2XKMA

Consensus structure of pf1 filamentous bacteriophage from x-ray fibre diffraction and solid-state nmr
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Consensus Structure of Pf1 Filamentous Bacteriophage from X-Ray Fibre Diffraction and Solid-State NMR.
pubmed doi rcsb
molecule tags Viral protein
molecule keywords CAPSID PROTEIN G8P
total genus 19
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2010-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2xkmA00
1QL1A 1ZN5A 4IFMA 2KLVA 1PFIA 1IFMA 2IFMA 2IFNA 3IFMA 2KSJA 1IFNA 2XKMA 1QL2A
chains in the Genus database with same CATH superfamily
3KQGA 1LTGC 4H44C 1KILC 1LGHB 1L0NJ 1SQXK 4JF7A 2HPCB 2QJPB 2FYUJ 2HPCA 1NOHA 1FZCA 4D6TJ 2Q3IA 5AW2B 3RL0C 2Q1KA 4EOTA 1RQVA 2E75C 3AEDC 3E1IA 3AE7C 2HR3A 1HBWA 2JR8A 2WT7A 3PH0A 1SQVE 4R4LA 3SWYA 3CD6P 1JY3O 1JY2P 2A06E 1SQQG 2HODA 3H25A 2RN0A 1HTLC 5KAFH 1SP4A 5E79E 1PGOA 1LTJB 3SWKA 1NWQA 1IZNB 1A02F 5KLVK 3BRTB 1YI2P 1KORA 1OW8A 3GHGB 1FBMA 3WUUA 1YIJP 2YIUB 2ZXEB 2OYHB 1CI6A 1KFNA 1UIIA 5KLIB 1HF9A 1FZCC 4LC1A 1BGYE 3TDKA 1KYOH 3A0BH 3N7NA 1MKMA 1X22A 3CX5H 1USEA 1GU4A 2R5DA 3TGUE 1IJDB 2KYVA 2ZAEB 2IPPA 4WY4A 1JCCA 1N7LA 4IOIH 3VMXA 1RF0C 1URQC 2OYIB 1LNQA 1BCCJ 3L73E 5DJTB 1H8AA 3JSVC 1JCDA 1VQ6P 3BCCG 2AEJA 1AFOA 1RHZB 2O1KA 4AYCA 2QVAA 3OA7A 3MIWA 3H1HJ 3Q1MA 1FDIA 3AE6C 3KPEA 1M56D 2V7QH 3U1AA 4U3FE 3CMAP 2H8PD 1L0LK 2PRRA 3Q3DA 3JCUE 1RH5B 3JCUH 3CCRP 4NPEA 3Q5SA 3CC7P 1P84D 2ZT9C 2E75B 3TYYA 1Q7YQ 1CI6B 1QEXA 3QH9A 1LT9A 1GDTA 4H13D 3B4SA 3S1KA 1KC8Q 1DEBA 2CPBA 4WY4D 1M7LA 3C9IA 3PLNA 1ZR4A 1LTJA 1OMIA 2Z5IA 4M3LA 3BCCD 3EWKA 4PD4E 4DJGA 1J1DB 1NTMK 1LTJC 4UB6E 1IFJA 1R8EA 1NYHA 2A45H 5GTHE 5GTHH 1OXZA 1HH0A 1NH4A 1JTHB 1S1CX 1GU5A 3AEFC 2QE7H 4ASWA 5KLIC 2Y9ZA 1L0LJ 1P84H 3V4QA 1GL2A 3A0BE 1FZBA 2G3AA 2KIKA 3HD7D 4PJ0H 1RF1B 1M1JC 2WZ7A 3TK1A 2M8RA 3CI9A 3CCQP 3WMM0 4K35A 4ZKUA 3KDPB 1X0TA 3V2NA 1SFCC 1EDLA 1L0NE 2D2CB 2JJLA 3G9RA 1NU1J 3AE1C 1KFMA 2FYUD 3VYIA 3HUSB 5B66E 1YITP 2L5GB 1P84E 2WSCJ 3L35A 1FDMA 3CWBE 1JTHA 1PP9J 1SQQD 2J59M 1SVFA 2AXTH 2AXTE 1S2EA 2WSEH 3H1LJ 1NTZK 3NXSA 4NPFX 3BATA 3H1IJ 3GF3A 2Q7CA 3TNUA 4IFMA 2LR2A 2YMKA 3H1LG 3CCMP 1PP9G 3SFDC 3Q5PA 2IBZE 3RL0g 1Q90D 5AVUB 5CCGA 1IK7A 2QSIA 1KZUB 3IAOA 4HB1A 5M1BA 1N7SB 1T2KD 2JO1A 3AEEC 1ZP0C 2YKQA 1HGVA 1JY3P 1S5LE 2NRGA 1EQ7A 2Q6QA 2ZT9B 3L70J 4PJ0E 5CBNA 1U57A 1T3UA 1KB9E 1QGKB 1PP9E 1S3JA 1NO4A 1ZRTE 2E74C 2FYZA 4L76A 1SQQK 2NPSB 2O01N 4TT3H 5APYA 1IFPA 5AVVB 2JWAA 4PD4H 3USSA 5CBOA 2B89A 2KB7P 2XNDH 3FWLA 2IZ0A 5K5GB 3SWFA 1Q82Q 1VQ9P 2SPZA 3B71A 1A02J 1QL2A 5GTIE 5GTIH 1N7SD 3H1KD 2JEEA 3MP7B 4B86A 2FXPA 2B87A 2M3BA 4LLHA 1NKNA 2HFED 2QM7A 3VMAA 1SQQE 1OFCX 1BCCE 1VL2A 