GMIC 1E7VA 2FNJB 5JH5C 4WQOB 2RSUA 2N1WA 1M94A 1PQSA 2B3AA 1CMXB 2C60A 3PS6A 2BWFA 4HJKA 2N9PC 2AWTA 1YJ1A 2LXAA 2DZKA 3OJ3A 3QJZA 2JRIB 3AI5A 1JRUA 4TQ0A 4RM8A 1VCBA 4MELA 2CU1A 2YVCA 2KMAA 4FN2A 4NPNA 1GG3A 2NPTA 4WJPA 3ZRFA 2MBHA 1EF1A 3IFWB 2NBWB 4IM3A 4AP4C 3K9PB 5EDSA 4EFOA 5BO4B 3PT2B 3APDA 3VTVA 4W9GA 3ZDMC 4LDTD 2L76A 2R2QA 3TIXA 1F9JA 4KV2A 3V60A 2DYBA 3DVGY 3X23A 4B95A 2D11A 4DK5A 2RGFA 3U8ZA 3UQAA 2MBEA 5FR6A 3WANA 4J6IA 4HDQA 3ZUNA 1ISNA 3JW0X 3WA0A 4MJSA 5C23A 3Q3JA 2ZNVC 3NY5A 4AJWA 2AL3A 1XT9B 3JSVA 2KFJA 2RD0A 1WGGA 1V9JA 2ZJDA 2KDBA 3VUWA 3LDZE 2MP2A 4AUQC 2LRWA 4IC7B 1L7YA 4I6NB 4K1RB 3VHTC 2MLBA 4OVVA 3VXWA 2KOXA 3V61A 4B6WA 2GBKA 1H4RA 3OJ4B 4KIKA 4JL9A 4N9F4 2K1FA 2V4LA 3CF6E 3HHMA 3M63B 4WWPA 2CHXA 2LASA 3HIZA 2N9EB 5CX3A 2K39A 3S2AA 1E8ZA 2IZVB 3AULA 2J7QB 3CMMB 2XK5A 3QC8B 4AWJA 4BKTA 2KWUB 4W9HA 4TUUA 4GSWA 3W1SC 3A4SC 4W9DA 3H7SA 2KWCA 2CS4A 3ONSA 3A1QA 4NJ7A 3ALBA 3QK0A 2CHZA 2AYOB 2EKEC 2ZCCA 4IW0A 1G6JA 4HCNB 4WWNA 1WM3A 1WZ3A 3DBRI 3MTNB 4HPMB 4G11A 4EEWA 2YLMA 4DXAB 1SE9A 3IBEA 5D6JB 2KZRA 1MG8A 5DPTA 4ANWA 2MBQA 3WAOA 1Q1OA 2PE9A 1QZEA 2XBBC 2DX5B 4BFRA 2IO1B 1RAXA 4ICVA 3R7RA 4GIVA 2KXJA 2V1YA 5CHVC 2LUEA 3VFKA 2D10A 3OAWA 2N1VA 1FXTB 1U4AA 4K7SA 5D7GA 1GUAB 1H8CA 1RFAA 2O6VD 3TL5A 3ZO5B 1WXMA 3KUDB 1OTRB 5D2MB 3U30A 3VTWA 2KTFA 2C7MB 3L13A 2K8CA 4TQ1A 2GBJA 3O65B 1GJZA 1WMHB 5CTRC 2BKFA 1E8XA 1E90A 3DVNV 3GOEA 1WE6A 3DBLI 1P1AA 2Y5BB 2DZIA 4CHKA 5IA7A 2UYZB 5J2RA 3ZRCA 4ANVA 4BKSD 4EUTA 4FULA 1BT0A 1KM7A 4BVUC 4WJOA 5LLIA 4IWPA 4DHZB 2MBBB 4FJZA 4URKA 3EC8A 1C3TA 2GBRA 2J0MA 2ASQA 3QCAA 2M8SA 2EMSA 4GDKB 5DPWA 4JLCA 1XQQA 3CSTA 1WY8A 2UWQA 2D07B 3L54A 5IAAC 3DOWA 3UGBB 2ZEQA 4CYEA 2LVQA 1LFDA 3BY4B 2L0FA 1OEYA 4EKUA 2Z0DB 3WALA 1WGDA 2CKHB 2REXA 3H1UA 4MH0E 4MSQB 1K8RB 2Z59B 2KDIA 1S1QB 4YL8A 2BF8B 2HJ8A 3DVGX 3EHVA 4GDLB 4F7ZA 3T8MA 4W9KA 3PREA 4A3OA 2D2QA 1YX6B 4IM0A 2KX3A 2K6QA 4HPLB 2C7HA 2KNBA 2N9XA 3L0WB 3TMPB 4BOZB 2M0XA 3K9OB 4NNJB 1YD8U 4WWOA 4II3B 5DPSA 2DZJA 2O2VB 3DVNU 2GBNA 4FBJB 1YX5B 2OJRA 1J19A 3ML8A 2LVOA 4I6LB 3DPDA 2NVUI 4BBNF 4GOCA 4RM9A 3ZNGC 2WDTB 3WIMA 1WH3A 2BYFA 2MX2A 2K8HA 1V2YA 2GBMA 2WWZA 4I6PA 4MGYE 5LXIB 2J0JA 4ASWC 4ZYNA 2KDFB 4KVGB 3R3MA 2KFKB 4NAWA 3EFUA 4II2B 4E3CA 1OGWA 2KTRA 1WXAA 2MWSB 2G45B 3APCA 1WJNA 1WJ6A 2K25A 2KKCA 3VUYA 2IO3B 4NQKE 3A4RA 3C0RB 3B0AA 3NZSA 3KYDD 2DZMA 1V81A 4JIOU 4ZDVA 2KJHB 4NY0A 1WGHA 3ECIA 1S3SG 2C7NB 4DDID 2LZ6A 2MW5A 3Q3FA 4OVUA 3L08A 3A9KB 2HE7A 2OOBB 2O6VA 4MEMA 4PYUA 3RULA 4HVBA 3P2BA 4GB9A 3H7PA 2LRUA 3RCZA 1OQYA 3A9JB 5HKHA 4ANUA 3W1SA 2CR5A 1SGHA 1HE8A 3NOBA 4TV3A 3NS8A 1WXVA 3VDZA 2KANA 2L0TA 2RR9A 3ZNID 1LXDA 2DENB 2FCSA 2BKRB 1UZXB 2JXXA 1EO6A 2KJRA 4KSKC 4BKSA 3D32A 2KQ7A 3R7QA 2NS5A 2WX0A 4HXDA 5JHAA 3KYCD 2LGXA 5G2NA 1UELA 2AL6A 4AJYB 2I1KA 3VH4B 1J0GA 3I3TB 4W9JA 3N32A 4ZRJA 4ZRKA 1KOTA 2IY1B 3PVLA 2N7DA 3EECA 2JPHA 2FIFA 3PV1A 4FJYA 3T9LA 1L2NA 4IUMB 1D3ZA 3NZUA 4DBGA 2BWES 5LXHA 2BYEA 2A4ZA 3UIPB 3OLMD 5DPRA 2DYMA 1NDDA 1A5RA 4MGKE 3KW5B 1AARA 1WX9A 2NBVB 1T0YA 3PRPB 4MM3A 5AZFA 4G0NB 1NBFC 3V6EB 1WJUA 2PJHA 3W1YA 2DAJA 1UD7A 3H6NA 1R4MI 2IY0B 5D94A 2NPTB 3ZLZA 2M1MA 4KDLB 3AXCA 2JUOA 4GMVA 4W9FA 2ZPNA 2MQJA 2FCNA
chains in the Genus database with same CATH superfamily
2GRIA 2K9XA 2JZZA 2WXHA 2KQSA 3KUZA 3DBHI 2BGFA 1QOAA 5JXVA 2ZPYA 2FCQA 2QCZA 4K3CA 3NS1A 1I4XA 3MFGA 1ZUD2 3AH7A 4M0WB 1PGAA 2ZCBA 2JVCA 4FLHA 3JSVB 2D3CA 3AE1B 3B2GA 2XEWA 1GC6A 4IWOA 1WGRA 1WXSA 2IO0B 5JHBA 2IO2B 1WRDB 2PVGC 3VTUA 4AOFA 3UQAA 2KLGA 2L7RA 2KLCA 3VQIA 4AQ7A 1OQQA 2CHWA 2BS3B 2BBCA 3ABVB 1HTQA 3GE8C 3SDLC 3NHEB 4BKGA 2BPSA 2XK5B 1TT5B 3ZXRA 4A90A 1FCCC 1WIAA 4YSXB 2V3NA 1DGJA 1PGBA 5DCNA 4K7UA 4M02A 1F2RC 2G9HD 4TKNA 4YT0B 1GOZA 2HTHA 4XYCA 1K51A 1V5TA 1SJED 1UH6A 1N60A 1WX7A 5KHQA 3ZKJC 4MDKE 1C77A 2W82A 1P3QU 4ARIA 4XC2A 2W9NA 1K53A 3QARA 3DHGC 3QAQA 3JVZX 4LCDE 1XLNA 3DWMA 1L0XB 2QDFA 4LJOB 4CO7A 2OEDA 3PRMB 1EF5A 1LM8B 3U7DA 1D5XC 4USAA 1XEEA 2YEPB 4RMAA 4RNAA 5MPOA 2CJNA 1JWBD 1V49A 4FHKA 1LQBA 2IJ0A 1E7UA 2IGDA 4W9LA 2KT7A 4GDLA 4WAAA 3Q2AC 4KZ0A 4WH4A 2VH2A 1V1PA 1WFYA 2PPHA 3NRZA 1FNWA 1ZDVA 3UQBA 3C19A 2XN9C 3RNGC 2KK8A 4QAYA 2JY6A 2PKOA 4FA6A 2VRRB 3L16A 1E9MA 2ZW1A 4FHJA 5AEKB 1HTOA 4HKQA 3NJTA 5LNK1 3QA8A 1TJEA 2BYTA 1WSPA 2PIAA 3BINA 1XCTL 3ZJTA 3PZDA 4NAWB 3AE7B 1ZE3D 3DHHC 4FXCA 1JQ4A 2IGHA 1C1YB 5CHWA 1E7PB 1T0SC 4DWFA 3BYTB 4JQWC 3AN1A 2N9LA 3TUOA 3ZTDA 3X0WA 2WNMA 1V86A 3H9DA 2MSED 4ACFA 5J18A 2MRPA 3QWZB 3B2FA 1J7AA 2PEAA 4NZLB 1JRPA 2Q5WD 2GMIC 2RSUA 2N1WA 1P7EA 3HVDA 2B3AA 1B1ZA 1CMXB 1BMLC 1L0YB 2BWFA 2N9PC 1YJ1A 3RMKC 2DZKA 3Q8BA 1SF0A 2JRIB 4LNOA 4MELA 1IBXB 1DOXA 1N62A 3EGRA 1EF1A 3RNBC 1PDXA 3K9PB 3C8YA 4YWGG 3SFEB 4L1BA 1TIFA 3ZDMC 1FIQA 2L76A 3TIXA 1FMAD 4KV2A 3X23A 3LXFA 4WURA 1F2RI 3AE6B 5FR6A 4ARCA 3JW0X 1KLGD 2ZJDA 3VUWA 2LRWA 3IXSA 3HUIA 4TMAB 4OVVA 3VXWA 2N7JA 3AEFB 3MP9A 3I9V1 1H4RA 4KIKA 1UWXA 1T0RC 1PFDA 1MG4A 3IAS1 2LASA 1TZOA 2N9EB 5I4DA 1C9FA 3RNCC 2H88B 3ZGZA 3QC8B 2KYWA 4XWWA 1RFKA 3MC8A 2KWCA 3ONSA 3A1QA 3ZXVA 4DXFA 3ALBA 3QK0A 2CHZA 2AYOB 5HG2A 4WWNA 2WXPA 3W5VB 1SE9A 1C4PA 2V3PA 5DPTA 2K3UA 2DNFA 2K5PA 1ET9A 4ZOHC 2IO1B 3GZNB 4ICVA 3PO0A 3VFKA 3AM9A 2KQ4X 2LUMA 3NG0A 4K7SA 4XWTA 3TL5A 3ZO5B 1WXMA 1L4DB 3U30A 4TQ1A 3L13A 4P1BC 1WMHB 2HJ1A 1E8XA 3DVNV 1WE6A 1CQVA 2Y5BB 1OQRA 3FILA 4EUTA 4FULA 1Y56A 3DHIC 2W54A 4FJZA 2GBRA 5DPWA 1XQQA 3CSTA 1WY8A 5IAAC 5FR3A 2L0FA 5IO9A 3WALA 3UI3A 1K8RB 2BF8B 3PZ8A 3EHVA 4W9KA 3PREA 1ZXIA 1P7FA 2KX3A 3N20C 2BS2B 2M0XA 3K9OB 4WWOA 5C3JB 2GBNA 2DLBA 4BBNF 3AECB 2PVOD 1FPYA 2WDTB 4ZHPA 1WH3A 2BYFA 2K8HA 2H89B 4ZYNA 1NVID 3W9CB 2KDFB 2KFKB 4E3CA 2KTRA 2RDGA 1WJNA 3APCA 3RFZB 2K25A 4NQKE 4ZRPA 3C0RB 3B0AA 4ZDVA 4NY0A 1TKEA 4OW0A 1L6VA 4PYUA 2WXNA 2N9KA 4HVBA 2QC8A 3P2BA 3RCZA 1NENB 3A9JB 4BZAA 3P4PB 3NS8A 1TS3A 2RDHA 2FCSA 1UZXB 1EO6A 2KJRA 4BKSA 5G2NA 4YTMB 3I3TB 4ZRJA 4OZCA 3RN9C 2IY1B 3T9LA 1PGXA 1D3ZA 1NI3A 1MHXA 3AB5A 5DPRA 2LHDA 1NDDA 1VLBA 3KW5B 4MM3A 4L2YA 3V6EB 2PJHA 1XCQL 3W1YA 3P4SB 2M1MA 4KDLB 4Q2JA 1WWTA 3TEXA 4GMVA 1AYFA 1SE4A 4PS8A 2BB6A 1YQBA 2RPVA 2NCNA 3CSFA 2JT4B 3FKYA 3VVWB 3IG3A 3V05A 1YJJA 1J8CA 4US8A 4WJQA 2JWZA 4M01A 4LJPB 1QKZA 4X57B 1L6UA 1J7CA 1F77A 2WDQB 3BZDB 3CWIA 5CHFA 4JPSA 3PRZA 1E8WA 2HD5B 1IUEA 1P9DU 1WF9A 3SFDB 4LTUA 4EZLA 1GC7A 1ZPSA 1TKYA 3BK2A 4XE0A 2KVRA 1UF0A 1VZ7A 3ZNZB 3ZVVA 3B08A 1YN3A 2JWUA 1ZGUB 1ZKHA 2WXLA 2AQ3B 1E6EB 4IKGA 3SHQA 4P6VF 4RCOA 1WM2A 1MHHE 5JZEB 1FO4A 3DBSA 3BK1A 2G4DB 1WYWB 3A33B 3CIRB 2N0SB 1IYFA 2WYQA 1XXGA 4MT5A 2L05A 2RMMA 4W9EA 2KWVB 3PLUA 5EE9A 1MPEA 2V3SA 2AEHA 3RZFA 1TTNA 4LDTB 3RYTA 1WGKA 3GZNI 4M00A 1EU3A 2N4FA 4BBNC 5E6OA 3B1LX 2J42A 1YNTE 3TEYA 1Q10A 3KUCB 3PHXB 1STEA 3OWEB 2CJOA 2KO3A 