2XKMA

Consensus structure of pf1 filamentous bacteriophage from x-ray fibre diffraction and solid-state nmr
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Consensus Structure of Pf1 Filamentous Bacteriophage from X-Ray Fibre Diffraction and Solid-State NMR.
pubmed doi rcsb
molecule tags Viral protein
molecule keywords CAPSID PROTEIN G8P
total genus 19
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2010-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2xkmA00
1IFNA 2IFMA 4IFMA 3IFMA 1QL1A 2KLVA 1ZN5A 1QL2A 2IFNA 2XKMA 1PFIA 2KSJA 1IFMA
chains in the Genus database with same CATH superfamily
2PRRA 1SQQE 1IFDA 2K3RA 3AEBC 3CX5D 4H13B 1AVYA 2AXTH 5GTHH 3L75G 1URQB 4BRYB 1KILB 5APVA 3BASA 5KKZB 1BCCJ 1LTJC 2YXQB 4D6TG 3Q3DA 1URQD 5APTA 4IFFA 2WPRA 2L5GB 2POHA 2IYPA 1HVVA 3RBZA 1NU1E 4GOFA 1KORA 1GTWA 2OYIB 1QEXA 1HJ0A 3L71D 2LR2A 3GG2A 2Q3EA 1JCDA 3RK3C 3RL0D 4RESB 2AEMA 1W5CE 1BGYD 2ZAEB 3RL0g 3Q5RA 4EYYQ 1VQ4P 1OIPA 1KV4A 3TGUE 2J58A 3CC7P 3NXSA 3H1LJ 1X0TA 4BWNA 2WPSA 1SQVD 1OW7A 3CX5E 3RGUA 2YMKA 1SQQD 4BRYA 3SWKA 2Q9IA 4KHXA 1NH4A 4JYCA 5APSA 1FZCA 3PHLA 1PGOA 3MIWA 1CI6B 2K37A 2ZT9C 4WB4A 4IL6H 1R8EA 3MHVA 2E42A 4IFDK 2R5BA 1EDLA 1SQVJ 2L91A 1SFCB 2O01N 3MGNA 4D6TD 3CXHD 2Q6QA 5AW8B 1NTZE 1TU3F 1MKMA 2FYUJ 4H0LD 5AVZB 4EDFA 1LP1A 1NTMG 5B5EE 2HFED 1LTIC 2QJKB 1YIJP 1X8YA 3VYIA 2KUBA 1RHZB 2O01H 2I8DA 3B5NC 2ITAA 1J2JB 3USSA 1GZLA 2A45H 2KSEA 2Z5HA 5AVWB 3VMAA 5APUA 4C7NA 4DJGA 2E76B 1SS1A 2QE7H 2YIUC 1M1JB 4NPFX 1IC2A 5CCGD 2FFDC 2B89A 1JY2P 2WSFJ 3P7KA 4KT0J 1BGYG 3V4WA 1EXIA 1G1IA 3VP9A 5AVTB 2Q1KA 1YJNP 1BE3E 3CCVP 2C9LY 3A5TA 1Y8AA 5K5GB 4DT0A 3CCEP 1KD1Q 4XE5B 1H0TB 3BVHA 3AE9C 5KLIC 1MUUA 1N86A 2CPSA 1KQFB 3V2PA 1KYOE 1PP9G 3GF7A 2KNCA 1SFCA 2SPZA 4R4LA 1S1CX 1NOHA 2M3EA 2RN0A 2Z5IA 1LNQA 3M9HA 4OGQD 3EFGA 3N4XA 5KLVE 3OA7A 2O1JA 1K8AQ 2P67A 1ZR4A 3V5BA 1PPJE 3GHGC 1FBMA 4PV1B 5CMZA 4JPZB 2YO2A 1EZVE 1GW4A 1L4AB 2BASA 2KP8A 3RK2D 3CWBE 1BE3D 3CXHI 1GD2E 3L70G 1EDKA 4ASVA 1EXJA 1S2EA 2H88C 5APXA 1PV3A 1X79B 2QJYC 3KDPB 2QA4P 1SQVK 1QVGO 3CMAP 1K05A 1LGHB 1ZP0C 2FY8A 2OARA 3TNUA 1URQC 2M0BA 5BVZA 2QG4A 3PP5A 2KI7B 1FDOA 5KKZC 1BCCE 3BCCG 3CCRP 2OQQA 3VN0A 1NTKE 3JSVC 1VQNP 5E79H 1LP1B 1VF5D 5KLVK 1A02F 2NRGA 1KILD 2YXRB 1YTZT 3H1KJ 4L73A 1S5LE 3KQGA 1LTAC 2HG5D 3OW2O 3L74E 5APQA 3LIEA 1PGJA 2JO1A 2D2CC 3EQ2A 3ZDMA 5AW7B 2P2UA 1KZUB 1W2EA 3H1KE 3AE4C 1IJDB 1YJWP 4AUWA 5AVVB 3IF4A 1PIXA 2W83C 5KAIE 2YKPA 4I6MC 2LKMA 4C7RA 3VP8A 3L73J 1J1EB 2P1JA 1NJIQ 2B87B 1M90Q 1NTZK 2ZVNB 1UIIA 3KXDA 1LTSC 1N73C 1KB9E 2QSIA 1OWAA 3KZIH 1NTKJ 2Y0CA 2RMZA 3RK3D 3RL0C 3SFDC 4DOJA 3A2AA 1FZEA 3FGAD 5KJ7D 5CBNA 3L73E 1EDIA 2XKMA 1OZHA 2CK3H 2ZYGA 4RKUJ 1MFTA 1SFCC 2XNXA 3BCCD 2Y9YA 2A45G 2K9JB 2KS1B 2R3CA 3PJSK 3WU2H 3H32B 1GK6A 2OYIA 2GM4A 3P32A 3NMDA 2M8RA 2WSSH 4K35A 4WY4D 4QMAA 5BU8B 1YQ4C 3H1HE 3G4SP 2FYNC 2CPBA 2ZYAA 3CXHH 3VOPA 2JWDA 3B71A 3A0BE 5AVUB 4C46A 5AW2B 3RK3E 2IFNA 2YIUB 5KAFE 3Q1MA 5KLVJ 3EFFK 2O01J 2N1TB 3H1IE 1U7MA 2V4HA 3I5CA 2Q7CA 4H0LB 1SQPG 1GU4A 1FZCB 2OTJP 1OVRA 2BEZF 3SSUA 4HYTB 3TDKA 1NTZJ 3CCJP 3L73D 3TSIA 3C1LA 3MTUE 3W68A 2WSCH 1X9VA 1L0NK 1P84H 2ZFCA 2K9YA 4H44D 2LXBA 3WMM0 3L70J 1HBWA 1SQXE 2IPPA 1CI6A 4H44B 4WY4C 1L0LD 2HPCB 2E75B 3S1KA 2C9NY 2WITA 1PGQA 3A0HE 4MN4C 4PD4D 4R4MA 3FWLA 2P7JA 3H1HJ 3R2PA 4RO0A 1LWUC 1JB0J 3BCCJ 3G6EP 5CBOA 2HODB 4AQRD 5GTIE 2N9BA 1YI2P 1DEBA 1OVUA 3AE1C 3O8ZA 2KLUA 3P8CE 4N6JA 1VQ5P 1L0LJ 1USEA 1FU1A 1YYCA 3M0AA 2QJYB 2FFDA 3V2NA 3RK2B 1X22A 2KSJA 1N73A 1SLQA 1VPCA 1XTCC 2JJLA 1FDIA 4GT1A 4PV1D 5APWA 1LTGC 2YNYA 2Y9ZA 3NFQA 1IO4A 1GK4A 1LT9C 1NU1D 1T2KD 2WT7B 1H88A 1USDA 2E74D 5TISH 2OYHC 2KYVA 2XNDH 4I7ZB 3L73G 1UIXA 2FXMA 2FXPA 2NZ2A 1GL2B 4IFMA 4PJ0H 2FKWB 5AVXB 5M1BA 2W90A 2K1AA 1L4AA 1NHLA 