2XKMA

Consensus structure of pf1 filamentous bacteriophage from x-ray fibre diffraction and solid-state nmr
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Consensus Structure of Pf1 Filamentous Bacteriophage from X-Ray Fibre Diffraction and Solid-State NMR.
pubmed doi rcsb
molecule tags Viral protein
molecule keywords CAPSID PROTEIN G8P
total genus 19
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2010-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2xkmA00
2KSJA 4IFMA 2XKMA 1IFNA 2IFNA 2IFMA 3IFMA 2KLVA 1QL2A 1ZN5A 1IFMA 1QL1A 1PFIA
chains in the Genus database with same CATH superfamily
2IZ1A 2Y0EA 2Z4EA 1GMJA 3R2PA 1JEKA 1YQ4C 3V5BA 1NTKK 1VDFA 2NPSC 2XNXA 3FWNA 5KKZC 1KQSO 1VQ5P 2E42A 3N4XA 3CCQP 2HODA 2N1TD 1BGYG 1MUUA 2XDJA 1L4AC 4L73A 2IBZG 2B87A 4Y99B 4WWIA 2ZJSE 1L0LD 1NU1K 4H0LD 2W6BA 1GL2B 3L70E 1IFIA 5AVSB 1NTKJ 1SLQA 1T3UA 2G3AA 3NTNA 2H88C 4LC1A 2OYHA 1S9KE 2PGDA 3KYQA 2WT7B 1SQVG 1USEA 1DD3A 2HG5D 3KZIE 4HB1A 5AVXB 1ZXGA 2N1TC 1NTZJ 2CK3H 5CCGC 3RBXA 3G6EP 2LXBA 3FGAD 1FDMA 1BGYD 1KB9I 2KSEA 3LIDA 1NAFA 3RK2B 5CCHC 2QEXP 2WPVB 3CCMP 1K73Q 1BSHA 1NH4A 2WSFJ 2LR2A 1FAVA 3C8VA 1SQQK 4U3FJ 1KB9D 4W7ZA 3H1JE 2ZT9C 1K8AQ 1SQPK 1YBKA 2OTLP 2WSEH 1KYOE 1JY2P 3AECC 4GKGA 1L2PA 2B9BA 2HODB 1S5LH 1PP9G 2KUBA 1MFZA 5KLVD 2V4HA 4H13D 2C9NY 3H1KJ 1LTTC 1RH5B 3RK3C 3QH9A 5KLVG 2JO1A 1YHQP 4EIJA 1YI2P 2H43A 1SQXK 1CW5A 1EQ7A 3HUSB 1NTZK 3WU2H 3D6YA 1NKNA 2IPPA 1N7SA 1L0LE 3NXSA 3IFMA 3R4YA 5KAFE 1ZLLA 3M9HA 1S5LX 4JYBA 3TGUE 1L0ND 1LWUC 1OFCX 2YXRB 4WY4C 3RL0D 3VP9A 1MKMA 2IYOA 5CBOA 3I56P 1X0TA 3VMYA 3H32B 1IJDB 3L72E 3H1HG 2BEZF 2HPCB 3L73E 1SQBG 1U7JA 2FXOA 4IFDK 4HH2A 3M9QA 2K9JB 1S72P 1EDKA 1KYOD 1LNQA 1OVVA 2I1JA 2WSEJ 2Z5HA 3H1LD 1FZCB 2POHA 1VQ8P 3BCCE 1IK7A 3BRVB 2IBZD 3FWLA 3ITKA 1SQXE 1NJIQ 2WZ7A 1N8RQ 1EXJA 2WVRA 2KK7A 1UIXA 3RK3D 2A06D 2K37A 1SP4A 1M1KQ 1W5CE 2H7HA 1PPJE 2A45G 2ZYDA 1S5LE 5BU8B 3LW5J 2I1KA 5APQA 3D6ZA 3HD7C 1P84D 1KQGB 1T6AA 1LT9A 3CWBE 3KXDA 1ZN5A 3A3YB 3U1CA 1SFCC 3OW2O 4WY4D 1IZNB 4BWNA 2OYIA 1Q2NA 2W6AA 3ABVC 2OARA 1RF1C 4BRYB 4OWFA 5CCHD 1FZBA 3Q1MA 3CXHE 4JQ0D 1G1JA 4UB6E 3U1AA 4JYCA 2IZ0A 3RL0g 1YQ3C 2WSFH 2A45H 2QJKB 1JY2O 3B5NB 5APWA 1AVYA 2JR8A 3AEAC 3OA7A 3V4QA 1SFCD 4ZKPA 1ZMEC 1E79H 2XU6A 5L8RJ 3V6IA 1GZLA 5GTHH 4H13C 1IFNA 2Q1KA 2HR3A 2KB7P 4I1LA 5KAIH 1VQ4P 4JBZA 1BCCJ 2NPSA 3VOPA 2OQQA 3T97B 5KKZB 1Y9BA 1KYOI 4HKZH 1E5WA 2Q5UA 3P8CE 2NPSD 4GIFA 3Q3DA 2OTKE 2JP3A 3MTUE 2JWDA 1GL2C 1NOHA 2KS1A 3H1LJ 3SSUA 1XTCC 1TU3F 3CX5D 3L73G 1PGOA 2FYUJ 2M0BA 1PP9D 1PV3A 3F89A 4IL6H 1NYHA 1S3JA 3HUSA 1RQVA 3L72D 3CPWO 3Q5PA 3CXHD 1VQPP 1FZCC 2YMYA 2ZYGA 5BU5A 2V7QH 3H1KE 1SQPE 1BDDA 3IAOA 2YXQB 2FBWC 2KNCA 1T2KD 1RHZB 3D71A 1X79B 4O9BA 2SPZA 3A2AA 1EZVG 2MKVA 3N7NA 4JF7A 1IFPA 4K35A 5CCGD 3NFQA 3BATA 4IFMA 4WY4A 3WU2E 4M3LA 3EQ2A 1X9VA 2HYNA 1N86A 3B5NA 5DJUB 3SWYA 1H8AA 3TYYA 1N7LA 3V4WA 3CC2P 1IFMA 1G2CA 3BRTB 5TISH 1L0NK 2XV5A 3L75E 1DEBA 3H1IG 1YJWP 1T2KC 1PPJD 1RQUA 3IN6A 3O6QB 2Q9IA 2ZT9D 1SQBD 3HD7B 1LT9B 1KYOH 3AEGC 5APTA 2OYIB 1SQPG 4TT3H 1GL2D 4D6TJ 1JY3O 1SQXD 4Y28J 3V2NA 2FY8A 1LTBC 2P58A 2YKQA 2C9LY 3HTKB 2IFNA 3AEEC 3BASA 4ZMDA 1JTHA 1LP1A 1LTJC 2J58A 2R5DA 5GTIH 1NGMB 3A0BE 1ZOYC 2B87B 2KZJA 2RMZA 3L71G 3MGNA 3RL0B 1GU5A 1PGQA 1JO5A 4IL6E 3MUDA 4U3FG 1R5LA 2CPBA 4D6TD 1L0NE 2ZXXA 3H25A 1VQ7P 1PGPA 2OGUA 2K9JA 2FYUG 3CCJP 4UB8H 3AEDC 1H0TA 3H1KD 2R5BA 4I6MC 2KIKA 3MP7B 4H44D 5KLIC 1JCDA 2QJKC 3F5HA 3L74J 3PRJA 1IO4A 1Y8AA 1PP9E 3KQGA 3JC22 4UB8E 4WY4B 5APVA 3L37A 2I8DA 1RE4A 1SQXJ 3AE2C 5B5EE 3KZIH 2KNCB 5AW5B 3Q5SA 1L4AB 3CCRP 1OVUA 1GU4A 4UB6H 1BE3E 4WVZA 1GK4A 2JKVA 5H2FE 3CMEP 2P1JA 2ZXEB 1OX3A 2FYUE 1HGZA 4C46A 5KJ7A 2KXPB 2GA1A 3L70G 5E79H 4Z1MH 2W6JH 1VQLP 3EFFK 2WQYC 1HJBA 1URQB 3HE5B 5KAIE 