1BE3D 1Y47A 3E7KA 3G3ZA 1IO4A 2XU6A 1YQ4C 1RE3A 2OTLP 2V4HA 1SS1A 3L75J 2KNCA 4HYTB 4RKUJ 5AW0B 5AW5B 3PP5A 2NZ2A 4PV1B 4EYYQ 4ZNCA 1YJ9P 3RK3D 3V2PA 1KILA 1YQ3C 2OTKE 3C1LA 2YXRB 4W80A 3VP8A 1KV4A 1SQVD 3HE5A 3HUSC 2FXMA 3PJSK 2E5YA 5APXA 5AVTB 2OYHA 1GL2D 3W68A 4U3FG 1UIXA 1NTZE 1VF5C 3H1JG 1W5CE 3HRNA 1ZXGA 4IL6X 1EXJA 3H1JJ 1HVVA 2WQYC 3MHVA 3V2RA 1T8ZA 5BU8B 1FZFA 5KAFE 2LXBA 3MUDA 2KOGA 2N1TA 5CCHC 1KILB 3CCSP 1N73B 3MD0A 1PPJG 3V5BA 5AW1B 1SQVJ 1FZAA 3GW6A 3P7KA 1IK9A 1VDFA 2IDBA 3PHLA 3AE3C 2E76B 4OGQD 3EFFK 3H1HE 1S5LH 3EFGA 3T97B 4DCKA 1KN7A 1Q81Q 4RESB 3TGUD 4GODA 1DIPA 2HLOA 1HJBA 2I8DA 1FDOA 5H2FE 2NPSC 4YTPC 5KJ7A 3HD7B 2P2UA 3L73J 1NTKE 1BSNA 1FC2C 1LWUA 1MUUA 3VMZA 1NTME 4N3YB 5KLVE 1VQ8P 2BEQD 5KKZC 1BSHA 4LGDE 3GF7A 2AEFA 3CL3D 4YPCA 4L74A 2YIUC 2ZVNB 2QJYC 1KYOE 4XE5B 1HJ0A 1SQVK 2O1JA 4BWNA 2WITA 1S4XA 1YBKA 3KYQA 3NFQA 2OGUA 3TF5A 2W6AA 1LTSC 1Z56A 2YNYA 2R32A 4PV1C 2YXQB 3M9QA 2E75D 3RL0D 4C7NA 3RBXA 5AW3B 1ZN5A 1JEKA 2LXCB 3BVHA 2WPSA 1URQB 3H1LE 1BE3J 2YKPA 2M0BA 3AE9C 3H1HD 5AVXB 4IL6E 2HODB 3ZDMA 1SFCB 1W2EA 3H1IG 1PGJA 1EDJA 2ZVOB 1FZEA 2JKVA 2KXPB 2L91A 2P1JA 3OAKA 4H13B 1S72P 1CW5A 1AVYA 5KJ7D 2WT7B 1LJ2A 1EDIA 1HUCA 4JYCA 3CWBD 4PD4D 1N73C 3CMEP 4H0LC 2FKWB 3GLMA 2KS1A 3A0HH 4ZMDA 1YJNP 5TISE 4N78D 3L71D 1MFZA 2UWJE 3O6QA 5APSA 2K9JB 1NTMG 4QMAA 4RJTA 2I1JA 2NPSA 1KD1Q 1AJYA 2IBZG 4W7ZA 2QJPC 2YKOA 4GKGA 1NU1G 1PGQA 3UIAA 1K9MQ 1SQPD 2BEZF 1N7SA 1OZHA 4Z1MH 2OQQA 3PTZA 1NAYA 4C7NB 3A5TA 4I1LA 2FFDC 3GHGA 1SQBK 1FOSE 2E74B 2YMYA 2N1TC 3AEGC 5CCHA 1Y9BA 4UB8H 4WBAA 1K04A 3G71P 1KQSO 1AA0A 1TU3F 3EQ2A 3WU2E 1NJIQ 1SQXJ 1QL1A 4R4MA 2Z5HA 3CX5E 1S5LX 2A45G 2FYUK 2WSSH 3AE8C 1NAFA 1EC5A 1JY2N 3II6A 4XA4A 4W7YA 1GTWA 4PD4I 2BCCD 3O8ZA 3HUSA 1GMJA 1GW3A 2PFXA 2W83C 3W67A 1LTAC 2JWDA 3NTNA 1IC2A 1L4AC 3A0HE 2P10A 2PGDA 3L71E 3LIDA 3D71A 3MTUE 1SQBG 5H2FH 4IFDK 3L70D 2PP6A 4OVNF 1LTBC 1OW7A 1QX8A 1SQBJ 1WT6A 3L75D 3RK3E 1AV1A 1WRGA 5CJ4A 1J2JB 2PAJA 2OYIC 4I7ZB 1VQKP 3M9HA 4WY4B 3ITKA 3D6YA 3B5ND 1FOSF 2K9YA 1HGZA 1BCCD 2QG4A 3AE5C 3K5BA 3H32A 3L72E 3M0DC 1ZMEC 4GIFA 5B66H 1NVOA 4JPZB 3SFEC 5AW8B 1SQXG 3L74J 2BASA 1PL5A 1SFCD 1U7MA 1VPCA 2B88A 1XTCC 1ZRTD 4DT0A 4RO0A 1PIXA 2JP3A 1URQD 3L74E 1Y8AA 2FY8A 3L72G 2E76C 2CPSA 2IYOA 1YJWP 1L0NG 3KHUA 1NTZD 2W6JH 2D2CD 5CCGC 3CCLP 2W8ZA 3A2AA 1EZVG 3L74D 1DH3A 1NTKD 2P7JA 2WPQA 1CZQA 2Q9IA 1H0TB 1KB9I 2CK3H 1OWAA 3B5NB 5KLVG 1RF0A 4D6TE 1SQBE 1H88A 2R5BA 1BDCA 5AW9B 4ASVA 1BGYD 2KP8A 2XZRA 1ZLLA 2M5AA 2KZIA 1HWTC 1OW6A 2A06D 3RK2B 1JB0J 1KYOD 2LKMA 5EFWB 2QJKC 1JUNA 1RF1C 1SFCA 1N2DC 2E74D 3FXDA 1PV3A 1JOCA 1ZV8A 2H89C 2HG5D 3H6PA 3R4YA 2QIWA 1M1JA 2WPVB 2K37A 1JM0A 3FGAD 4TLFA 2IYPA 3G6EP 4H44D 