4PD4I 3O6QB 3V2QA 2OYIC 3AEDC 3TGUJ 1JTHA 2LXCB 1KQSO 2KK7A 1ZXGA 1YTZI 3CMEP 1L0LG 4XFJA 3OAKA 2WSEH 2WWWA 4EI2A 3CCMP 1PGPA 4LLHA 5AVQB 1PPJD 3MZWB 1RF1B 1M1KQ 1JCCA 3CLQA 3GW6A 1Q7YQ 1IFJA 4DCKA 1JM0A 1QLED 2YO3A 1N7SD 3BRTB 2IDBA 3SFEC 1ZLLA 2WPVB 3E7KA 4JF7A 2JDIH 3HD7A 3L72G 2FYUG 3JCUH 2QJPC 3HE5A 1R5SA 4WWIA 1SQPK 2FYUD 2OYHA 3ABVC 1VQ9P 1R5LA 2ZVOB 1L2PA 3Q5PA 1Y9BA 1L0ND 2QJKC 3H1IJ 5AW5B 3RK2C 4ZMDA 1NTKG 2NPSC 2XZRA 2HLOA 3CWBD 1BCCG 3LIDA 1HTLC 4Y28J 2QEXP 5C39A 1BCCD 1JY2N 2GUVA 1L0LK 5AW6B 5DJUB 1E5WA 1GL2D 4GDOA 4OGQC 1SQXG 1LJ2A 3BRVB 3IAOA 3L70E 5H2FH 4Z1MH 1KC8Q 3CX5H 1FDMA 1DIPA 1SQVG 3H1JJ 3PTZA 3L36A 4L76A 4Y99C 4PD4E 3U1CA 4EOTA 3VTPC 2E5YA 3GHGA 1GDTA 1FZBA 1KFMA 1NVOA 4W7YA 5B66E 5KLIB 1SQPE 5AW1B 1AQTA 1KILC 1ZRTE 2WZ7A 3H1IG 5KLVG 3L71J 2H89C 1KQLA 1Q86Q 4GIFA 1DH3A 1VQOP 4OH8B 3CX5I 1KMIZ 2J5UA 1S4XA 1BGYJ 1NTMD 1NU1K 1VQPP 1JY3P 1VL2A 3CCQP 5AVSB 3AE6C 3L71E 3I56P 3AEEC 3M06A 3B5ND 1MV8A 3CWBJ 3PRJA 4YXWH 1M57D 1BGYE 1IZNB 2D2CD 2FYNB 3H1HD 1YBKA 1PP9J 3P8CD 4JBZA 2IBZI 2ZJSE 1AJYA 1LT1A 1LWUA 2E75D 2KOGA 1RF0C 2KLVA 3H1LG 1JMBA 2QM7A 1HGVA 1LTJA 3Q2YA 1NTME 5KTBA 1HF9A 1M8OB 2Q3IA 4IOIH 5APYA 1QVFO 1URQA 4ASWA 1K04A 1EZVI 3CC2P 1WT6A 4XA4A 1PP9D 1CW5A 1L4AD 3E1RA 3B8EB 1KYOI 5CCHA 2P58A 5KJ7C 1PFIA 1NU1J 2HYNA 2IZ1A 1IK7A 3NTNA 1SQXK 3IR9A 1G1JA 3M0DA 4UB6E 4O9BA 2H43A 2PP6A 2O3JA 3V2RA 1T6AA 1JO5A 3L75D 1SQQK 1ZV8A 2KB7P 2E74B 3WUVA 1L4AC 1AVOA 1LTJB 3P8MC 4GOEA 3TGUG 4D6TJ 3HD7D 2B88A 2ZYDA 2M5AB 3T97B 3MD0A 3HE5B 3D6ZA 1G2CB 2R32A 3LW5H 1KILE 1YHQP 2NPSA 1JEKA 1JY2O 1N7SB 1QX8A 2ZXEB 1FC2C 2JEEA 1KFNA 2OGUA 3CWBG 3QWOC 3HUSA 5AW9B 1NU1G 1VQMP 4N3YB 2I1JA 2XV5A 2Z4EA 4WVZA 1M56D 1FZGA 1EDJA 2V7QH 3L72E 2W27A 3HD7C 1NGMB 3HRNA 1A02J 1HJBA 2IX7C 1T8ZA 1JTHB 1DX7A 3B5NA 3LW5J 1SQQG 1EZVD 4HH2A 2PGDA 1Q81Q 4PV1C 4H0LC 2A06D 4JYBA 3TK1A 5KAIH 1FZCC 2WT7A 3AEAC 3H1JE 2JR8A 1NAFA 3C9IA 1ZR2A 2PAJA 1LWUB 1JMMA 1BE3G 2AXTE 3L35A 1LT9A 3II6A 5GTHE 1EQ7A 1JUNA 1OVVA 1SVFA 2JKVA 3BATA 3L72D 1OW8A 4ZKPA 3W67A 4WY4B 1PL5A 3FWNA 1S3JA 1JOCA 4DZOA 4GODA 1SFCD 3VMZA 3CCSP 2IBZE 4H13D 2FYZA 3WU2E 2H7HA 5AW3B 3HUSB 3D70A 1LTBC 1Q90D 1SQQJ 2GA1A 2HODA 3U59A 4WY4A 4EIJA 2NPSB 1NYHA 1QL2A 1VQLP 1CZQA 1SQBG 3CXHE 4I2LC 1NTZG 4YTPC 2IFMA 5CJ0A 1AFOA 1SQXD 5L8RJ 2OYHB 1AA0A 3AE8C 3AECC 4K3AA 3KYQA 4LGDE 5CCHD 2ZXXA 5KAFH 1RQVA 2HPCA 1HWTC 1KTMA 1DEEG 3E1IA 1YQ3C 4KJMA 1NKZB 4M3LA 3CL3D 1Z56A 3GF3A 4OWFA 4Y99B 1VQ7P 1FJPA 1CSBA 3RBXA 1J1EC 2XU6A 1Y47A 1P84E 1BDDA 1OFCX 4IL6E 4NPDA 3H25A 1RF1C 2AXCA 1J1DB 3Q5SA 5KLVD 2QIWA 1QL1A 1FS0E 2IZ0A 2AEJA 2C0WA 1PZQA 2H8PD 2J59M 2WSFH 5B5EH 2ZT9D 1XTGB 1T3JA 1M1JA 1M1JC 3F5HA 2FBWC 3HE4A 3M91A 1KQGB 2WPQA 2A45I 2K9JA 4HB1A 2MKVA 3OJAB 4IL6X 2E74C 2KXPB 1NTZD 1MFZA 1RE3A 2N1TD 3H1HG 3MP7B 1N7LA 3S4RA 1IK9A 4TLFA 4A7PA 4D6TE 2N1TC 3FXEA 1ZMEC 2Q5UA 1IFNA 1H89A 2WSCJ 5AVRB 5AW0B 4W80A 2W6AA 2YMYA 3IN6A 3CD6P 1HGZA 1KYOH 1HUCA 2WSEJ 1W2BO 2A06E 5TJHA 2IYOA 2WQYC 4B86A 2O1KA 3O6QA 2RH0A 1EC5A 3M9QA 2E75C 1AV1A 1E79H 1GL2C 1OW6A 1S72P 2DW3A 1J1DC 3H1JD 4W7ZA 1OX3A 5CCGC 1P84I 2I1KA 4HJGH 5AVYB 3S9OA 4AYCA 1BDCA 3AE7C 2YKQA 3L70D 2AEFA 2Y0EA 3H1KD 1N73B 1FOSE 3RL0B 3H1KG 3WUTA 2FFDB 2N9YB 3ITKA 3VMYA 3TGUD 4ZNCA 3JCUE 1S9KE 1QGKB 1JY3N 1SP4A 3TNUB 2Y0DA 4N78E 3L74G 3VMXA 3AE2C 2RKLA 3WUUA 5E79E 1L0NG 2QJPB 1N7SA 1HH0A 1N7SC 1NTKD 1ZW0A 2E76C 2OYOA 4RJTA 2HR3A 4WBAA 1S5LH 3BCCE 3CCUP 2M5AA 2KZJA 3M0DC 2G8YA 1JNMA 1NTMJ 3HUSC 4TT3H 4YPCA 3TYYA 3HE4B 1S9KD 1RH5B 1KB9I 4U3FJ 1N8RQ 3HD7B 4NPEA 1VF5B 1NWQA 3CPWO 3AE5C 3L4FA 1ZRTD 2BCCG 2GUSA 1FOSF 1IFIA 1RQUA 4OVNF 5H2FE 3GLMA 1IFPA 5BU5A 3FXDA 1EZVG 1K73Q 2KNCB 4U3FE 3L37A 2K88A 4PD4H 2V7QJ 3L74J 1YITP 1RF1A 1PPJG 2B87A 2B9BA 1RE4C 1S5LX 3PLNA 1NKNA 3V4QA 5B66H 2NPSD 2UWJE 