2XKMA

Consensus structure of pf1 filamentous bacteriophage from x-ray fibre diffraction and solid-state nmr
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords CAPSID PROTEIN G8P
publication title Consensus Structure of Pf1 Filamentous Bacteriophage from X-Ray Fibre Diffraction and Solid-State NMR.
pubmed doi rcsb
molecule tags Viral protein
total genus 19
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2010-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2xkmA00
4IFMA 2XKMA 1QL1A 1PFIA 2KSJA 2IFMA 3IFMA 2IFNA 1IFMA 1IFNA 1QL2A 2KLVA 1ZN5A
chains in the Genus database with same CATH superfamily
1BDCA 1L0NK 3CLQA 1J1EC 1GU4A 2KS1A 4I1LA 3KDPB 3H32A 1LWUA 3M9HA 2OARA 2OYOA 1PP9E 3KPEA 4PD4D 4NPEA 2RH0A 4ASVA 2KB7P 2WSSH 3HTKA 4H13B 3L75D 3CC4P 3G71P 4PD4H 1VQLP 2ZAEB 1QLED 2IFNA 1PGQA 1FZGA 1JCCA 2J5UA 1GW4A 1NTKJ 1Q2NA 1L0NG 4RKUJ 2R3SA 1R5LA 5AVVB 3RK2C 2L5GB 2PRRA 3BCCE 3H1HD 2A06G 2I1KA 3OA7A 1E5WA 3RK2D 1H88A 1JY3N 1KORA 2LKMA 2Y0EA 1EDKA 4PV1D 3AE6C 1NU1J 1NHLA 4JPZB 3MIWA 1KC8Q 2HPCA 4U3FE 1URQB 1QX8A 2M3EA 2E76C 3FX0A 5DJUB 3ABVC 4OVNF 1IO4A 1N86A 3L72D 1IFIA 2E76D 1NTZD 1SQPK 1PV3A 2IYPA 3RK3D 3H6PA 2BEQD 2WVRA 3LW5H 1AVOA 1FBMA 4GDOA 1N7SB 3AEFC 4DCKA 2RKLA 1N73B 5AW5B 1KILD 3O8ZA 4PJ0E 2KNCB 2C9NY 1YHQP 2ZT9B 1SQBE 1JUNA 1JMBA 5AVUB 1YJNP 4JBZA 1EZVG 2YIUC 1SQPG 3NXSA 3CMAP 4IFFA 5AW1B 1OIPA 4WVZA 2IZ0A 2OQQA 1GK4A 1EXIA 3S9OA 1EZVD 4D6TG 5CCHD 1KD1Q 3RBXA 1Q90D 2M8RA 1JB0J 1BCCE 1LP1A 4LC1A 3CWBD 1L0LE 3H1KG 3WU2H 1SS1A 3RK3B 1EDJA 3L74E 3T97B 2E5TA 3NFQA 1LTJB 1JO5A 2K9YA 2J58A 1SQXJ 2YKQA 1CSBA 2KIKA 4K35A 4OGQB 1HGVA 3AEDC 2K9JB 1YTZT 1JTHA 4KJMA 3SFEC 1NKNA 1Z56A 3CC7P 5CJ4A 2OYIA 3TNUA 2IBZG 3L70G 3W67A 2YMKA 1JY2O 4C7RA 1GTWA 4I2LC 2OGUA 1P84I 1VQ6P 1VQ7P 2W6BA 5GTHH 1IK9A 1VL2A 2K88A 1X8YA 5CCGD 1L0NE 2I8DA 1G2CA 3KZIE 2OYHA 3L71G 2IBZD 3L73D 2H89C 1VF5C 1CI6A 1CZQA 4XA4A 2A06E 1NTMJ 1T8ZA 5APVA 1N2DC 1HWTC 3C1LA 3H1JJ 1NTKK 1K73Q 1VF5D 2WZ7A 2AEMA 2KSJA 1PGOA 4TT3H 1J1DC 2A45G 4MN4C 3GHGB 4YXDC 4O9BA 2AEJA 1FOSF 4IFDK 3AE1C 2ZXEB 1BE3G 3VP9A 1OX3A 3MP7B 1IFPA 2XDJA 4EI2A 4OWFA 4ZKUA 3H1IJ 1S4XA 4JF7A 2KP8A 1HBWA 1EXJA 1KQFB 5AW3B 1NU1K 4W80A 1FDOA 1NTKG 2A45H 5AVTB 4BRYB 3ZDMA 5B5EH 1RQVA 2N1TC 1HF9A 2GA1A 3IF4A 4A7PA 1VQMP 1FZCC 3MGNA 4WY4B 3IAOA 4ZKPA 4W7ZA 2QJKB 1M8OB 1NTKD 2HYNA 4UB8H 3MZWB 5CCGA 2DW3A 2XU6A 3SWYA 2JJLA 2M5AA 2H88C 2PP6A 4XE5B 3AEAC 1LT9B 1SQQK 1NU1G 1SQPE 2D2CB 2NPSC 2Z5HA 3WU2E 2ZYAA 1RF0C 1M1JC 3HD7C 3PTZA 4D6TE 1NU1D 3L35A 2BCCG 1ZRTD 3HD7D 2HR3A 3H1KE 4GODA 3CL3D 1SQQG 4K3AA 5KLVJ 1E79H 1N8RQ 4JYCA 3B5ND 2P1JA 1AA0A 1LWUC 3VMXA 2CK3H 2HG5D 5GTHE 2C0XA 2J59M 2O3JA 4L73A 5KKZC 1SQVE 2FYUJ 4H44C 1SQQD 1VQ9P 1KB9E 1X22A 3B4SA 3HUSA 1SVFA 1FZEA 2I1JA 3L70E 1KYOH 1IJDB 3CI9A 1JY2N 4N6JA 4YPCA 3TGUG 1FZCA 1OXZA 5H2FH 2E74C 3EFFK 2WPQA 1W2BO 1FAVA 5KAFE 5AVWB 1S9KD 4H13D 2FKWB 3L71E 5KLIB 3V2RA 3GW6A 1S3JA 2HODB 1QVFO 1FZAA 3MD0A 1L4AB 1MFZA 3V2QA 5KAIH 3CPWO 2Q9IA 5AVRB 2R5DA 1RF0A 2E75B 5TISH 1M1JA 1NKZB 3HD7A 5AVSB 1GL2D 2YKPA 1USDA 5EFWB 1WT6A 1BGYJ 2IDBA 1NO4A 2FY8A 3B5NA 3HRNA 1ZR4A 1BE3E 3I56P 3C9IA 1URQC 2WT7A 1CW5A 1SQXD 2QJPB 4WB4A 3L75G 1IK7A 1R8EA 4AUWA 3V6IA 4YTPC 2N9BA 1A02J 4XFJA 1URQD 1R5SA 3H32B 5AW2B 4Y28J 3Q3DA 1VQ5P 1BSNA 1H0TA 2HFED 1Y47A 2IX7C 1S5LH 3OJAB 1IFJA 2YMYA 3MTUE 3I55P 3VOPA 1M56D 1N7SC 3H1HG 1EDIA 2YXQB 1N73C 4HB1A 4JYBA 2V7QJ 3BRVB 3GG2A 3BRTB 5CMZA 3V5BA 1NTZK 1DEEG 1DEBA 3VMAA 3W68A 1N7SD 2ZT9C 3AE2C 5C39A 3WMM0 3Q5RA 4W7YA 3F89A 5AW9B 5E79E 2FYNB 1ZRTE 1GL2B 2KUBA 4PV1C 1PPJD 1PP9J 5AVYB 2ZT9D 4ZMDA 1TU3F 2W6JH 1OW8A 1JOCA 2VRSA 3H1JD 4UB6H 2CPBA 1GD2E 3L72G 2AEFA 1GW3A 2BCCE 3VMYA 3KXDA 1NTZG 1IFMA 1EDLA 2R3CA 4LLHA 3H1LG 2HPCB 2NZ2A 3S1KA 3FWLA 5AW6B 1SQQE 2XNXA 3RK3C 2JWAA 1KYOE 3BCCJ 3A2AA 2QVAA 4C7NB 1SFCB 3RL0B 1RE4C 1URQA 1NH4A 1S5LX 2OYIC 1KILC 5H2FE 1RHZB 3H1LD 4CPGA 2MJZA 1HTLC 1J1EB 1DD4A 2E42A 1MUUA 1K04A 2OTKE 4OGQD 4U3FJ 2G3AA 2GUSA 3O6QB 3CX5E 2IPPA 3TGUE 2OYHC 1N7SA 3AEEC 1N73A 1GMJA 4HKZH 4M3LA 2KNCA 1W2EA 2ZFCA 2W6AA 3F5HA 3V2NA 3BASA 1N7LA 3CWBG 1YTZI 5CCHC 1GK6A 2H8PD 1KMIZ 3SSUA 1T6AA 4GKGA 3JC22 2O01J 1XTGB 1FU1A 2P2UA 3RL0g 5KTBA 1A02F 1SQBJ 1AQ5A 2Q3EA 5KLVD 3CCEP 1S5LE 3M91A 3A7OA 3PRJA 4PD4E 3D6YA 2ZVNB 3P8CD 3V4WA 3SWFA 3AE9C 3L75E 3PP5A 4N3YB 4N78D 2FYUD 3T97A 2ZYGA 1LTJA 2Y0DA 3PJSK 3NMDA 1L2PA 1RE4A 1KILA 1BCCJ 1KFNA 1IFNA 3L73G 4I7ZC 5CCGC 1UIIA 2K9JA 2QG4A 4YXWH 1L0LJ 1RF1C 2P10A 1AFOA 3H1HE 1GZLA 1PGJA 3G3ZA 3L74J 2QJKC 1P84D 4Y99C 2UWJE 1OW6A 3CCMP 1QGKB 2BASA 1P84H 3KYQA 3RGUA 1KB9I 4WY4D 1WMKA 1NVOA 2ZXXA 3E1RA 1AVYA 2W27A 1VQKP 4R4MA 2WSCH 2RN0A 4WWIA 5CCHA 1ZXGA 3A3YB 2E5YA 4KHXA 1LGHB 1LT1A 2D2CD 3L72E 2YO2A 3R2PA 2KZIA 1BGYD 3CXHD 1NTZE 1HJBA 4Z1MH 3Q5SA 3FGAD 3H1LE 1H8AA 1L0NJ 3BVHA 3M0DC 3RK3E 3CCQP 2Q1KA 1ZR2A 4AYCA 2RMZA 3CC2P 3CXHH 2OTJP 2LXCB 3HE5B 3GHGA 5L8RJ 2WSEJ 3G6EP 1KILE 2ZJSE 3FWNA 3B71A 4RESB 2KSEA 2A45I 1LTBC 3HUSC 1FC2C 1QEXA 3AE7C 1S2EA 2SPZA 3EFGA 2QIWA 1JY2P 2P58A 2WWWA 5BU8B 2W90A 1NWQA 3EWKA 3SWKA 4BRYA 1MZ9A 1RF1A 1ZV8A 2LXBA 3M9BA 1HUCA 2WMMA 4WBAA 1S1CX 2R44A 3P32A 3AEGC 1EZVE 5APTA 3FXDA 2QJYC 1LTGC 1PP9D 3OAKA 2B89A 1T2KD 1K8AQ 2Z5IA 2NRGA 3CWBE 3CCRP 1M1KQ 4IFMA 1PIXA 2R32A 2PAJA 1JCDA 1L4AC 4DT0A 3U1CA 3B5NC 1X9VA 1SP4A 4R4LA 5APXA 1L4AD 2ZYDA 3Q1MA 3IN6A 1FZBA 3BCCD 1SQPJ 3D71A 2E75D 3M0DA 1YI2P 5AW4B 3TYYA 4GT1A 3IR9A 3CD6P 3M9QA 1JMMA 3M0AA 2Q3IA 3VTPC 2AXCA 1KQLA 2H43A 2M3BA 1ZMEC 4D6TJ 1P84E 3JCUH 2O1JA 2IBZE 1NAFA 4U3FD 3L73E 4U7JA 1SQXK 3U1AA 1KYOI 1Q7YQ 3H1KJ 1VQPP 3AECC 4H13C 3A0BH 2Q7CA 2N1TB 5AVZB 3HE4B 2C9LY 1KQGB 2P7JA 1VQ8P 2Y0CA 5KJ7C 1GU5A 1ZN5A 2JDIH 5APWA 2Q5UA 1SQVJ 2B87B 2H7HA 1JY3P 2XNDH 3LIEA 2KZJA 1YJ9P 3CXHE 2FYNC 4H0LB 2FXOA 2NPSB 1GL2C 5KJ7D 2QA4P 3CX5I 1K9MQ 1RH5B 1SQXG 3P7KA 3L70J 1HVVA 2K37A 1FDIA 2IZ1A 2JO1A 2HODA 4PJ0H 1IZNB 4GIFA 1L4AA 5B5EE 1VQ4P 1AQTA 1MKMA 1UIXA 1NTMK 3R4YA 2KXPB 2GM4A 2GUVA 3UIAA 2P67A 2FFDB 3L71J 3L4FA 3OW2O 3PLNA 4DJGA 2FBWC 4UB8E 1H89A 2KS1B 2WTYA 3L74G 1NGMB 1SFCC 1AJYA 2WPSA 3RL0C 5BVZA 1LWUB 3RBZA 1NTKE 1YQ4C 1HGZA 4RO0A 5AW7B 1BCCD 3VYIA 1QVGO 3WUTA 1H0TB 5KKZB 1SFCD 1L0LD 4H44B 3HTKB 3RL0D 1OMIA 2G8YA 1YBKA 4PD4I 1NTMG 1SLQA 1PPJG 3V2PA 3L74D 1BE3J 2FFDA 4OH8B 1JM0A 3H1JG 1FE6A 2JKVA 1LTTC 2KLUA 2JWDA 3P8MC 1NU1E 2E74B 1XTCC 3E1IA 2AXTH 3AE4C 1NTMD 5KJ7A 1OZHA 2O1KA 1S72P 3H1IG 1FJKA 1U57A 1GL2A 1M90Q 1Y9BA 4IL6H 5K5GB 1OWAA 3JSVC 4RJTA 3MUDC 1G1IA 1L0ND 2L91A 1FOSE 2KI7B 3JCUE 2QM7A 3H1ID 3SFDC 2O01N 2KOGA 3KZIH 1LJ2A 2A06D 1LTJC 1J2JB 3A0BE 2Q6QA 3KHUA 2MKVA 3WUUA 2YNYA 2WSEH 3D70A 4LGDE 3IFMA 1EC5A 2W8ZA 4OGQC 2PGDA 1Q81Q 5BU5A 2XZRA 4C7NA 1SFCA 5APQA 5KLVK 1RE3C 2BCCJ 1NAYA 1S9KE 1BDDA 3MHVA 4EDFA 1EQ7A 5KAIE 1QL2A 1YITP 1SQQJ 2Y9ZA 2IFMA 3PH0A 1ZW0A 2FYUK 5TISE 3U59A 2POHA 4BWNA 5DJTB 2OTLP 1RQUA 2E43A 3FXEA 3O6QA 3GF7A 2WSFJ 3RK2B 3GMAA 3TK1A 3PHLA 3USSA 3ITKA 4I6MC 1DX7A 1LNQA 1WRGA 4IL6X 5KLVG 2IYOA 1IC2A 4L76A 4PV1B 1FDMA 1VQOP 4GOEA 1M7LA 2QEXP 1SQXE 1USEA 1OW7A 3VN0A 3I5CA 1LP1B 1JEKA 3TGUJ 1EZVI 1KN7A 2FYUG 1SQVK 3GHGC 1YJWP 2XKMA 1FZFA 3MUDA 1SQPD 3L37A 3CCJP 3BATA 2K1AA 2W83C 2E76B 3AE3C 3Q2YA 4AQRD 1D7MA 5B66H 2QE7H 1JTHB 4TLFA 3WUVA 2FXMA 2HLOA 4D6TD 4EYYQ 2OYIB 1KILB 3KQGA 2AXTE 2ZVOB 3TNUB 1VDFA 2JR8A 1SQVG 5APUA 3H1KD 1RE3A 4UB6E 3NTNA 2JEEA 1NTME 3EQ2A 1PPJE 4WY4C 4DOJA 3QWOC 3H1JE 2QSIA 3Q5PA 1KTMA 4IL6E 1M57D 1G2CB 2OYHB 3L75J 2KK7A 5APYA 2B9BA 1K05A 1SQVD 4EIJA 1LT9C 1CI6B 2YIUB 1BGYG 3TSIA 2IBZI 2D2CC 1KB9D 2WQYC 1GDTA 1X79B 3M06A 2KLVA 1DIPA 3GLMA 2FYZA 3H1IE 3LIDA 3L70D 