2N9BA 3V2PA 2WWWA 3L4FA 1LT1A 2D2CC 4PV1C 1S1CX 4HJGH 1FZEA 1KFNA 1S9KD 3TNUB 1BCCE 1NO4A 2C0XA 3HE4A 4H44C 3TDKA 1QLED 2E76B 1NU1G 1KN7A 4N3YB 1SFCB 1ZR4A 1NVOA 3BCCG 1OIPA 2QVAA 3HTKA 3OJAB 3U59A 4XFJA 4YXDC 1BE3G 4ZNCA 3WMM0 4GODA 1A02F 2DW3A 1PIXA 4HYTB 1VF5C 3EWKA 1G1IA 3MHVA 4N78E 3LW5H 3L75G 2K3RA 5CJ4A 2WPSA 3CLQA 5AVTB 4C7NB 3H1JJ 1DIPA 4D6TE 1FDIA 5B5EH 1U57A 4U3FE 4Y99C 2WT7A 4N6JA 1AJYA 2WSCH 3KPEA 3M0AA 2PP6A 3AE7C 2NRGA 3HRNA 2FYNC 2E74D 1FDOA 2BEQD 3C1LA 3L74D 2RH0A 3PHLA 1G2CB 1P84I 4NPEA 1VF5D 5AW1B 3CI9A 1SQQJ 2NZ2A 1PGJA 2ZYAA 3PTZA 2HFED 4PD4D 1NTMG 4RKUJ 2IBZE 3MZWB 1LTSC 2PRRA 4AUWA 3E1RA 4PV1D 2JWAA 2AXTH 3TK1A 2IBZI 2GM4A 1J1EB 3PP5A 5AVWB 3B4SA 2WPRA 3IF4A 3L70J 4GOFA 3S9OA 4OVNF 3H1HE 1PL5A 2KS1B 4BXLA 3SFEC 1NTKG 2Y9YA 1QGKB 2YO2A 3A0HE 3AEFC 3CXHI 3RK2D 3WUVA 4DOJA 2QRXA 1KORA 1L4AA 1UIIA 2O3JA 2B89A 2QG4A 3L73J 3LIEA 4RESB 3H1JG 1KILB 3H1IE 3CMAP 3CCLP 2YKOA 1EDLA 1M7LA 1EDIA 3AE4C 1CI6B 1HBWA 1HGVA 4NPFX 2BCCE 2E74C 3S4RA 3S1KA 2M8RA 1OWAA 1HWTC 1EXIA 2QE7H 1LT9C 3KDPB 1BCCG 3SFDC 1M90Q 1L0NJ 1OMIA 2D2CD 1AVOA 4H13B 5APXA 2FXPA 2WPQA 5KJ7D 5CHXA 1LTJA 1MFTA 3Q5RA 3TGUG 1Q7YQ 1YTZT 1Z56A 4EDFA 1GW3A 5TJHA 4KT0J 3RGUA 1SQQG 2KYVA 2L91A 2HLOA 1D7MA 1BGYE 1M57D 2QM8A 3AE8C 3C9IA 3CCUP 2R3SA 3MUDC 5AW8B 3RK2C 3AE1C 2AEJA 1OZHA 5BVZA 2FYUK 1FE6A 5E79E 5KLVK 1IC2A 3CXHH 3VP8A 4DT0A 2IDBA 3G3ZA 5AW3B 4XE5B 4AQRD 4PV1B 5CBNA 2WTYA 2FFDC 1NTZG 3GHGB 2Q3EA 1GD2E 1FU1A 2P67A 2M3BA 3CWBD 3CL3D 1AA0A 2W90A 4IL6X 1VQMP 3CX5H 4NPDA 5GTHE 1S2EA 2GUVA 4QMAA 1NTKE 1M8OB 1FOSF 1MV8A 1FJPA 1NKZB 2KOGA 3G71P 5KTBA 1AQTA 1Y47A 4WB4A 2W83C 1KC8Q 3H32A 4GOEA 2QA4P 1KMIZ 1LTAC 1GL2A 2K9YA 2RKLA 2Q3IA 3O6QA 2QJYC 3GG2A 1LGHB 1NTZD 1T8ZA 3HE4B 2E76D 4IOIH 1K9MQ 3P7KA 4U7JA 1KILA 4EI2A 3BCCD 1JUNA 1H88A 1JB0J 1KB9H 1SQBJ 4C7RA 2Y0DA 2QIWA 1SQBE 3TGUJ 1KILC 3SWKA 3AEBC 3B5ND 1NTMD 2KLUA 1LTIC 4MN4C 3JSVC 1L0LJ 2M5AA 3GMAA 2BCCD 1SQQD 5AW7B 3V2QA 5CCGA 2AXTE 5CMZA 1LJ2A 1DEEG 1FBMA 1K04A 2E76C 1QL2A 2BCCG 2Q6QA 1W2EA 1YYCA 3H1ID 3H1HJ 3QWOC 4OGQB 4PJ0H 4YTPC 1ZR2A 2O01H 1BDCA 3TGUD 1JMBA 1VQOP 1FC2C 4R4LA 5KJ7C 3BVHA 1CSBA 1WT6A 2YIUC 3EFGA 1OW7A 1M1JA 3MIWA 3T97A 3VMZA 1J1DB 3TSIA 3CX5I 5TISE 2P7JA 4XA4A 3VMXA 1SQBK 1BCCD 4CPGA 2ITAA 2QJYB 4TLFA 2B88A 1GK6A 1P84H 1VL2A 2KP8A 4PD4I 4BRYA 5AW6B 2FYNB 1L0LK 1NU1D 3AE6C 4JPZB 4AYCA 2KI7B 4ASWA 1YIJP 3GHGA 2ZVOB 1NTZE 1X8YA 1JY3N 2O01N 2PAJA 3L36A 2IFMA 3CC7P 5H2FH 1KILE 4OGQD 1AQ5A 3B5NC 2V7QJ 2OYHB 2W8ZA 1EDJA 2KSJA 3W67A 4EOTA 1NWQA 3CWBG 1SFCA 1OW6A 1R5SA 2BASA 4I7ZB 3A5TA 3TNUA 2FFDB 5AVUB 3GF7A 4A7PA 5CCHA 3FXEA 1FZCA 3L35A 1SQXG 2IYPA 2WSSH 3L75J 2D2CB 1PZQA 1RF0C 1M56D 1GW4A 1SVFA 3SWFA 2K88A 1JY3P 1SQVK 3B71A 2BCCJ 4LLHA 1FJKA 1LTJB 3VN0A 1WRGA 2K1AA 1KZUB 2ZT9B 4GDOA 2Z5IA 2E75C 1Q86Q 2OYOA 3H1IJ 4L75A 5KLVE 2YKPA 2N9YB 1FZGA 4WBAA 1P84E 1JM0A 1VQ6P 2UWJE 1ZRTD 2ZAEB 1LTGC 1SQPJ 1ZW0A 3AE3C 4OGQC 4RJTA 1NTMJ 1N7SB 1Q90D 2O1JA 2Y9ZA 2E43A 3II6A 2E5YA 1RF0A 2L5GB 3FXDA 3O8ZA 1H0TB 1JOCA 2R3CA 1LWUA 2JJLA 1BE3D 1U7MA 3JCUH 3CCVP 3L71J 1M1JC 1J1EC 1H89A 1NU1J 1N73C 1Q81Q 1HVVA 1NTMK 2QM7A 5APSA 3L74E 5CJ0A 2J5UA 5KLIB 5APUA 1EC5A 1KFMA 2H89C 2KLVA 2Q7CA 1RF1B 1SQVE 3A0BH 4ZKUA 2OYIC 2VRSA 1K05A 2AEFA 3H1LG 2QSIA 1HH0A 1IFDA 4YXWH 3GW6A 3V2RA 1QX8A 3L70D 1JCCA 3P8MC 3AE5C 1RE3C 5C39A 1QL1A 1N7SD 1T3JA 1ZP0C 2ZFCA 4EYYQ 1FZFA 3IR9A 4I2LC 2R44A 2C0WA 4K3AA 1Q82Q 4DCKA 3CC4P 1JNMA 2KZIA 1N73B 1L0NG 1M1JB 3I55P 2P2UA 1JMMA 3M0DA 4KJMA 1VQ9P 1YJNP 1RY3A 2A06E 3WUUA 1OVRA 4OH8B 3OAKA 4C7NA 1IK9A 2O1KA 1MZ9A 2PFXA 4W7YA 1VPCA 2QJPC 4PD4E 2JDIH 3E7KA 3P8CD 4LGDE 3H1JD 2AEMA 3USSA 1KILD 2M5AB 2WITA 4I7ZC 2FYUD 4RO0A 5AVZB 1CI6A 2XZRA 3PJSK 5AW4B 1RF1A 1ZRTE 4KHXA 2E75B 2E5TA 2YNYA 3FX0A 5EFWB 1WMKA 1NU1E 4D6TG 1QVGO 