2Y5PA 1WI0A 4FADA 2JZ3B 1F52A 4REZA 1EUVB 3TCAA 2O2VA 1IGDA 3EUB2 1PYWD 4GU2A 5J17A 2YEPF 3AU4A 2C5LC 3LB8C 2WQYB 1Q0WB 1V5OA 3RNEC 3NVWA 4K3BA 2WXJA 3DQVA 4OVZA 1DOIA 4HROA 2M56B 3WAPA 4KKJA 1NI2A 2LD9A 2GLSA 1AWDA 4B0MA 3A9KA 2L8JA 1LGRA 2JRHA 2DHZA 3BVGA 2UU7A 3R66C 3Q8FA 3PGEA 4NQLB 1XLQA 2O6VB 3H7PB 4O1NA 4PS7A 1R4MB 4JX1C 4DHZE 1RLFA 3PSEB 5E6NA 1X1MA 2WXGA 4E74A 3JYUA 4HEA1 2LGIA 4PS3A 5AUKA 5AZGA 4P7IA 2FNJB 1I4QA 4WQOB 3KLSX 4N58A 1PQSA 2QSDA 3AV8A 3QJZA 3AI5A 4TQ0A 2YVCA 1XO3A 2WXQA 3I57A 2NPTA 1VJKA 2BW2A 3IFWB 2DBYA 4KGTA 3T3NA 2AQ2B 2ICIA 5EDSA 1I4GA 5BO4B 3B9JA 5GXGB 3PT2B 4W9GA 4LDTD 1ESFA 2W3SA 4B95A 2D11A 3U8ZA 3AE2B 4J6IA 4HDQA 3ZUNA 3WA0A 4KX6B 4M0WA 3U4EG 1I7HA 3JSVA 2KFJA 1C78A 4C4VB 2KDBA 2Y3AA 4I6NB 4K1RB 2MLBA 1V97A 2M0AA 2KOXA 3OJ4B 2MH7A 4JL9A 3Q14C 2K1FA 2V4LA 4WWPA 4KGSA 5C2TB 3S2AA 2IZVB 3CMMB 2XK5A 2KWUB 4TUUA 3W1SC 2VZKB 4NJCA 2R61A 2OHFA 1G6JA 4S0RA 2E3TA 4G11A 3I63C 4XDDA 3IBEA 5D6JB 2INPE 1RWSA 2IPKD 2PE9A 1ROEA 1N5XA 5EE1A 4BFRA 1JROA 2JX5A 1I4RA 3R7RA 4GIVA 4OHJA 3GE3C 3AE3B 4LNFA 1FXTB 1TYGB 3MC9A 5D7GA 2O6VD 1OTRB 2ACZB 3P1MA 2K8CA 2GBJA 5CTRC 2BKFA 3GOEA 1P1AA 2LGSA 1XLOA 2DZIA 3NVZA 2UYZB 4ANVA 1BT0A 4BVUC 5LLIA 3HVZA 4L23A 4URKA 4DHZB 2MBBB 3ZJUA 2J0MA 4GDKB 1NYRA 5IN7A 3DOWA 4HPPA 2ZEQA 3R2TA 2LVQA 3ETRA 2I2YA 5BMGA 4YL8A 1JCKB 4F7ZA 3T8MA 2D2QA 3BYYB 2K6QA 2C7HA 4N59A 2MJ3A 4BOZB 2X38A 4JWSC 1YD8U 4NNJB 4II3B 1I4PA 4FBJB 3ML8A 3DPDA 2NVUI 4GOCA 3WIMA 1FRDA 4MGYE 5LXIB 2J0JA 2LMCA 1YJIA 4KVGB 3R3MA 3RNFC 4NAWA 1OGWA 1WXAA 1K52A 1WJ6A 1SE3A 2KKCA 1KFYB 3A4RA 1JMLA 3NZSA 3KYDD 5IP4D 2DZMA 1L5PA 1S3SG 2C7NB 1QILA 4RGOS 2OOBB 1D5MC 4TSSA 2LRUA 1OQYA 1M4VA 2VZKD 4ANUA 2CR5A 3U2SC 1KRHA 1SGHA 1QF6A 3NOBA 2V0GA 3RPFC 2KANA 1MFWA 2RR9A 1QOGA 3ZNID 1LXDA 2JZPA 2JXXA 3KWLA 4KSKC 4A8XC 2KQ7A 3R7QA 4MH8A 2WX0A 1SXTA 3BVMA 2OJWA 1V8CA 2AL6A 4AJYB 4W9JA 1C4CA 1KOTA 3PVLA 3EECA 2FIFA 3PV1A 1JALA 2X8XX 4FJYA 2WXFA 1IBXA 2BWES 2BYEA 5H8YE 2DYMA 3VRAB 4MGKE 1WX9A 2DAJA 1UD7A 1R4MI 2IY0B 5D94A 3VRBB 2JUOA 1DYQA 4RH6A 4W9FA 5G55A 2BQQA 4HK2A 1FM0D 2I1JA 2M17A 1VRAB 5HHDG 2MCNB 1WJ4A 3N1ZC 3ZDTA 2ZZPB 2LVPA 3RI7C 1BUIC 3TJPA 2INDC 4EZKA 4HDOA 1IPGA 4KZCA 4MJSB 4BOSC 2SEBD 3MHSD 3SD5A 2M4NA 1UUPA 5BMHA 2MP2B 1WR6E 4E71A 1QLBB 5HFYA 3MJWA 4MSMB 4IM2A 3U7ZA 3V62A 3WCQA 2ZVOA 3QHTA 2FIDA 3ZIMA 2W55A 2IYDB 1KLVA 2J52A 3VAWA 1Z5SB 4KDIC 2MBOA 4RGNA 4GN1A 5BYQA 3AE9B 5T8IA 3KVFB 1KJTA 2RPQA 2VH1A 4K81A 4JE3B 3N1XC 1EU4A 3MJ5A 1D6EC 5TSSA 2KC1A 4K7WA 1YQ3B 1R7SA 3R8BA 3WAMA 1KTKA 1E5WA 3M95A 3MHZA 1FXAA 5KHOA 2KVZA 3IT4B 1TZ1A 2KN5A 2GB1A 4HWIB 2C9WB 4GGQA 4DHJD 1WMHA 3Q8CA 2TSSA 2NBUA 3HM3A 3DDCB 1NEKB 2PLPA 4KSLC 4MACA 1FNUA 1PUTA 1P0RA 1JW9D 2JYTA 4YXDB 2KDEB 1F0ZA 3SR6A 3UIOB 3DCGA 4PT5A 4DXGA 2J0KA 2FE8A 1TS2A 2BS4B 2KMCA 1WZ0A 2LJIA 1UGMA 2L3ZA 1I42A 2QHOA 3Q6BA 2D3GA 2BT6A 3V6CB 2LJ5A 1FFUA 1ZOYB 5H92C 2DYOA 3L10B 2KJ6A 5G5HA 4ZRQA 4ZYSA 4IOIE 1Z2MA 3GB1A 4LNKA 3V3XA 3IHPC 1Q5WB 4XZ4A 1UBQA 4A3PA 2KFKA 2LI5A 3EA6A 2ZNVB 1JWUD 3GS2A 4JWUC 3AEDB 4HJGE 2LEKA 4A6QA 2HDEA 4C80A 5L95C 2N7EA 5IOIA 1JWMD 2Z8LA 4MGZE 2ZVNA 3AEAB 1FFVA 1GPXA 3A9JA 3UINB 2Z0EB 3PPAA 4PYZA 1HZ6A 4WJNA 1SE2A 1WE7A 3H8HA 5AZHA 4EZJA 3T3OA 4W9IA 4IG7B 4GLSC 1E7VA 5JH5C 2NMQA 3W5UB 1T3QA 2AWTA 2LXAA 3OJ3A 1JRUA 1YQ4B 2QIEB 4NPNA 1C4AA 4WJPA 3AEGB 4EE2A 4LK0M 3ZRFA 2MBHA 4IM3A 1T0QC 3AE5B 4AP4C 2WXIA 4EFOA 3VTVA 3APDA 2EKIA 1F9JA 3V60A 2KWDA 2DYBA 1NYQA 2RGFA 2WXMA 1ISNA 5C23A 2KACA 2ZNVC 4KGRA 2AL3A 1XT9B 3LDZE 4AUQC 1L7YA 4UDUC 3V61A 4B6WA 5HI1A 2GBKA 4DQOC 1YN4A 3CF6E 3HHMA 4B0EA 2CHXA 3HIZA 3Q69A 3NVVA 5CX3A 2K39A 5D3IB 2L32A 1E8ZA 3NUHB 3P4RB 2ZW0A 4AWJA 1RYJA 2D3BA 1SJHD 2SAKA 4GSWA 5EE0A 3A4SC 4W9DA 2CS4A 4NJ7A 1FEHA 5BYSA 2WXOA 2ZCCA 1FCLA 3NVYA 1ZDXA 4IW0A 5FKAC 1WM3A 4ZHOA 3MTNB 1V1OA 4EEWA 1MG8A 4ANWA 3WAOA 1Q1OA 1XLPA 1QZEA 2XBBC 1D5ZC 2WS3B 1RAXA 5CHVC 2LUEA 5G5GA 2N1VA 1U4AA 4ITKA 1GUAB 1RFAA 4OZAA 4S17A 2CU3A 2BB5A 3DWGC 1E90A 4CHKA 5IA7A 1EM7A 4WJOA 3OG5A 3QCAA 2M8SA 4JLCA 2QEJC 3L54A 3UGBB 1HZ5A 2D07B 3BY4B 4EKUA 1ET6A 4MH0E 2WXKA 1GB4A 2Z59B 1S1QB 1JWSD 4CQNA 2HJ8A 4GDLB 2JYEA 4A3OA 4IM0A 4XGAB 1V1PB 4HPLB 2KNBA 1TS5A 3AEEB 2N9XA 3L0WB 3TMPB 2FBWB 2L52A 5DPSA 2WP9B 4WIPA 1R4NB 2AX5A 1J19A 2OJRA 1WXQA 4I6LB 3FAHA 2MX2A 4NAMA 1V2YA 2GBMA 4XDCA 1ZP0B 1UNSA 2WU5B 2MWSB 2G45B 1AW7A 3VUYA 2IO3B 1C76A 4JIOU 2KJHB 3P42A 1J7BA 1WGHA 3ECIA 1BXTA 1ZXHA 2MW5A 2AQ1B 3Q3FA 4YTPB 1N63A 2HE7A 3RULA 2O6VA 3VR9B 3H7PA 3W1SA 2G1EA 4TV3A 2DWQA 2DENB 2LHEA 1N5WA 3J9CA 2PW9A 2NS5A 5JHAA 3KYCD 2LGXA 1MJDA 1YOVB 1J0GA 3NZ3A 2NTSA 1WYGA 4ZRKA 1D4BA 2N7DA 1UGJA 1VZ8A 1L2NA 4IUMB 3NZUA 4DBGA 5LXHA 3UIPB 1A5RA 1AARA 2NBVB 1T0YA 3PRPB 2PMVA 4G0NB 1NBFC 3FC4A 3H6NA 4IDIA 1SIJA 3U52E 3AXCA 2MHJA 2LFIA 2ZPNA 2LGYA 1F1HA 4W9CA 4G50A 1RRBA 4A9AA 3RZWC 2LGDA 3Q3NC 3N30A 3M62B 4DDGD 4C4VA 2JF5A 1QT9A 2LWPA 3HRDD 3QQ8B 2ONQA 1CZPA 3UF8A 1YIWA 2KC2A 4NJ6A 2KN4A 2L1AA 2DAFA 3DBRB 3RT3B 2G4SA 4MGIE 3ZNHB 2ON8A 5IKCM 3BVZA 3W2DA 3QIJA 2IBIB 2QMTA 1VD2A 3QX1A 4D2KA 3M3JA 2JXTA 4KIKB 2QJLA 3LJ3A 4IWQA 4WAFA 3KWVA 2PTLA 3E9SA 3ZTCA 1QOBA 4RF0A 1TGZB 4EOYA 1WR1A 1HXYD 3VH3B 1T5XD 3VUXA 1TY0A 2GI9A 4C56C 2K6DB 2V9HA 2G3QB 3AU5A 5E6PA 4FJVB 1IP9A 1DOYA 5TR5A 3PTFC 3A1QB 1MVKA 3L4PA 1OEYJ 2FCMA 3DBLB 1XD3B 5L83A 4R3DA 1Y8RC 3SU8X 2FAZA 3ML9A 5C1ZA 3L17A 1YMHE 4HKZE 3HM6X 2L83A 1V6EA 3N3KB 1QOFA 4ZRIA 1WX8A 4HLEA 2KMMA 2LXCA 4C00A 4BAXA 2L00B 1B9RA 3SEBA 3HK0A 2INCC 2K8BA 1XF5L 2PE6B 2NR2A 4DHJB 5E6JA 3ENEA 4GDKA 3IVFA 3Q3OC 2IDYA 1EWYC 4GXBA 2R2OA 1P98A 3FILB 4ANXA 2WDVB 4M8NA 3AE8B 3RNAC 3TBLD 4F8CB 1L0VB 1WGYA 3LYYA 2MA9B 3PHWB 4JGHB 2A5UA 1I35A 4HCPB 2FUHB 2KX0A 3Q8EA 1N61A 2WLBA 3RD2A 1VR9A 4HRSA 4XX5A 3PLVA 1ZW7A 2GOWA 5D3DA 4P16A 3KQ4A 1L4ZB 3TEWA 3IAM1 1V80A 1GNUA 4AS1A 1E8YA 4A55A 1JWAD 1SIFA 3KH0A 2I38A 4H2AA 1LO5D 4F1SA 3APFA 2KTRB 2KD0A 4RFBA 4LNNA 4M8MA 1GB1A 2NTTA 2WX1A 4B9KA 2JU6X 3MC0B 1UBIA 1R4NI 2V4IB 4G3XB 3ZYYX 4PK1A 3R2IA 2XNAC 2EMTA 3IT6B 1K50A 3RUIB 2BYVE 4P1CC 2KHWB 1RM6C 1UWMA 5GMVA 3ZW3A 4A20A 4ICUA 1TBEA 1GAQB 3AMZA 1M94A 2C60A 1QQRA 3PS6A 3EFCA 4HJKA 3DBHB 4RM8A 1VCBA 2Y5CA 2CU1A 2KMAA 4FN2A 1GG3A 1TKGA 1HA5A 2E6XA 1YN5A 1ACCA 2NBWB 1EWCA 1CJEA 4MM3B 2WHIA 5EE3A 2K0PA 2R2QA 3TSSA 3DVGY 4DK5A 2MBEA 3WANA 4OZBA 2WDRB 5BMIA 4MJSA 3I5JC 2B76B 3Q3JA 3NY5A 4AJWA 2RD0A 2KDMA 1WGGA 1V9JA 2MP2A 4IC7B 3URYA 3VHTC 4YTNB 3VR8B 2QILA 4N9F4 4YSZB 2IGGA 3M63B 1KLUD 1C79A 3TEZA 2HTME 3AULA 2J7QB 4BKTA 2W3RA 4W9HA 2MJDA 3H7SA 5BYRA 1CK1A 3Q8AA 2EKEC 4RF1A 3GP7A 4HCNB 4RGTA 1WZ3A 3DBRI 1FD6A 4HPMB 2YLMA 4DXAB 1SB3C 2KZRA 1T6BX 2MBQA 3E56A 3PZ7A 1N6ZA 2JSVX 1E10A 2DX5B 2KXJA 2V1YA 2D10A 3OAWA 2BTEA 2D3AA 1SBBB 1I4HA 1TY2A 1H8CA 3KUDB 5D2MB 2J4XA 3VTWA 2KTFA 2C7MB 1GJZA 3O65B 3DBLI 4YSYB 2WU2B 2FUG1 2JQRB 2WGSA 5J2RA 3ZRCA 4BKSD 1KM7A 4WWMA 3N9YC 1SEBD 4IWPA 3EC8A 1C3TA 2ASQA 2EMSA 2UWQA 4CYEA 3ZQ4A 1LFDA 2RDBC 1OEYA 2Z0DB 1IGCA 1WGDA 2CKHB 2REXA 3H1UA 4MSQB 2D5GA 2KDIA 1FXIA 3DVGX 2EELA 2M19A 4C7YA 1YX6B 1SSNA 4C7ZA 1AN8A 3O13A 2DZJA 2O2VB 3DVNU 1YX5B 3AE4B 2LVOA 4WQMA 4RM9A 3ZNGC 1VZ6A 1ENFA 2WWZA 5FK9C 4LLGM 4I6PA 4ASWC 2INNE 2KAJA 3EFUA 4J3OD 4II2B 2BVCA 1FRRA 4N6EB 4KKIA 1V81A 4US9A 3BIID 3AEBB 4DDID 2LZ6A 1TS4A 4OVUA 3L08A 3ZJVA 3A9KB 1MI0A 4MEMA 4GB9A 2WXRA 1E0ZA 2J53A 5HKHA 1HE8A 1OFFA 4RGMA 1WXVA 3VDZA 1VDVA 3P4QB 2L0TA 5AUIA 2MEKA 1FNVA 2BKRB 3P63A 3D32A 1HQRD 2MJEA 4HXDA 3N1YC 1A70A 1UELA 2I1KA 3VH4B 2K22A 3BWUD 3N32A 2JPHA 1HEZE 2A4ZA 3OLMD 3Q3MC 4LNIA 5AZFA 1KF6B 1WJUA 1WRIA 1KH0A 2NPTB 3ZLZA 2MQJA 2FCNA