1KB9H 1VPCA 1PFIA 2C0WA 5AW0B 3H1HJ 2QM8A 1KV4A 3C8VA 3D6ZA 3II6A 2Y9YA 3CCVP 1HJ0A 1YQ3C 2M0BA 3VP8A 1PZQA 3L71D 5M1BA 2KYVA 3QH9A 3CXHI 1HH0A 5KAFH 2YO3A 2V4HA 2BEZF 5TJHA 1FS0E 3AE5C 4NPFX 3CCLP 3HE5A 1ZOYC 2FXPA 1FJPA 3L72J 1MV8A 2WITA 3B8EB 1NTZJ 3LW5J 1OFCX 1PP9G 1BSHA 3H1LJ 3A5TA 1BE3D 1DD3A 3G9RA 4I7ZB 1Y8AA 1RF1B 2K3RA 2V7QH 2YXRB 2M5AB 5GTIH 3A0HH 5CHXA 1T2KC 3AE8C 1IFDA 4WY4A 4DZOA 1AV1A 4NPDA 4Y99B 3L36A 2N1TD 5KLIC 1YIJP 1KQSO 1LT9A 1VF5B 3V4QA 5KLVE 1OVRA 5APSA 3BCCG 1ZP0C 4H0LC 3P8CE 5B66E 4JQ0D 1JY3O 4EOTA 1LTAC 3TF5A 3CCSP 2E75C 2Z4EA 4N78E 2YKOA 1J1DB 4H0LD 2FYUE 2NPSD 3TDKA 5CBNA 1LTSC 3S4RA 1T3JA 2XV5A 4U3FG 1NOHA 4KT0J 4B86A 2FFDC 1NJIQ 3CWBJ 5E79H 2ITAA 3K5BA 2QJPC 1U7MA 1VQNP 5CJ0A 2CPSA 1SQBK 1T3UA 5AW8B 2JP3A 2BCCD 1PGPA 1KZUB 3HUSB 3AEBC 4GOFA 1MFTA 1KFMA 1YYCA 2WPRA 1JNMA 2LR2A 4HJGH 4QMAA 1DH3A 1FZCB 1KYOD 2PFXA 2B88A 5AVQB 3G4SP 1OVVA 4H44D 1U7JA 1ZLLA 4HYTB 1SQBG 2N1TA 1L0LK 3HE4A 4C46A 1BGYE 2WPVB 2WSFH 3N4XA 3E7KA 3H25A 2QJYB 4L75A 3CCUP 3GF3A 3L73J 3VMZA 2R5BA 2B87A 3CX5D 1M1JB 2WSCJ 2E74D 1W5CE 3TGUD 4HH2A 5AVXB 1SQBD 4L74A 3HD7B 1RY3A 2N9YB 3CMEP 4BXLA 1PL5A 2NPSA 2O01H 3CX5H 1G1JA 5CBOA 1OVUA 1X0TA 3B5NB 1BCCG 4IOIH 2WT7B 1QL1A 1L0LG 1Q86Q 1LTIC 3N7NA 3A0HE 5GTIE 1NYHA 2QRXA 4ASWA 4ZNCA 1Q82Q
chains in the Genus database with same CATH topology
1L0NK 2IFMA 2W27A 2FYUK 3CLQA 3HD7D 1J1EC 3U59A 1GU4A 2WSCH 2POHA 3CL3D 4I1LA 5CCHA 3KDPB 3H32A 2E43A 1LWUA 3M9HA 3A3YB 2OARA 4KHXA 4JYCA 3B5ND 1LGHB 3RK2B 3KPEA 2P1JA 2YO2A 3R2PA 3TK1A 4I6MC 1DX7A 1LWUC 3VMXA 2KB7P 1WRGA 2HG5D 3HTKA 1HJBA 2C0XA 1H8AA 2J59M 1IC2A 3BVHA 3M0DC 2IFNA 1FDMA 1ZR2A 1FZGA 4AYCA 1M7LA 1JCCA 3VN0A 1GW4A 3HE5B 3I5CA 3GHGA 5AVVB 3RK2C 3HUSA 1SVFA 1SQVK 1FZEA 2L5GB 2I1JA 3GHGC 2XKMA 4RESB 1IJDB 3CI9A 1JY2N 4N6JA 1FZFA 2A45I 3MUDA 1LTBC 3HUSC 3L37A 2I1KA 3OA7A 1FZCA 3BATA 1E5WA 3RK2D 1OXZA 1H88A 1JY3N 2WPQA 1FAVA 2LKMA 5AVWB 4AQRD 3EFGA 1S9KD 1JY2P 2WWWA 5BU8B 1NWQA 2FKWB 1JTHB 3V2RA 1MZ9A 2FXMA 2HLOA 1NHLA 2OYIB 1RF1A 1KILB 1ZV8A 2HODB 3KQGA 1FZAA 3TNUB 3M9BA 3MIWA 3MD0A 1HUCA 1L4AB 1MFZA 2HPCA 4WBAA 1VDFA 3V2QA 1URQB 3P32A 5APUA 5APTA 1RE3A 2Q9IA 5AVRB 2R5DA 3NTNA 1IO4A 1RF0A 2JEEA 1LTGC 1M1JA 1N86A 3EQ2A 3OAKA 1NKZB 1T2KD 4WY4C 2Z5IA 3HD7A 4DOJA 5AVSB 1GL2D 2YKPA 1IFIA 4IFMA 1WT6A 2R32A 1SQPK 1G2CB 1NO4A 2PAJA 2OYHB 3B5NA 3HRNA 5APYA 1ZR4A 3RK3D 3H6PA 1JCDA 1L4AC 4EIJA 1LT9C 3C9IA 1CI6B 1URQC 3U1CA 2WT7A 1CW5A 3LW5H 3TSIA 1FBMA 3B5NC 4WB4A 1N7SB 1X9VA 1SP4A 1N73B 5AW5B 1GDTA 1KILD 1X79B 3M06A 4AUWA 2KLVA 3O8ZA 5APXA 2FYZA 1L4AD 2N9BA 1A02J 1URQD 3LIDA 3H32B 5AW2B 1VPCA 2C9NY 1PFIA 1FZBA 2C0WA 5AW0B 1JUNA 3M0DA 2QM8A 2HFED 5AW4B 4GT1A 5AVUB 3TYYA 3IR9A 2IX7C 3M9QA 1IFJA 3OJAB 3II6A 1JMMA 2YMYA 3MTUE 3M0AA 3VOPA 1N7SC 3NXSA 2Q3IA 1N73C 3VP8A 4IFFA 4JYBA 5AW1B 2KYVA 3BRVB 3VTPC 1KQLA 3BRTB 2H43A 1HH0A 2M3BA 1GK4A 5CMZA 1NTZK 3V5BA 2YO3A 1DEBA 2O1JA 1N7SD 3WMM0 1NAFA 4W7YA 1SQXK 3U1AA 5AW9B 5CCHD 2Q7CA 3HE5A 1GL2B 2M8RA 2N1TB 5AVZB 3HE4B 5AVYB 1FJPA 4LC1A 1MV8A 2WITA 1JOCA 2C9LY 2VRSA 3B8EB 3RK3B 2CPBA 1GD2E 2P7JA 5KJ7C 1GU5A 1ZN5A 3A5TA 3NFQA 5APWA 1LTJB 2Q5UA 1JO5A 1GW3A 3VMYA 2J58A 2H7HA 1JY3P 1RF1B 3LIEA 2YKQA 1CSBA 1IFMA 5CHXA 2R3CA 1HGVA 4LLHA 1T2KC 2NPSB 1GL2C 5KJ7D 2HPCB 1IFDA 4WY4A 1YTZT 4DZOA 1JTHA 5AW6B 1NKNA 1Z56A 3P7KA 2XNXA 1HVVA 4Y99B 3RK3C 5CJ4A 3L36A 2OYIA 3A2AA 2HODA 4C7NB 1SFCB 2N1TD 3TNUA 3RL0B 4GIFA 1L4AA 1LT9A 1RE4C 1URQA 1NH4A 3V4QA 2OYIC 5APSA 1KILC 1JY2O 1NTMK 4C7RA 1GTWA 4I2LC 2MJZA 2GM4A 2GUVA 3UIAA 1HTLC 3P8CE 1J1EB 2P67A 2FFDB 2E42A 1MUUA 2W6BA 1JY3O 1IK9A 3L4FA 1X8YA 5CCGD 1LTAC 4EOTA 1H89A 2Z4EA 4N78E 2YKOA 1J1DB 1G2CA 2OYHA 2NPSD 2WTYA 1SFCC 2WPSA 1LTSC 3RL0C 5BVZA 2GUSA 1LWUB 1CI6A 1CZQA 2IPPA 1HGZA 2OYHC 4XA4A 5AW7B 1T3JA 1N7SA 2XV5A 