2QRXA 2P10A 3G3ZA 3H1LE 1RF0A 1KB9H 2E76D 3EWKA 1P84D 3KZIE 3MUDA 3H1ID 3TF5A 3AEGC 4H44C 1ZN5A 3B4SA 3V6IA 1OMIA 1PP9E 2E5TA 2OTKE 3I55P 2E43A 1FE6A 2R44A 3SWYA 3L74D 4LC1A 3KPEA 2BCCJ 1VQ8P 3D6YA 3H32A 2JWAA 2YKOA 1OXZA 2KS1A 3RK3B 3KHUA 3U1AA 2FXOA 4C7NB 3D71A 2QM8A 3L71G 3PH0A 1T2KC 1GU5A 3A7OA 3GMAA 2D2CB 1RE3C 2W6JH 3QH9A 3UIAA 1Q82Q 2M3BA 1SQBD 2KZIA 3A0BH 1GMJA 4L74A 1DD3A 1NO4A 2QVAA 2R5DA 2R3SA 1RE4A 3F89A 1N2DC 4OGQB 4CPGA 1L0NJ 3HTKA 1T3UA 2BCCD 3MUDC 1DD4A 1VF5C 1KB9D 2WTYA 2ZT9B 1SQPD 2FYUK 1M7LA 4U3FD 5DJTB 1BSHA 3R4YA 1LT9B 2VRSA 3CI9A 4U3FG 3AE3C 2MJZA 1SQVE 4I7ZC 3CC4P 1FZFA 1FAVA 1GL2A 4JQ0D 2KIKA 2C0XA 5CCHC 2BCCE 2XDJA 3A3YB 1RY3A 1NTKK 3GHGB 3H6PA 1D7MA 3A0HH 5AW4B 3FX0A 3HTKB 3B5NB 3JC22 2WVRA 4H13C 4UB6H 4ZKUA 1VQKP 3SWFA 4HKZH 2BEQD 1IFMA 5GTIH 1VQ6P 1JY3O 1L0NE 1H0TA 3IFMA 4N78D 2PFXA 3L72J 1FJKA 3C8VA 3G9RA 4YXDC 3N7NA 2FYUE 1WMKA 1SQBE 2WMMA 2OTLP 1ZOYC 2W8ZA 1AQ5A 3M9BA 4I1LA 1LTTC 5CJ4A 1G2CA 1U7JA 4L75A 1KILA 2G3AA 3T97A 1H8AA 1YJ9P 4UB8H 3H1LD 1NAYA 1MZ9A 2IBZG 3L75J 3K5BA 4BXLA 1SQPJ 1KN7A 1NTMK 1SQBJ 2IBZD 1BSNA 5TISE 1Q2NA 4UB8E 5CHXA 1L0LE 4U7JA 4PJ0E 5EFWB 1SQXJ 3CCLP 2W6BA 3L75E 1BE3J 3AEFC 3H1JG 5KJ7A 2A06G 1WRGA 3G71P 1VDFA 1GW3A 4GKGA 1K9MQ 1KYOD 1FZAA 1U57A 2N1TA 5CCGA 2JP3A 1SQBK
chains in the Genus database with same CATH topology
1IFDA 1HJBA 1URQB 1KILB 5APVA 3BASA 1LTJC 1URQD 5APTA 4IFFA 2WPRA 2L5GB 2POHA 1HVVA 2OYIB 1GTWA 1JCDA 3RK3C 3RL0D 4RESB 2J58A 3NXSA 2WPSA 2Q9IA 4KHXA 1NH4A 4JYCA 5APSA 3MIWA 1CI6B 4WB4A 2E42A 4IFDK 2R5BA 1SFCB 3MGNA 5AW8B 5AVZB 2HFED 1LTIC 1X8YA 3VYIA 2O01H 3B5NC 1J2JB 4C7NA 1GZLA 2A45H 2Z5HA 5AVWB 1T2KC 2OYIC 5APUA 5CCGD 2FFDC 1M1JB 1IC2A 3P7KA 1JY2P 3V4WA 1G1IA 3VP9A 5AVTB 2C9LY 3A5TA 4XE5B 3BVHA 1MUUA 1N86A 2CPSA 3V2PA 1SFCA 1NOHA 2Z5IA 3M9HA 3EFGA 3N4XA 3OA7A 2O1JA 2P67A 1ZR4A 3V5BA 3GHGC 1FBMA 5CMZA 2YO2A 1GW4A 1L4AB 2BASA 2KP8A 3RK2D 1GD2E 5APXA 1X79B 3KDPB 1SQVK 1LGHB 2OARA 3TNUA 1URQC 3PP5A 3VN0A 5KLVK 1A02F 1KILD 1YTZT 3KQGA 1LTAC 2HG5D 5APQA 3LIEA 3EQ2A 5AW7B 2P2UA 1KZUB 1W2EA 1IJDB 4AUWA 5AVVB 4C7RA 2YKPA 4I6MC 2LKMA 3VP8A 1J1EB 2P1JA 1NTZK 1LTSC 1N73C 1IO4A 4DOJA 1OWAA 3RK3D 3RL0C 3A2AA 1FZEA 5KJ7D 2XKMA 2XNXA 1SFCC 5BU8B 2OYIA 2A45G 2R3CA 2GM4A 3H32B 1GK6A 3P32A 3NMDA 2M8RA 4WY4D 2CPBA 3VOPA 5AVUB 4C46A 5AW2B 2IFNA 2N1TB 3I5CA 2Q7CA 1FZCB 1GU4A 4HYTB 3TSIA 3MTUE 2WSCH 1X9VA 1L0NK 2ZFCA 3WMM0 1HBWA 2IPPA 1CI6A 2HPCB 4WY4C 2C9NY 2WITA 3R2PA 2P7JA 1LWUC 2HODB 4AQRD 2N9BA 1DEBA 3O8ZA 3P8CE 4N6JA 1FU1A 1YYCA 3M0AA 2FFDA 3V2NA 3RK2B 2KSJA 1N73A 1SLQA 1VPCA 1XTCC 2JJLA 4GT1A 5APWA 1LTGC 2YNYA 3NFQA 1GK4A 1LT9C 1T2KD 2WT7B 1H88A 2OYHC 2KYVA 4IFMA 2FXMA 5AVXB 1GL2B 2FKWB 1L4AA 1NHLA 3V2QA 1JTHA 1YTZI 3OAKA 2WSEH 2WWWA 4LLHA 5AVQB 1RF1B 1JCCA 3CLQA 1IFJA 2YO3A 1N7SD 3BRTB 1ZLLA 4JF7A 3HD7A 3HE5A 2OYHA 1SQPK 5AW5B 3RK2C 2NPSC 3LIDA 2XZRA 2HLOA 1HTLC 1JY2N 2GUVA 1L0LK 5AW6B 1E5WA 1GL2D 3BRVB 1FDMA 3L36A 4Y99C 4EOTA 3U1CA 1GDTA 3VTPC 3GHGA 1FZBA 1KFMA 4W7YA 5AW1B 1KILC 2WZ7A 1KQLA 1DH3A 4GIFA 4OH8B 1NU1K 1JY3P 5AVSB 3M06A 3B5ND 1MV8A 3P8CD 1LWUA 2KOGA 1RF0C 2KLVA 2QM7A 1HGVA 1LTJA 5KTBA 5APYA 2Q3IA 1URQA 1WT6A 4XA4A 1CW5A 1L4AD 3B8EB 5CCHA 5KJ7C 2HYNA 3NTNA 1SQXK 3IR9A 1G1JA 3M0DA 4O9BA 2H43A 2PP6A 3V2RA 1JO5A 1SQQK 1ZV8A 2KB7P 1L4AC 1LTJB 3P8MC 3HD7D 3MD0A 3HE5B 1G2CB 2R32A 3LW5H 2NPSA 1N7SB 1JY2O 2ZXEB 2JEEA 1KFNA 3HUSA 5AW9B 4N3YB 2I1JA 2XV5A 2Z4EA 1FZGA 2W27A 3HD7C 3HRNA 1A02J 2IX7C 1T8ZA 1JTHB 1DX7A 3B5NA 4HH2A 3TK1A 1FZCC 4JYBA 2WT7A 1NAFA 3C9IA 1ZR2A 2PAJA 3L35A 1LWUB 1JMMA 1LT9A 3II6A 1EQ7A 1JUNA 1SVFA 3BATA 4ZKPA 4WY4B 1JOCA 4DZOA 1SFCD 3VMZA 2FYZA 2H7HA 5AW3B 3HUSB 1LTBC 4EIJA 5BVZA 2HODA 3U59A 4WY4A 2NPSB 1QL2A 1CZQA 4I2LC 2IFMA 5CJ0A 1AFOA 2OYHB 1HWTC 1AQ5A 3KYQA 4LGDE 5CCHD 2HPCA 