chains in the Genus database with same CATH topology
4HK2A 2LGYA 2I1JA 4PS8A 4G50A 2M17A 4W9CA 1RRBA 2MCNB 1WJ4A 3ZDTA 2JZZA 2ZZPB 2LVPA 2LGDA 2KQSA 3KUZA 1YQBA 3RZWC 3TJPA 3DBHI 2BGFA 3N30A 3M62B 4DDGD 2JF5A 4EZKA 4HDOA 2LWPA 1IPGA 2ZPYA 2FCQA 2NCNA 3CSFA 2JT4B 3QQ8B 4KZCA 4MJSB 3UF8A 4BOSC 3VVWB 3IG3A 4M0WB 1J8CA 1YIWA 2JVCA 2KC2A 2ZCBA 4FLHA 4NJ6A 3MHSD 3SD5A 2M4NA 3JSVB 4WJQA 2JWZA 4LJPB 2DAFA 2XEWA 2MP2B 1GC6A 1WR6E 3RT3B 2G4SA 4X57B 4E71A 4IWOA 1WGRA 1WXSA 2IO0B 5JHBA 4MGIE 2IO2B 3ZNHB 1WRDB 3MJWA 4MSMB 3QIJA 4IM2A 3V62A 3VTUA 2IBIB 4AOFA 1VD2A 3QX1A 5CHFA 2KLGA 2L7RA 2KLCA 3M3JA 3VQIA 2ZVOA 3PRZA 3QHTA 4KIKB 3LJ3A 2FIDA 3ZIMA 1E8WA 2CHWA 2IYDB 2HD5B 4IWQA 1KLVA 1P9DU 1WF9A 3ZTCA 1TGZB 3VAWA 4EZLA 1Z5SB 4EOYA 1GC7A 1WR1A 3SDLC 4KDIC 3VH3B 3NHEB 2MBOA 3VUXA 2KVRA 4BKGA 4GN1A 2BPSA 2XK5B 3ZNZB 3ZVVA 3B08A 3KVFB 1ZGUB 2K6DB 1KJTA 1ZKHA 1WIAA 2G3QB 2RPQA 3AU5A 4FJVB 5E6PA 1IP9A 4K81A 5TR5A 3PTFC 3A1QB 3SHQA 1OEYJ 2FCMA 4K7UA 5DCNA 1XD3B 4TKNA 2KC1A 5L83A 4K7WA 2HTHA 1WM2A 1Y8RC 5JZEB 1V5TA 3WAMA 3SU8X 1E5WA 3M95A 1UH6A 2FAZA 3DBSA 3ML9A 5KHOA 5C1ZA 1WX7A 3L17A 5KHQA 3ZKJC 4MDKE 1TZ1A 2KN5A 3HM6X 1V6EA 1P3QU 2G4DB 1WYWB 3A33B 3N3KB 4HWIB 1IYFA 2C9WB 4ZRIA 1WX8A 4GGQA 2LXCA 2WYQA 4DHJD 4HLEA 4XC2A 1WMHA 2W9NA 2L05A 3QARA 2L00B 3QAQA 3JVZX 4LCDE 2NBUA 3HK0A 3HM3A 2KWVB 4W9EA 3PLUA 2K8BA 3DDCB 4KSLC 2V3SA 4LJOB 4CO7A 2AEHA 2PE6B 3RZFA 2NR2A 4DHJB 3PRMB 3ENEA 1EF5A 1LM8B 1TTNA 4LDTB 3RYTA 4GDKA 3IVFA 3U7DA 4GXBA 1P0RA 2R2OA 4RMAA 1P98A 2KDEB 3GZNI 4ANXA 3UIOB 3DCGA 2J0KA 2N4FA 4BBNC 5E6OA 1V49A 3B1LX 4FHKA 4M8NA 2KMCA 1LQBA 3TBLD 4F8CB 1E7UA 1WZ0A 4W9LA 1UGMA 3KUCB 1WGYA 3PHXB 2L3ZA 4GDLA 4WAAA 2MA9B 4KZ0A 1I42A 3PHWB 2QHOA 2D3GA 3V6CB 4JGHB 1WFYA 2LJ5A 2PPHA 2A5UA 1I35A 2KO3A 4HCPB 2DYOA 2FUHB 3L10B 2KJ6A 2KX0A 1WI0A 4FADA 2JZ3B 3UQBA 1EUVB 3RD2A 3TCAA 2O2VA 4XX5A 3PLVA 2KK8A 2JY6A 4FA6A 1ZW7A 2GOWA 2VRRB 5G55A 4GU2A 1Z2MA 5J17A 3AU4A 3L16A 2C5LC 1V80A 1GNUA 1Q0WB 3IHPC 4FHJA 1Q5WB 1E8YA 1V5OA 4XZ4A 5AEKB 1UBQA 4A3PA 1SIFA 2KFKA 2LI5A 3QA8A 3KH0A 2ZNVB 3DQVA 3BINA 3PZDA 3WAPA 4NAWB 4F1SA 3APFA 1NI2A 2KTRB 2KD0A 2LD9A 5L95C 2N7EA 4M8MA 3A9KA 4MGZE 2WX1A 2ZVNA 2L8JA 1C1YB 5CHWA 4B9KA 1UBIA 1R4NI 3A9JA 2JRHA 2DHZA 4DWFA 4JQWC 4G3XB 3R66C 3UINB 2Z0EB 3PPAA 4PYZA 2EMTA 3ZTDA 3X0WA 3PGEA 4NQLB 2O6VB 4WJNA 1V86A 3H7PB 1WE7A 4PS7A 3RUIB 4DHZE 2BYVE 3H9DA 1RLFA 2KHWB 2MSED 5AZHA 4EZJA 5J18A 2MRPA 3PSEB 3QWZB 5E6NA 1X1MA 5GMVA 2PEAA 3ZW3A 4E74A 3JYUA 4PS3A 4W9IA 4IG7B 4A20A 5AZGA 4ICUA 4P7IA 1TBEA 2GMIC 1E7VA 2FNJB 5JH5C 4WQOB 2RSUA 2N1WA 1M94A 1PQSA 2B3AA 1CMXB 2C60A 3PS6A 2BWFA 4HJKA 2N9PC 2AWTA 1YJ1A 2LXAA 2DZKA 3OJ3A 3QJZA 2JRIB 3AI5A 1JRUA 4TQ0A 4RM8A 1VCBA 4MELA 2CU1A 2YVCA 2KMAA 4FN2A 4NPNA 1GG3A 2NPTA 4WJPA 3ZRFA 2MBHA 1EF1A 3IFWB 2NBWB 4IM3A 4AP4C 3K9PB 5EDSA 4EFOA 5BO4B 3PT2B 3APDA 3VTVA 4W9GA 3ZDMC 4LDTD 2L76A 2R2QA 3TIXA 1F9JA 4KV2A 3V60A 2DYBA 3DVGY 3X23A 4B95A 2D11A 4DK5A 2RGFA 3U8ZA 3UQAA 2MBEA 5FR6A 3WANA 4J6IA 4HDQA 3ZUNA 1ISNA 3JW0X 3WA0A 4MJSA 5C23A 3Q3JA 2ZNVC 3NY5A 4AJWA 2AL3A 1XT9B 3JSVA 2KFJA 2RD0A 1WGGA 1V9JA 2ZJDA 2KDBA 3VUWA 3LDZE 2MP2A 4AUQC 2LRWA 4IC7B 1L7YA 4I6NB 4K1RB 3VHTC 2MLBA 4OVVA 3VXWA 2KOXA 3V61A 4B6WA 2GBKA 1H4RA 3OJ4B 4KIKA 4JL9A 4N9F4 2K1FA 2V4LA 3CF6E 3HHMA 3M63B 4WWPA 2CHXA 2LASA 3HIZA 2N9EB 5CX3A 2K39A 3S2AA 1E8ZA 2IZVB 3AULA 2J7QB 3CMMB 2XK5A 3QC8B 4AWJA 4BKTA 2KWUB 4W9HA 4TUUA 4GSWA 3W1SC 3A4SC 4W9DA 3H7SA 2KWCA 2CS4A 3ONSA 3A1QA 4NJ7A 3ALBA 3QK0A 2CHZA 2AYOB 2EKEC 2ZCCA 4IW0A 1G6JA 4HCNB 4WWNA 1WM3A 1WZ3A 3DBRI 3MTNB 4HPMB 4G11A 4EEWA 2YLMA 4DXAB 1SE9A 3IBEA 5D6JB 2KZRA 1MG8A 5DPTA 4ANWA 2MBQA 3WAOA 1Q1OA 2PE9A 1QZEA 2XBBC 2DX5B 4BFRA 2IO1B 1RAXA 4ICVA 3R7RA 4GIVA 2KXJA 2V1YA 5CHVC 2LUEA 3VFKA 2D10A 3OAWA 2N1VA 1FXTB 1U4AA 4K7SA 5D7GA 1GUAB 1H8CA 1RFAA 2O6VD 3TL5A 3ZO5B 1WXMA 3KUDB 1OTRB 5D2MB 3U30A 3VTWA 2KTFA 2C7MB 3L13A 2K8CA 4TQ1A 2GBJA 3O65B 1GJZA 1WMHB 5CTRC 2BKFA 1E8XA 1E90A 3DVNV 3GOEA 1WE6A 3DBLI 1P1AA 2Y5BB 2DZIA 4CHKA 5IA7A 2UYZB 5J2RA 3ZRCA 4ANVA 4BKSD 4EUTA 4FULA 1BT0A 1KM7A 4BVUC 4WJOA 5LLIA 4IWPA 4DHZB 2MBBB 4FJZA 4URKA 3EC8A 1C3TA 2GBRA 2J0MA 2ASQA 3QCAA 2M8SA 2EMSA 4GDKB 5DPWA 4JLCA 1XQQA 3CSTA 1WY8A 2UWQA 2D07B 3L54A 5IAAC 3DOWA 3UGBB 2ZEQA 4CYEA 2LVQA 1LFDA 3BY4B 2L0FA 1OEYA 4EKUA 2Z0DB 3WALA 1WGDA 2CKHB 2REXA 3H1UA 4MH0E 4MSQB 1K8RB 2Z59B 2KDIA 1S1QB 4YL8A 2BF8B 2HJ8A 3DVGX 3EHVA 4GDLB 4F7ZA 3T8MA 4W9KA 3PREA 4A3OA 2D2QA 1YX6B 4IM0A 2KX3A 2K6QA 4HPLB 2C7HA 2KNBA 2N9XA 3L0WB 3TMPB 4BOZB 2M0XA 3K9OB 4NNJB 1YD8U 4WWOA 4II3B 5DPSA 2DZJA 2O2VB 3DVNU 2GBNA 4FBJB 1YX5B 2OJRA 1J19A 3ML8A 2LVOA 4I6LB 3DPDA 2NVUI 4BBNF 4GOCA 4RM9A 3ZNGC 2WDTB 3WIMA 1WH3A 2BYFA 2MX2A 2K8HA 1V2YA 2GBMA 2WWZA 4I6PA 4MGYE 5LXIB 2J0JA 4ASWC 4ZYNA 2KDFB 4KVGB 3R3MA 2KFKB 4NAWA 3EFUA 4II2B 4E3CA 1OGWA 2KTRA 1WXAA 2MWSB 2G45B 3APCA 1WJNA 1WJ6A 2K25A 2KKCA 3VUYA 2IO3B 4NQKE 3A4RA 3C0RB 3B0AA 3NZSA 3KYDD 2DZMA 1V81A 4JIOU 4ZDVA 2KJHB 4NY0A 1WGHA 3ECIA 1S3SG 2C7NB 4DDID 2LZ6A 2MW5A 3Q3FA 4OVUA 3L08A 3A9KB 2HE7A 2OOBB 2O6VA 4MEMA 4PYUA 3RULA 4HVBA 3P2BA 4GB9A 3H7PA 2LRUA 3RCZA 1OQYA 3A9JB 5HKHA 4ANUA 3W1SA 2CR5A 1SGHA 1HE8A 3NOBA 4TV3A 3NS8A 1WXVA 3VDZA 2KANA 2L0TA 2RR9A 3ZNID 1LXDA 2DENB 2FCSA 2BKRB 1UZXB 2JXXA 1EO6A 2KJRA 4KSKC 4BKSA 3D32A 2KQ7A 3R7QA 2NS5A 2WX0A 4HXDA 5JHAA 3KYCD 2LGXA 5G2NA 1UELA 2AL6A 4AJYB 2I1KA 3VH4B 1J0GA 3I3TB 4W9JA 3N32A 4ZRJA 4ZRKA 1KOTA 2IY1B 3PVLA 2N7DA 3EECA 2JPHA 2FIFA 3PV1A 4FJYA 3T9LA 1L2NA 4IUMB 1D3ZA 3NZUA 4DBGA 2BWES 5LXHA 2BYEA 2A4ZA 3UIPB 3OLMD 5DPRA 2DYMA 1NDDA 1A5RA 4MGKE 3KW5B 1AARA 1WX9A 2NBVB 1T0YA 3PRPB 4MM3A 5AZFA 4G0NB 1NBFC 3V6EB 1WJUA 2PJHA 3W1YA 2DAJA 1UD7A 3H6NA 1R4MI 2IY0B 5D94A 2NPTB 3ZLZA 2M1MA 4KDLB 3AXCA 2JUOA 4GMVA 4W9FA 2ZPNA 2MQJA 2FCNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HK2 A;  2LGY A;  2I1J A;  4PS8 A;  4G50 A;  2M17 A;  4W9C A;  1RRB A;  2MCN B;  1WJ4 A;  3ZDT A;  2JZZ A;  