1KILD 1OVVA 2M3EA 2HYNA 3BASA 2Z4EA 2A06G 3KZIH 4EIJA 3OW2O 1WMKA 2K3RA 4KJMA 4K3AA 4YXDC 2ITAA 2IZ1A 5KAIH 5KLVD 3HE5B 1D7MA 1EXIA 1VQ4P 1M8OB 4WB4A 4MN4C 2W6BA 2V7QJ 3CXHI 1E79H 3L73D 2N9YB 3KZIE 4IL6H 1NKZB 1L0LG 1N8RQ 1RY3A 3RK3B 2KSEA 4H0LB 2QEXP 4D6TD 1L0ND 1NU1K 1JMMA 1LWUB 1JY2O 2ZYAA 4Y99C 3CC4P 1QVFO 3VN0A 2B9BA 2K1AA 5CHXA 1AVOA 3GG2A 3JC22 3I55P 3RK2D 4D6TG 1GL2C 2WVRA 1L0LD 2K9JA 1QLED 3NMDA 5L8RJ 3L73G 3CPWO 3IN6A 5KKZB 5KTBA 4XFJA 2H43A 3F89A 1X9VA 2E42A 2ZFCA 2RKLA 4Y28J 1SQPE 3BCCJ 4IFFA 1H0TA 4BRYB 1BCCG 2AEMA 1T6AA 3QWOC 3AE4C 1H89A 1YYCA 1NGMB 2H88C 2OYIA 1FJPA 3LW5J 2N1TB 1IFIA 3CC2P 1VQNP 3GHGC 3FX0A 1NTKK 1URQA 4YXWH 1LT9C 1N86A 3HTKB 2IBZI 5AW6B 3IR9A 1IFDA 1L4AA 1OVUA 2O01H 2WSFJ 2YO2A 4N78E 2NPSD 3RGUA 1PGPA 1G2CB 2BCCE 1KYOI 3CXHE 3I5CA 3V4WA 4KHXA 2BCCJ 5APUA 1LT1A 3L36A 2BCCG 1ZW0A 1BGYG 3B8EB 3L37A 3L72J 3M0AA 3KXDA 1VQLP 1JNMA 3V2QA 2WSEJ 3FWNA 1QVGO 4U3FJ 1NTKG 1YHQP 1GD2E 1OIPA 1USDA 1EZVD 2Q5UA 3CLQA 3L74G 3WU2H 3BRVB 1NTKJ 2K88A 3HE4B 1NTZG 3A7OA 4WY4C 1PFIA 1RQUA 1SQPJ 3BCCE 3RK3C 1M90Q 3CX5D 3L72D 4Y99B 4C7RA 1LTTC 1SQPG 3E1RA 1EZVE 2XV5A 1L0NK 1NU1D 4DOJA 3T97A 1Q2NA 1S9KD 1VQ5P 1PPJE 1GL2B 2C0XA 1DD4A 1RF1A 2IBZD 4L75A 2FFDB 3TGUJ 1SQXD 3P8MC 1J1EB 3H1KE 3I56P 3HD7C 2R44A 3L71G 3L70E 1BGYJ 2KK7A 3H1JE 5DJUB 3RL0B 1N73A 4AUWA 2I1KA 3GMAA 2KZJA 1K8AQ 4HKZH 1G1IA 5CJ0A 1OX3A 4UB8E 5TJHA 2OARA 4OGQC 5KAIE 1ZOYC 3VOPA 3Q2YA 1AQ5A 2GM4A 1SQPK 1LT9B 3L75G 2QJYB 2N9BA 4HH2A 1DD3A 3FXEA 2JDIH 3TNUB 3L70G 3AEBC 1SQBD 1L4AB 1W2BO 1M1JB 2Y9YA 2ZYGA 5C39A 3CX5I 2KNCB 2KUBA 4I6MC 4UB6H 1FZCB 2KI7B 1NU1E 1KQLA 3C8VA 1EDKA 2KS1B 4I7ZC 1MFTA 5TISH 4JYBA 2QA4P 5AVSB 2FYNC 2ZT9D 3P8CE 2P67A 2W90A 3M0DA 3S9OA 1KILE 4EI2A 5BVZA 4H13C 1VQMP 5AVQB 3AEAC 3HE4A 3PRJA 5E79H 3B5NA 3OJAB 2J58A 4PV1D 4BXLA 4C46A 3Q5RA 1JO5A 1X79B 3P8CD 1FE6A 3CCUP 4JQ0D 3IF4A 1RE4C 2W27A 2R3CA 1K05A 3MGNA 1GW4A 1N7SC 4N6JA 1DX7A 3ABVC 2XNXA 3U1CA 1SLQA 3L4FA 1DEEG 1LP1A 4GDOA 3TGUG 4DZOA 3VP9A 1GZLA 1G2CA 1NTMD 2OTJP 1VQPP 1J1EC 1KQGB 1XTGB 1M57D 1RE4A 2RH0A 3CXHH 2E5TA 2IFMA 3H1IE 4H0LD 1IFNA 3B5NC 1KMIZ 3CWBG 3M91A 4JBZA 1M1KQ 3HTKA 2DW3A 3H1KJ 5CMZA 3S4RA 2G8YA 1BDDA 2O01J 5KLVJ 3G4SP 4U7JA 1KB9H 2IX7C 3H1ID 1JMBA 2OYHC 2E43A 2H7HA 2ZYDA 2FFDA 4U3FD 1R5SA 1VF5D 2QJKB 1T3JA 3H1HG 3HD7A 4BRYA 1KTMA 4EDFA 1SQVG 1VQ7P 1FAVA 2KSJA 1P84I 5CCHD 1L0LE 2WSCH 1MV8A 3A3YB 1AQTA 4GOEA 4KT0J 2N1TD 3L71J 5APTA 3V6IA 2KLVA 1VQOP 1PZQA 2ZXXA 1T2KC 2ZJSE 1Q86Q 1NHLA 2FYNB 2C9LY 1JY3N 2XDJA 1E5WA 5APQA 1MZ9A 4GOFA 5AVYB 2WSFH 4ZKPA 2GUVA 1NTZJ 1G1JA 1L4AD 1LWUC 3P32A 3VMYA 5APWA 1GK4A 1GK6A 3AE2C 1OVRA 2C0WA 3IFMA 5APVA 4NPDA 3CXHD 3MZWB 2WMMA 4H44B 5AVZB 3L75E 3LW5H 3TSIA 3N4XA 