3E1IA 1NKZB 4M3LA 3CL3D 1Z56A 4Y99B 1FJPA 1CSBA 1J1EC 2XU6A 1RF1C 1J1DB 1QL1A 2C0WA 2H8PD 2WSFH 2J59M 1XTGB 1T3JA 1M1JA 1M1JC 3HE4A 3M91A 2WPQA 2A45I 3OJAB 1MFZA 1RE3A 2N1TD 1N7LA 1IK9A 2N1TC 2Q5UA 1IFNA 1H89A 5AVRB 5AW0B 4W80A 2W6AA 2YMYA 1HGZA 1HUCA 4B86A 2O1KA 3M9QA 1GL2C 4W7ZA 1J1DC 5CCGC 2I1KA 5AVYB 4AYCA 2YKQA 1N73B 1FOSE 3RL0B 2FFDB 3VMYA 1S9KE 1JY3N 1SP4A 3TNUB 4N78E 3VMXA 1N7SA 1HH0A 1N7SC 4WBAA 3M0DC 1JNMA 3HUSC 3TYYA 3HE4B 1S9KD 3HD7B 1NWQA 3L4FA 2GUSA 1FOSF 1IFIA 5BU5A 3L37A 1RF1A 1FZCA 1RE4C 1NKNA 3V4QA 2NPSD 3G3ZA 1RF0A 3MUDA 1ZN5A 2E43A 3SWYA 4LC1A 3KPEA 3H32A 2YKOA 1OXZA 3RK3B 3U1AA 4C7NB 2QM8A 1GU5A 3A7OA 3UIAA 1RE3C 2M3BA 1PFIA 1NO4A 2R5DA 1RE4A 1N2DC 3HTKA 1T3UA 2WTYA 2FYUK 1M7LA 1LT9B 2VRSA 3CI9A 2MJZA 1FZFA 1FAVA 1GL2A 2C0XA 5CCHC 2XDJA 3A3YB 1RY3A 1NTKK 3GHGB 3H6PA 5AW4B 3HTKB 3B5NB 4ZKUA 3SWFA 1IFMA 1JY3O 3IFMA 4N78D 1FJKA 3N7NA 3M9BA 4I1LA 1LTTC 5CJ4A 1G2CA 1KILA 3T97A 1H8AA 1MZ9A 1NTMK 5CHXA 2W6BA 5KJ7A 1WRGA 1VDFA 1GW3A 4GKGA 1FZAA 2N1TA 5CCGA 1SQBK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IFN A;  2IFM A;  4IFM A;  3IFM A;  1QL1 A;  2KLV A;  1ZN5 A;  1QL2 A;  2IFN A;  2XKM A;  1PFI A;  2KSJ A;  1IFM A; 
#chains in the Genus database with same CATH topology
 2PRR A;  1SQQ E;  1IFD A;  2K3R A;  3AEB C;  3CX5 D;  4H13 B;  1AVY A;  2AXT H;  5GTH H;  3L75 G;  1URQ B;  4BRY B;  1KIL B;  5APV A;  3BAS A;  5KKZ B;  1BCC J;  1LTJ C;  2YXQ B;  4D6T G;  3Q3D A;  1URQ D;  5APT A;  4IFF A;  2WPR A;  2L5G B;  2POH A;  2IYP A;  1HVV A;  3RBZ A;  1NU1 E;  4GOF A;  1KOR A;  1GTW A;  2OYI B;  1QEX A;  1HJ0 A;  3L71 D;  2LR2 A;  3GG2 A;  2Q3E A;  1JCD A;  3RK3 C;  3RL0 D;  4RES B;  2AEM A;  1W5C E;  1BGY D;  2ZAE B;  3RL0 g;  3Q5R A;  4EYY Q;  1VQ4 P;  1OIP A;  1KV4 A;  3TGU E;  2J58 A;  3CC7 P;  3NXS A;  3H1L J;  1X0T A;  4BWN A;  2WPS A;  1SQV D;  1OW7 A;  3CX5 E;  3RGU A;  2YMK A;  1SQQ D;  4BRY A;  3SWK A;  2Q9I A;  4KHX A;  1NH4 A;  4JYC A;  5APS A;  1FZC A;  3PHL A;  1PGO A;  3MIW A;  1CI6 B;  2K37 A;  2ZT9 C;  4WB4 A;  4IL6 H;  1R8E A;  3MHV A;  2E42 A;  4IFD K;  2R5B A;  1EDL A;  1SQV J;  2L91 A;  1SFC B;  2O01 N;  3MGN A;  4D6T D;  3CXH D;  2Q6Q A;  5AW8 B;  1NTZ E;  1TU3 F;  1MKM A;  2FYU J;  4H0L D;  5AVZ B;  4EDF A;  1LP1 A;  1NTM G;  5B5E E;  2HFE D;  1LTI C;  2QJK B;  1YIJ P;  1X8Y A;  3VYI A;  2KUB A;  1RHZ B;  2O01 H;  2I8D A;  3B5N C;  2ITA A;  1J2J B;  3USS A;  1GZL A;  2A45 H;  2KSE A;  2Z5H A;  5AVW B;  3VMA A;  5APU A;  4C7N A;  4DJG A;  2E76 B;  1SS1 A;  2QE7 H;  2YIU C;  1M1J B;  4NPF X;  1IC2 A;  5CCG D;  2FFD C;  2B89 A;  1JY2 P;  2WSF J;  3P7K A;  4KT0 J;  1BGY G;  3V4W A;  1EXI A;  1G1I A;  3VP9 A;  5AVT B;  2Q1K A;  1YJN P;  1BE3 E;  3CCV P;  2C9L Y;  3A5T A;  1Y8A A;  5K5G B;  4DT0 A;  3CCE P;  1KD1 Q;  4XE5 B;  1H0T B;  3BVH A;  3AE9 C;  5KLI C;  1MUU A;  1N86 A;  2CPS A;  1KQF B;  3V2P A;  1KYO E;  1PP9 G;  3GF7 A;  2KNC A;  1SFC A;  2SPZ A;  4R4L A;  1S1C X;  1NOH A;  2M3E A;  2RN0 A;  2Z5I A;  1LNQ A;  3M9H A;  4OGQ D;  3EFG A;  3N4X A;  5KLV E;  3OA7 A;  2O1J A;  1K8A Q;  2P67 A;  1ZR4 A;  3V5B A;  1PPJ E;  3GHG C;  1FBM A;  4PV1 B;  5CMZ A;  4JPZ B;  2YO2 A;  1EZV E;  1GW4 A;  1L4A B;  2BAS A;  2KP8 A;  3RK2 D;  3CWB E;  1BE3 D;  3CXH I;  1GD2 E;  3L70 G;  1EDK A;  4ASV A;  1EXJ A;  1S2E A;  2H88 C;  5APX A;  1PV3 A;  1X79 B;  2QJY C;  3KDP B;  2QA4 P;  1SQV K;  1QVG O;  3CMA P;  1K05 A;  1LGH B;  1ZP0 C;  2FY8 A;  2OAR A;  3TNU A;  1URQ C;  2M0B A;  5BVZ A;  2QG4 A;  3PP5 A;  2KI7 B;  1FDO A;  5KKZ C;  1BCC E;  3BCC G;  3CCR P;  2OQQ A;  3VN0 A;  1NTK E;  3JSV C;  1VQN P;  5E79 H;  1LP1 B;  1VF5 D;  5KLV K;  1A02 F;  2NRG A;  1KIL D;  2YXR B;  1YTZ T;  3H1K J;  4L73 A;  1S5L E;  3KQG A;  1LTA C;  2HG5 