5AVVB 3P32A 3GF3A 4U3FD 1KQFB 2WMMA 1SS1A 3BCCJ 3L71D 1JY2N 5DJTB 1YTZI 1BE3J 1N7SC 4N78D 3RBZA 3M0DC 2LXCB 3M91A 5K5GB 5KAFH 2WSCJ 3UIAA 5GTIE 2FYZA 3Q2YA 2NPSB 1KV4A 3K5BA 3VYIA 1RE4C 1SQPD 2YMKA 3E1IA 4W80A 5AW2B 1AFOA 2N1TA 2XNDH 2FKWB 1VQKP 2E74B 1J2JB 1QVFO 1NAYA 1J1DC 1RE3A 1FZAA 1FOSE 5APYA 1VF5B 3B8EB 4B86A 1A02J 2O01J 3CX5E 1SQQE 3NMDA 3GHGC 3H1HD 1OXZA 4DZOA 1KD1Q 5AW0B 1VQNP 1AV1A 1GDTA 2FXMA 3G9RA 1NHLA 3I5CA 3TF5A 1R8EA 4H44B 1DX7A 4H0LC 4YPCA 2H8PD 1EZVD 2MJZA 2R32A 3PLNA 4PD4H 2XKMA 2FFDA 1N73A 2ZVNB 5B66E 1URQC 2J59M 1EZVI 2YO3A 2A06G 2M3EA 1KQLA 2OYHC 1HF9A 1USDA 1BSNA 3L72G 2LKMA 1JTHB 1LP1B 1FS0E 3L73D 2Y0CA 1N2DC 1NTKD 1OW8A 2JEEA 1PFIA 1QEXA 3VMAA 2W27A 3WUTA 2RN0A 1GTWA 1KTMA 3CWBJ 2AXCA 1HUCA 1SQVJ 1URQD 1W2BO 3HD7D 5AVQB 4L76A 3HD7A 3RK3B 2E75D 1URQA 3HE5A 3A0HH 3ZDMA 1CZQA 4PJ0E 3CCSP 1DH3A 3CD6P 1BGYJ 1L4AD 4R4MA 4ASVA 4GT1A 1YJ9P 1YITP 2YIUB 3H6PA 3L71E 2IX7C 1IFJA 1S4XA 1XTGB 4L74A 1LWUB 1HJ0A 2P10A 3M06A 3VTPC 5M1BA 2CPSA 3G4SP 3CCEP 4IFFA 1SQVD 2QJPB 3PH0A 1X22A 2A45I 3AE9C 3RK3E 2HPCA 1NTME 1DD4A 1PPJG 3L74G 3D70A 3JCUE 4H0LB 2OTJP 3GLMA 2GUSA 5B66H 3HUSC 1ZV8A 3MD0A 3M9BA 5AVRB 5AVYB 3W68A 1EZVE 1KB9E 1L0LG 2N1TB 3A7OA 3H1KG 3L72J 3H1LE 3RL0C 5KLVJ 3KHUA 1PP9J 1HTLC 5AW9B 4DJGA 3L75D 2G8YA
chains in the Genus database with same CATH topology
2Z4EA 3R2PA 3V5BA 1NTKK 1VDFA 2NPSC 2XNXA 2E42A 3N4XA 2HODA 2N1TD 1MUUA 2XDJA 1L4AC 4Y99B 1NU1K 2W6BA 1GL2B 1IFIA 5AVSB 1SLQA 1T3UA 3NTNA 4LC1A 2OYHA 1S9KE 3KYQA 2WT7B 2HG5D 5AVXB 2N1TC 5CCGC 1FDMA 3LIDA 1NAFA 3RK2B 5CCHC 1NH4A 1FAVA 1SQQK 4W7ZA 1SQPK 2WSEH 1JY2P 4GKGA 2HODB 2C9NY 1MFZA 1LTTC 3RK3C 2H43A 4EIJA 1CW5A 1SQXK 1EQ7A 3HUSB 1NTZK 1NKNA 2IPPA 1N7SA 3NXSA 3IFMA 1ZLLA 3M9HA 4JYBA 1LWUC 4WY4C 3RL0D 3VP9A 3VMYA 3H32B 1IJDB 2HPCB 4IFDK 4HH2A 3M9QA 2Z5HA 1FZCB 2I1JA 2POHA 3BRVB 2WZ7A 3RK3D 1SP4A 2H7HA 2A45G 5BU8B 2I1KA 5APQA 3HD7C 1LT9A 1ZN5A 3A3YB 3U1CA 1SFCC 4WY4D 2OYIA 2W6AA 1RF1C 2OARA 5CCHD 1FZBA 1G1JA 3U1AA 4JYCA 2WSFH 2A45H 1JY2O 3B5NB 5APWA 4ZKPA 3OA7A 3V4QA 1SFCD 2XU6A 1GZLA 1IFNA 2KB7P 4I1LA 2NPSA 3VOPA 1E5WA 2Q5UA 3P8CE 2NPSD 3MTUE 1GL2C 1NOHA 1XTCC 3HUSA 1FZCC 2YMYA 1T2KD 1X79B 4O9BA 3A2AA 4JF7A 3N7NA 5CCGD 3NFQA 3BATA 4IFMA 4WY4A 4M3LA 3EQ2A 1X9VA 2HYNA 1N86A 3B5NA 3SWYA 1H8AA 3TYYA 1N7LA 3V4WA 1IFMA 1G2CA 3BRTB 1L0NK 2XV5A 1DEBA 1T2KC 2Q9IA 3HD7B 1LT9B 2OYIB 5APTA 1GL2D 1JY3O 3V2NA 1LTBC 2YKQA 3HTKB 2IFNA 3BASA 1JTHA 1LTJC 2R5DA 2J58A 3MGNA 3RL0B 1GU5A 1JO5A 3MUDA 2CPBA 2R5BA 4I6MC 1JCDA 1IO4A 3KQGA 4WY4B 5APVA 3L37A 1RE4A 5AW5B 1L4AB 1GU4A 1GK4A 2P1JA 2ZXEB 4C46A 5KJ7A 1HGZA 1HJBA 1URQB 3HE5B 2N9BA 3V2PA 2WWWA 3L4FA 1FZEA 1KFNA 1S9KD 3TNUB 2C0XA 1NO4A 3HE4A 4N3YB 1SFCB 1ZR4A 3HTKA 3OJAB 3U59A 3WMM0 1A02F 4HYTB 1G1IA 5CJ4A 4N78E 3LW5H 2WPSA 3CLQA 5AVTB 4C7NB 2WT7A 4Y99C 4N6JA 2WSCH 3KPEA 3M0AA 2PP6A 4GIFA 3HRNA 1G2CB 5AW1B 3CI9A 2HFED 4AUWA 1LTSC 3TK1A 2GM4A 1J1EB 3PP5A 5AVWB 2WPRA 2YO2A 4DOJA 3RK2D 5BU5A 1L4AA 3LIEA 4RESB 1KILB 2YKOA 1M7LA 1CI6B 1HBWA 1HGVA 2M8RA 1OWAA 1HWTC 1LT9C 3KDPB 5APXA 2WPQA 5KJ7D 5CHXA 1LTJA 1YTZT 1Z56A 1GW3A 2KYVA 2HLOA 2QM8A 3C9IA 5AW8B 3RK2C 5BVZA 2FYUK 5KLVK 1IC2A 3VP8A 2FFDC 3G3ZA 2WTYA 5AW3B 4XE5B 4AQRD 3GHGB 1GD2E 1FU1A 2P67A 2M3BA 3CL3D 2GUVA 1FOSF 1MV8A 1FJPA 1NKZB 2KOGA 5KTBA 4WB4A 3H32A 1LTAC 1GL2A 2Q3IA 1LGHB 1T8ZA 3HE4B 3P7KA 1KILA 1JUNA 1H88A 4C7RA 1KILC 3B5ND 1LTIC 5AW7B 3V2QA 5CCGA 5CMZA 1FBMA 1QL2A 1W2EA 1YYCA 1ZR2A 2O01H 5KJ7C 3BVHA 1CSBA 1WT6A 3EFGA 3MIWA 3T97A 1M1JA 3VMZA 1J1DB 3TSIA 2P7JA 4XA4A 3VMXA 1SQBK 1GK6A 2KP8A 5AW6B 1L0LK 4AYCA 3GHGA 1X8YA 2PAJA 1JY3N 3L36A 2IFMA 1AQ5A 3B5NC 2OYHB 2KSJA 4EOTA 1NWQA 1SFCA 2BASA 3A5TA 3TNUA 2FFDB 5AVUB 5CCHA 1FZCA 3L35A 1RF0C 1GW4A 1SVFA 3SWFA 1JY3P 1SQVK 4LLHA 3VN0A 1FJKA 1LTJB 1WRGA 