3M9BA 2MKVA 2WPRA 4L73A 2A45I 1IFMA 2Y0EA 5AVWB 2J5UA 2IFNA 2MJZA 1PPJD 2YO3A 1X8YA 1K73Q 5BU5A 2B87B 2WTYA 2M5AB 1J1DC 1KB9D 1U7JA 1PP9D 1SQQJ 2FYUE 3O6QB 5AW4B 3D6ZA 2P58A 3H1LD 3WUVA 2GUSA 2FXOA 3SSUA 3R2PA 2GA1A 3H1JD 1FU1A 3D70A 2RMZA 2Y0CA 3U59A 3WUTA 3AECC 4A7PA 2E76D 4OGQB 1FZGA 3CCEP 5KJ7C 1FS0E 2FYUG 5B5EH 5B5EE 3RK2C 1ZR2A 2AXCA 1BE3E 2D2CC 2FBWC 3M06A 4WWIA 1SQXE 5AVRB 4CPGA 2QRXA 4O9BA 2OYOA 1KQFB 2Q3EA 1CSBA 2POHA 5AW7B 4AQRD 1S9KE 1RE3C 1BE3G 2XKMA 1LP1B 2WWWA 1FJKA 4WVZA 5CCGD 2R3SA 1YTZI 2QM8A 2C9NY 3VTPC 2VRSA 2Y0DA 3MUDC 4GT1A 4OWFA 3H1KG 3CCJP 2O3JA 3CCVP 3LIEA 3CWBJ 3H32B 4I2LC 1VF5B 4HJGH 4OH8B 2KLUA 3F5HA 1R5LA 3RBZA 1NTMJ 1L2PA 1YTZT 1EZVI 1LTIC
chains in the Genus database with same CATH topology
3KQGA 1LTGC 1KILC 1LGHB 1SQXK 4JF7A 2HPCB 2HPCA 1NOHA 1FZCA 2Q3IA 5AW2B 3RL0C 4EOTA 3E1IA 2WT7A 3SWYA 1JY3O 1JY2P 2HODA 1HTLC 1SP4A 1LTJB 1NWQA 1A02F 5KLVK 3BRTB 3GHGB 1FBMA 2ZXEB 2OYHB 1CI6A 1KFNA 1FZCC 4LC1A 3N7NA 1GU4A 2R5DA 1IJDB 2KYVA 2IPPA 4WY4A 1JCCA 1N7LA 3VMXA 1RF0C 1URQC 2OYIB 1H8AA 1AFOA 1JCDA 2O1KA 4AYCA 3OA7A 3MIWA 3KPEA 3U1AA 2H8PD 1L0LK 3TYYA 1CI6B 1LT9A 1GDTA 1DEBA 2CPBA 4WY4D 1M7LA 3C9IA 1ZR4A 1LTJA 4M3LA 2Z5IA 1J1DB 1NTMK 1LTJC 1IFJA 2A45H 1OXZA 1HH0A 1NH4A 1JTHB 1GU5A 3V4QA 1GL2A 1RF1B 1FZBA 3HD7D 1M1JC 2WZ7A 3TK1A 2M8RA 3CI9A 3WMM0 4ZKUA 3KDPB 3V2NA 1SFCC 2JJLA 3VYIA 1KFMA 3HUSB 2L5GB 1FDMA 3L35A 1JTHA 2J59M 1SVFA 2WSEH 3NXSA 2Q7CA 1NTZK 3TNUA 3BATA 4IFMA 5AVUB 5CCGA 1KZUB 1N7SB 1T2KD 2YKQA 1HGVA 1JY3P 1EQ7A 1T3UA 2GM4A 4WB4A 2FYZA 1NO4A 4AUWA 1SQQK 2NPSB 5AVVB 5APYA 2KB7P 3SWFA 1A02J 1QL2A 1N7SD 2JEEA 4B86A 2M3BA 4LLHA 1NKNA 2HFED 2QM7A 3G3ZA 1IO4A 2XU6A 1RE3A 5AW0B 4HYTB 5AW5B 3PP5A 3RK3D 3V2PA 1KILA 4W80A 3VP8A 3HUSC 3HE5A 2FXMA 5APXA 5AVTB 2OYHA 1GL2D 3HRNA 1HVVA 3V2RA 5BU8B 1T8ZA 1FZFA 3MUDA 2KOGA 2N1TA 5CCHC 1KILB 1N73B 3MD0A 3V5BA 5AW1B 1FZAA 3P7KA 1IK9A 1VDFA 3EFGA 4RESB 2HLOA 1HJBA 2NPSC 5KJ7A 3HD7B 2P2UA 3VMZA 1LWUA 1MUUA 4N3YB 4LGDE 3CL3D 4XE5B 1SQVK 2O1JA 2WITA 3KYQA 3NFQA 2W6AA 1LTSC 1Z56A 2YNYA 2R32A 3RL0D 3M9QA 4C7NA 5AW3B 1ZN5A 3BVHA 2WPSA 1URQB 2YKPA 5AVXB 2HODB 1SFCB 1W2EA 1FZEA 2P1JA 1CW5A 3OAKA 5KJ7D 4JYCA 1HUCA 1N73C 2FKWB 4N78D 1MFZA 5APSA 2I1JA 2NPSA 4W7ZA 2YKOA 4GKGA 3UIAA 1N7SA 3A5TA 4C7NB 1FOSE 4I1LA 2FFDC 3GHGA 1SQBK 2YMYA 2N1TC 5CCHA 4WBAA 3EQ2A 1QL1A 2Z5HA 2A45G 4XA4A 2FYUK 3II6A 1NAFA 1JY2N 4W7YA 1GTWA 3O8ZA 3HUSA 1GW3A 1LTAC 3NTNA 1IC2A 1L4AC 4IFDK 3LIDA 3MTUE 2PP6A 1LTBC 1WT6A 1WRGA 5CJ4A 1J2JB 2PAJA 2OYIC 3M9HA 4WY4B 3B5ND 1FOSF 1HGZA 3M0DC 3H32A 4GIFA 5AW8B 2BASA 1VPCA 1SFCD 1XTCC 1URQD 2CPSA 5CCGC 3A2AA 1DH3A 2P7JA 2WPQA 1CZQA 2Q9IA 3B5NB 1OWAA 1RF0A 1H88A 2R5BA 5AW9B 2KP8A 2XZRA 1ZLLA 