3VYIA 1T8ZA 1N73A 5APVA 1NOHA 1N2DC 1HWTC 4B86A 1SFCD 2FFDC 3HTKB 3RL0D 4M3LA 1NTKK 1W2EA 2ZFCA 2WZ7A 2KSJA 5CJ0A 2CPSA 1SQBK 1T3UA 2W6AA 1SLQA 3V2NA 3V2PA 5AW8B 1J1DC 2A45G 3BASA 2FFDA 4OH8B 1YTZI 5CCHC 3GHGB 4O9BA 1KZUB 1GK6A 1LTTC 1FOSF 2H8PD 4IFDK 3HUSB 2ZXEB 3VP9A 1KFMA 1YYCA 2WPRA 1JNMA 3P8MC 2XDJA 1XTCC 3E1IA 4GKGA 4ZKUA 1DH3A 4JF7A 1XTGB 1FU1A 2KP8A 2P2UA 1FZCB 1HBWA 5KJ7A 5KTBA 1A02F 1AQ5A 2O1KA 5AVQB 5AW3B 1NU1K 4W80A 3M91A 1ZLLA 3A7OA 1FJKA 2A45H 4HYTB 5AVTB 1GL2A 2N1TA 3P8CD 1L0LK 3HE4A 3V4WA 1OWAA 4C46A 3SWFA 2WSFH 3N4XA 1G1IA 2N1TC 1FOSE 3PP5A 4N3YB 4N78D 1FZCC 3MGNA 4WY4B 4ZKPA 2QM7A 3T97A 4W7ZA 1LTJA 3NMDA 3VMZA 2HYNA 2R5BA 1RE4A 5CCGA 1M1JB 2KOGA 2XU6A 4HH2A 1KILA 5AVXB 3SWYA 2JJLA 3HD7B 1RY3A 2PP6A 1LTJC 1J2JB 4XE5B 2NPSA 1KFNA 2O01H 1IFNA 1LT9B 2YNYA 5CCGC 1SQQK 2WSEH 1G1JA 4LGDE 1RF1C 3IFMA 3B5NB 1AFOA 2NPSC 1GZLA 2Z5HA 3G3ZA 5BU5A 2WT7B 2XZRA 1QL1A 4C7NA 1SFCA 5APQA 5KLVK 1RE3C 1RF0C 4Y99C 1M1JC 1S9KE 1LTIC 3N7NA 3HD7C 1EQ7A 2BASA 3KYQA 4WY4D 1QL2A 3L35A 1N7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFM A;  2XKM A;  1QL1 A;  1PFI A;  2KSJ A;  2IFM A;  3IFM A;  2IFN A;  1IFM A;  1IFN A;  1QL2 A;  2KLV A;  1ZN5 A; 
#chains in the Genus database with same CATH topology
 1BDC A;  1L0N K;  3CLQ A;  1J1E C;  1GU4 A;  2KS1 A;  4I1L A;  3KDP B;  3H32 A;  1LWU A;  3M9H A;  2OAR A;  2OYO A;  1PP9 E;  3KPE A;  4PD4 D;  4NPE A;  2RH0 A;  4ASV A;  2KB7 P;  2WSS H;  3HTK A;  4H13 B;  3L75 D;  3CC4 P;  3G71 P;  4PD4 H;  1VQL P;  2ZAE B;  1QLE D;  2IFN A;  1PGQ A;  1FZG A;  1JCC A;  2J5U A;  1GW4 A;  1NTK J;  1Q2N A;  1L0N G;  4RKU J;  2R3S A;  1R5L A;  5AVV B;  3RK2 C;  2L5G B;  2PRR A;  3BCC E;  3H1H D;  2A06 G;  2I1K A;  3OA7 A;  1E5W A;  3RK2 D;  1H88 A;  1JY3 N;  1KOR A;  2LKM A;  2Y0E A;  1EDK A;  4PV1 D;  3AE6 C;  1NU1 J;  1NHL A;  4JPZ B;  3MIW A;  1KC8 Q;  2HPC A;  4U3F E;  1URQ B;  1QX8 A;  2M3E A;  2E76 C;  3FX0 A;  5DJU B;  3ABV C;  4OVN F;  1IO4 A;  1N86 A;  3L72 D;  1IFI A;  2E76 D;  1NTZ D;  1SQP K;  1PV3 A;  2IYP A;  3RK3 D;  3H6P A;  2BEQ D;  2WVR A;  3LW5 H;  1AVO A;  1FBM A;  4GDO A;  1N7S B;  3AEF C;  4DCK A;  2RKL A;  1N73 B;  5AW5 B;  1KIL D;  3O8Z A;  4PJ0 E;  2KNC B;  2C9N Y;  1YHQ P;  2ZT9 B;  1SQB E;  1JUN A;  1JMB A;  5AVU B;  1YJN P;  4JBZ A;  1EZV G;  2YIU C;  1SQP G;  3NXS A;  3CMA P;  4IFF A;  5AW1 B;  1OIP A;  4WVZ A;  2IZ0 A;  2OQQ A;  1GK4 A;  1EXI A;  3S9O A;  1EZV D;  4D6T G;  5CCH D;  1KD1 Q;  3RBX A;  1Q90 D;  2M8R A;  1JB0 J;  1BCC E;  1LP1 A;  4LC1 A;  3CWB D;  1L0L E;  3H1K G;  3WU2 H;  1SS1 A;  3RK3 B;  1EDJ A;  3L74 E;  3T97 B;  2E5T A;  3NFQ A;  1LTJ B;  1JO5 A;  2K9Y A;  2J58 A;  1SQX J;  2YKQ A;  1CSB A;  2KIK A;  4K35 A;  4OGQ B;  1HGV A;  3AED C;  2K9J B;  1YTZ T;  1JTH A;  4KJM A;  3SFE C;  1NKN A;  1Z56 A;  3CC7 P;  5CJ4 A;  2OYI A;  3TNU A;  2IBZ G;  3L70 G;  3W67 A;  2YMK A;  1JY2 O;  4C7R A;  1GTW A;  4I2L C;  2OGU A;  1P84 I;  1VQ6 P;  1VQ7 P;  2W6B A;  5GTH H;  1IK9 A;  1VL2 A;  2K88 A;  1X8Y A;  5CCG D;  1L0N E;  2I8D A;  1G2C A;  3KZI E;  2OYH A;  3L71 G;  2IBZ D;  3L73 D;  2H89 C;  1VF5 C;  1CI6 A;  1CZQ A;  4XA4 A;  2A06 E;  1NTM J;  1T8Z A;  5APV A;  1N2D C;  1HWT C;  3C1L A;  3H1J J;  1NTK K;  1K73 Q;  1VF5 D;  2WZ7 A;  2AEM A;  2KSJ A;  1PGO A;  4TT3 H;  1J1D C;  2A45 G;  4MN4 C;  3GHG B;  4YXD C;  4O9B A;  2AEJ A;  1FOS F;  4IFD K;  3AE1 C;  2ZXE B;  1BE3 G;  3VP9 A;  1OX3 A;  3MP7 B;  1IFP A;  2XDJ A;  4EI2 A;  4OWF A;  4ZKU A;  3H1I J;  1S4X A;  4JF7 A;  2KP8 A;  1HBW A;  1EXJ A;  1KQF B;  5AW3 B;  1NU1 K;  4W80 A;  1FDO A;  1NTK G;  2A45 H;  5AVT B;  4BRY B;  3ZDM A;  5B5E H;  1RQV A;  2N1T C;  1HF9 A;  2GA1 A;  3IF4 A;  4A7P A;  1VQM P;  1FZC C;  3MGN A;  4WY4 B;  3IAO A;  4ZKP