1KZUB 2Z5IA 2YKPA 1FZGA 4WBAA 1LTGC 1N7SB 2O1JA 2E43A 3II6A 2L5GB 1RF0A 3O8ZA 1JOCA 2R3CA 1LWUA 2JJLA 1M1JC 1J1EC 1H89A 1N73C 1HVVA 1NTMK 2QM7A 5APSA 5CJ0A 5APUA 1KFMA 2KLVA 2Q7CA 1RF1B 4ZKUA 2OYIC 2VRSA 1HH0A 1IFDA 3V2RA 1JCCA 3P8MC 1RE3C 1QL1A 1N7SD 1T3JA 2ZFCA 1FZFA 3IR9A 4I2LC 2C0WA 1JNMA 1N73B 1M1JB 2P2UA 1JMMA 3M0DA 1RY3A 4OH8B 3OAKA 4C7NA 1IK9A 2O1KA 1MZ9A 4W7YA 1VPCA 4LGDE 3P8CD 1KILD 2WITA 5AVZB 1RF1A 1CI6A 2XZRA 5AW4B 4KHXA 2YNYA 5AVVB 3P32A 1JY2N 1YTZI 1N7SC 4N78D 3M0DC 3M91A 3UIAA 2FYZA 2NPSB 3VYIA 1RE4C 3E1IA 4W80A 5AW2B 1AFOA 2N1TA 2FKWB 1J2JB 1J1DC 1RE3A 1FZAA 1FOSE 5APYA 3B8EB 4B86A 1A02J 3NMDA 4DZOA 3GHGC 1OXZA 5AW0B 1GDTA 2FXMA 3I5CA 1NHLA 1DX7A 2H8PD 2MJZA 2R32A 2XKMA 2FFDA 1N73A 1URQC 2J59M 2YO3A 1KQLA 2OYHC 2LKMA 1JTHB 1N2DC 1PFIA 2JEEA 2W27A 1GTWA 1HUCA 1URQD 3HD7D 5AVQB 3HD7A 3RK3B 2C9LY 1URQA 3HE5A 1CZQA 1DH3A 1L4AD 4GT1A 3H6PA 2IX7C 1IFJA 1XTGB 3VTPC 1LWUB 3M06A 2CPSA 4IFFA 2A45I 2HPCA 2GUSA 3HUSC 1ZV8A 3MD0A 3M9BA 5AVRB 5AVYB 2N1TB 3A7OA 3RL0C 1HTLC 5AW9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KSJ A;  4IFM A;  2XKM A;  1IFN A;  2IFN A;  2IFM A;  3IFM A;  2KLV A;  1QL2 A;  1ZN5 A;  1IFM A;  1QL1 A;  1PFI A; 
#chains in the Genus database with same CATH topology
 2IZ1 A;  2Y0E A;  2Z4E A;  1GMJ A;  3R2P A;  1JEK A;  1YQ4 C;  3V5B A;  1NTK K;  1VDF A;  2NPS C;  2XNX A;  3FWN A;  5KKZ C;  1KQS O;  1VQ5 P;  2E42 A;  3N4X A;  3CCQ P;  2HOD A;  2N1T D;  1BGY G;  1MUU A;  2XDJ A;  1L4A C;  4L73 A;  2IBZ G;  2B87 A;  4Y99 B;  4WWI A;  2ZJS E;  1L0L D;  1NU1 K;  4H0L D;  2W6B A;  1GL2 B;  3L70 E;  1IFI A;  5AVS B;  1NTK J;  1SLQ A;  1T3U A;  2G3A A;  3NTN A;  2H88 C;  4LC1 A;  2OYH A;  1S9K E;  2PGD A;  3KYQ A;  2WT7 B;  1SQV G;  1USE A;  1DD3 A;  2HG5 D;  3KZI E;  4HB1 A;  5AVX B;  1ZXG A;  2N1T C;  1NTZ J;  2CK3 H;  5CCG C;  3RBX A;  3G6E P;  2LXB A;  3FGA D;  1FDM A;  1BGY D;  1KB9 I;  2KSE A;  3LID A;  1NAF A;  3RK2 B;  5CCH C;  2QEX P;  2WPV B;  3CCM P;  1K73 Q;  1BSH A;  1NH4 A;  2WSF J;  2LR2 A;  1FAV A;  3C8V A;  1SQQ K;  4U3F J;  1KB9 D;  4W7Z A;  3H1J E;  2ZT9 C;  1K8A Q;  1SQP K;  1YBK A;  2OTL P;  2WSE H;  1KYO E;  1JY2 P;  3AEC C;  4GKG A;  1L2P A;  2B9B A;  2HOD B;  1S5L H;  1PP9 G;  2KUB A;  1MFZ A;  5KLV D;  2V4H A;  4H13 D;  2C9N Y;  3H1K J;  1LTT C;  1RH5 B;  3RK3 C;  3QH9 A;  5KLV G;  2JO1 A;  1YHQ P;  4EIJ A;  1YI2 P;  2H43 A;  1SQX K;  1CW5 A;  1EQ7 A;  3HUS B;  1NTZ K;  3WU2 H;  3D6Y A;  1NKN A;  2IPP A;  1N7S A;  1L0L E;  3NXS A;  3IFM A;  3R4Y A;  5KAF E;  1ZLL A;  3M9H A;  1S5L X;  4JYB A;  3TGU E;  1L0N D;  1LWU C;  1OFC X;  2YXR B;  4WY4 C;  3RL0 D;  3VP9 A;  1MKM A;  2IYO A;  5CBO A;  3I56 P;  1X0T A;  3VMY A;  3H32 B;  1IJD B;  3L72 E;  3H1H G;  2BEZ F;  2HPC B;  3L73 E;  1SQB G;  1U7J A;  2FXO A;  4IFD K;  4HH2 A;  3M9Q A;  2K9J B;  1S72 P;  1EDK A;  1KYO D;  1LNQ A;  1OVV A;  2I1J A;  2WSE J;  2Z5H A;  3H1L D;  1FZC B;  2POH A;  1VQ8 P;  3BCC E;  1IK7 A;  3BRV B;  2IBZ D;  3FWL A;  3ITK A;  1SQX E;  1NJI Q;  2WZ7 A;  1N8R Q;  1EXJ A;  2WVR A;  2KK7 A;  1UIX A;  3RK3 D;  2A06 D;  2K37 A;  1SP4 A;  1M1K Q;  1W5C E;  2H7H A;  1PPJ E;  2A45 G;  2ZYD A;  1S5L E;  5BU8 B;  3LW5 J;  2I1K A;  5APQ A;  3D6Z A;  3HD7 C;  1P84 D;  1KQG B;  1T6A A;  1LT9 A;  3CWB E;  3KXD A;  1ZN5 A;  3A3Y B;  3U1C A;  1SFC C;  3OW2 O;  4WY4 D;  1IZN B;  4BWN A;  2OYI A;  1Q2N A;  2W6A A;  3ABV C;  2OAR A;  1RF1 C;  4BRY B;  4OWF A;  5CCH D;  1FZB A;  3Q1M A;  3CXH E;  4JQ0 D;  1G1J A;  4UB6 E;  3U1A A;  4JYC A;  2IZ0 A;  3RL0 g;  1YQ3 C;  2WSF H;  2A45 H;  2QJK B;  1JY2 O;  3B5N B;  5APW A;  1AVY A;  2JR8 A;  3AEA C;  3OA7 A;  3V4Q A;  1SFC D;  4ZKP A;  1ZME C;  1E79 H;  2XU6 A;  5L8R J;  3V6I A;  1GZL A;  5GTH H;  4H13 C;  1IFN