D;  3OW2 O;  3L74 E;  5APQ A;  3LIE A;  1PGJ A;  2JO1 A;  2D2C C;  3EQ2 A;  3ZDM A;  5AW7 B;  2P2U A;  1KZU B;  1W2E A;  3H1K E;  3AE4 C;  1IJD B;  1YJW P;  4AUW A;  5AVV B;  3IF4 A;  1PIX A;  2W83 C;  5KAI E;  2YKP A;  4I6M C;  2LKM A;  4C7R A;  3VP8 A;  3L73 J;  1J1E B;  2P1J A;  1NJI Q;  2B87 B;  1M90 Q;  1NTZ K;  2ZVN B;  1UII A;  3KXD A;  1LTS C;  1N73 C;  1KB9 E;  2QSI A;  1OWA A;  3KZI H;  1NTK J;  2Y0C A;  2RMZ A;  3RK3 D;  3RL0 C;  3SFD C;  4DOJ A;  3A2A A;  1FZE A;  3FGA D;  5KJ7 D;  5CBN A;  3L73 E;  1EDI A;  2XKM A;  1OZH A;  2CK3 H;  2ZYG A;  4RKU J;  1MFT A;  1SFC C;  2XNX A;  3BCC D;  2Y9Y A;  2A45 G;  2K9J B;  2KS1 B;  2R3C A;  3PJS K;  3WU2 H;  3H32 B;  1GK6 A;  2OYI A;  2GM4 A;  3P32 A;  3NMD A;  2M8R A;  2WSS H;  4K35 A;  4WY4 D;  4QMA A;  5BU8 B;  1YQ4 C;  3H1H E;  3G4S P;  2FYN C;  2CPB A;  2ZYA A;  3CXH H;  3VOP A;  2JWD A;  3B71 A;  3A0B E;  5AVU B;  4C46 A;  5AW2 B;  3RK3 E;  2IFN A;  2YIU B;  5KAF E;  3Q1M A;  5KLV J;  3EFF K;  2O01 J;  2N1T B;  3H1I E;  1U7M A;  2V4H A;  3I5C A;  2Q7C A;  4H0L B;  1SQP G;  1GU4 A;  1FZC B;  2OTJ P;  1OVR A;  2BEZ F;  3SSU A;  4HYT B;  3TDK A;  1NTZ J;  3CCJ P;  3L73 D;  3TSI A;  3C1L A;  3MTU E;  3W68 A;  2WSC H;  1X9V A;  1L0N K;  1P84 H;  2ZFC A;  2K9Y A;  4H44 D;  2LXB A;  3WMM 0;  3L70 J;  1HBW A;  1SQX E;  2IPP A;  1CI6 A;  4H44 B;  4WY4 C;  1L0L D;  2HPC B;  2E75 B;  3S1K A;  2C9N Y;  2WIT A;  1PGQ A;  3A0H E;  4MN4 C;  4PD4 D;  4R4M A;  3FWL A;  2P7J A;  3H1H J;  3R2P A;  4RO0 A;  1LWU C;  1JB0 J;  3BCC J;  3G6E P;  5CBO A;  2HOD B;  4AQR D;  5GTI E;  2N9B A;  1YI2 P;  1DEB A;  1OVU A;  3AE1 C;  3O8Z A;  2KLU A;  3P8C E;  4N6J A;  1VQ5 P;  1L0L J;  1USE A;  1FU1 A;  1YYC A;  3M0A A;  2QJY B;  2FFD A;  3V2N A;  3RK2 B;  1X22 A;  2KSJ A;  1N73 A;  1SLQ A;  1VPC A;  1XTC C;  2JJL A;  1FDI A;  4GT1 A;  4PV1 D;  5APW A;  1LTG C;  2YNY A;  2Y9Z A;  3NFQ A;  1IO4 A;  1GK4 A;  1LT9 C;  1NU1 D;  1T2K D;  2WT7 B;  1H88 A;  1USD A;  2E74 D;  5TIS H;  2OYH C;  2KYV A;  2XND H;  4I7Z B;  3L73 G;  1UIX A;  2FXM A;  2FXP A;  2NZ2 A;  1GL2 B;  4IFM A;  4PJ0 H;  2FKW B;  5AVX B;  5M1B A;  2W90 A;  2K1A A;  1L4A A;  1NHL A;  4PD4 I;  3O6Q B;  3V2Q A;  2OYI C;  3AED C;  3TGU J;  1JTH A;  2LXC B;  1KQS O;  2KK7 A;  1ZXG A;  1YTZ I;  3CME P;  1L0L G;  4XFJ A;  3OAK A;  2WSE H;  2WWW A;  4EI2 A;  3CCM P;  1PGP A;  4LLH A;  5AVQ B;  1PPJ D;  3MZW B;  1RF1 B;  1M1K Q;  1JCC A;  3CLQ A;  3GW6 A;  1Q7Y Q;  1IFJ A;  4DCK A;  1JM0 A;  1QLE D;  2YO3 A;  1N7S D;  3BRT B;  2IDB A;  3SFE C;  1ZLL A;  2WPV B;  3E7K A;  4JF7 A;  2JDI H;  3HD7 A;  3L72 G;  2FYU G;  3JCU H;  2QJP C;  3HE5 A;  1R5S A;  4WWI A;  1SQP K;  2FYU D;  2OYH A;  3ABV C;  1VQ9 P;  1R5L A;  2ZVO B;  1L2P A;  3Q5P A;  1Y9B A;  1L0N D;  2QJK C;  3H1I J;  5AW5 B;  3RK2 C;  4ZMD A;  1NTK G;  2NPS C;  2XZR A;  2HLO A;  3CWB D;  1BCC G;  3LID A;  1HTL C;  4Y28 J;  2QEX P;  5C39 A;  1BCC D;  1JY2 N;  2GUV A;  1L0L K;  5AW6 B;  5DJU B;  1E5W A;  1GL2 D;  4GDO A;  4OGQ C;  1SQX G;  1LJ2 A;  3BRV B;  3IAO A;  3L70 E;  5H2F H;  4Z1M H;  1KC8 Q;  3CX5 H;  1FDM A;  1DIP A;  1SQV G;  3H1J J;  3PTZ A;  3L36 A;  4L76 A;  4Y99 C;  4PD4 E;  3U1C A;  4EOT A;  3VTP C;  2E5Y A;  3GHG A;  1GDT A;  1FZB A;  1KFM A;  1NVO A;  4W7Y A;  5B66 E;  5KLI B;  1SQP E;  5AW1 B;  1AQT A;  1KIL C;  1ZRT E;  2WZ7 A;  3H1I G;  5KLV G;  3L71 J;  2H89 C;  1KQL A;  1Q86 Q;  4GIF A;  1DH3 A;  1VQO P;  4OH8 B;  3CX5 I;  1KMI Z;  2J5U A;  1S4X A;  1BGY J;  1NTM D;  1NU1 K;  1VQP P;  1JY3 P;  1VL2 A;  3CCQ P;  5AVS B;  3AE6 C;  3L71 E;  3I56 P;  3AEE C;  3M06 A;  3B5N D;  1MV8 A;  3CWB J;  3PRJ A;  4YXW H;  1M57 D;  1BGY E;  1IZN B;  2D2C D;  2FYN B;  3H1H D;  1YBK A;  1PP9 J;  3P8C D;  4JBZ A;  2IBZ I;  2ZJS E;  1AJY A;  1LT1 A;  1LWU A;  2E75 D;  2KOG A;  1RF0 C;  2KLV A;  3H1L G;  1JMB A;  2QM7 A;  1HGV A;  1LTJ A;  3Q2Y A;  1NTM E;  5KTB A;  1HF9 A;  1M8O B;  2Q3I A;  4IOI H;  5APY A;  1QVF O;  1URQ A;  4ASW A;  1K04 A;  1EZV I;  3CC2 P;  1WT6 A;  4XA4 A;  1PP9 D;  1CW5 A;  1L4A D;  3E1R A;  3B8E B;  1KYO I;  5CCH A;  2P58 A;  5KJ7 C;  1PFI A;  1NU1 J;  2HYN A;  2IZ1 A;  1IK7 A;  3NTN A;  1SQX K;  3IR9 A;  1G1J A;  3M0D A;  4UB6 E;  4O9B A;  2H43 A;  2PP6 A;  2O3J A;  3V2R A;  1T6A A;  1JO5 A;  3L75 D;  1SQQ K;  1ZV8 A;  2KB7 P;  2E74 B;  3WUV A;  1L4A C;  1AVO A;  1LTJ B;  3P8M C;  4GOE A;  3TGU G;  4D6T J;  3HD7 D;  2B88 A;  2ZYD A;  2M5A B;  3T97 B;  3MD0 A;  3HE5 B;  3D6Z A;  1G2C B;  2R32 A;  3LW5 H;  1KIL E;  1YHQ P;  2NPS A;  1JEK A;  1JY2 O;  1N7S B;  1QX8 A;  2ZXE B;  1FC2 C;  2JEE A;  1KFN A;  2OGU A;  3CWB G;  3QWO C;  3HUS A;  5AW9 B;  1NU1 G;  1VQM P;  4N3Y B;  2I1J A;  2XV5 A;  2Z4E A;  4WVZ A;  1M56 D;  1FZG A;  1EDJ A;  2V7Q H;  3L72 E;  2W27 A;  3HD7 C;  1NGM B;  3HRN A;  1A02 J;  1HJB A;  2IX7 C;  1T8Z A;  1JTH B;  1DX7 A;  3B5N A;  3LW5 J;  1SQQ G;  1EZV D;  4HH2 A;  2PGD A;  1Q81 Q;  4PV1 C;  4H0L C;  2A06 D;  4JYB A;  3TK1 A;  5KAI H;  1FZC C;  2WT7 A;  3AEA C;  3H1J E;  2JR8 A;  1NAF A;  3C9I A;  1ZR2 A;  2PAJ A;  1LWU B;  1JMM A;  1BE3 G;  2AXT E;  3L35 A;  1LT9 A;  3II6 A;  5GTH E;  1EQ7 A;  1JUN A;  1OVV A;  1SVF A;  2JKV A;  3BAT A;  3L72 D;  1OW8 A;  4ZKP A;  3W67 A;  4WY4 B;  1PL5 A;  3FWN A;  1S3J A;  1JOC A;  4DZO A;  4GOD A;  1SFC D;  3VMZ A;  3CCS P;  2IBZ E;  4H13 D;  2FYZ A;  3WU2 E;  2H7H A;  5AW3 B;  3HUS B;  3D70 A;  1LTB C;  1Q90 D;  1SQQ J;  2GA1 A;  2HOD A;  3U59 A;  4WY4 A;  4EIJ A;  2NPS B;  1NYH A;  1QL2 A;  1VQL P;  1CZQ A;  1SQB G;  3CXH E;  4I2L C;  1NTZ G;  4YTP C;  2IFM A;  5CJ0 A;  1AFO A;  1SQX D;  5L8R J;  2OYH B;  1AA0 A;  3AE8 C;  3AEC C;  4K3A A;  3KYQ A;  4LGD E;  5CCH D;  2ZXX A;  5KAF H;  1RQV A;  2HPC A;  1HWT C;  1KTM A;  1DEE G;  3E1I A;  1YQ3 C;  4KJM A;  1NKZ B;  4M3L A;  3CL3 D;  1Z56 A;  3GF3 A;  4OWF A;  4Y99 B;  1VQ7 P;  1FJP A;  1CSB A;  3RBX A;  1J1E C;  2XU6 A;  1Y47 A;  1P84 E;  1BDD A;  1OFC X;  4IL6 E;  4NPD A;  3H25 A;  1RF1 C;  2AXC A;  1J1D B;  3Q5S A;  5KLV D;  2QIW A;  1QL1 A;  1FS0 E;  2IZ0 A;  2AEJ A;  2C0W A;  1PZQ A;  2H8P D;  2J59 M;  2WSF H;  5B5E H;  2ZT9 D;  1XTG B;  1T3J A;  1M1J A;  1M1J C;  3F5H A;  2FBW C;  3HE4 A;  3M91 A;  1KQG B;  2WPQ A;  2A45 I;  2K9J A;  4HB1 A;  2MKV A;  3OJA B;  4IL6 X;  2E74 C;  2KXP B;  1NTZ D;  1MFZ A;  1RE3 A;  2N1T D;  3H1H G;  3MP7 B;  1N7L A;  3S4R A;  1IK9 A;  4TLF A;  4A7P A;  4D6T E;  2N1T C;  3FXE A;  1ZME C;  2Q5U A;  1IFN A;  1H89 A;  2WSC J;  5AVR B;  5AW0 B;  4W80 A;  2W6A A;  2YMY A;  3IN6 A;  3CD6 P;  1HGZ A;  1KYO H;  1HUC A;  2WSE J;  1W2B O;  2A06 E;  5TJH A;  2IYO A;  2WQY C;  4B86 A;  2O1K A;  3O6Q A;  2RH0 A;  1EC5 A;  3M9Q A;  2E75 C;  1AV1 A;  1E79 H;  1GL2 C;  1OW6 A;  1S72 P;  2DW3 A;  1J1D C;  3H1J D;  4W7Z A;  1OX3 A;  5CCG C;  1P84 I;  2I1K A;  4HJG H;  5AVY B;  3S9O A;  4AYC A;  1BDC A;  3AE7 C;  2YKQ A;  3L70 D;  2AEF A;  2Y0E A;  3H1K D;  1N73 B;  1FOS E;  3RL0 B;  3H1K G;  3WUT A;  2FFD B;  2N9Y B;  3ITK A;  3VMY A;  3TGU D;  4ZNC A;  3JCU E;  1S9K E;  1QGK B;  1JY3 N;  1SP4 A;  3TNU B;  2Y0D A;  4N78 E;  3L74 G;  3VMX A;  3AE2 C;  2RKL A;  3WUU A;  5E79 E;  1L0N G;  2QJP B;  1N7S A;  1HH0 A;  1N7S C;  1NTK D;  1ZW0 A;  2E76 C;  2OYO A;  4RJT A;  2HR3 A;  4WBA A;  1S5L H;  3BCC E;  3CCU P;  2M5A A;  2KZJ A;  3M0D C;  2G8Y A;  1JNM A;  1NTM J;  3HUS C;  4TT3 H;  4YPC A;  3TYY A;  3HE4 B;  1S9K D;  1RH5 B;  1KB9 I;  4U3F J;  1N8R Q;  3HD7 B;  4NPE A;  1VF5 B;  1NWQ A;  3CPW O;  3AE5 C;  3L4F A;  1ZRT D;  2BCC