2ZZP B;  2LVP A;  2LGD A;  2KQS A;  3KUZ A;  1YQB A;  3RZW C;  3TJP A;  3DBH I;  2BGF A;  3N30 A;  3M62 B;  4DDG D;  2JF5 A;  4EZK A;  4HDO A;  2LWP A;  1IPG A;  2ZPY A;  2FCQ A;  2NCN A;  3CSF A;  2JT4 B;  3QQ8 B;  4KZC A;  4MJS B;  3UF8 A;  4BOS C;  3VVW B;  3IG3 A;  4M0W B;  1J8C A;  1YIW A;  2JVC A;  2KC2 A;  2ZCB A;  4FLH A;  4NJ6 A;  3MHS D;  3SD5 A;  2M4N A;  3JSV B;  4WJQ A;  2JWZ A;  4LJP B;  2DAF A;  2XEW A;  2MP2 B;  1GC6 A;  1WR6 E;  3RT3 B;  2G4S A;  4X57 B;  4E71 A;  4IWO A;  1WGR A;  1WXS A;  2IO0 B;  5JHB A;  4MGI E;  2IO2 B;  3ZNH B;  1WRD B;  3MJW A;  4MSM B;  3QIJ A;  4IM2 A;  3V62 A;  3VTU A;  2IBI B;  4AOF A;  1VD2 A;  3QX1 A;  5CHF A;  2KLG A;  2L7R A;  2KLC A;  3M3J A;  3VQI A;  2ZVO A;  3PRZ A;  3QHT A;  4KIK B;  3LJ3 A;  2FID A;  3ZIM A;  1E8W A;  2CHW A;  2IYD B;  2HD5 B;  4IWQ A;  1KLV A;  1P9D U;  1WF9 A;  3ZTC A;  1TGZ B;  3VAW A;  4EZL A;  1Z5S B;  4EOY A;  1GC7 A;  1WR1 A;  3SDL C;  4KDI C;  3VH3 B;  3NHE B;  2MBO A;  3VUX A;  2KVR A;  4BKG A;  4GN1 A;  2BPS A;  2XK5 B;  3ZNZ B;  3ZVV A;  3B08 A;  3KVF B;  1ZGU B;  2K6D B;  1KJT A;  1ZKH A;  1WIA A;  2G3Q B;  2RPQ A;  3AU5 A;  4FJV B;  5E6P A;  1IP9 A;  4K81 A;  5TR5 A;  3PTF C;  3A1Q B;  3SHQ A;  1OEY J;  2FCM A;  4K7U A;  5DCN A;  1XD3 B;  4TKN A;  2KC1 A;  5L83 A;  4K7W A;  2HTH A;  1WM2 A;  1Y8R C;  5JZE B;  1V5T A;  3WAM A;  3SU8 X;  1E5W A;  3M95 A;  1UH6 A;  2FAZ A;  3DBS A;  3ML9 A;  5KHO A;  5C1Z A;  1WX7 A;  3L17 A;  5KHQ A;  3ZKJ C;  4MDK E;  1TZ1 A;  2KN5 A;  3HM6 X;  1V6E A;  1P3Q U;  2G4D B;  1WYW B;  3A33 B;  3N3K B;  4HWI B;  1IYF A;  2C9W B;  4ZRI A;  1WX8 A;  4GGQ A;  2LXC A;  2WYQ A;  4DHJ D;  4HLE A;  4XC2 A;  1WMH A;  2W9N A;  2L05 A;  3QAR A;  2L00 B;  3QAQ A;  3JVZ X;  4LCD E;  2NBU A;  3HK0 A;  3HM3 A;  2KWV B;  4W9E A;  3PLU A;  2K8B A;  3DDC B;  4KSL C;  2V3S A;  4LJO B;  4CO7 A;  2AEH A;  2PE6 B;  3RZF A;  2NR2 A;  4DHJ B;  3PRM B;  3ENE A;  1EF5 A;  1LM8 B;  1TTN A;  4LDT B;  3RYT A;  4GDK A;  3IVF A;  3U7D A;  4GXB A;  1P0R A;  2R2O A;  4RMA A;  1P98 A;  2KDE B;  3GZN I;  4ANX A;  3UIO B;  3DCG A;  2J0K A;  2N4F A;  4BBN C;  5E6O A;  1V49 A;  3B1L X;  4FHK A;  4M8N A;  2KMC A;  1LQB A;  3TBL D;  4F8C B;  1E7U A;  1WZ0 A;  4W9L A;  1UGM A;  3KUC B;  1WGY A;  3PHX B;  2L3Z A;  4GDL A;  4WAA A;  2MA9 B;  4KZ0 A;  1I42 A;  3PHW B;  2QHO A;  2D3G A;  3V6C B;  4JGH B;  1WFY A;  2LJ5 A;  2PPH A;  2A5U A;  1I35 A;  2KO3 A;  4HCP B;  2DYO A;  2FUH B;  3L10 B;  2KJ6 A;  2KX0 A;  1WI0 A;  4FAD A;  2JZ3 B;  3UQB A;  1EUV B;  3RD2 A;  3TCA A;  2O2V A;  4XX5 A;  3PLV A;  2KK8 A;  2JY6 A;  4FA6 A;  1ZW7 A;  2GOW A;  2VRR B;  5G55 A;  4GU2 A;  1Z2M A;  5J17 A;  3AU4 A;  3L16 A;  2C5L C;  1V80 A;  1GNU A;  1Q0W B;  3IHP C;  4FHJ A;  1Q5W B;  1E8Y A;  1V5O A;  4XZ4 A;  5AEK B;  1UBQ A;  4A3P A;  1SIF A;  2KFK A;  2LI5 A;  3QA8 A;  3KH0 A;  2ZNV B;  3DQV A;  3BIN A;  3PZD A;  3WAP A;  4NAW B;  4F1S A;  3APF A;  1NI2 A;  2KTR B;  2KD0 A;  2LD9 A;  5L95 C;  2N7E A;  4M8M A;  3A9K A;  4MGZ E;  2WX1 A;  2ZVN A;  2L8J A;  1C1Y B;  5CHW A;  4B9K A;  1UBI A;  1R4N I;  3A9J A;  2JRH A;  2DHZ A;  4DWF A;  4JQW C;  4G3X B;  3R66 C;  3UIN B;  2Z0E B;  3PPA A;  4PYZ A;  2EMT A;  3ZTD A;  3X0W A;  3PGE A;  4NQL B;  2O6V B;  4WJN A;  1V86 A;  3H7P B;  1WE7 A;  4PS7 A;  3RUI B;  4DHZ E;  2BYV E;  3H9D A;  1RLF A;  2KHW B;  2MSE D;  5AZH A;  4EZJ A;  5J18 A;  2MRP A;  3PSE B;  3QWZ B;  5E6N A;  1X1M A;  5GMV A;  2PEA A;  3ZW3 A;  4E74 A;  3JYU A;  4PS3 A;  4W9I A;  4IG7 B;  4A20 A;  5AZG A;  4ICU A;  4P7I A;  1TBE A;  2GMI C;  1E7V A;  2FNJ B;  5JH5 C;  4WQO B;  2RSU A;  2N1W A;  1M94 A;  1PQS A;  2B3A A;  1CMX B;  2C60 A;  3PS6 A;  2BWF A;  4HJK A;  2N9P C;  2AWT A;  1YJ1 A;  2LXA A;  2DZK A;  3OJ3 A;  3QJZ A;  2JRI B;  3AI5 A;  1JRU A;  4TQ0 A;  4RM8 A;  1VCB A;  4MEL A;  2CU1 A;  2YVC A;  2KMA A;  4FN2 A;  4NPN A;  1GG3 A;  2NPT A;  4WJP A;  3ZRF A;  2MBH A;  1EF1 A;  3IFW B;  2NBW B;  4IM3 A;  4AP4 C;  3K9P B;  5EDS A;  4EFO A;  5BO4 B;  3PT2 B;  3APD A;  3VTV A;  4W9G A;  3ZDM C;  4LDT D;  2L76 A;  2R2Q A;  3TIX A;  1F9J A;  4KV2 A;  3V60 A;  2DYB A;  3DVG Y;  3X23 A;  4B95 A;  2D11 A;  4DK5 A;  2RGF A;  3U8Z A;  3UQA A;  2MBE A;  5FR6 A;  3WAN A;  4J6I A;  4HDQ A;  3ZUN A;  1ISN A;  3JW0 X;  3WA0 A;  4MJS A;  5C23 A;  3Q3J A;  2ZNV C;  3NY5 A;  4AJW A;  2AL3 A;  1XT9 B;  3JSV A;  2KFJ A;  2RD0 A;  1WGG A;  1V9J A;  2ZJD A;  2KDB A;  3VUW A;  3LDZ E;  2MP2 A;  4AUQ C;  2LRW A;  4IC7 B;  1L7Y A;  4I6N B;  4K1R B;  3VHT C;  2MLB A;  4OVV A;  3VXW A;  2KOX A;  3V61 A;  4B6W A;  2GBK A;  1H4R A;  3OJ4 B;  4KIK A;  4JL9 A;  4N9F 4;  2K1F A;  2V4L A;  3CF6 E;  3HHM A;  3M63 B;  4WWP A;  2CHX A;  2LAS A;  3HIZ A;  2N9E B;  5CX3 A;  2K39 A;  3S2A A;  1E8Z A;  2IZV B;  3AUL A;  2J7Q B;  3CMM B;  2XK5 A;  3QC8 B;  4AWJ A;  4BKT A;  2KWU B;  4W9H A;  4TUU A;  4GSW A;  3W1S C;  3A4S C;  4W9D A;  3H7S A;  2KWC A;  2CS4 A;  3ONS A;  3A1Q A;  4NJ7 A;  3ALB A;  3QK0 A;  2CHZ A;  2AYO B;  2EKE C;  2ZCC A;  4IW0 A;  1G6J A;  4HCN B;  4WWN A;  1WM3 A;  1WZ3 A;  3DBR I;  3MTN B;  4HPM B;  4G11 A;  4EEW A;  2YLM A;  4DXA B;  1SE9 A;  3IBE A;  5D6J B;  2KZR A;  1MG8 A;  5DPT A;  4ANW A;  2MBQ A;  3WAO A;  1Q1O A;  2PE9 A;  1QZE A;  2XBB C;  2DX5 B;  4BFR A;  2IO1 B;  1RAX A;  4ICV A;  3R7R A;  4GIV A;  2KXJ A;  2V1Y A;  5CHV C;  2LUE A;  3VFK A;  2D10 A;  3OAW A;  2N1V A;  1FXT B;  1U4A A;  4K7S A;  5D7G A;  1GUA B;  1H8C A;  1RFA A;  2O6V D;  3TL5 A;  3ZO5 B;  1WXM A;  3KUD B;  1OTR B;  5D2M B;  3U30 A;  3VTW A;  2KTF A;  2C7M B;  3L13 A;  2K8C A;  4TQ1 A;  2GBJ A;  3O65 B;  1GJZ A;  1WMH B;  5CTR C;  2BKF A;  1E8X A;  1E90 A;  3DVN V;  3GOE A;  1WE6 A;  3DBL I;  1P1A A;  2Y5B B;  2DZI A;  4CHK A;  5IA7 A;  2UYZ B;  5J2R A;  3ZRC A;  4ANV A;  4BKS D;  4EUT A;  4FUL A;  1BT0 A;  1KM7 A;  4BVU C;  4WJO A;  5LLI A;  4IWP A;  4DHZ B;  2MBB B;  4FJZ A;  4URK A;  3EC8 A;  1C3T A;  2GBR A;  2J0M A;  2ASQ A;  3QCA A;  2M8S A;  2EMS A;  4GDK B;  5DPW A;  4JLC A;  1XQQ A;  3CST A;  1WY8 A;  2UWQ A;  2D07 B;  3L54 A;  5IAA C;  3DOW A;  3UGB B;  2ZEQ A;  4CYE A;  2LVQ A;  1LFD A;  3BY4 B;  2L0F A;  1OEY A;  4EKU A;  2Z0D B;  3WAL A;  1WGD A;  2CKH B;  2REX A;  3H1U A;  4MH0 E;  4MSQ B;  1K8R B;  2Z59 B;  2KDI A;  1S1Q B;  4YL8 A;  2BF8 B;  2HJ8 A;  3DVG X;  3EHV A;  4GDL B;  4F7Z A;  3T8M A;  4W9K A;  3PRE A;  4A3O A;  2D2Q A;  1YX6 B;  4IM0 A;  2KX3 A;  2K6Q A;  4HPL B;  2C7H A;  2KNB A;  2N9X A;  3L0W B;  3TMP B;  4BOZ B;  2M0X A;  3K9O B;  4NNJ B;  1YD8 U;  4WWO A;  4II3 B;  5DPS A;  2DZJ A;  2O2V B;  3DVN U;  2GBN A;  4FBJ B;  1YX5 B;  2OJR A;  1J19 A;  3ML8 A;  2LVO A;  