A;  2Q1K A;  2HR3 A;  2KB7 P;  4I1L A;  5KAI H;  1VQ4 P;  4JBZ A;  1BCC J;  2NPS A;  3VOP A;  2OQQ A;  3T97 B;  5KKZ B;  1Y9B A;  1KYO I;  4HKZ H;  1E5W A;  2Q5U A;  3P8C E;  2NPS D;  4GIF A;  3Q3D A;  2OTK E;  2JP3 A;  3MTU E;  2JWD A;  1GL2 C;  1NOH A;  2KS1 A;  3H1L J;  3SSU A;  1XTC C;  1TU3 F;  3CX5 D;  3L73 G;  1PGO A;  2FYU J;  2M0B A;  1PP9 D;  1PV3 A;  3F89 A;  4IL6 H;  1NYH A;  1S3J A;  3HUS A;  1RQV A;  3L72 D;  3CPW O;  3Q5P A;  3CXH D;  1VQP P;  1FZC C;  2YMY A;  2ZYG A;  5BU5 A;  2V7Q H;  3H1K E;  1SQP E;  1BDD A;  3IAO A;  2YXQ B;  2FBW C;  2KNC A;  1T2K D;  1RHZ B;  3D71 A;  1X79 B;  4O9B A;  2SPZ A;  3A2A A;  1EZV G;  2MKV A;  3N7N A;  4JF7 A;  1IFP A;  4K35 A;  5CCG D;  3NFQ A;  3BAT A;  4IFM A;  4WY4 A;  3WU2 E;  4M3L A;  3EQ2 A;  1X9V A;  2HYN A;  1N86 A;  3B5N A;  5DJU B;  3SWY A;  1H8A A;  3TYY A;  1N7L A;  3V4W A;  3CC2 P;  1IFM A;  1G2C A;  3BRT B;  5TIS H;  1L0N K;  2XV5 A;  3L75 E;  1DEB A;  3H1I G;  1YJW P;  1T2K C;  1PPJ D;  1RQU A;  3IN6 A;  3O6Q B;  2Q9I A;  2ZT9 D;  1SQB D;  3HD7 B;  1LT9 B;  1KYO H;  3AEG C;  5APT A;  2OYI B;  1SQP G;  4TT3 H;  1GL2 D;  4D6T J;  1JY3 O;  1SQX D;  4Y28 J;  3V2N A;  2FY8 A;  1LTB C;  2P58 A;  2YKQ A;  2C9L Y;  3HTK B;  2IFN A;  3AEE C;  3BAS A;  4ZMD A;  1JTH A;  1LP1 A;  1LTJ C;  2J58 A;  2R5D A;  5GTI H;  1NGM B;  3A0B E;  1ZOY C;  2B87 B;  2KZJ A;  2RMZ A;  3L71 G;  3MGN A;  3RL0 B;  1GU5 A;  1PGQ A;  1JO5 A;  4IL6 E;  3MUD A;  4U3F G;  1R5L A;  2CPB A;  4D6T D;  1L0N E;  2ZXX A;  3H25 A;  1VQ7 P;  1PGP A;  2OGU A;  2K9J A;  2FYU G;  3CCJ P;  4UB8 H;  3AED C;  1H0T A;  3H1K D;  2R5B A;  4I6M C;  2KIK A;  3MP7 B;  4H44 D;  5KLI C;  1JCD A;  2QJK C;  3F5H A;  3L74 J;  3PRJ A;  1IO4 A;  1Y8A A;  1PP9 E;  3KQG A;  3JC2 2;  4UB8 E;  4WY4 B;  5APV A;  3L37 A;  2I8D A;  1RE4 A;  1SQX J;  3AE2 C;  5B5E E;  3KZI H;  2KNC B;  5AW5 B;  3Q5S A;  1L4A B;  3CCR P;  1OVU A;  1GU4 A;  4UB6 H;  1BE3 E;  4WVZ A;  1GK4 A;  2JKV A;  5H2F E;  3CME P;  2P1J A;  2ZXE B;  1OX3 A;  2FYU E;  1HGZ A;  4C46 A;  5KJ7 A;  2KXP B;  2GA1 A;  3L70 G;  5E79 H;  4Z1M H;  2W6J H;  1VQL P;  3EFF K;  2WQY C;  1HJB A;  1URQ B;  3HE5 B;  5KAI E;  2N9B A;  3V2P A;  2WWW A;  3L4F A;  1LT1 A;  2D2C C;  4PV1 C;  1S1C X;  4HJG H;  1FZE A;  1KFN A;  1S9K D;  3TNU B;  1BCC E;  1NO4 A;  2C0X A;  3HE4 A;  4H44 C;  3TDK A;  1QLE D;  2E76 B;  1NU1 G;  1KN7 A;  4N3Y B;  1SFC B;  1ZR4 A;  1NVO A;  3BCC G;  1OIP A;  2QVA A;  3HTK A;  3OJA B;  3U59 A;  4XFJ A;  4YXD C;  1BE3 G;  4ZNC A;  3WMM 0;  4GOD A;  1A02 F;  2DW3 A;  1PIX A;  4HYT B;  1VF5 C;  3EWK A;  1G1I A;  3MHV A;  4N78 E;  3LW5 H;  3L75 G;  2K3R A;  5CJ4 A;  2WPS A;  3CLQ A;  5AVT B;  4C7N B;  3H1J J;  1DIP A;  4D6T E;  1FDI A;  5B5E H;  1U57 A;  4U3F E;  4Y99 C;  2WT7 A;  4N6J A;  1AJY A;  2WSC H;  3KPE A;  3M0A A;  2PP6 A;  3AE7 C;  2NRG A;  3HRN A;  2FYN C;  2E74 D;  1FDO A;  2BEQ D;  3C1L A;  3L74 D;  2RH0 A;  3PHL A;  1G2C B;  1P84 I;  4NPE A;  1VF5 D;  5AW1 B;  3CI9 A;  1SQQ J;  2NZ2 A;  1PGJ A;  2ZYA A;  3PTZ A;  2HFE D;  4PD4 D;  1NTM G;  4RKU J;  2IBZ E;  3MZW B;  1LTS C;  2PRR A;  4AUW A;  3E1R A;  4PV1 D;  2JWA A;  2AXT H;  3TK1 A;  2IBZ I;  2GM4 A;  1J1E B;  3PP5 A;  5AVW B;  3B4S A;  2WPR A;  3IF4 A;  3L70 J;  4GOF A;  3S9O A;  4OVN F;  3H1H E;  1PL5 A;  2KS1 B;  4BXL A;  3SFE C;  1NTK G;  2Y9Y A;  1QGK B;  2YO2 A;  3A0H E;  3AEF C;  3CXH I;  3RK2 D;  3WUV A;  4DOJ A;  2QRX A;  1KOR A;  1L4A A;  1UII A;  2O3J A;  2B89 A;  2QG4 A;  3L73 J;  3LIE A;  4RES B;  3H1J G;  1KIL B;  3H1I E;  3CMA P;  3CCL P;  2YKO A;  1EDL A;  1M7L A;  1EDI A;  3AE4 C;  1CI6 B;  1HBW A;  1HGV A;  4NPF X;  2BCC E;  2E74 C;  3S4R A;  3S1K A;  2M8R A;  1OWA A;  1HWT C;  1EXI A;  2QE7 H;  1LT9 C;  3KDP