1HWTC 3RK2B 2LKMA 1JUNA 1RF1C 1SFCA 1N2DC 3H6PA 2HG5D 1JOCA 1ZV8A 1M1JA 1KILD 2Z4EA 3BASA 2HYNA 4EIJA 3HE5B 2W6BA 1NKZB 1RY3A 3RK3B 1NU1K 1JMMA 1LWUB 1JY2O 4Y99C 3VN0A 5CHXA 3RK2D 1GL2C 3NMDA 5KTBA 2H43A 1X9VA 2E42A 2ZFCA 4IFFA 1H89A 2OYIA 1FJPA 1YYCA 2N1TB 1IFIA 3GHGC 1NTKK 1URQA 1LT9C 1N86A 3HTKB 5AW6B 3IR9A 1IFDA 1L4AA 2O01H 4N78E 2YO2A 2NPSD 1G2CB 3I5CA 3V4WA 4KHXA 5APUA 3L36A 3B8EB 3L37A 3M0AA 1JNMA 3V2QA 1GD2E 2Q5UA 3CLQA 3BRVB 3HE4B 3A7OA 4WY4C 1PFIA 3RK3C 4C7RA 4Y99B 1LTTC 2XV5A 4DOJA 1L0NK 3T97A 1S9KD 1GL2B 2C0XA 1RF1A 2FFDB 3P8MC 1J1EB 3HD7C 1N73A 3RL0B 2I1KA 1G1IA 5CJ0A 3VOPA 2OARA 1AQ5A 1SQPK 1LT9B 1HBWA 4HH2A 2N9BA 3TNUB 1L4AB 1M1JB 4I6MC 1FZCB 1KQLA 4JYBA 5AVSB 3P8CE 2P67A 3M0DA 5BVZA 5AVQB 4C46A 3HE4A 1JO5A 3B5NA 3OJAB 2J58A 1X79B 3P8CD 1RE4C 2W27A 2R3CA 3MGNA 4N6JA 1GW4A 1N7SC 1DX7A 3U1CA 2XNXA 1SLQA 3L4FA 4DZOA 3VP9A 1GZLA 1G2CA 1J1EC 1XTGB 1RE4A 2IFMA 1IFNA 3B5NC 3M91A 3HTKA 5CMZA 2IX7C 2E43A 2H7HA 2OYHC 2FFDA 1T3JA 3HD7A 1FAVA 2KSJA 5CCHD 2WSCH 3A3YB 1MV8A 5APTA 2N1TD 2KLVA 1T2KC 1NHLA 2C9LY 1JY3N 2XDJA 1E5WA 5APQA 1MZ9A 5AVYB 2WSFH 4ZKPA 2GUVA 1G1JA 1L4AD 3P32A 1LWUC 5APWA 1GK4A 1GK6A 3IFMA 5APVA 2C0WA 5AVZB 3LW5H 3TSIA 3N4XA 3M9BA 2WPRA 2A45I 1IFMA 5AVWB 2IFNA 2MJZA 2YO3A 1X8YA 5BU5A 2WTYA 1J1DC 5AW4B 2GUSA 3R2PA 1FU1A 3U59A 1FZGA 5KJ7C 3RK2C 1ZR2A 5CCGD 3M06A 5AVRB 4O9BA 1CSBA 2POHA 5AW7B 4AQRD 1S9KE 1RE3C 2XKMA 2WWWA 1FJKA 1YTZI 2QM8A 2C9NY 3VTPC 2VRSA 4GT1A 3LIEA 3H32B 4I2LC 4OH8B 2WT7B 3VMYA 1YTZT 1LTIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QL1 A;  1ZN5 A;  4IFM A;  2KLV A;  1PFI A;  1IFM A;  2IFM A;  2IFN A;  3IFM A;  2KSJ A;  1IFN A;  2XKM A;  1QL2 A; 
#chains in the Genus database with same CATH topology
 3KQG A;  1LTG C;  4H44 C;  1KIL C;  1LGH B;  1L0N J;  1SQX K;  4JF7 A;  2HPC B;  2QJP B;  2FYU J;  2HPC A;  1NOH A;  1FZC A;  4D6T J;  2Q3I A;  5AW2 B;  3RL0 C;  2Q1K A;  4EOT A;  1RQV A;  2E75 C;  3AED C;  3E1I A;  3AE7 C;  2HR3 A;  1HBW A;  2JR8 A;  2WT7 A;  3PH0 A;  1SQV E;  4R4L A;  3SWY A;  3CD6 P;  1JY3 O;  1JY2 P;  2A06 E;  1SQQ G;  2HOD A;  3H25 A;  2RN0 A;  1HTL C;  5KAF H;  1SP4 A;  5E79 E;  1PGO A;  1LTJ B;  3SWK A;  1NWQ A;  1IZN B;  1A02 F;  5KLV K;  3BRT B;  1YI2 P;  1KOR A;  1OW8 A;  3GHG B;  1FBM A;  3WUU A;  1YIJ P;  2YIU B;  2ZXE B;  2OYH B;  1CI6 A;  1KFN A;  1UII A;  5KLI B;  1HF9 A;  1FZC C;  4LC1 A;  1BGY E;  3TDK A;  1KYO H;  3A0B H;  3N7N A;  1MKM A;  1X22 A;  3CX5 H;  1USE A;  1GU4 A;  2R5D A;  3TGU E;  1IJD B;  2KYV A;  2ZAE B;  2IPP A;  4WY4 A;  1JCC A;  1N7L A;  4IOI H;  3VMX A;  1RF0 C;  1URQ C;  2OYI B;  1LNQ A;  1BCC J;  3L73 E;  5DJT B;  1H8A A;  3JSV C;  1JCD A;  1VQ6 P;  3BCC G;  