4I6L B;  3DPD A;  2NVU I;  4BBN F;  4GOC A;  4RM9 A;  3ZNG C;  2WDT B;  3WIM A;  1WH3 A;  2BYF A;  2MX2 A;  2K8H A;  1V2Y A;  2GBM A;  2WWZ A;  4I6P A;  4MGY E;  5LXI B;  2J0J A;  4ASW C;  4ZYN A;  2KDF B;  4KVG B;  3R3M A;  2KFK B;  4NAW A;  3EFU A;  4II2 B;  4E3C A;  1OGW A;  2KTR A;  1WXA A;  2MWS B;  2G45 B;  3APC A;  1WJN A;  1WJ6 A;  2K25 A;  2KKC A;  3VUY A;  2IO3 B;  4NQK E;  3A4R A;  3C0R B;  3B0A A;  3NZS A;  3KYD D;  2DZM A;  1V81 A;  4JIO U;  4ZDV A;  2KJH B;  4NY0 A;  1WGH A;  3ECI A;  1S3S G;  2C7N B;  4DDI D;  2LZ6 A;  2MW5 A;  3Q3F A;  4OVU A;  3L08 A;  3A9K B;  2HE7 A;  2OOB B;  2O6V A;  4MEM A;  4PYU A;  3RUL A;  4HVB A;  3P2B A;  4GB9 A;  3H7P A;  2LRU A;  3RCZ A;  1OQY A;  3A9J B;  5HKH A;  4ANU A;  3W1S A;  2CR5 A;  1SGH A;  1HE8 A;  3NOB A;  4TV3 A;  3NS8 A;  1WXV A;  3VDZ A;  2KAN A;  2L0T A;  2RR9 A;  3ZNI D;  1LXD A;  2DEN B;  2FCS A;  2BKR B;  1UZX B;  2JXX A;  1EO6 A;  2KJR A;  4KSK C;  4BKS A;  3D32 A;  2KQ7 A;  3R7Q A;  2NS5 A;  2WX0 A;  4HXD A;  5JHA A;  3KYC D;  2LGX A;  5G2N A;  1UEL A;  2AL6 A;  4AJY B;  2I1K A;  3VH4 B;  1J0G A;  3I3T B;  4W9J A;  3N32 A;  4ZRJ A;  4ZRK A;  1KOT A;  2IY1 B;  3PVL A;  2N7D A;  3EEC A;  2JPH A;  2FIF A;  3PV1 A;  4FJY A;  3T9L A;  1L2N A;  4IUM B;  1D3Z A;  3NZU A;  4DBG A;  2BWE S;  5LXH A;  2BYE A;  2A4Z A;  3UIP B;  3OLM D;  5DPR A;  2DYM A;  1NDD A;  1A5R A;  4MGK E;  3KW5 B;  1AAR A;  1WX9 A;  2NBV B;  1T0Y A;  3PRP B;  4MM3 A;  5AZF A;  4G0N B;  1NBF C;  3V6E B;  1WJU A;  2PJH A;  3W1Y A;  2DAJ A;  1UD7 A;  3H6N A;  1R4M I;  2IY0 B;  5D94 A;  2NPT B;  3ZLZ A;  2M1M A;  4KDL B;  3AXC A;  2JUO A;  4GMV A;  4W9F A;  2ZPN A;  2MQJ A;  2FCN A; 
#chains in the Genus database with same CATH topology
 2GRI A;  2K9X A;  2JZZ A;  2WXH A;  2KQS A;  3KUZ A;  3DBH I;  2BGF A;  1QOA A;  5JXV A;  2ZPY A;  2FCQ A;  2QCZ A;  4K3C A;  3NS1 A;  1I4X A;  3MFG A;  1ZUD 2;  3AH7 A;  4M0W B;  1PGA A;  2ZCB A;  2JVC A;  4FLH A;  3JSV B;  2D3C A;  3AE1 B;  3B2G A;  2XEW A;  1GC6 A;  4IWO A;  1WGR A;  1WXS A;  2IO0 B;  5JHB A;  2IO2 B;  1WRD B;  2PVG C;  3VTU A;  4AOF A;  3UQA A;  2KLG A;  2L7R A;  2KLC A;  3VQI A;  4AQ7 A;  1OQQ A;  2CHW A;  2BS3 B;  2BBC A;  3ABV B;  1HTQ A;  3GE8 C;  3SDL C;  3NHE B;  4BKG A;  2BPS A;  2XK5 B;  1TT5 B;  3ZXR A;  4A90 A;  1FCC C;  1WIA A;  4YSX B;  2V3N A;  1DGJ A;  1PGB A;  5DCN A;  4K7U A;  4M02 A;  1F2R C;  2G9H D;  4TKN A;  4YT0 B;  1GOZ A;  2HTH A;  4XYC A;  1K51 A;  1V5T A;  1SJE D;  1UH6 A;  1N60 A;  1WX7 A;  5KHQ A;  3ZKJ C;  4MDK E;  1C77 A;  2W82 A;  1P3Q U;  4ARI A;  4XC2 A;  2W9N A;  1K53 A;  3QAR A;  3DHG C;  3QAQ A;  3JVZ X;  4LCD E;  1XLN A;  3DWM A;  1L0X B;  2QDF A;  4LJO B;  4CO7 A;  2OED A;  3PRM B;  1EF5 A;  1LM8 B;  3U7D A;  1D5X C;  4USA A;  1XEE A;  2YEP B;  4RMA A;  4RNA A;  5MPO A;  2CJN A;  1JWB D;  1V49 A;  4FHK A;  1LQB A;  2IJ0 A;  1E7U A;  2IGD A;  4W9L A;  2KT7 A;  4GDL A;  4WAA A;  3Q2A C;  4KZ0 A;  4WH4 A;  2VH2 A;  1V1P A;  1WFY A;  2PPH A;  3NRZ A;  1FNW A;  1ZDV A;  3UQB A;  3C19 A;  2XN9 C;  3RNG C;  2KK8 A;  4QAY A;  2JY6 A;  2PKO A;  4FA6 A;  2VRR B;  3L16 A;  1E9M A;  2ZW1 A;  4FHJ A;  5AEK B;  1HTO A;  4HKQ A;  3NJT A;  5LNK 1;  3QA8 A;  1TJE A;  2BYT A;  1WSP A;  2PIA A;  3BIN A;  1XCT L;  3ZJT A;  3PZD A;  4NAW B;  3AE7 B;  1ZE3 D;  3DHH C;  4FXC A;  1JQ4 A;  2IGH A;  1C1Y B;  5CHW A;  1E7P B;  1T0S C;  4DWF A;  3BYT B;  4JQW C;  3AN1 A;  2N9L A;  3TUO A;  3ZTD A;  3X0W A;  2WNM A;  1V86 A;  3H9D A;  2MSE D;  4ACF A;  5J18 A;  2MRP A;  3QWZ B;  3B2F A;  1J7A A;  2PEA A;  4NZL B;  1JRP A;  2Q5W D;  2GMI C;  2RSU A;  2N1W A;  1P7E A;  3HVD A;  2B3A A;  1B1Z A;  1CMX B;  1BML C;  1L0Y B;  2BWF A;  2N9P C;  1YJ1 A;  3RMK C;  2DZK A;  3Q8B A;  1SF0 A;  2JRI B;  4LNO A;  4MEL A;  1IBX B;  1DOX A;  1N62 A;  3EGR A;  1EF1 A;  3RNB C;  1PDX A;  3K9P B;  3C8Y A;  4YWG G;  3SFE B;  4L1B A;  1TIF A;  3ZDM C;  1FIQ A;  2L76 A;  3TIX A;  1FMA D;  4KV2 A;  3X23 A;  3LXF A;  4WUR A;  1F2R I;  3AE6 B;  5FR6 A;  4ARC A;  3JW0 X;  1KLG D;  2ZJD A;  3VUW A;  2LRW A;  3IXS A;  3HUI A;  4TMA B;  4OVV A;  3VXW A;  2N7J A;  3AEF B;  3MP9 A;  3I9V 1;  1H4R A;  4KIK A;  1UWX A;  1T0R C;  1PFD A;  1MG4 A;  3IAS 1;  2LAS A;  1TZO A;  2N9E B;  5I4D A;  1C9F A;  3RNC C;  2H88 B;  3ZGZ A;  3QC8 B;  2KYW A;  4XWW A;  1RFK A;  3MC8 A;  2KWC A;  3ONS A;  3A1Q A;  3ZXV A;  4DXF A;  3ALB A;  3QK0 A;  2CHZ A;  2AYO B;  5HG2 A;  4WWN A;  2WXP A;  3W5V B;  1SE9 A;  1C4P A;  2V3P A;  5DPT A;  2K3U A;  2DNF A;  2K5P A;  1ET9 A;  4ZOH C;  2IO1 B;  3GZN B;  4ICV A;  3PO0 A;  3VFK A;  3AM9 A;  2KQ4 X;  2LUM A;  3NG0 A;  4K7S A;  4XWT A;  3TL5 A;  3ZO5 B;  1WXM A;  1L4D B;  3U30 A;  4TQ1 A;  3L13 A;  4P1B C;  1WMH B;  2HJ1 A;  1E8X A;  3DVN V;  1WE6 A;  1CQV A;  2Y5B B;  1OQR A;  3FIL A;  4EUT A;  4FUL A;  1Y56 A;  3DHI C;  2W54 A;  4FJZ A;  2GBR A;  5DPW A;  1XQQ A;  3CST A;  1WY8 A;  5IAA C;  5FR3 A;  2L0F A;  5IO9 A;  3WAL A;  3UI3 A;  1K8R B;  2BF8 B;  3PZ8 A;  3EHV A;  4W9K A;  3PRE A;  1ZXI A;  1P7F A;  2KX3 A;  3N20 C;  2BS2 B;  2M0X A;  3K9O B;  4WWO A;  5C3J B;  2GBN A;  2DLB A;  4BBN F;  3AEC B;  2PVO D;  1FPY A;  2WDT B;  4ZHP A;  1WH3 A;  2BYF A;  2K8H A;  2H89 B;  4ZYN A;  1NVI D;  3W9C B;  2KDF B;  2KFK B;  4E3C A;  2KTR A;  2RDG A;  1WJN A;  3APC A;  3RFZ B;  2K25 A;  4NQK E;  4ZRP A;  3C0R B;  3B0A A;  4ZDV A;  4NY0 A;  1TKE A;  4OW0 A;  1L6V A;  4PYU A;  2WXN A;  2N9K A;  4HVB A;  2QC8 A;  3P2B A;  3RCZ A;  1NEN B;  3A9J B;  4BZA A;  3P4P B;  3NS8 A;  1TS3 A;  2RDH A;  2FCS A;  1UZX B;  1EO6 A;  2KJR A;  4BKS A;  5G2N A;  4YTM B;  3I3T B;  4ZRJ A;  4OZC A;  3RN9 C;  2IY1 B;  3T9L A;  1PGX A;  1D3Z A;  1NI3 A;  1MHX A;  3AB5 A;  5DPR A;  2LHD A;  1NDD A;  1VLB A;  3KW5 B;  4MM3 A;  4L2Y A;  3V6E B;  2PJH A;  1XCQ L;  3W1Y A;  3P4S B;  2M1M A;  4KDL B;  4Q2J A;  1WWT A;  3TEX A;  4GMV A;  1AYF A;  1SE4 A;  4PS8 A;  2BB6 A;  1YQB A;  2RPV A;  2NCN A;  3CSF A;  2JT4 B;  3FKY A;  3VVW B;  3IG3 A;  3V05 A;  1YJJ A;  1J8C A;  4US8 A;  4WJQ A;  2JWZ A;  4M01 A;  4LJP B;  1QKZ A;  4X57 B;  1L6U A;  1J7C A;  1F77 A;  2WDQ B;  3BZD B;  3CWI A;  5CHF A;  4JPS A;  3PRZ A;  1E8W A;  2HD5 B;  1IUE A;  1P9D U;  1WF9 A;  3SFD B;  4LTU A;  4EZL A;  1GC7 A;  1ZPS A;  1TKY A;  3BK2 A;  4XE0 A;  2KVR A;  1UF0 A;  1VZ7 A;  3ZNZ B;  3ZVV A;  3B08 A;  1YN3 A;  2JWU A;  1ZGU B;  1ZKH A;  2WXL A;  2AQ3 B;  1E6E B;  4IKG A;  3SHQ A;  4P6V F;  4RCO A;  1WM2 A;  1MHH E;  5JZE B;  1FO4 A;  3DBS A;  3BK1 A;  2G4D B;  1WYW B;  3A33 B;  3CIR B;  2N0S B;  1IYF A;  2WYQ A;  1XXG A;  4MT5 A;  2L05 A;  2RMM A;  4W9E A;  2KWV B;  3PLU A;  5EE9 A;  1MPE A;  2V3S