A;  4W7Z A;  2QJK B;  1M8O B;  1NTK D;  2HYN A;  4UB8 H;  3MZW B;  5CCG A;  2DW3 A;  2XU6 A;  3SWY A;  2JJL A;  2M5A A;  2H88 C;  2PP6 A;  4XE5 B;  3AEA C;  1LT9 B;  1SQQ K;  1NU1 G;  1SQP E;  2D2C B;  2NPS C;  2Z5H A;  3WU2 E;  2ZYA A;  1RF0 C;  1M1J C;  3HD7 C;  3PTZ A;  4D6T E;  1NU1 D;  3L35 A;  2BCC G;  1ZRT D;  3HD7 D;  2HR3 A;  3H1K E;  4GOD A;  3CL3 D;  1SQQ G;  4K3A A;  5KLV J;  1E79 H;  1N8R Q;  4JYC A;  3B5N D;  2P1J A;  1AA0 A;  1LWU C;  3VMX A;  2CK3 H;  2HG5 D;  5GTH E;  2C0X A;  2J59 M;  2O3J A;  4L73 A;  5KKZ C;  1SQV E;  2FYU J;  4H44 C;  1SQQ D;  1VQ9 P;  1KB9 E;  1X22 A;  3B4S A;  3HUS A;  1SVF A;  1FZE A;  2I1J A;  3L70 E;  1KYO H;  1IJD B;  3CI9 A;  1JY2 N;  4N6J A;  4YPC A;  3TGU G;  1FZC A;  1OXZ A;  5H2F H;  2E74 C;  3EFF K;  2WPQ A;  1W2B O;  1FAV A;  5KAF E;  5AVW B;  1S9K D;  4H13 D;  2FKW B;  3L71 E;  5KLI B;  3V2R A;  3GW6 A;  1S3J A;  2HOD B;  1QVF O;  1FZA A;  3MD0 A;  1L4A B;  1MFZ A;  3V2Q A;  5KAI H;  3CPW O;  2Q9I A;  5AVR B;  2R5D A;  1RF0 A;  2E75 B;  5TIS H;  1M1J A;  1NKZ B;  3HD7 A;  5AVS B;  1GL2 D;  2YKP A;  1USD A;  5EFW B;  1WT6 A;  1BGY J;  2IDB A;  1NO4 A;  2FY8 A;  3B5N A;  3HRN A;  1ZR4 A;  1BE3 E;  3I56 P;  3C9I A;  1URQ C;  2WT7 A;  1CW5 A;  1SQX D;  2QJP B;  4WB4 A;  3L75 G;  1IK7 A;  1R8E A;  4AUW A;  3V6I A;  4YTP C;  2N9B A;  1A02 J;  4XFJ A;  1URQ D;  1R5S A;  3H32 B;  5AW2 B;  4Y28 J;  3Q3D A;  1VQ5 P;  1BSN A;  1H0T A;  2HFE D;  1Y47 A;  2IX7 C;  1S5L H;  3OJA B;  1IFJ A;  2YMY A;  3MTU E;  3I55 P;  3VOP A;  1M56 D;  1N7S C;  3H1H G;  1EDI A;  2YXQ B;  1N73 C;  4HB1 A;  4JYB A;  2V7Q J;  3BRV B;  3GG2 A;  3BRT B;  5CMZ A;  3V5B A;  1NTZ K;  1DEE G;  1DEB A;  3VMA A;  3W68 A;  1N7S D;  2ZT9 C;  3AE2 C;  5C39 A;  3WMM 0;  3Q5R A;  4W7Y A;  3F89 A;  5AW9 B;  5E79 E;  2FYN B;  1ZRT E;  1GL2 B;  2KUB A;  4PV1 C;  1PPJ D;  1PP9 J;  5AVY B;  2ZT9 D;  4ZMD A;  1TU3 F;  2W6J H;  1OW8 A;  1JOC A;  2VRS A;  3H1J D;  4UB6 H;  2CPB A;  1GD2 E;  3L72 G;  2AEF A;  1GW3 A;  2BCC E;  3VMY A;  3KXD A;  1NTZ G;  1IFM A;  1EDL A;  2R3C A;  4LLH A;  3H1L G;  2HPC B;  2NZ2 A;  3S1K A;  3FWL A;  5AW6 B;  1SQQ E;  2XNX A;  3RK3 C;  2JWA A;  1KYO E;  3BCC J;  3A2A A;  2QVA A;  4C7N B;  1SFC B;  3RL0 B;  1RE4 C;  1URQ A;  1NH4 A;  1S5L X;  2OYI C;  1KIL C;  5H2F E;  1RHZ B;  3H1L D;  4CPG A;  2MJZ A;  1HTL C;  1J1E B;  1DD4 A;  2E42 A;  1MUU A;  1K04 A;  2OTK E;  4OGQ D;  4U3F J;  2G3A A;  2GUS A;  3O6Q B;  3CX5 E;  2IPP A;  3TGU E;  2OYH C;  1N7S A;  3AEE C;  1N73 A;  1GMJ A;  4HKZ H;  4M3L A;  2KNC A;  1W2E A;  2ZFC A;  2W6A A;  3F5H A;  3V2N A;  3BAS A;  1N7L A;  3CWB G;  1YTZ I;  5CCH C;  1GK6 A;  2H8P D;  1KMI Z;  3SSU A;  1T6A A;  4GKG A;  3JC2 2;  2O01 J;  1XTG B;  1FU1 A;  2P2U A;  3RL0 g;  5KTB A;  1A02 F;  1SQB J;  1AQ5 A;  2Q3E A;  5KLV D;  3CCE P;  1S5L E;  3M91 A;  3A7O A;  3PRJ A;  4PD4 E;  3D6Y A;  2ZVN B;  3P8C D;  3V4W A;  3SWF A;  3AE9 C;  3L75 E;  3PP5 A;  4N3Y B;  4N78 D;  2FYU D;  3T97 A;  2ZYG A;  1LTJ A;  2Y0D A;  3PJS K;  3NMD A;  1L2P A;  1RE4 A;  1KIL A;  1BCC J;  1KFN A;  1IFN A;  3L73 G;  4I7Z C;  5CCG C;  1UII A;  2K9J A;  2QG4 A;  4YXW H;  1L0L J;  1RF1 C;  2P10 A;  1AFO A;  3H1H E;  1GZL A;  1PGJ A;  3G3Z A;  3L74 J;  2QJK C;  1P84 D;  4Y99 C;  2UWJ E;  1OW6 A;  3CCM P;  1QGK B;  2BAS A;  1P84 H;  3KYQ A;  3RGU A;  1KB9 I;  4WY4 D;  1WMK A;  1NVO A;  2ZXX A;  3E1R A;  1AVY A;  2W27 A;  1VQK P;  4R4M A;  2WSC H;  2RN0 A;  4WWI A;  5CCH A;  1ZXG A;  3A3Y B;  2E5Y A;  4KHX A;  1LGH B;  1LT1 A;  2D2C D;  3L72 E;  2YO2 A;  3R2P A;  2KZI A;  1BGY D;  3CXH D;  1NTZ E;  1HJB A;  4Z1M H;  3Q5S A;  3FGA D;  3H1L E;  1H8A A;  1L0N J;  3BVH A;  3M0D C;  3RK3 E;  3CCQ P;  2Q1K A;  1ZR2 A;  4AYC A;  2RMZ A;  3CC2 P;  3CXH H;  2OTJ P;  2LXC B;  3HE5 B;  3GHG A;  5L8R J;  2WSE J;  3G6E P;  1KIL E;  2ZJS E;  3FWN A;  3B71 A;  4RES B;  2KSE A;  2A45 I;  1LTB C;  3HUS C;  1FC2 C;  1QEX A;  3AE7 C;  1S2E A;  2SPZ A;  3EFG A;  2QIW A;  1JY2 P;  2P58 A;  2WWW A;  5BU8 B;  2W90 A;  1NWQ A;  3EWK A;  3SWK A;  4BRY A;  1MZ9 A;  1RF1 A;  1ZV8 A;  2LXB A;  3M9B A;  1HUC A;  2WMM A;  4WBA A;  1S1C X;  2R44 A;  3P32 A;  3AEG C;  1EZV E;  5APT A;  3FXD A;  2QJY C;  1LTG C;  1PP9 D;  3OAK A;  2B89 A;  1T2K D;  1K8A Q;  2Z5I A;  2NRG A;  3CWB E;  3CCR P;  1M1K Q;  4IFM A;  1PIX A;  2R32 A;  2PAJ A;  1JCD A;  1L4A C;  4DT0 A;  3U1C A;  3B5N C;  1X9V A;  1SP4 A;  4R4L A;  5APX A;  1L4A D;  2ZYD A;  3Q1M A;  3IN6 A;  1FZB A;  3BCC D;  1SQP J;  3D71 A;  2E75 D;  3M0D A;  1YI2 P;  5AW4 B;  3TYY A;  4GT1 A;  3IR9 A;  3CD6 P;  3M9Q A;  1JMM A;  3M0A A;  2Q3I A;  3VTP C;  2AXC A;  1KQL A;  2H43 A;  2M3B A;  1ZME C;  4D6T J;  1P84 E;  3JCU H;  2O1J A;  2IBZ E;  1NAF A;  4U3F D;  3L73 E;  4U7J A;  1SQX K;  3U1A A;  1KYO I;  1Q7Y Q;  3H1K J;  1VQP P;  3AEC C;  4H13 C;  3A0B H;  2Q7C A;  2N1T B;  5AVZ B;  3HE4 B;  2C9L Y;  1KQG B;  2P7J A;  1VQ8 P;  2Y0C A;  5KJ7 C;  1GU5 A;  1ZN5 A;  2JDI H;  5APW A;  2Q5U A;  1SQV J;  2B87 B;  2H7H A;  1JY3 P;  2XND H;  3LIE A;  2KZJ A;  1YJ9 P;  3CXH E;  2FYN C;  4H0L B;  2FXO A;  2NPS B;  1GL2 C;  5KJ7 D;  2QA4 P;  3CX5 I;  1K9M Q;  1RH5 B;  1SQX G;  3P7K A;  3L70 J;  1HVV A;  2K37 A;  1FDI A;  2IZ1 A;  2JO1 A;  2HOD A;  4PJ0 H;  1IZN B;  4GIF A;  1L4A A;  5B5E E;  1VQ4 P;  1AQT A;  1MKM A;  1UIX A;  1NTM K;  3R4Y A;  2KXP B;  2GM4 A;  2GUV A;  3UIA A;  2P67 A;  2FFD B;  3L71 J;  3L4F A;  3OW2 O;  3PLN A;  4DJG A;  2FBW C;  4UB8 E;  1H89 A;  2KS1 B;  2WTY A;  3L74 G;  1NGM B;  1SFC C;  1AJY A;  2WPS A;  3RL0 C;  5BVZ A;  1LWU B;  3RBZ A;  1NTK E;  1YQ4 C;  1HGZ A;  4RO0 A;  5AW7 B;  1BCC D;  3VYI A;  1QVG O;  3WUT A;  1H0T B;  5KKZ B;  1SFC D;  1L0L D;  4H44 B;  3HTK B;  3RL0 D;  1OMI A;  2G8Y A;  1YBK A;  4PD4 I;  1NTM G;  1SLQ A;  1PPJ G;  3V2P A;  3L74 D;  1BE3 J;  2FFD A;  4OH8 B;  1JM0 A;  3H1J G;  1FE6 A;  2JKV A;  1LTT C;  2KLU A;  2JWD A;  3P8M C;  1NU1 E;  2E74 B;  1XTC C;  3E1I A;  2AXT H;  3AE4 C;  1NTM D;  5KJ7 A;  1OZH A;  2O1K A;  1S72 P;  3H1I G;  1FJK A;  1U57 A;  1GL2 A;  1M90 Q;  1Y9B A;  4IL6 H;  5K5G B;  1OWA A;  3JSV C;  4RJT A;  3MUD C;  1G1I A;  1L0N D;  2L91 A;  1FOS E;  2KI7 B;  3JCU E;  2QM7 A;  3H1I D;  3SFD C;  2O01 N;  2KOG A;  3KZI H;  1LJ2 A;  2A06 D;  1LTJ C;  1J2J B;  3A0B E;  2Q6Q A;  3KHU A;  2MKV A;  3WUU A;  2YNY A;  2WSE H;  3D70 A;  4LGD E;  3IFM A;  1EC5 A;  2W8Z A;  4OGQ C;  2PGD A;  1Q81 Q;  5BU5 A;  2XZR A;  4C7N A;  1SFC A;  5APQ A;  5KLV K;  1RE3 C;  2BCC J;  1NAY A;  1S9K E;  1BDD A;  3MHV A;  4EDF A;  1EQ7 A;  5KAI E;  1QL2 A;  1YIT P;  1SQQ J;  2Y9Z A;  2IFM A;  3PH0 A;  1ZW0 A;  2FYU K;  5TIS E;  3U59 A;  2POH A;  4BWN A;  5DJT B;  2OTL P;  1RQU A;  2E43 A;  3FXE A;  3O6Q A;  3GF7 A;  2WSF J;  3RK2 B;  3GMA A;  3TK1 A;  3PHL A;  3USS A;  3ITK A;  4I6M C;  1DX7 A;  1LNQ A;  1WRG A;  4IL6 X;  5KLV G;  2IYO A;  1IC2 A;  4L76 A;  4PV1 B;  1FDM A;  1VQO P;  4GOE A;  1M7L A;  2QEX P;  1SQX E;  1USE A;  1OW7 A;  3VN0 A;  3I5C A;  1LP1 B;  1JEK A;  3TGU J;  1EZV I;  1KN7 A;  2FYU G;  1SQV K;  3GHG C;  1YJW P;  2XKM A;  1FZF A;  3MUD A;  1SQP D;  3L37 A;  3CCJ P;  3BAT A;  2K1A A;  2W83 C;  2E76 B;  3AE3 C;  3Q2Y A;  4AQR D;  1D7M A;  5B66 H;  2QE7 H;  1JTH B;  4TLF A;  3WUV A;  2FXM A;  2HLO A;  4D6T D;  4EYY Q;  2OYI B;  1KIL B;  3KQG A;  2AXT E;  2ZVO B;  3TNU B;  1VDF A;  2JR8 A;  1SQV G;  5APU A;  3H1K D;  1RE3 A;  4UB6 E;  3NTN A;  2JEE A;  1NTM E;  3EQ2 A;  1PPJ E;  4WY4 C;  4DOJ A;  3QWO C;  3H1J E;  2QSI A;  