B;  1BCC G;  3SFD C;  1M90 Q;  1L0N J;  1OMI A;  2D2C D;  1AVO A;  4H13 B;  5APX A;  2FXP A;  2WPQ A;  5KJ7 D;  5CHX A;  1LTJ A;  1MFT A;  3Q5R A;  3TGU G;  1Q7Y Q;  1YTZ T;  1Z56 A;  4EDF A;  1GW3 A;  5TJH A;  4KT0 J;  3RGU A;  1SQQ G;  2KYV A;  2L91 A;  2HLO A;  1D7M A;  1BGY E;  1M57 D;  2QM8 A;  3AE8 C;  3C9I A;  3CCU P;  2R3S A;  3MUD C;  5AW8 B;  3RK2 C;  3AE1 C;  2AEJ A;  1OZH A;  5BVZ A;  2FYU K;  1FE6 A;  5E79 E;  5KLV K;  1IC2 A;  3CXH H;  3VP8 A;  4DT0 A;  2IDB A;  3G3Z A;  5AW3 B;  4XE5 B;  4AQR D;  4PV1 B;  5CBN A;  2WTY A;  2FFD C;  1NTZ G;  3GHG B;  2Q3E A;  1GD2 E;  1FU1 A;  2P67 A;  2M3B A;  3CWB D;  3CL3 D;  1AA0 A;  2W90 A;  4IL6 X;  1VQM P;  3CX5 H;  4NPD A;  5GTH E;  1S2E A;  2GUV A;  4QMA A;  1NTK E;  1M8O B;  1FOS F;  1MV8 A;  1FJP A;  1NKZ B;  2KOG A;  3G71 P;  5KTB A;  1AQT A;  1Y47 A;  4WB4 A;  2W83 C;  1KC8 Q;  3H32 A;  4GOE A;  2QA4 P;  1KMI Z;  1LTA C;  1GL2 A;  2K9Y A;  2RKL A;  2Q3I A;  3O6Q A;  2QJY C;  3GG2 A;  1LGH B;  1NTZ D;  1T8Z A;  3HE4 B;  2E76 D;  4IOI H;  1K9M Q;  3P7K A;  4U7J A;  1KIL A;  4EI2 A;  3BCC D;  1JUN A;  1H88 A;  1JB0 J;  1KB9 H;  1SQB J;  4C7R A;  2Y0D A;  2QIW A;  1SQB E;  3TGU J;  1KIL C;  3SWK A;  3AEB C;  3B5N D;  1NTM D;  2KLU A;  1LTI C;  4MN4 C;  3JSV C;  1L0L J;  2M5A A;  3GMA A;  2BCC D;  1SQQ D;  5AW7 B;  3V2Q A;  5CCG A;  2AXT E;  5CMZ A;  1LJ2 A;  1DEE G;  1FBM A;  1K04 A;  2E76 C;  1QL2 A;  2BCC G;  2Q6Q A;  1W2E A;  1YYC A;  3H1I D;  3H1H J;  3QWO C;  4OGQ B;  4PJ0 H;  4YTP C;  1ZR2 A;  2O01 H;  1BDC A;  3TGU D;  1JMB A;  1VQO P;  1FC2 C;  4R4L A;  5KJ7 C;  3BVH A;  1CSB A;  1WT6 A;  2YIU C;  3EFG A;  1OW7 A;  1M1J A;  3MIW A;  3T97 A;  3VMZ A;  1J1D B;  3TSI A;  3CX5 I;  5TIS E;  2P7J A;  4XA4 A;  3VMX A;  1SQB K;  1BCC D;  4CPG A;  2ITA A;  2QJY B;  4TLF A;  2B88 A;  1GK6 A;  1P84 H;  1VL2 A;  2KP8 A;  4PD4 I;  4BRY A;  5AW6 B;  2FYN B;  1L0L K;  1NU1 D;  3AE6 C;  4JPZ B;  4AYC A;  2KI7 B;  4ASW A;  1YIJ P;  3GHG A;  2ZVO B;  1NTZ E;  1X8Y A;  1JY3 N;  2O01 N;  2PAJ A;  3L36 A;  2IFM A;  3CC7 P;  5H2F H;  1KIL E;  4OGQ D;  1AQ5 A;  3B5N C;  2V7Q J;  2OYH B;  2W8Z A;  1EDJ A;  2KSJ A;  3W67 A;  4EOT A;  1NWQ A;  3CWB G;  1SFC A;  1OW6 A;  1R5S A;  2BAS A;  4I7Z B;  3A5T A;  3TNU A;  2FFD B;  5AVU B;  3GF7 A;  4A7P A;  5CCH A;  3FXE A;  1FZC A;  3L35 A;  1SQX G;  2IYP A;  2WSS H;  3L75 J;  2D2C B;  1PZQ A;  1RF0 C;  1M56 D;  1GW4 A;  1SVF A;  3SWF A;  2K88 A;  1JY3 P;  1SQV K;  3B71 A;  2BCC J;  4LLH A;  1FJK A;  1LTJ B;  3VN0 A;  1WRG A;  2K1A A;  1KZU B;  2ZT9 B;  4GDO A;  2Z5I A;  2E75 C;  1Q86 Q;  2OYO A;  3H1I J;  4L75 A;  5KLV E;  2YKP A;  2N9Y B;  1FZG A;  4WBA A;  1P84 E;  1JM0 A;  1VQ6 P;  2UWJ E;  1ZRT D;  2ZAE B;  1LTG C;  1SQP J;  1ZW0 A;  3AE3 C;  4OGQ C;  4RJT A;  1NTM J;  1N7S B;  1Q90 D;  2O1J A;  2Y9Z A;  2E43 A;  3II6 A;  2E5Y A;  1RF0 A;  2L5G B;  3FXD A;  3O8Z A;  1H0T B;  1JOC A;  2R3C A;  1LWU A;  2JJL A;  1BE3 D;  1U7M A;  3JCU H;  3CCV P;  3L71 J;  1M1J C;  1J1E C;  1H89 A;  1NU1 J;  1N73 C;  1Q81 Q;  1HVV A;  1NTM K;  2QM7 A;  5APS A;  3L74 E;  5CJ0 A;  2J5U A;  5KLI B;  5APU A;  1EC5 A;  1KFM A;  2H89 C;  2KLV A;  2Q7C A;  1RF1 B;  1SQV E;  3A0B H;  4ZKU A;  2OYI C;  2VRS A;  1K05 A;  2AEF A;  3H1L G;  2QSI A;  1HH0 A;  1IFD A;  4YXW H;  3GW6 A;  3V2R A;  1QX8 A;  3L70 D;  1JCC A;  3P8M C;  3AE5 C;  1RE3 C;  5C39 A;  1QL1 A;  1N7S D;  1T3J A;  1ZP0 C;  2ZFC A;  4EYY Q;  1FZF A;  3IR9 A;  4I2L C;  2R44 A;  2C0W A;  4K3A A;  1Q82 Q;  4DCK A;  3CC4 P;  1JNM A;  2KZI A;  1N73 B;  1L0N G;  1M1J B;  3I55 P;  2P2U A;  1JMM A;  3M0D A;  4KJM A;  1VQ9 P;  1YJN P;  1RY3 A;  2A06 E;  3WUU A;  1OVR A;  4OH8 B;  3OAK A;  4C7N A;  1IK9 A;  2O1K A;  1MZ9 A;  2PFX A;  4W7Y A;  