A;  2AEH A;  3RZF A;  1TTN A;  4LDT B;  3RYT A;  1WGK A;  3GZN I;  4M00 A;  1EU3 A;  2N4F A;  4BBN C;  5E6O A;  3B1L X;  2J42 A;  1YNT E;  3TEY A;  1Q10 A;  3KUC B;  3PHX B;  1STE A;  3OWE B;  2CJO A;  2KO3 A;  2Y5P A;  1WI0 A;  4FAD A;  2JZ3 B;  1F52 A;  4REZ A;  1EUV B;  3TCA A;  2O2V A;  1IGD A;  3EUB 2;  1PYW D;  4GU2 A;  5J17 A;  2YEP F;  3AU4 A;  2C5L C;  3LB8 C;  2WQY B;  1Q0W B;  1V5O A;  3RNE C;  3NVW A;  4K3B A;  2WXJ A;  3DQV A;  4OVZ A;  1DOI A;  4HRO A;  2M56 B;  3WAP A;  4KKJ A;  1NI2 A;  2LD9 A;  2GLS A;  1AWD A;  4B0M A;  3A9K A;  2L8J A;  1LGR A;  2JRH A;  2DHZ A;  3BVG A;  2UU7 A;  3R66 C;  3Q8F A;  3PGE A;  4NQL B;  1XLQ A;  2O6V B;  3H7P B;  4O1N A;  4PS7 A;  1R4M B;  4JX1 C;  4DHZ E;  1RLF A;  3PSE B;  5E6N A;  1X1M A;  2WXG A;  4E74 A;  3JYU A;  4HEA 1;  2LGI A;  4PS3 A;  5AUK A;  5AZG A;  4P7I A;  2FNJ B;  1I4Q A;  4WQO B;  3KLS X;  4N58 A;  1PQS A;  2QSD A;  3AV8 A;  3QJZ A;  3AI5 A;  4TQ0 A;  2YVC A;  1XO3 A;  2WXQ A;  3I57 A;  2NPT A;  1VJK A;  2BW2 A;  3IFW B;  2DBY A;  4KGT A;  3T3N A;  2AQ2 B;  2ICI A;  5EDS A;  1I4G A;  5BO4 B;  3B9J A;  5GXG B;  3PT2 B;  4W9G A;  4LDT D;  1ESF A;  2W3S A;  4B95 A;  2D11 A;  3U8Z A;  3AE2 B;  4J6I A;  4HDQ A;  3ZUN A;  3WA0 A;  4KX6 B;  4M0W A;  3U4E G;  1I7H A;  3JSV A;  2KFJ A;  1C78 A;  4C4V B;  2KDB A;  2Y3A A;  4I6N B;  4K1R B;  2MLB A;  1V97 A;  2M0A A;  2KOX A;  3OJ4 B;  2MH7 A;  4JL9 A;  3Q14 C;  2K1F A;  2V4L A;  4WWP A;  4KGS A;  5C2T B;  3S2A A;  2IZV B;  3CMM B;  2XK5 A;  2KWU B;  4TUU A;  3W1S C;  2VZK B;  4NJC A;  2R61 A;  2OHF A;  1G6J A;  4S0R A;  2E3T A;  4G11 A;  3I63 C;  4XDD A;  3IBE A;  5D6J B;  2INP E;  1RWS A;  2IPK D;  2PE9 A;  1ROE A;  1N5X A;  5EE1 A;  4BFR A;  1JRO A;  2JX5 A;  1I4R A;  3R7R A;  4GIV A;  4OHJ A;  3GE3 C;  3AE3 B;  4LNF A;  1FXT B;  1TYG B;  3MC9 A;  5D7G A;  2O6V D;  1OTR B;  2ACZ B;  3P1M A;  2K8C A;  2GBJ A;  5CTR C;  2BKF A;  3GOE A;  1P1A A;  2LGS A;  1XLO A;  2DZI A;  3NVZ A;  2UYZ B;  4ANV A;  1BT0 A;  4BVU C;  5LLI A;  3HVZ A;  4L23 A;  4URK A;  4DHZ B;  2MBB B;  3ZJU A;  2J0M A;  4GDK B;  1NYR A;  5IN7 A;  3DOW A;  4HPP A;  2ZEQ A;  3R2T A;  2LVQ A;  3ETR A;  2I2Y A;  5BMG A;  4YL8 A;  1JCK B;  4F7Z A;  3T8M A;  2D2Q A;  3BYY B;  2K6Q A;  2C7H A;  4N59 A;  2MJ3 A;  4BOZ B;  2X38 A;  4JWS C;  1YD8 U;  4NNJ B;  4II3 B;  1I4P A;  4FBJ B;  3ML8 A;  3DPD A;  2NVU I;  4GOC A;  3WIM A;  1FRD A;  4MGY E;  5LXI B;  2J0J A;  2LMC A;  1YJI A;  4KVG B;  3R3M A;  3RNF C;  4NAW A;  1OGW A;  1WXA A;  1K52 A;  1WJ6 A;  1SE3 A;  2KKC A;  1KFY B;  3A4R A;  1JML A;  3NZS A;  3KYD D;  5IP4 D;  2DZM A;  1L5P A;  1S3S G;  2C7N B;  1QIL A;  4RGO S;  2OOB B;  1D5M C;  4TSS A;  2LRU A;  1OQY A;  1M4V A;  2VZK D;  4ANU A;  2CR5 A;  3U2S C;  1KRH A;  1SGH A;  1QF6 A;  3NOB A;  2V0G A;  3RPF C;  2KAN A;  1MFW A;  2RR9 A;  1QOG A;  3ZNI D;  1LXD A;  2JZP A;  2JXX A;  3KWL A;  4KSK C;  4A8X C;  2KQ7 A;  3R7Q A;  4MH8 A;  2WX0 A;  1SXT A;  3BVM A;  2OJW A;  1V8C A;  2AL6 A;  4AJY B;  4W9J A;  1C4C A;  1KOT A;  3PVL A;  3EEC A;  2FIF A;  3PV1 A;  1JAL A;  2X8X X;  4FJY A;  2WXF A;  1IBX A;  2BWE S;  2BYE A;  5H8Y E;  2DYM A;  3VRA B;  4MGK E;  1WX9 A;  2DAJ A;  1UD7 A;  1R4M I;  2IY0 B;  5D94 A;  3VRB B;  2JUO A;  1DYQ A;  4RH6 A;  4W9F A;  5G55 A;  2BQQ A;  4HK2 A;  1FM0 D;  2I1J A;  2M17 A;  1VRA B;  5HHD G;  2MCN B;  1WJ4 A;  3N1Z C;  3ZDT A;  2ZZP B;  2LVP A;  3RI7 C;  1BUI C;  3TJP A;  2IND C;  4EZK A;  4HDO A;  1IPG A;  4KZC A;  4MJS B;  4BOS C;  2SEB D;  3MHS D;  3SD5 A;  2M4N A;  1UUP A;  5BMH A;  2MP2 B;  1WR6 E;  4E71 A;  1QLB B;  5HFY A;  3MJW A;  4MSM B;  4IM2 A;  3U7Z A;  3V62 A;  3WCQ A;  2ZVO A;  3QHT A;  2FID A;  3ZIM A;  2W55 A;  2IYD B;  1KLV A;  2J52 A;  3VAW A;  1Z5S B;  4KDI C;  2MBO A;  4RGN A;  4GN1 A;  5BYQ A;  3AE9 B;  5T8I A;  3KVF B;  1KJT A;  2RPQ A;  2VH1 A;  4K81 A;  4JE3 B;  3N1X C;  1EU4 A;  3MJ5 A;  1D6E C;  5TSS A;  2KC1 A;  4K7W A;  1YQ3 B;  1R7S A;  3R8B A;  3WAM A;  1KTK A;  1E5W A;  3M95 A;  3MHZ A;  1FXA A;  5KHO A;  2KVZ A;  3IT4 B;  1TZ1 A;  2KN5 A;  2GB1 A;  4HWI B;  2C9W B;  4GGQ A;  4DHJ D;  1WMH A;  3Q8C A;  2TSS A;  2NBU A;  3HM3 A;  3DDC B;  1NEK B;  2PLP A;  4KSL C;  4MAC A;  1FNU A;  1PUT A;  1P0R A;  1JW9 D;  2JYT A;  4YXD B;  2KDE B;  1F0Z A;  3SR6 A;  3UIO B;  3DCG A;  4PT5 A;  4DXG A;  2J0K A;  2FE8 A;  1TS2 A;  2BS4 B;  2KMC A;  1WZ0 A;  2LJI A;  1UGM A;  2L3Z A;  1I42 A;  2QHO A;  3Q6B A;  2D3G A;  2BT6 A;  3V6C B;  2LJ5 A;  1FFU A;  1ZOY B;  5H92 C;  2DYO A;  3L10 B;  2KJ6 A;  5G5H A;  4ZRQ A;  4ZYS A;  4IOI E;  1Z2M A;  3GB1 A;  4LNK A;  3V3X A;  3IHP C;  1Q5W B;  4XZ4 A;  1UBQ A;  4A3P A;  2KFK A;  2LI5 A;  3EA6 A;  2ZNV B;  1JWU D;  3GS2 A;  4JWU C;  3AED B;  4HJG E;  2LEK A;  4A6Q A;  2HDE A;  4C80 A;  5L95 C;  2N7E A;  5IOI A;  1JWM D;  2Z8L A;  4MGZ E;  2ZVN A;  3AEA B;  1FFV A;  1GPX A;  3A9J A;  3UIN B;  2Z0E B;  3PPA A;  4PYZ A;  1HZ6 A;  4WJN A;  1SE2 A;  1WE7 A;  3H8H A;  5AZH A;  4EZJ A;  3T3O A;  4W9I A;  4IG7 B;  4GLS C;  1E7V A;  5JH5 C;  2NMQ A;  3W5U B;  1T3Q A;  2AWT A;  2LXA A;  3OJ3 A;  1JRU A;  1YQ4 B;  2QIE B;  4NPN A;  1C4A A;  4WJP A;  3AEG B;  4EE2 A;  4LK0 M;  3ZRF A;  2MBH A;  4IM3 A;  1T0Q C;  3AE5 B;  4AP4 C;  2WXI A;  4EFO A;  3VTV A;  3APD A;  2EKI A;  1F9J A;  3V60 A;  2KWD A;  2DYB A;  1NYQ A;  2RGF A;  2WXM A;  1ISN A;  5C23 A;  2KAC A;  2ZNV C;  4KGR A;  2AL3 A;  1XT9 B;  3LDZ E;  4AUQ C;  1L7Y A;  4UDU C;  3V61 A;  4B6W A;  5HI1 A;  2GBK A;  4DQO C;  1YN4 A;  3CF6 E;  3HHM A;  4B0E A;  2CHX A;  3HIZ A;  3Q69 A;  3NVV A;  5CX3 A;  2K39 A;  5D3I B;  2L32 A;  1E8Z A;  3NUH B;  3P4R B;  2ZW0 A;  4AWJ A;  1RYJ A;  2D3B A;  1SJH D;  2SAK A;  4GSW A;  5EE0 A;  3A4S C;  4W9D A;  2CS4 A;  4NJ7 A;  1FEH A;  5BYS A;  2WXO A;  2ZCC A;  1FCL A;  3NVY A;  1ZDX A;  4IW0 A;  5FKA C;  1WM3 A;  4ZHO A;  3MTN B;  1V1O A;  4EEW A;  1MG8 A;  4ANW A;  3WAO A;  1Q1O A;  1XLP A;  1QZE A;  2XBB C;  1D5Z C;  2WS3 B;  1RAX A;  5CHV C;  2LUE A;  5G5G A;  2N1V A;  1U4A A;  4ITK A;  1GUA B;  1RFA A;  4OZA A;  4S17 A;  2CU3 A;  2BB5 A;  3DWG C;  1E90 A;  4CHK A;  5IA7 A;  1EM7 A;  4WJO A;  3OG5 A;  3QCA A;  2M8S A;  4JLC A;  2QEJ C;  3L54 A;  3UGB B;  1HZ5 A;  2D07 B;  3BY4 B;  4EKU A;  1ET6 A;  4MH0 E;  2WXK A;  1GB4 A;  2Z59 B;  1S1Q B;  1JWS D;  4CQN A;  2HJ8 A;  4GDL B;  2JYE A;  4A3O A;  4IM0 A;  4XGA B;  1V1P B;  4HPL B;  2KNB A;  1TS5 A;  3AEE B;  2N9X A;  3L0W B;  3TMP B;  2FBW B;  2L52 A;  5DPS A;  2WP9 B;  4WIP A;  1R4N B;  2AX5 A;  1J19 A;  2OJR A;  1WXQ A;  4I6L B;  3FAH A;  2MX2 A;  4NAM A;  1V2Y A;  2GBM A;  4XDC A;  1ZP0 B;  1UNS A;  2WU5 B;  2MWS B;  2G45 B;  1AW7 