3Q5P A;  1KTM A;  4IL6 E;  1M57 D;  1G2C B;  2OYH B;  3L75 J;  2KK7 A;  5APY A;  2B9B A;  1K05 A;  1SQV D;  4EIJ A;  1LT9 C;  1CI6 B;  2YIU B;  1BGY G;  3TSI A;  2IBZ I;  2D2C C;  1KB9 D;  2WQY C;  1GDT A;  1X79 B;  3M06 A;  2KLV A;  1DIP A;  3GLM A;  2FYZ A;  3H1I E;  3LID A;  3L70 D;  1KB9 H;  1VPC A;  1PFI A;  2C0W A;  5AW0 B;  3H1H J;  2QM8 A;  1KV4 A;  3C8V A;  3D6Z A;  3II6 A;  2Y9Y A;  3CCV P;  1HJ0 A;  1YQ3 C;  2M0B A;  3VP8 A;  1PZQ A;  3L71 D;  5M1B A;  2KYV A;  3QH9 A;  3CXH I;  1HH0 A;  5KAF H;  2YO3 A;  2V4H A;  2BEZ F;  5TJH A;  1FS0 E;  3AE5 C;  4NPF X;  3CCL P;  3HE5 A;  1ZOY C;  2FXP A;  1FJP A;  3L72 J;  1MV8 A;  2WIT A;  3B8E B;  1NTZ J;  3LW5 J;  1OFC X;  1PP9 G;  1BSH A;  3H1L J;  3A5T A;  1BE3 D;  1DD3 A;  3G9R A;  4I7Z B;  1Y8A A;  1RF1 B;  2K3R A;  2V7Q H;  2YXR B;  2M5A B;  5GTI H;  3A0H H;  5CHX A;  1T2K C;  3AE8 C;  1IFD A;  4WY4 A;  4DZO A;  1AV1 A;  4NPD A;  4Y99 B;  3L36 A;  2N1T D;  5KLI C;  1YIJ P;  1KQS O;  1LT9 A;  1VF5 B;  3V4Q A;  5KLV E;  1OVR A;  5APS A;  3BCC G;  1ZP0 C;  4H0L C;  3P8C E;  5B66 E;  4JQ0 D;  1JY3 O;  4EOT A;  1LTA C;  3TF5 A;  3CCS P;  2E75 C;  2Z4E A;  4N78 E;  2YKO A;  1J1D B;  4H0L D;  2FYU E;  2NPS D;  3TDK A;  5CBN A;  1LTS C;  3S4R A;  1T3J A;  2XV5 A;  4U3F G;  1NOH A;  4KT0 J;  4B86 A;  2FFD C;  1NJI Q;  3CWB J;  5E79 H;  2ITA A;  3K5B A;  2QJP C;  1U7M A;  1VQN P;  5CJ0 A;  2CPS A;  1SQB K;  1T3U A;  5AW8 B;  2JP3 A;  2BCC D;  1PGP A;  1KZU B;  3HUS B;  3AEB C;  4GOF A;  1MFT A;  1KFM A;  1YYC A;  2WPR A;  1JNM A;  2LR2 A;  4HJG H;  4QMA A;  1DH3 A;  1FZC B;  1KYO D;  2PFX A;  2B88 A;  5AVQ B;  3G4S P;  1OVV A;  4H44 D;  1U7J A;  1ZLL A;  4HYT B;  1SQB G;  2N1T A;  1L0L K;  3HE4 A;  4C46 A;  1BGY E;  2WPV B;  2WSF H;  3N4X A;  3E7K A;  3H25 A;  2QJY B;  4L75 A;  3CCU P;  3GF3 A;  3L73 J;  3VMZ A;  2R5B A;  2B87 A;  3CX5 D;  1M1J B;  2WSC J;  2E74 D;  1W5C E;  3TGU D;  4HH2 A;  5AVX B;  1SQB D;  4L74 A;  3HD7 B;  1RY3 A;  2N9Y B;  3CME P;  4BXL A;  1PL5 A;  2NPS A;  2O01 H;  3CX5 H;  1G1J A;  5CBO A;  1OVU A;  1X0T A;  3B5N B;  1BCC G;  4IOI H;  2WT7 B;  1QL1 A;  1L0L G;  1Q86 Q;  1LTI C;  3N7N A;  3A0H E;  5GTI E;  1NYH A;  2QRX A;  4ASW A;  4ZNC A;  1Q82 Q; 
#chains in the Genus database with same CATH homology
 1L0N K;  2IFM A;  2W27 A;  2FYU K;  3CLQ A;  3HD7 D;  1J1E C;  3U59 A;  1GU4 A;  2WSC H;  2POH A;  3CL3 D;  4I1L A;  5CCH A;  3KDP B;  3H32 A;  2E43 A;  1LWU A;  3M9H A;  3A3Y B;  2OAR A;  4KHX A;  4JYC A;  3B5N D;  1LGH B;  3RK2 B;  3KPE A;  2P1J A;  2YO2 A;  3R2P A;  3TK1 A;  4I6M C;  1DX7 A;  1LWU C;  3VMX A;  2KB7 P;  1WRG A;  2HG5 D;  3HTK A;  1HJB A;  2C0X A;  1H8A A;  2J59 M;  1IC2 A;  3BVH A;  3M0D C;  2IFN A;  1FDM A;  1ZR2 A;  1FZG A;  4AYC A;  1M7L A;  1JCC A;  3VN0 A;  1GW4 A;  3HE5 B;  3I5C A;  3GHG A;  5AVV B;  3RK2 C;  3HUS A;  1SVF A;  1SQV K;  1FZE A;  2L5G B;  2I1J A;  3GHG C;  2XKM A;  4RES B;  1IJD B;  3CI9 A;  1JY2 N;  4N6J A;  1FZF A;  2A45 I;  3MUD A;  1LTB C;  3HUS C;  3L37 A;  2I1K A;  3OA7 A;  1FZC A;  3BAT A;  1E5W A;  3RK2 D;  1OXZ A;  1H88 A;  1JY3 N;  2WPQ A;  1FAV A;  2LKM A;  5AVW B;  4AQR D;  3EFG A;  1S9K D;  1JY2 P;  2WWW A;  5BU8 B;  1NWQ A;  2FKW B;  1JTH B;  3V2R A;  1MZ9 A;  2FXM A;  2HLO A;  1NHL A;  2OYI B;  1RF1 A;  1KIL B;  1ZV8 A;  2HOD B;  3KQG A;  1FZA A;  3TNU B;  3M9B A;  3MIW A;  3MD0 A;  1HUC A;  1L4A B;  1MFZ A;  2HPC A;  4WBA A;  1VDF A;  3V2Q A;  1URQ B;  3P32 A;  5APU A;  5APT A;  1RE3 A;  2Q9I A;  5AVR B;  2R5D A;  3NTN A;  1IO4 A;  1RF0 A;  2JEE A;  1LTG C;  1M1J A;  1N86 A;  3EQ2 A;  3OAK A;  1NKZ B;  1T2K D;  4WY4 C;  2Z5I A;  3HD7 A;  4DOJ A;  5AVS B;  1GL2 D;  2YKP A;  1IFI A;  4IFM A;  1WT6 A;  2R32 A;  1SQP K;  1G2C B;  1NO4 