G;  2GUS A;  1FOS F;  1IFI A;  1RQU A;  4OVN F;  5H2F E;  3GLM A;  1IFP A;  5BU5 A;  3FXD A;  1EZV G;  1K73 Q;  2KNC B;  4U3F E;  3L37 A;  2K88 A;  4PD4 H;  2V7Q J;  3L74 J;  1YIT P;  1RF1 A;  1PPJ G;  2B87 A;  2B9B A;  1RE4 C;  1S5L X;  3PLN A;  1NKN A;  3V4Q A;  5B66 H;  2NPS D;  2UWJ E;  2QRX A;  2P10 A;  3G3Z A;  3H1L E;  1RF0 A;  1KB9 H;  2E76 D;  3EWK A;  1P84 D;  3KZI E;  3MUD A;  3H1I D;  3TF5 A;  3AEG C;  4H44 C;  1ZN5 A;  3B4S A;  3V6I A;  1OMI A;  1PP9 E;  2E5T A;  2OTK E;  3I55 P;  2E43 A;  1FE6 A;  2R44 A;  3SWY A;  3L74 D;  4LC1 A;  3KPE A;  2BCC J;  1VQ8 P;  3D6Y A;  3H32 A;  2JWA A;  2YKO A;  1OXZ A;  2KS1 A;  3RK3 B;  3KHU A;  3U1A A;  2FXO A;  4C7N B;  3D71 A;  2QM8 A;  3L71 G;  3PH0 A;  1T2K C;  1GU5 A;  3A7O A;  3GMA A;  2D2C B;  1RE3 C;  2W6J H;  3QH9 A;  3UIA A;  1Q82 Q;  2M3B A;  1SQB D;  2KZI A;  3A0B H;  1GMJ A;  4L74 A;  1DD3 A;  1NO4 A;  2QVA A;  2R5D A;  2R3S A;  1RE4 A;  3F89 A;  1N2D C;  4OGQ B;  4CPG A;  1L0N J;  3HTK A;  1T3U A;  2BCC D;  3MUD C;  1DD4 A;  1VF5 C;  1KB9 D;  2WTY A;  2ZT9 B;  1SQP D;  2FYU K;  1M7L A;  4U3F D;  5DJT B;  1BSH A;  3R4Y A;  1LT9 B;  2VRS A;  3CI9 A;  4U3F G;  3AE3 C;  2MJZ A;  1SQV E;  4I7Z C;  3CC4 P;  1FZF A;  1FAV A;  1GL2 A;  4JQ0 D;  2KIK A;  2C0X A;  5CCH C;  2BCC E;  2XDJ A;  3A3Y B;  1RY3 A;  1NTK K;  3GHG B;  3H6P A;  1D7M A;  3A0H H;  5AW4 B;  3FX0 A;  3HTK B;  3B5N B;  3JC2 2;  2WVR A;  4H13 C;  4UB6 H;  4ZKU A;  1VQK P;  3SWF A;  4HKZ H;  2BEQ D;  1IFM A;  5GTI H;  1VQ6 P;  1JY3 O;  1L0N E;  1H0T A;  3IFM A;  4N78 D;  2PFX A;  3L72 J;  1FJK A;  3C8V A;  3G9R A;  4YXD C;  3N7N A;  2FYU E;  1WMK A;  1SQB E;  2WMM A;  2OTL P;  1ZOY C;  2W8Z A;  1AQ5 A;  3M9B A;  4I1L A;  1LTT C;  5CJ4 A;  1G2C A;  1U7J A;  4L75 A;  1KIL A;  2G3A A;  3T97 A;  1H8A A;  1YJ9 P;  4UB8 H;  3H1L D;  1NAY A;  1MZ9 A;  2IBZ G;  3L75 J;  3K5B A;  4BXL A;  1SQP J;  1KN7 A;  1NTM K;  1SQB J;  2IBZ D;  1BSN A;  5TIS E;  1Q2N A;  4UB8 E;  5CHX A;  1L0L E;  4U7J A;  4PJ0 E;  5EFW B;  1SQX J;  3CCL P;  2W6B A;  3L75 E;  1BE3 J;  3AEF C;  3H1J G;  5KJ7 A;  2A06 G;  1WRG A;  3G71 P;  1VDF A;  1GW3 A;  4GKG A;  1K9M Q;  1KYO D;  1FZA A;  1U57 A;  2N1T A;  5CCG A;  2JP3 A;  1SQB K; 
#chains in the Genus database with same CATH homology
 1IFD A;  1HJB A;  1URQ B;  1KIL B;  5APV A;  3BAS A;  1LTJ C;  1URQ D;  5APT A;  4IFF A;  2WPR A;  2L5G B;  2POH A;  1HVV A;  2OYI B;  1GTW A;  1JCD A;  3RK3 C;  3RL0 D;  4RES B;  2J58 A;  3NXS A;  2WPS A;  2Q9I A;  4KHX A;  1NH4 A;  4JYC A;  5APS A;  3MIW A;  1CI6 B;  4WB4 A;  2E42 A;  4IFD K;  2R5B A;  1SFC B;  3MGN A;  5AW8 B;  5AVZ B;  2HFE D;  1LTI C;  1X8Y A;  3VYI A;  2O01 H;  3B5N C;  1J2J B;  4C7N A;  1GZL A;  2A45 H;  2Z5H A;  5AVW B;  1T2K C;  2OYI C;  5APU A;  5CCG D;  2FFD C;  1M1J B;  1IC2 A;  3P7K A;  1JY2 P;  3V4W A;  1G1I A;  3VP9 A;  5AVT B;  2C9L Y;  3A5T A;  4XE5 B;  3BVH A;  1MUU A;  1N86 A;  2CPS A;  3V2P A;  1SFC A;  1NOH A;  2Z5I A;  3M9H A;  3EFG A;  3N4X A;  3OA7 A;  2O1J A;  2P67 A;  1ZR4 A;  3V5B A;  3GHG C;  1FBM A;  5CMZ A;  2YO2 A;  1GW4 A;  1L4A B;  2BAS A;  2KP8 A;  3RK2 D;  1GD2 E;  5APX A;  1X79 B;  3KDP B;  1SQV K;  1LGH B;  2OAR A;  3TNU A;  1URQ C;  3PP5 A;  3VN0 A;  5KLV K;  1A02 F;  1KIL D;  1YTZ T;  3KQG A;  1LTA C;  2HG5 D;  5APQ A;  3LIE A;  3EQ2 A;  5AW7 B;  2P2U A;  1KZU B;  1W2E A;  1IJD B;  4AUW A;  5AVV B;  4C7R A;  2YKP A;  4I6M C;  2LKM A;  3VP8 A;  1J1E B;  2P1J A;  1NTZ K;  1LTS C;  1N73 C;  1IO4 A;  4DOJ A;  1OWA A;  3RK3 D;  3RL0 C;  3A2A A;  1FZE A;  5KJ7 D;  2XKM A;  2XNX A;  1SFC C;  5BU8 B;  2OYI A;  2A45 G;  2R3C A;  2GM4 A;  3H32 B;  1GK6 A;  3P32 A;  3NMD A;  2M8R A;  4WY4 D;  2CPB A;  3VOP A;  5AVU B;  4C46 A;  5AW2 B;  2IFN A;  