1VPC A;  2QJP C;  4PD4 E;  2JDI H;  3E7K A;  3P8C D;  4LGD E;  3H1J D;  2AEM A;  3USS A;  1KIL D;  2M5A B;  2WIT A;  4I7Z C;  2FYU D;  4RO0 A;  5AVZ B;  1CI6 A;  2XZR A;  3PJS K;  5AW4 B;  1RF1 A;  1ZRT E;  4KHX A;  2E75 B;  2E5T A;  2YNY A;  3FX0 A;  5EFW B;  1WMK A;  1NU1 E;  4D6T G;  1QVG O;  5AVV B;  3P32 A;  3GF3 A;  4U3F D;  1KQF B;  2WMM A;  1SS1 A;  3BCC J;  3L71 D;  1JY2 N;  5DJT B;  1YTZ I;  1BE3 J;  1N7S C;  4N78 D;  3RBZ A;  3M0D C;  2LXC B;  3M91 A;  5K5G B;  5KAF H;  2WSC J;  3UIA A;  5GTI E;  2FYZ A;  3Q2Y A;  2NPS B;  1KV4 A;  3K5B A;  3VYI A;  1RE4 C;  1SQP D;  2YMK A;  3E1I A;  4W80 A;  5AW2 B;  1AFO A;  2N1T A;  2XND H;  2FKW B;  1VQK P;  2E74 B;  1J2J B;  1QVF O;  1NAY A;  1J1D C;  1RE3 A;  1FZA A;  1FOS E;  5APY A;  1VF5 B;  3B8E B;  4B86 A;  1A02 J;  2O01 J;  3CX5 E;  1SQQ E;  3NMD A;  3GHG C;  3H1H D;  1OXZ A;  4DZO A;  1KD1 Q;  5AW0 B;  1VQN P;  1AV1 A;  1GDT A;  2FXM A;  3G9R A;  1NHL A;  3I5C A;  3TF5 A;  1R8E A;  4H44 B;  1DX7 A;  4H0L C;  4YPC A;  2H8P D;  1EZV D;  2MJZ A;  2R32 A;  3PLN A;  4PD4 H;  2XKM A;  2FFD A;  1N73 A;  2ZVN B;  5B66 E;  1URQ C;  2J59 M;  1EZV I;  2YO3 A;  2A06 G;  2M3E A;  1KQL A;  2OYH C;  1HF9 A;  1USD A;  1BSN A;  3L72 G;  2LKM A;  1JTH B;  1LP1 B;  1FS0 E;  3L73 D;  2Y0C A;  1N2D C;  1NTK D;  1OW8 A;  2JEE A;  1PFI A;  1QEX A;  3VMA A;  2W27 A;  3WUT A;  2RN0 A;  1GTW A;  1KTM A;  3CWB J;  2AXC A;  1HUC A;  1SQV J;  1URQ D;  1W2B O;  3HD7 D;  5AVQ B;  4L76 A;  3HD7 A;  3RK3 B;  2E75 D;  1URQ A;  3HE5 A;  3A0H H;  3ZDM A;  1CZQ A;  4PJ0 E;  3CCS P;  1DH3 A;  3CD6 P;  1BGY J;  1L4A D;  4R4M A;  4ASV A;  4GT1 A;  1YJ9 P;  1YIT P;  2YIU B;  3H6P A;  3L71 E;  2IX7 C;  1IFJ A;  1S4X A;  1XTG B;  4L74 A;  1LWU B;  1HJ0 A;  2P10 A;  3M06 A;  3VTP C;  5M1B A;  2CPS A;  3G4S P;  3CCE P;  4IFF A;  1SQV D;  2QJP B;  3PH0 A;  1X22 A;  2A45 I;  3AE9 C;  3RK3 E;  2HPC A;  1NTM E;  1DD4 A;  1PPJ G;  3L74 G;  3D70 A;  3JCU E;  4H0L B;  2OTJ P;  3GLM A;  2GUS A;  5B66 H;  3HUS C;  1ZV8 A;  3MD0 A;  3M9B A;  5AVR B;  5AVY B;  3W68 A;  1EZV E;  1KB9 E;  1L0L G;  2N1T B;  3A7O A;  3H1K G;  3L72 J;  3H1L E;  3RL0 C;  5KLV J;  3KHU A;  1PP9 J;  1HTL C;  5AW9 B;  4DJG A;  3L75 D;  2G8Y A; 
#chains in the Genus database with same CATH homology
 2Z4E A;  3R2P A;  3V5B A;  1NTK K;  1VDF A;  2NPS C;  2XNX A;  2E42 A;  3N4X A;  2HOD A;  2N1T D;  1MUU A;  2XDJ A;  1L4A C;  4Y99 B;  1NU1 K;  2W6B A;  1GL2 B;  1IFI A;  5AVS B;  1SLQ A;  1T3U A;  3NTN A;  4LC1 A;  2OYH A;  1S9K E;  3KYQ A;  2WT7 B;  2HG5 D;  5AVX B;  2N1T C;  5CCG C;  1FDM A;  3LID A;  1NAF A;  3RK2 B;  5CCH C;  1NH4 A;  1FAV A;  1SQQ K;  4W7Z A;  1SQP K;  2WSE H;  1JY2 P;  4GKG A;  2HOD B;  2C9N Y;  1MFZ A;  1LTT C;  3RK3 C;  2H43 A;  4EIJ A;  1CW5 A;  1SQX K;  1EQ7 A;  3HUS B;  1NTZ K;  1NKN A;  2IPP A;  1N7S A;  3NXS A;  3IFM A;  1ZLL A;  3M9H A;  4JYB A;  1LWU C;  4WY4 C;  3RL0 D;  3VP9 A;  3VMY A;  3H32 B;  1IJD B;  2HPC B;  4IFD K;  4HH2 A;  3M9Q A;  2Z5H A;  1FZC B;  2I1J A;  2POH A;  3BRV B;  2WZ7 A;  3RK3 D;  1SP4 A;  2H7H A;  2A45 G;  5BU8 B;  2I1K A;  5APQ A;  3HD7 C;  1LT9 A;  1ZN5 A;  3A3Y B;  3U1C A;  1SFC C;  4WY4 D;  2OYI A;  2W6A A;  1RF1 C;  2OAR A;  5CCH D;  1FZB A;  1G1J A;  3U1A A;  4JYC A;  2WSF H;  2A45 H;  1JY2 O;  3B5N B;  5APW A;  4ZKP A;  3OA7 A;  3V4Q A;  1SFC D;  2XU6 A;  1GZL A;  1IFN A;  2KB7 P;  4I1L A;  2NPS A;  3VOP A;  1E5W A;  2Q5U A;  3P8C E;  2NPS D;  3MTU E;  1GL2 C;  1NOH A;  1XTC C;  3HUS A;  1FZC C;  2YMY A;  1T2K D;  1X79 B;  4O9B A;  3A2A A;  4JF7 A;  3N7N A;  5CCG D;  3NFQ A;  3BAT A;  4IFM A;  4WY4 A;  4M3L A;  3EQ2 A;  1X9V A;  2HYN A;  1N86 A;  3B5N A;  3SWY A;  1H8A A;  3TYY A;  1N7L A;  3V4W A;  1IFM A;  1G2C A;  3BRT B;  