A;  2PAJ A;  2OYH B;  3B5N A;  3HRN A;  5APY A;  1ZR4 A;  3RK3 D;  3H6P A;  1JCD A;  1L4A C;  4EIJ A;  1LT9 C;  3C9I A;  1CI6 B;  1URQ C;  3U1C A;  2WT7 A;  1CW5 A;  3LW5 H;  3TSI A;  1FBM A;  3B5N C;  4WB4 A;  1N7S B;  1X9V A;  1SP4 A;  1N73 B;  5AW5 B;  1GDT A;  1KIL D;  1X79 B;  3M06 A;  4AUW A;  2KLV A;  3O8Z A;  5APX A;  2FYZ A;  1L4A D;  2N9B A;  1A02 J;  1URQ D;  3LID A;  3H32 B;  5AW2 B;  1VPC A;  2C9N Y;  1PFI A;  1FZB A;  2C0W A;  5AW0 B;  1JUN A;  3M0D A;  2QM8 A;  2HFE D;  5AW4 B;  4GT1 A;  5AVU B;  3TYY A;  3IR9 A;  2IX7 C;  3M9Q A;  1IFJ A;  3OJA B;  3II6 A;  1JMM A;  2YMY A;  3MTU E;  3M0A A;  3VOP A;  1N7S C;  3NXS A;  2Q3I A;  1N73 C;  3VP8 A;  4IFF A;  4JYB A;  5AW1 B;  2KYV A;  3BRV B;  3VTP C;  1KQL A;  3BRT B;  2H43 A;  1HH0 A;  2M3B A;  1GK4 A;  5CMZ A;  1NTZ K;  3V5B A;  2YO3 A;  1DEB A;  2O1J A;  1N7S D;  3WMM 0;  1NAF A;  4W7Y A;  1SQX K;  3U1A A;  5AW9 B;  5CCH D;  2Q7C A;  3HE5 A;  1GL2 B;  2M8R A;  2N1T B;  5AVZ B;  3HE4 B;  5AVY B;  1FJP A;  4LC1 A;  1MV8 A;  2WIT A;  1JOC A;  2C9L Y;  2VRS A;  3B8E B;  3RK3 B;  2CPB A;  1GD2 E;  2P7J A;  5KJ7 C;  1GU5 A;  1ZN5 A;  3A5T A;  3NFQ A;  5APW A;  1LTJ B;  2Q5U A;  1JO5 A;  1GW3 A;  3VMY A;  2J58 A;  2H7H A;  1JY3 P;  1RF1 B;  3LIE A;  2YKQ A;  1CSB A;  1IFM A;  5CHX A;  2R3C A;  1HGV A;  4LLH A;  1T2K C;  2NPS B;  1GL2 C;  5KJ7 D;  2HPC B;  1IFD A;  4WY4 A;  1YTZ T;  4DZO A;  1JTH A;  5AW6 B;  1NKN A;  1Z56 A;  3P7K A;  2XNX A;  1HVV A;  4Y99 B;  3RK3 C;  5CJ4 A;  3L36 A;  2OYI A;  3A2A A;  2HOD A;  4C7N B;  1SFC B;  2N1T D;  3TNU A;  3RL0 B;  4GIF A;  1L4A A;  1LT9 A;  1RE4 C;  1URQ A;  1NH4 A;  3V4Q A;  2OYI C;  5APS A;  1KIL C;  1JY2 O;  1NTM K;  4C7R A;  1GTW A;  4I2L C;  2MJZ A;  2GM4 A;  2GUV A;  3UIA A;  1HTL C;  3P8C E;  1J1E B;  2P67 A;  2FFD B;  2E42 A;  1MUU A;  2W6B A;  1JY3 O;  1IK9 A;  3L4F A;  1X8Y A;  5CCG D;  1LTA C;  4EOT A;  1H89 A;  2Z4E A;  4N78 E;  2YKO A;  1J1D B;  1G2C A;  2OYH A;  2NPS D;  2WTY A;  1SFC C;  2WPS A;  1LTS C;  3RL0 C;  5BVZ A;  2GUS A;  1LWU B;  1CI6 A;  1CZQ A;  2IPP A;  1HGZ A;  2OYH C;  4XA4 A;  5AW7 B;  1T3J A;  1N7S A;  2XV5 A;  3VYI A;  1T8Z A;  1N73 A;  5APV A;  1NOH A;  1N2D C;  1HWT C;  4B86 A;  1SFC D;  2FFD C;  3HTK B;  3RL0 D;  4M3L A;  1NTK K;  1W2E A;  2ZFC A;  2WZ7 A;  2KSJ A;  5CJ0 A;  2CPS A;  1SQB K;  1T3U A;  2W6A A;  1SLQ A;  3V2N A;  3V2P A;  5AW8 B;  1J1D C;  2A45 G;  3BAS A;  2FFD A;  4OH8 B;  1YTZ I;  5CCH C;  3GHG B;  4O9B A;  1KZU B;  1GK6 A;  1LTT C;  1FOS F;  2H8P D;  4IFD K;  3HUS B;  2ZXE B;  3VP9 A;  1KFM A;  1YYC A;  2WPR A;  1JNM A;  3P8M C;  2XDJ A;  1XTC C;  3E1I A;  4GKG A;  4ZKU A;  1DH3 A;  4JF7 A;  1XTG B;  1FU1 A;  2KP8 A;  2P2U A;  1FZC B;  1HBW A;  5KJ7 A;  5KTB A;  1A02 F;  1AQ5 A;  2O1K A;  5AVQ B;  5AW3 B;  1NU1 K;  4W80 A;  3M91 A;  1ZLL A;  3A7O A;  1FJK A;  2A45 H;  4HYT B;  5AVT B;  1GL2 A;  2N1T A;  3P8C D;  1L0L K;  3HE4 A;  3V4W A;  1OWA A;  4C46 A;  3SWF A;  2WSF H;  3N4X A;  1G1I A;  2N1T C;  1FOS E;  3PP5 A;  4N3Y B;  4N78 D;  1FZC C;  3MGN A;  4WY4 B;  4ZKP A;  2QM7 A;  3T97 A;  4W7Z A;  1LTJ A;  3NMD A;  3VMZ A;  2HYN A;  2R5B A;  1RE4 A;  5CCG A;  1M1J B;  2KOG A;  2XU6 A;  4HH2 A;  1KIL A;  5AVX B;  3SWY A;  2JJL A;  3HD7 B;  1RY3 A;  2PP6 A;  1LTJ C;  1J2J B;  4XE5 B;  2NPS A;  1KFN A;  2O01 H;  1IFN A;  1LT9 B;  2YNY A;  5CCG C;  1SQQ K;  2WSE H;  1G1J A;  4LGD E;  1RF1 C;  3IFM A;  3B5N B;  1AFO A;  2NPS C;  1GZL A;  2Z5H A;  3G3Z A;  5BU5 A;  2WT7 B;  2XZR A;  1QL1 A;  4C7N A;  1SFC A;  5APQ A;  5KLV K;  1RE3 C;  1RF0 C;  4Y99 C;  1M1J C;  1S9K E;  1LTI C;  3N7N A;  3HD7 C;  1EQ7 A;  2BAS A;  3KYQ A;  4WY4 D;  1QL2 A;  3L35 A;  1N7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...