2AEJ A;  1AFO A;  1RHZ B;  2O1K A;  4AYC A;  2QVA A;  3OA7 A;  3MIW A;  3H1H J;  3Q1M A;  1FDI A;  3AE6 C;  3KPE A;  1M56 D;  2V7Q H;  3U1A A;  4U3F E;  3CMA P;  2H8P D;  1L0L K;  2PRR A;  3Q3D A;  3JCU E;  1RH5 B;  3JCU H;  3CCR P;  4NPE A;  3Q5S A;  3CC7 P;  1P84 D;  2ZT9 C;  2E75 B;  3TYY A;  1Q7Y Q;  1CI6 B;  1QEX A;  3QH9 A;  1LT9 A;  1GDT A;  4H13 D;  3B4S A;  3S1K A;  1KC8 Q;  1DEB A;  2CPB A;  4WY4 D;  1M7L A;  3C9I A;  3PLN A;  1ZR4 A;  1LTJ A;  1OMI A;  2Z5I A;  4M3L A;  3BCC D;  3EWK A;  4PD4 E;  4DJG A;  1J1D B;  1NTM K;  1LTJ C;  4UB6 E;  1IFJ A;  1R8E A;  1NYH A;  2A45 H;  5GTH E;  5GTH H;  1OXZ A;  1HH0 A;  1NH4 A;  1JTH B;  1S1C X;  1GU5 A;  3AEF C;  2QE7 H;  4ASW A;  5KLI C;  2Y9Z A;  1L0L J;  1P84 H;  3V4Q A;  1GL2 A;  3A0B E;  1FZB A;  2G3A A;  2KIK A;  3HD7 D;  4PJ0 H;  1RF1 B;  1M1J C;  2WZ7 A;  3TK1 A;  2M8R A;  3CI9 A;  3CCQ P;  3WMM 0;  4K35 A;  4ZKU A;  3KDP B;  1X0T A;  3V2N A;  1SFC C;  1EDL A;  1L0N E;  2D2C B;  2JJL A;  3G9R A;  1NU1 J;  3AE1 C;  1KFM A;  2FYU D;  3VYI A;  3HUS B;  5B66 E;  1YIT P;  2L5G B;  1P84 E;  2WSC J;  3L35 A;  1FDM A;  3CWB E;  1JTH A;  1PP9 J;  1SQQ D;  2J59 M;  1SVF A;  2AXT H;  2AXT E;  1S2E A;  2WSE H;  3H1L J;  1NTZ K;  3NXS A;  4NPF X;  3BAT A;  3H1I J;  3GF3 A;  2Q7C A;  3TNU A;  4IFM A;  2LR2 A;  2YMK A;  3H1L G;  3CCM P;  1PP9 G;  3SFD C;  3Q5P A;  2IBZ E;  3RL0 g;  1Q90 D;  5AVU B;  5CCG A;  1IK7 A;  2QSI A;  1KZU B;  3IAO A;  4HB1 A;  5M1B A;  1N7S B;  1T2K D;  2JO1 A;  3AEE C;  1ZP0 C;  2YKQ A;  1HGV A;  1JY3 P;  1S5L E;  2NRG A;  1EQ7 A;  2Q6Q A;  2ZT9 B;  3L70 J;  4PJ0 E;  5CBN A;  1U57 A;  1T3U A;  1KB9 E;  1QGK B;  1PP9 E;  1S3J A;  1NO4 A;  1ZRT E;  2E74 C;  2FYZ A;  4L76 A;  1SQQ K;  2NPS B;  2O01 N;  4TT3 H;  5APY A;  1IFP A;  5AVV B;  2JWA A;  4PD4 H;  3USS A;  5CBO A;  2B89 A;  2KB7 P;  2XND H;  3FWL A;  2IZ0 A;  5K5G B;  3SWF A;  1Q82 Q;  1VQ9 P;  2SPZ A;  3B71 A;  1A02 J;  1QL2 A;  5GTI E;  5GTI H;  1N7S D;  3H1K D;  2JEE A;  3MP7 B;  4B86 A;  2FXP A;  2B87 A;  2M3B A;  4LLH A;  1NKN A;  2HFE D;  2QM7 A;  3VMA A;  1SQQ E;  1OFC X;  1BCC E;  1VL2 A;  1BE3 D;  1Y47 A;  3E7K A;  3G3Z A;  1IO4 A;  2XU6 A;  1YQ4 C;  1RE3 A;  2OTL P;  2V4H A;  1SS1 A;  3L75 J;  2KNC A;  4HYT B;  4RKU J;  5AW0 B;  5AW5 B;  3PP5 A;  2NZ2 A;  4PV1 B;  4EYY Q;  4ZNC A;  1YJ9 P;  3RK3 D;  3V2P A;  1KIL A;  1YQ3 C;  2OTK E;  3C1L A;  2YXR B;  4W80 A;  3VP8 A;  1KV4 A;  1SQV D;  3HE5 A;  3HUS C;  2FXM A;  3PJS K;  2E5Y A;  5APX A;  5AVT B;  2OYH A;  1GL2 D;  3W68 A;  4U3F G;  1UIX A;  1NTZ E;  1VF5 C;  3H1J G;  1W5C E;  3HRN A;  1ZXG A;  4IL6 X;  1EXJ A;  3H1J J;  1HVV A;  2WQY C;  3MHV A;  3V2R A;  1T8Z A;  5BU8 