1L0N K;  2XV5 A;  1DEB A;  1T2K C;  2Q9I A;  3HD7 B;  1LT9 B;  2OYI B;  5APT A;  1GL2 D;  1JY3 O;  3V2N A;  1LTB C;  2YKQ A;  3HTK B;  2IFN A;  3BAS A;  1JTH A;  1LTJ C;  2R5D A;  2J58 A;  3MGN A;  3RL0 B;  1GU5 A;  1JO5 A;  3MUD A;  2CPB A;  2R5B A;  4I6M C;  1JCD A;  1IO4 A;  3KQG A;  4WY4 B;  5APV A;  3L37 A;  1RE4 A;  5AW5 B;  1L4A B;  1GU4 A;  1GK4 A;  2P1J A;  2ZXE B;  4C46 A;  5KJ7 A;  1HGZ A;  1HJB A;  1URQ B;  3HE5 B;  2N9B A;  3V2P A;  2WWW A;  3L4F A;  1FZE A;  1KFN A;  1S9K D;  3TNU B;  2C0X A;  1NO4 A;  3HE4 A;  4N3Y B;  1SFC B;  1ZR4 A;  3HTK A;  3OJA B;  3U59 A;  3WMM 0;  1A02 F;  4HYT B;  1G1I A;  5CJ4 A;  4N78 E;  3LW5 H;  2WPS A;  3CLQ A;  5AVT B;  4C7N B;  2WT7 A;  4Y99 C;  4N6J A;  2WSC H;  3KPE A;  3M0A A;  2PP6 A;  4GIF A;  3HRN A;  1G2C B;  5AW1 B;  3CI9 A;  2HFE D;  4AUW A;  1LTS C;  3TK1 A;  2GM4 A;  1J1E B;  3PP5 A;  5AVW B;  2WPR A;  2YO2 A;  4DOJ A;  3RK2 D;  5BU5 A;  1L4A A;  3LIE A;  4RES B;  1KIL B;  2YKO A;  1M7L A;  1CI6 B;  1HBW A;  1HGV A;  2M8R A;  1OWA A;  1HWT C;  1LT9 C;  3KDP B;  5APX A;  2WPQ A;  5KJ7 D;  5CHX A;  1LTJ A;  1YTZ T;  1Z56 A;  1GW3 A;  2KYV A;  2HLO A;  2QM8 A;  3C9I A;  5AW8 B;  3RK2 C;  5BVZ A;  2FYU K;  5KLV K;  1IC2 A;  3VP8 A;  2FFD C;  3G3Z A;  2WTY A;  5AW3 B;  4XE5 B;  4AQR D;  3GHG B;  1GD2 E;  1FU1 A;  2P67 A;  2M3B A;  3CL3 D;  2GUV A;  1FOS F;  1MV8 A;  1FJP A;  1NKZ B;  2KOG A;  5KTB A;  4WB4 A;  3H32 A;  1LTA C;  1GL2 A;  2Q3I A;  1LGH B;  1T8Z A;  3HE4 B;  3P7K A;  1KIL A;  1JUN A;  1H88 A;  4C7R A;  1KIL C;  3B5N D;  1LTI C;  5AW7 B;  3V2Q A;  5CCG A;  5CMZ A;  1FBM A;  1QL2 A;  1W2E A;  1YYC A;  1ZR2 A;  2O01 H;  5KJ7 C;  3BVH A;  1CSB A;  1WT6 A;  3EFG A;  3MIW A;  3T97 A;  1M1J A;  3VMZ A;  1J1D B;  3TSI A;  2P7J A;  4XA4 A;  3VMX A;  1SQB K;  1GK6 A;  2KP8 A;  5AW6 B;  1L0L K;  4AYC A;  3GHG A;  1X8Y A;  2PAJ A;  1JY3 N;  3L36 A;  2IFM A;  1AQ5 A;  3B5N C;  2OYH B;  2KSJ A;  4EOT A;  1NWQ A;  1SFC A;  2BAS A;  3A5T A;  3TNU A;  2FFD B;  5AVU B;  5CCH A;  1FZC A;  3L35 A;  1RF0 C;  1GW4 A;  1SVF A;  3SWF A;  1JY3 P;  1SQV K;  4LLH A;  3VN0 A;  1FJK A;  1LTJ B;  1WRG A;  1KZU B;  2Z5I A;  2YKP A;  1FZG A;  4WBA A;  1LTG C;  1N7S B;  2O1J A;  2E43 A;  3II6 A;  2L5G B;  1RF0 A;  3O8Z A;  1JOC A;  2R3C A;  1LWU A;  2JJL A;  1M1J C;  1J1E C;  1H89 A;  1N73 C;  1HVV A;  1NTM K;  2QM7 A;  5APS A;  5CJ0 A;  5APU A;  1KFM A;  2KLV A;  2Q7C A;  1RF1 B;  4ZKU A;  2OYI C;  2VRS A;  1HH0 A;  1IFD A;  3V2R A;  1JCC A;  3P8M C;  1RE3 C;  1QL1 A;  1N7S D;  1T3J A;  2ZFC A;  1FZF A;  3IR9 A;  4I2L C;  2C0W A;  1JNM A;  1N73 B;  1M1J B;  2P2U A;  1JMM A;  3M0D A;  1RY3 A;  4OH8 B;  3OAK A;  4C7N A;  1IK9 A;  2O1K A;  1MZ9 A;  4W7Y A;  1VPC A;  4LGD E;  3P8C D;  1KIL D;  2WIT A;  5AVZ B;  1RF1 A;  1CI6 A;  2XZR A;  5AW4 B;  4KHX A;  2YNY A;  5AVV B;  3P32 A;  1JY2 N;  1YTZ I;  1N7S C;  4N78 D;  3M0D C;  3M91 A;  3UIA A;  2FYZ A;  2NPS B;  3VYI A;  1RE4 C;  3E1I A;  4W80 A;  5AW2 B;  1AFO A;  2N1T A;  2FKW B;  1J2J B;  1J1D C;  1RE3 A;  1FZA A;  1FOS E;  5APY A;  3B8E B;  4B86 A;  1A02 J;  3NMD A;  4DZO A;  3GHG C;  1OXZ A;  5AW0 B;  1GDT A;  2FXM A;  3I5C A;  1NHL A;  1DX7 A;  2H8P D;  2MJZ A;  2R32 A;  2XKM A;  2FFD A;  1N73 A;  1URQ C;  2J59 M;  2YO3 A;  1KQL A;  2OYH C;  2LKM A;  1JTH B;  1N2D C;  1PFI A;  2JEE A;  2W27 A;  1GTW A;  1HUC A;  1URQ D;  3HD7 D;  5AVQ B;  3HD7 A;  3RK3 B;  2C9L Y;  1URQ A;  3HE5 A;  1CZQ A;  1DH3 A;  1L4A D;  4GT1 A;  3H6P A;  2IX7 C;  1IFJ A;  1XTG B;  3VTP C;  1LWU B;  3M06 A;  2CPS A;  4IFF A;  2A45 I;  2HPC A;  2GUS A;  3HUS C;  1ZV8 A;  3MD0 A;  3M9B A;  5AVR B;  5AVY B;  2N1T B;  3A7O A;  3RL0 C;  1HTL C;  5AW9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...