A;  3VUY A;  2IO3 B;  1C76 A;  4JIO U;  2KJH B;  3P42 A;  1J7B A;  1WGH A;  3ECI A;  1BXT A;  1ZXH A;  2MW5 A;  2AQ1 B;  3Q3F A;  4YTP B;  1N63 A;  2HE7 A;  3RUL A;  2O6V A;  3VR9 B;  3H7P A;  3W1S A;  2G1E A;  4TV3 A;  2DWQ A;  2DEN B;  2LHE A;  1N5W A;  3J9C A;  2PW9 A;  2NS5 A;  5JHA A;  3KYC D;  2LGX A;  1MJD A;  1YOV B;  1J0G A;  3NZ3 A;  2NTS A;  1WYG A;  4ZRK A;  1D4B A;  2N7D A;  1UGJ A;  1VZ8 A;  1L2N A;  4IUM B;  3NZU A;  4DBG A;  5LXH A;  3UIP B;  1A5R A;  1AAR A;  2NBV B;  1T0Y A;  3PRP B;  2PMV A;  4G0N B;  1NBF C;  3FC4 A;  3H6N A;  4IDI A;  1SIJ A;  3U52 E;  3AXC A;  2MHJ A;  2LFI A;  2ZPN A;  2LGY A;  1F1H A;  4W9C A;  4G50 A;  1RRB A;  4A9A A;  3RZW C;  2LGD A;  3Q3N C;  3N30 A;  3M62 B;  4DDG D;  4C4V A;  2JF5 A;  1QT9 A;  2LWP A;  3HRD D;  3QQ8 B;  2ONQ A;  1CZP A;  3UF8 A;  1YIW A;  2KC2 A;  4NJ6 A;  2KN4 A;  2L1A A;  2DAF A;  3DBR B;  3RT3 B;  2G4S A;  4MGI E;  3ZNH B;  2ON8 A;  5IKC M;  3BVZ A;  3W2D A;  3QIJ A;  2IBI B;  2QMT A;  1VD2 A;  3QX1 A;  4D2K A;  3M3J A;  2JXT A;  4KIK B;  2QJL A;  3LJ3 A;  4IWQ A;  4WAF A;  3KWV A;  2PTL A;  3E9S A;  3ZTC A;  1QOB A;  4RF0 A;  1TGZ B;  4EOY A;  1WR1 A;  1HXY D;  3VH3 B;  1T5X D;  3VUX A;  1TY0 A;  2GI9 A;  4C56 C;  2K6D B;  2V9H A;  2G3Q B;  3AU5 A;  5E6P A;  4FJV B;  1IP9 A;  1DOY A;  5TR5 A;  3PTF C;  3A1Q B;  1MVK A;  3L4P A;  1OEY J;  2FCM A;  3DBL B;  1XD3 B;  5L83 A;  4R3D A;  1Y8R C;  3SU8 X;  2FAZ A;  3ML9 A;  5C1Z A;  3L17 A;  1YMH E;  4HKZ E;  3HM6 X;  2L83 A;  1V6E A;  3N3K B;  1QOF A;  4ZRI A;  1WX8 A;  4HLE A;  2KMM A;  2LXC A;  4C00 A;  4BAX A;  2L00 B;  1B9R A;  3SEB A;  3HK0 A;  2INC C;  2K8B A;  1XF5 L;  2PE6 B;  2NR2 A;  4DHJ B;  5E6J A;  3ENE A;  4GDK A;  3IVF A;  3Q3O C;  2IDY A;  1EWY C;  4GXB A;  2R2O A;  1P98 A;  3FIL B;  4ANX A;  2WDV B;  4M8N A;  3AE8 B;  3RNA C;  3TBL D;  4F8C B;  1L0V B;  1WGY A;  3LYY A;  2MA9 B;  3PHW B;  4JGH B;  2A5U A;  1I35 A;  4HCP B;  2FUH B;  2KX0 A;  3Q8E A;  1N61 A;  2WLB A;  3RD2 A;  1VR9 A;  4HRS A;  4XX5 A;  3PLV A;  1ZW7 A;  2GOW A;  5D3D A;  4P16 A;  3KQ4 A;  1L4Z B;  3TEW A;  3IAM 1;  1V80 A;  1GNU A;  4AS1 A;  1E8Y A;  4A55 A;  1JWA D;  1SIF A;  3KH0 A;  2I38 A;  4H2A A;  1LO5 D;  4F1S A;  3APF A;  2KTR B;  2KD0 A;  4RFB A;  4LNN A;  4M8M A;  1GB1 A;  2NTT A;  2WX1 A;  4B9K A;  2JU6 X;  3MC0 B;  1UBI A;  1R4N I;  2V4I B;  4G3X B;  3ZYY X;  4PK1 A;  3R2I A;  2XNA C;  2EMT A;  3IT6 B;  1K50 A;  3RUI B;  2BYV E;  4P1C C;  2KHW B;  1RM6 C;  1UWM A;  5GMV A;  3ZW3 A;  4A20 A;  4ICU A;  1TBE A;  1GAQ B;  3AMZ A;  1M94 A;  2C60 A;  1QQR A;  3PS6 A;  3EFC A;  4HJK A;  3DBH B;  4RM8 A;  1VCB A;  2Y5C A;  2CU1 A;  2KMA A;  4FN2 A;  1GG3 A;  1TKG A;  1HA5 A;  2E6X A;  1YN5 A;  1ACC A;  2NBW B;  1EWC A;  1CJE A;  4MM3 B;  2WHI A;  5EE3 A;  2K0P A;  2R2Q A;  3TSS A;  3DVG Y;  4DK5 A;  2MBE A;  3WAN A;  4OZB A;  2WDR B;  5BMI A;  4MJS A;  3I5J C;  2B76 B;  3Q3J A;  3NY5 A;  4AJW A;  2RD0 A;  2KDM A;  1WGG A;  1V9J A;  2MP2 A;  4IC7 B;  3URY A;  3VHT C;  4YTN B;  3VR8 B;  2QIL A;  4N9F 4;  4YSZ B;  2IGG A;  3M63 B;  1KLU D;  1C79 A;  3TEZ A;  2HTM E;  3AUL A;  2J7Q B;  4BKT A;  2W3R A;  4W9H A;  2MJD A;  3H7S A;  5BYR A;  1CK1 A;  3Q8A A;  2EKE C;  4RF1 A;  3GP7 A;  4HCN B;  4RGT A;  1WZ3 A;  3DBR I;  1FD6 A;  4HPM B;  2YLM A;  4DXA B;  1SB3 C;  2KZR A;  1T6B X;  2MBQ A;  3E56 A;  3PZ7 A;  1N6Z A;  2JSV X;  1E10 A;  2DX5 B;  2KXJ A;  2V1Y A;  2D10 A;  3OAW A;  2BTE A;  2D3A A;  1SBB B;  1I4H A;  1TY2 A;  1H8C A;  3KUD B;  5D2M B;  2J4X A;  3VTW A;  2KTF A;  2C7M B;  1GJZ A;  3O65 B;  3DBL I;  4YSY B;  2WU2 B;  2FUG 1;  2JQR B;  2WGS A;  5J2R A;  3ZRC A;  4BKS D;  1KM7 A;  4WWM A;  3N9Y C;  1SEB D;  4IWP A;  3EC8 A;  1C3T A;  2ASQ A;  2EMS A;  2UWQ A;  4CYE A;  3ZQ4 A;  1LFD A;  2RDB C;  1OEY A;  2Z0D B;  1IGC A;  1WGD A;  2CKH B;  2REX A;  3H1U A;  4MSQ B;  2D5G A;  2KDI A;  1FXI A;  3DVG X;  2EEL A;  2M19 A;  4C7Y A;  1YX6 B;  1SSN A;  4C7Z A;  1AN8 A;  3O13 A;  2DZJ A;  2O2V B;  3DVN U;  1YX5 B;  3AE4 B;  2LVO A;  4WQM A;  4RM9 A;  3ZNG C;  1VZ6 A;  1ENF A;  2WWZ A;  5FK9 C;  4LLG M;  4I6P A;  4ASW C;  2INN E;  2KAJ A;  3EFU A;  4J3O D;  4II2 B;  2BVC A;  1FRR A;  4N6E B;  4KKI A;  1V81 A;  4US9 A;  3BII D;  3AEB B;  4DDI D;  2LZ6 A;  1TS4 A;  4OVU A;  3L08 A;  3ZJV A;  3A9K B;  1MI0 A;  4MEM A;  4GB9 A;  2WXR A;  1E0Z A;  2J53 A;  5HKH A;  1HE8 A;  1OFF A;  4RGM A;  1WXV A;  3VDZ A;  1VDV A;  3P4Q B;  2L0T A;  5AUI A;  2MEK A;  1FNV A;  2BKR B;  3P63 A;  3D32 A;  1HQR D;  2MJE A;  4HXD A;  3N1Y C;  1A70 A;  1UEL A;  2I1K A;  3VH4 B;  2K22 A;  3BWU D;  3N32 A;  2JPH A;  1HEZ E;  2A4Z A;  3OLM D;  3Q3M C;  4LNI A;  5AZF A;  1KF6 B;  1WJU A;  1WRI A;  1KH0 A;  2NPT B;  3ZLZ A;  2MQJ A;  2FCN A; 
#chains in the Genus database with same CATH homology
 4HK2 A;  2LGY A;  2I1J A;  4PS8 A;  4G50 A;  2M17 A;  4W9C A;  1RRB A;  2MCN B;  1WJ4 A;  3ZDT A;  2JZZ A;  2ZZP B;  2LVP A;  2LGD A;  2KQS A;  3KUZ A;  1YQB A;  3RZW C;  3TJP A;  3DBH I;  2BGF A;  3N30 A;  3M62 B;  4DDG D;  2JF5 A;  4EZK A;  4HDO A;  2LWP A;  1IPG A;  2ZPY A;  2FCQ A;  2NCN A;  3CSF A;  2JT4 B;  3QQ8 B;  4KZC A;  4MJS B;  3UF8 A;  4BOS C;  3VVW B;  3IG3 A;  4M0W B;  1J8C A;  1YIW A;  2JVC A;  2KC2 A;  2ZCB A;  4FLH A;  4NJ6 A;  3MHS D;  3SD5 A;  2M4N A;  3JSV B;  4WJQ A;  2JWZ A;  4LJP B;  2DAF A;  2XEW A;  2MP2 B;  1GC6 A;  1WR6 E;  3RT3 B;  2G4S A;  4X57 B;  4E71 A;  4IWO A;  1WGR A;  1WXS A;  2IO0 B;  5JHB A;  4MGI E;  2IO2 B;  3ZNH B;  1WRD B;  3MJW A;  4MSM B;  3QIJ A;  4IM2 A;  3V62 A;  3VTU A;  2IBI B;  4AOF A;  1VD2 A;  3QX1 A;  5CHF A;  2KLG A;  2L7R A;  2KLC A;  3M3J A;  3VQI A;  2ZVO A;  3PRZ A;  3QHT A;  4KIK B;  3LJ3 A;  2FID A;  3ZIM A;  1E8W A;  2CHW A;  2IYD B;  2HD5 B;  4IWQ A;  1KLV A;  1P9D U;  1WF9 A;  3ZTC A;  1TGZ B;  3VAW A;  4EZL A;  1Z5S B;  4EOY A;  1GC7 A;  1WR1 A;  3SDL C;  4KDI C;  3VH3 B;  3NHE B;  2MBO A;  3VUX A;  2KVR A;  4BKG A;  4GN1 A;  2BPS A;  2XK5 B;  3ZNZ B;  3ZVV A;  3B08 A;  3KVF B;  1ZGU B;  2K6D B;  1KJT A;  1ZKH A;  1WIA A;  2G3Q B;  2RPQ A;  3AU5 A;  4FJV B;  5E6P A;  1IP9 A;  4K81 A;  5TR5 A;  3PTF C;  3A1Q B;  3SHQ A;  1OEY J;  2FCM A;  4K7U A;  5DCN A;  1XD3 B;  4TKN A;  2KC1 A;  5L83 A;  4K7W A;  2HTH A;  1WM2 A;  1Y8R C;  5JZE B;  1V5T A;  3WAM A;  3SU8 X;  1E5W A;  3M95 A;  1UH6 A;  2FAZ A;  3DBS A;  3ML9 A;  5KHO A;  5C1Z A;  1WX7 A;  3L17 A;  5KHQ A;  3ZKJ C;  4MDK E;  1TZ1 A;  2KN5 A;  3HM6 X;  1V6E A;  1P3Q U;  2G4D B;  1WYW B;  3A33 B;  3N3K B;  4HWI B;  1IYF A;  2C9W B;  4ZRI A;  1WX8 A;  4GGQ A;  2LXC A;  2WYQ A;  4DHJ D;  4HLE A;  4XC2 A;  1WMH A;  2W9N A;  2L05 A;  3QAR A;  2L00 B;  3QAQ A;  3JVZ X;  4LCD E;  2NBU A;  3HK0 A;  3HM3 A;  2KWV B;  4W9E A;  3PLU A;  2K8B A;  3DDC B;  4KSL C;  2V3S A;  4LJO B;  4CO7 A;  2AEH A;  2PE6 B;  3RZF A;  2NR2 A;  4DHJ B;  3PRM B;  3ENE A;  1EF5 A;  1LM8 B;  1TTN A;  4LDT B;  3RYT A;  4GDK A;  3IVF A;  3U7D A;  4GXB A;  1P0R A;  2R2O A;  4RMA A;  1P98 A;  2KDE B;  3GZN I;  4ANX A;  3UIO B;  3DCG A;  2J0K A;  2N4F A;  4BBN C;  5E6O A;  1V49 A;  3B1L X;  4FHK A;  4M8N A;  2KMC A;  1LQB A;  3TBL D;  4F8C B;  1E7U A;  1WZ0 A;  4W9L A;  1UGM A;  3KUC B;  1WGY A;  3PHX B;  2L3Z A;  4GDL A;  4WAA A;  2MA9 B;  4KZ0 A;  1I42 A;  3PHW B;  2QHO A;  2D3G A;  3V6C B;  4JGH B;  1WFY A;  2LJ5 A;  2PPH A;  2A5U A;  1I35 A;  2KO3 A;  4HCP B;  2DYO A;  2FUH B;  3L10 B;  2KJ6 A;  2KX0 A;  1WI0 A;  4FAD A;  2JZ3 B;  3UQB A;  1EUV B;  3RD2 A;  3TCA A;  2O2V A;  4XX5 A;  3PLV A;  2KK8 A;  2JY6 A;  4FA6 A;  1ZW7 A;  2GOW A;  2VRR B;  5G55 A;  4GU2 A;  1Z2M A;  5J17 A;  3AU4 A;  3L16 A;  2C5L C;  1V80 A;  1GNU A;  1Q0W B;  3IHP C;  4FHJ A;  1Q5W B;  1E8Y A;  1V5O A;  4XZ4 A;  5AEK B;  1UBQ A;  4A3P A;  1SIF A;  2KFK A;  2LI5 A;  3QA8 A;  3KH0 A;  2ZNV B;  3DQV A;  3BIN A;  3PZD A;  3WAP A;  4NAW B;  4F1S A;  3APF A;  1NI2 A;  2KTR B;  2KD0 A;  2LD9 A;  5L95 C;  2N7E A;  4M8M A;  3A9K A;  4MGZ E;  2WX1 A;  2ZVN A;  2L8J A;  1C1Y B;  5CHW A;  4B9K A;  1UBI A;  1R4N I;  3A9J A;  2JRH A;  2DHZ A;  4DWF A;  4JQW C;  4G3X B;  3R66 C;  3UIN B;  2Z0E B;  3PPA A;  4PYZ A;  2EMT A;  3ZTD A;  3X0W A;  3PGE A;  4NQL B;  2O6V B;  4WJN A;  1V86 A;  3H7P B;  1WE7 A;  4PS7 A;  3RUI B;  4DHZ E;  2BYV E;  3H9D A;  1RLF A;  2KHW B;  2MSE D;  5AZH A;  4EZJ A;  5J18 A;  2MRP A;  3PSE B;  3QWZ B;  5E6N A;  1X1M A;  5GMV A;  2PEA A;  3ZW3 A;  4E74 A;  3JYU A;  4PS3 A;  4W9I A;  4IG7 B;  4A20 A;  5AZG A;  4ICU A;  4P7I A;  1TBE A;  2GMI C;  1E7V A;  2FNJ B;  5JH5 C;  4WQO B;  2RSU A;  2N1W A;  1M94 A;  1PQS A;  2B3A A;  1CMX B;  2C60 A;  3PS6 A;  2BWF A;  4HJK A;  2N9P C;  2AWT A;  1YJ1 A;  2LXA A;  2DZK A;  3OJ3 A;  3QJZ A;  2JRI B;  3AI5 A;  1JRU A;  4TQ0 A;  4RM8 A;  1VCB A;  4MEL A;  2CU1 A;  2YVC A;  2KMA A;  4FN2 A;  4NPN A;  1GG3 A;  2NPT A;  4WJP A;  3ZRF A;  2MBH A;  1EF1 A;  3IFW B;  2NBW B;  4IM3 A;  4AP4 C;  3K9P B;  5EDS A;  4EFO A;  5BO4 B;  3PT2 B;  3APD A;  3VTV A;  4W9G A;  3ZDM C;  4LDT D;  2L76 A;  2R2Q A;  3TIX A;  1F9J A;  4KV2 A;  3V60 A;  2DYB A;  3DVG Y;  3X23 A;  4B95 A;  2D11 A;  4DK5 A;  2RGF A;  3U8Z A;  3UQA A;  2MBE A;  5FR6 A;  3WAN A;  4J6I A;  4HDQ A;  3ZUN A;  1ISN A;  3JW0 X;  3WA0 A;  4MJS A;  5C23 A;  3Q3J A;  2ZNV C;  3NY5 A;  4AJW A;  2AL3 A;  1XT9 B;  3JSV A;  2KFJ A;  2RD0 A;  1WGG A;  1V9J A;  2ZJD A;  2KDB A;  3VUW A;  3LDZ E;  2MP2 A;  4AUQ C;  2LRW A;  4IC7 B;  1L7Y A;  4I6N B;  4K1R B;  3VHT C;  2MLB A;  4OVV A;  3VXW A;  2KOX A;  3V61 A;  4B6W A;  2GBK A;  1H4R A;  3OJ4 B;  4KIK A;  4JL9 A;  4N9F 4;  2K1F A;  2V4L A;  3CF6 E;  3HHM A;  3M63 B;  4WWP A;  2CHX A;  2LAS A;  3HIZ A;  2N9E B;  5CX3 A;  2K39 A;  3S2A A;  1E8Z A;  2IZV B;  3AUL A;  2J7Q B;  3CMM B;  2XK5 A;  3QC8 B;  4AWJ A;  4BKT A;  2KWU B;  4W9H A;  4TUU A;  4GSW A;  3W1S C;  3A4S C;  4W9D A;  3H7S A;  2KWC A;  2CS4 A;  3ONS A;  3A1Q A;  4NJ7 A;  3ALB A;  3QK0 A;  2CHZ A;  2AYO B;  2EKE C;  2ZCC A;  4IW0 A;  1G6J A;  4HCN B;  4WWN A;  1WM3 A;  1WZ3 A;  3DBR I;  3MTN B;  4HPM B;  4G11 A;  4EEW A;  2YLM A;  4DXA B;  1SE9 A;  3IBE A;  5D6J B;  2KZR A;  1MG8 A;  5DPT A;  4ANW A;  2MBQ A;  3WAO A;  1Q1O A;  2PE9 A;  1QZE A;  2XBB C;  2DX5 B;  4BFR A;  2IO1 B;  1RAX A;  4ICV A;  3R7R A;  4GIV A;  2KXJ A;  2V1Y A;  5CHV C;  2LUE A;  3VFK A;  2D10 A;  3OAW A;  2N1V A;  1FXT B;  1U4A A;  4K7S A;  5D7G A;  1GUA B;  1H8C A;  1RFA A;  2O6V D;  3TL5 A;  3ZO5 B;  1WXM A;  3KUD B;  1OTR B;  5D2M B;  3U30 A;  3VTW A;  2KTF A;  2C7M B;  3L13 A;  2K8C A;  4TQ1 A;  2GBJ A;  3O65 B;  1GJZ A;  1WMH B;  5CTR C;  2BKF A;  1E8X A;  1E90 A;  3DVN V;  3GOE A;  1WE6 A;  3DBL I;  1P1A A;  2Y5B B;  2DZI A;  4CHK A;  5IA7 A;  2UYZ B;  5J2R A;  3ZRC A;  4ANV A;  4BKS D;  4EUT A;  4FUL A;  1BT0 A;  1KM7 A;  4BVU C;  4WJO A;  5LLI A;  4IWP A;  4DHZ B;  2MBB B;  4FJZ A;  4URK A;  3EC8 A;  1C3T A;  2GBR A;  2J0M A;  2ASQ A;  3QCA A;  2M8S A;  2EMS A;  4GDK B;  5DPW A;  4JLC A;  1XQQ A;  3CST A;  1WY8 A;  2UWQ A;  2D07 B;  3L54 A;  5IAA C;  3DOW A;  3UGB B;  2ZEQ A;  4CYE A;  2LVQ A;  1LFD A;  3BY4 B;  2L0F A;  1OEY A;  4EKU A;  2Z0D B;  3WAL A;  1WGD A;  2CKH B;  2REX A;  3H1U A;  4MH0 E;  4MSQ B;  1K8R B;  2Z59 B;  2KDI A;  1S1Q B;  4YL8 A;  2BF8 B;  2HJ8 A;  3DVG X;  3EHV A;  4GDL B;  4F7Z A;  3T8M A;  4W9K A;  3PRE A;  4A3O A;  2D2Q A;  1YX6 B;  4IM0 A;  2KX3 A;  2K6Q A;  4HPL B;  2C7H A;  2KNB A;  2N9X A;  3L0W B;  3TMP B;  4BOZ B;  2M0X A;  3K9O B;  4NNJ B;  1YD8 U;  4WWO A;  4II3 B;  5DPS A;  2DZJ A;  2O2V B;  3DVN U;  2GBN A;  4FBJ B;  1YX5 B;  2OJR A;  1J19 A;  3ML8 A;  2LVO A;  4I6L B;  3DPD A;  2NVU I;  4BBN F;  4GOC A;  4RM9 A;  3ZNG C;  2WDT B;  3WIM A;  1WH3 A;  2BYF A;  2MX2 A;  2K8H A;  1V2Y A;  2GBM A;  2WWZ A;  4I6P A;  4MGY E;  5LXI B;  2J0J A;  4ASW C;  4ZYN A;  2KDF B;  4KVG B;  3R3M A;  2KFK B;  4NAW A;  3EFU A;  4II2 B;  4E3C A;  1OGW A;  2KTR A;  1WXA A;  2MWS B;  2G45 B;  3APC A;  1WJN A;  1WJ6 A;  2K25 A;  2KKC A;  3VUY A;  2IO3 B;  4NQK E;  3A4R A;  3C0R B;  3B0A A;  3NZS A;  3KYD D;  2DZM A;  1V81 A;  4JIO U;  4ZDV A;  2KJH B;  4NY0 A;  1WGH A;  3ECI A;  1S3S G;  2C7N B;  4DDI D;  2LZ6 A;  2MW5 A;  3Q3F A;  4OVU A;  3L08 A;  3A9K B;  2HE7 A;  2OOB B;  2O6V A;  4MEM A;  4PYU A;  3RUL A;  4HVB A;  3P2B A;  4GB9 A;  3H7P A;  2LRU A;  3RCZ A;  1OQY A;  3A9J B;  5HKH A;  4ANU A;  3W1S A;  2CR5 A;  1SGH A;  1HE8 A;  3NOB A;  4TV3 A;  3NS8 A;  1WXV A;  3VDZ A;  2KAN A;  2L0T A;  2RR9 A;  3ZNI D;  1LXD A;  2DEN B;  2FCS A;  2BKR B;  1UZX B;  2JXX A;  1EO6 A;  2KJR A;  4KSK C;  4BKS A;  3D32 A;  2KQ7 A;  3R7Q A;  2NS5 A;  2WX0 A;  4HXD A;  5JHA A;  3KYC D;  2LGX A;  5G2N A;  1UEL A;  2AL6 A;  4AJY B;  2I1K A;  3VH4 B;  1J0G A;  3I3T B;  4W9J A;  3N32 A;  4ZRJ A;  4ZRK A;  1KOT A;  2IY1 B;  3PVL A;  2N7D A;  3EEC A;  2JPH A;  2FIF A;  3PV1 A;  4FJY A;  3T9L A;  1L2N A;  4IUM B;  1D3Z A;  3NZU A;  4DBG A;  2BWE S;  5LXH A;  2BYE A;  2A4Z A;  3UIP B;  3OLM D;  5DPR A;  2DYM A;  1NDD A;  1A5R A;  4MGK E;  3KW5 B;  1AAR A;  1WX9 A;  2NBV B;  1T0Y A;  3PRP B;  4MM3 A;  5AZF A;  4G0N B;  1NBF C;  3V6E B;  1WJU A;  2PJH A;  3W1Y A;  2DAJ A;  1UD7 A;  3H6N A;  1R4M I;  2IY0 B;  5D94 A;  2NPT B;  3ZLZ A;  2M1M A;  4KDL B;  3AXC A;  2JUO A;  4GMV A;  4W9F A;  2ZPN A;  2MQJ A;  2FCN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...