B;  1FZF A;  5KAF E;  2LXB A;  3MUD A;  2KOG A;  2N1T A;  5CCH C;  1KIL B;  3CCS P;  1N73 B;  3MD0 A;  1PPJ G;  3V5B A;  5AW1 B;  1SQV J;  1FZA A;  3GW6 A;  3P7K A;  1IK9 A;  1VDF A;  2IDB A;  3PHL A;  3AE3 C;  2E76 B;  4OGQ D;  3EFF K;  3H1H E;  1S5L H;  3EFG A;  3T97 B;  4DCK A;  1KN7 A;  1Q81 Q;  4RES B;  3TGU D;  4GOD A;  1DIP A;  2HLO A;  1HJB A;  2I8D A;  1FDO A;  5H2F E;  2NPS C;  4YTP C;  5KJ7 A;  3HD7 B;  2P2U A;  3L73 J;  1NTK E;  1BSN A;  1FC2 C;  1LWU A;  1MUU A;  3VMZ A;  1NTM E;  4N3Y B;  5KLV E;  1VQ8 P;  2BEQ D;  5KKZ C;  1BSH A;  4LGD E;  3GF7 A;  2AEF A;  3CL3 D;  4YPC A;  4L74 A;  2YIU C;  2ZVN B;  2QJY C;  1KYO E;  4XE5 B;  1HJ0 A;  1SQV K;  2O1J A;  4BWN A;  2WIT A;  1S4X A;  1YBK A;  3KYQ A;  3NFQ A;  2OGU A;  3TF5 A;  2W6A A;  1LTS C;  1Z56 A;  2YNY A;  2R32 A;  4PV1 C;  2YXQ B;  3M9Q A;  2E75 D;  3RL0 D;  4C7N A;  3RBX A;  5AW3 B;  1ZN5 A;  1JEK A;  2LXC B;  3BVH A;  2WPS A;  1URQ B;  3H1L E;  1BE3 J;  2YKP A;  2M0B A;  3AE9 C;  3H1H D;  5AVX B;  4IL6 E;  2HOD B;  3ZDM A;  1SFC B;  1W2E A;  3H1I G;  1PGJ A;  1EDJ A;  2ZVO B;  1FZE A;  2JKV A;  2KXP B;  2L91 A;  2P1J A;  3OAK A;  4H13 B;  1S72 P;  1CW5 A;  1AVY A;  5KJ7 D;  2WT7 B;  1LJ2 A;  1EDI A;  1HUC A;  4JYC A;  3CWB D;  4PD4 D;  1N73 C;  3CME P;  4H0L C;  2FKW B;  3GLM A;  2KS1 A;  3A0H H;  4ZMD A;  1YJN P;  5TIS E;  4N78 D;  3L71 D;  1MFZ A;  2UWJ E;  3O6Q A;  5APS A;  2K9J B;  1NTM G;  4QMA A;  4RJT A;  2I1J A;  2NPS A;  1KD1 Q;  1AJY A;  2IBZ G;  4W7Z A;  2QJP C;  2YKO A;  4GKG A;  1NU1 G;  1PGQ A;  3UIA A;  1K9M Q;  1SQP D;  2BEZ F;  1N7S A;  1OZH A;  4Z1M H;  2OQQ A;  3PTZ A;  1NAY A;  4C7N B;  3A5T A;  4I1L A;  2FFD C;  3GHG A;  1SQB K;  1FOS E;  2E74 B;  2YMY A;  2N1T C;  3AEG C;  5CCH A;  1Y9B A;  4UB8 H;  4WBA A;  1K04 A;  3G71 P;  1KQS O;  1AA0 A;  1TU3 F;  3EQ2 A;  3WU2 E;  1NJI Q;  1SQX J;  1QL1 A;  4R4M A;  2Z5H A;  3CX5 E;  1S5L X;  2A45 G;  2FYU K;  2WSS H;  3AE8 C;  1NAF A;  1EC5 A;  1JY2 N;  3II6 A;  4XA4 A;  4W7Y A;  1GTW A;  4PD4 I;  2BCC D;  3O8Z A;  3HUS A;  1GMJ A;  1GW3 A;  2PFX A;  2W83 C;  3W67 A;  1LTA C;  2JWD A;  3NTN A;  1IC2 A;  1L4A C;  3A0H E;  2P10 A;  2PGD A;  3L71 E;  3LID A;  3D71 A;  3MTU E;  1SQB G;  5H2F H;  4IFD K;  3L70 D;  2PP6 A;  4OVN F;  1LTB C;  1OW7 A;  1QX8 A;  1SQB J;  1WT6 A;  3L75 D;  3RK3 E;  1AV1 A;  1WRG A;  5CJ4 A;  1J2J B;  2PAJ A;  2OYI C;  4I7Z B;  1VQK P;  3M9H A;  4WY4 B;  3ITK A;  3D6Y A;  3B5N D;  1FOS F;  2K9Y A;  1HGZ A;  1BCC D;  2QG4 A;  3AE5 C;  3K5B A;  3H32 A;  3L72 E;  3M0D C;  1ZME C;  4GIF A;  5B66 H;  1NVO A;  4JPZ B;  3SFE C;  5AW8 B;  1SQX G;  3L74 J;  2BAS A;  1PL5 A;  1SFC D;  1U7M A;  1VPC A;  2B88 