2N1T B;  3I5C A;  2Q7C A;  1FZC B;  1GU4 A;  4HYT B;  3TSI A;  3MTU E;  2WSC H;  1X9V A;  1L0N K;  2ZFC A;  3WMM 0;  1HBW A;  2IPP A;  1CI6 A;  2HPC B;  4WY4 C;  2C9N Y;  2WIT A;  3R2P A;  2P7J A;  1LWU C;  2HOD B;  4AQR D;  2N9B A;  1DEB A;  3O8Z A;  3P8C E;  4N6J A;  1FU1 A;  1YYC A;  3M0A A;  2FFD A;  3V2N A;  3RK2 B;  2KSJ A;  1N73 A;  1SLQ A;  1VPC A;  1XTC C;  2JJL A;  4GT1 A;  5APW A;  1LTG C;  2YNY A;  3NFQ A;  1GK4 A;  1LT9 C;  1T2K D;  2WT7 B;  1H88 A;  2OYH C;  2KYV A;  4IFM A;  2FXM A;  5AVX B;  1GL2 B;  2FKW B;  1L4A A;  1NHL A;  3V2Q A;  1JTH A;  1YTZ I;  3OAK A;  2WSE H;  2WWW A;  4LLH A;  5AVQ B;  1RF1 B;  1JCC A;  3CLQ A;  1IFJ A;  2YO3 A;  1N7S D;  3BRT B;  1ZLL A;  4JF7 A;  3HD7 A;  3HE5 A;  2OYH A;  1SQP K;  5AW5 B;  3RK2 C;  2NPS C;  3LID A;  2XZR A;  2HLO A;  1HTL C;  1JY2 N;  2GUV A;  1L0L K;  5AW6 B;  1E5W A;  1GL2 D;  3BRV B;  1FDM A;  3L36 A;  4Y99 C;  4EOT A;  3U1C A;  1GDT A;  3VTP C;  3GHG A;  1FZB A;  1KFM A;  4W7Y A;  5AW1 B;  1KIL C;  2WZ7 A;  1KQL A;  1DH3 A;  4GIF A;  4OH8 B;  1NU1 K;  1JY3 P;  5AVS B;  3M06 A;  3B5N D;  1MV8 A;  3P8C D;  1LWU A;  2KOG A;  1RF0 C;  2KLV A;  2QM7 A;  1HGV A;  1LTJ A;  5KTB A;  5APY A;  2Q3I A;  1URQ A;  1WT6 A;  4XA4 A;  1CW5 A;  1L4A D;  3B8E B;  5CCH A;  5KJ7 C;  2HYN A;  3NTN A;  1SQX K;  3IR9 A;  1G1J A;  3M0D A;  4O9B A;  2H43 A;  2PP6 A;  3V2R A;  1JO5 A;  1SQQ K;  1ZV8 A;  2KB7 P;  1L4A C;  1LTJ B;  3P8M C;  3HD7 D;  3MD0 A;  3HE5 B;  1G2C B;  2R32 A;  3LW5 H;  2NPS A;  1N7S B;  1JY2 O;  2ZXE B;  2JEE A;  1KFN A;  3HUS A;  5AW9 B;  4N3Y B;  2I1J A;  2XV5 A;  2Z4E A;  1FZG A;  2W27 A;  3HD7 C;  3HRN A;  1A02 J;  2IX7 C;  1T8Z A;  1JTH B;  1DX7 A;  3B5N A;  4HH2 A;  3TK1 A;  1FZC C;  4JYB A;  2WT7 A;  1NAF A;  3C9I A;  1ZR2 A;  2PAJ A;  3L35 A;  1LWU B;  1JMM A;  1LT9 A;  3II6 A;  1EQ7 A;  1JUN A;  1SVF A;  3BAT A;  4ZKP A;  4WY4 B;  1JOC A;  4DZO A;  1SFC D;  3VMZ A;  2FYZ A;  2H7H A;  5AW3 B;  3HUS B;  1LTB C;  4EIJ A;  5BVZ A;  2HOD A;  3U59 A;  4WY4 A;  2NPS B;  1QL2 A;  1CZQ A;  4I2L C;  2IFM A;  5CJ0 A;  1AFO A;  2OYH B;  1HWT C;  1AQ5 A;  3KYQ A;  4LGD E;  5CCH D;  2HPC A;  3E1I A;  1NKZ B;  4M3L A;  3CL3 D;  1Z56 A;  4Y99 B;  1FJP A;  1CSB A;  1J1E C;  2XU6 A;  1RF1 C;  1J1D B;  1QL1 A;  2C0W A;  2H8P D;  2WSF H;  2J59 M;  1XTG B;  1T3J A;  1M1J A;  1M1J C;  3HE4 A;  3M91 A;  2WPQ A;  2A45 I;  3OJA B;  1MFZ A;  1RE3 A;  2N1T D;  1N7L A;  1IK9 A;  2N1T C;  2Q5U A;  1IFN A;  1H89 A;  5AVR B;  5AW0 B;  4W80 A;  2W6A A;  2YMY A;  1HGZ A;  1HUC A;  4B86 A;  2O1K A;  3M9Q A;  1GL2 C;  4W7Z A;  1J1D C;  5CCG C;  2I1K A;  5AVY B;  4AYC A;  2YKQ A;  1N73 B;  1FOS E;  3RL0 B;  2FFD B;  3VMY A;  1S9K E;  1JY3 N;  1SP4 A;  3TNU B;  4N78 E;  3VMX A;  1N7S A;  1HH0 A;  1N7S C;  4WBA A;  3M0D C;  1JNM A;  3HUS C;  3TYY A;  3HE4 B;  1S9K D;  3HD7 B;  1NWQ A;  3L4F A;  2GUS A;  1FOS F;  1IFI A;  5BU5 A;  3L37 A;  1RF1 A;  1FZC A;  1RE4 C;  1NKN A;  3V4Q A;  2NPS D;  3G3Z A;  1RF0 A;  3MUD A;  1ZN5 A;  2E43 A;  3SWY A;  4LC1 A;  3KPE A;  3H32 A;  2YKO A;  1OXZ A;  3RK3 B;  3U1A A;  4C7N B;  2QM8 A;  1GU5 A;  3A7O A;  3UIA A;  1RE3 C;  2M3B A;  1PFI A;  1NO4 A;  2R5D A;  1RE4 A;  1N2D C;  3HTK A;  1T3U A;  2WTY A;  2FYU K;  1M7L A;  1LT9 B;  2VRS A;  3CI9 A;  2MJZ A;  1FZF A;  1FAV A;  1GL2 A;  2C0X A;  5CCH C;  2XDJ A;  3A3Y B;  1RY3 A;  1NTK K;  3GHG B;  3H6P A;  5AW4 B;  3HTK B;  3B5N B;  4ZKU A;  3SWF A;  1IFM A;  1JY3 O;  3IFM A;  4N78 D;  1FJK A;  3N7N A;  3M9B A;  4I1L A;  1LTT C;  5CJ4 A;  1G2C A;  1KIL A;  3T97 A;  1H8A A;  1MZ9 A;  1NTM K;  5CHX A;  2W6B A;  5KJ7 A;  1WRG A;  1VDF A;  1GW3 A;  4GKG A;  1FZA A;  2N1T A;  5CCG A;  1SQB K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...