A;  1XTC C;  1ZRT D;  4DT0 A;  4RO0 A;  1PIX A;  2JP3 A;  1URQ D;  3L74 E;  1Y8A A;  2FY8 A;  3L72 G;  2E76 C;  2CPS A;  2IYO A;  1YJW P;  1L0N G;  3KHU A;  1NTZ D;  2W6J H;  2D2C D;  5CCG C;  3CCL P;  2W8Z A;  3A2A A;  1EZV G;  3L74 D;  1DH3 A;  1NTK D;  2P7J A;  2WPQ A;  1CZQ A;  2Q9I A;  1H0T B;  1KB9 I;  2CK3 H;  1OWA A;  3B5N B;  5KLV G;  1RF0 A;  4D6T E;  1SQB E;  1H88 A;  2R5B A;  1BDC A;  5AW9 B;  4ASV A;  1BGY D;  2KP8 A;  2XZR A;  1ZLL A;  2M5A A;  2KZI A;  1HWT C;  1OW6 A;  2A06 D;  3RK2 B;  1JB0 J;  1KYO D;  2LKM A;  5EFW B;  2QJK C;  1JUN A;  1RF1 C;  1SFC A;  1N2D C;  2E74 D;  3FXD A;  1PV3 A;  1JOC A;  1ZV8 A;  2H89 C;  2HG5 D;  3H6P A;  3R4Y A;  2QIW A;  1M1J A;  2WPV B;  2K37 A;  1JM0 A;  3FGA D;  4TLF A;  2IYP A;  3G6E P;  4H44 D;  1KIL D;  1OVV A;  2M3E A;  2HYN A;  3BAS A;  2Z4E A;  2A06 G;  3KZI H;  4EIJ A;  3OW2 O;  1WMK A;  2K3R A;  4KJM A;  4K3A A;  4YXD C;  2ITA A;  2IZ1 A;  5KAI H;  5KLV D;  3HE5 B;  1D7M A;  1EXI A;  1VQ4 P;  1M8O B;  4WB4 A;  4MN4 C;  2W6B A;  2V7Q J;  3CXH I;  1E79 H;  3L73 D;  2N9Y B;  3KZI E;  4IL6 H;  1NKZ B;  1L0L G;  1N8R Q;  1RY3 A;  3RK3 B;  2KSE A;  4H0L B;  2QEX P;  4D6T D;  1L0N D;  1NU1 K;  1JMM A;  1LWU B;  1JY2 O;  2ZYA A;  4Y99 C;  3CC4 P;  1QVF O;  3VN0 A;  2B9B A;  2K1A A;  5CHX A;  1AVO A;  3GG2 A;  3JC2 2;  3I55 P;  3RK2 D;  4D6T G;  1GL2 C;  2WVR A;  1L0L D;  2K9J A;  1QLE D;  3NMD A;  5L8R J;  3L73 G;  3CPW O;  3IN6 A;  5KKZ B;  5KTB A;  4XFJ A;  2H43 A;  3F89 A;  1X9V A;  2E42 A;  2ZFC A;  2RKL A;  4Y28 J;  1SQP E;  3BCC J;  4IFF A;  1H0T A;  4BRY B;  1BCC G;  2AEM A;  1T6A A;  3QWO C;  3AE4 C;  1H89 A;  1YYC A;  1NGM B;  2H88 C;  2OYI A;  1FJP A;  3LW5 J;  2N1T B;  1IFI A;  3CC2 P;  1VQN P;  3GHG C;  3FX0 A;  1NTK K;  1URQ A;  4YXW H;  1LT9 C;  1N86 A;  3HTK B;  2IBZ I;  5AW6 B;  3IR9 A;  1IFD A;  1L4A A;  1OVU A;  2O01 H;  2WSF J;  2YO2 A;  4N78 E;  2NPS D;  3RGU A;  1PGP A;  1G2C B;  2BCC E;  1KYO I;  3CXH E;  3I5C A;  3V4W A;  4KHX A;  2BCC J;  5APU A;  1LT1 A;  3L36 A;  2BCC G;  1ZW0 A;  1BGY G;  3B8E B;  3L37 A;  3L72 J;  3M0A A;  3KXD A;  1VQL P;  1JNM A;  3V2Q A;  2WSE J;  3FWN A;  1QVG O;  4U3F J;  1NTK G;  1YHQ P;  1GD2 E;  1OIP A;  1USD A;  1EZV D;  2Q5U A;  3CLQ A;  3L74 G;  3WU2 H;  3BRV B;  1NTK J;  2K88 A;  3HE4 B;  1NTZ G;  3A7O A;  4WY4 C;  1PFI A;  1RQU A;  1SQP J;  3BCC E;  3RK3 C;  1M90 Q;  3CX5 D;  3L72 D;  4Y99 B;  4C7R A;  1LTT C;  1SQP G;  3E1R A;  1EZV E;  2XV5 A;  1L0N K;  1NU1 D;  4DOJ A;  3T97 A;  1Q2N A;  1S9K D;  1VQ5 P;  1PPJ E;  1GL2 B;  2C0X A;  1DD4 A;  1RF1 A;  2IBZ D;  4L75 A;  2FFD B;  3TGU J;  1SQX D;  3P8M C;  1J1E B;  3H1K E;  3I56 P;  3HD7 C;  2R44 A;  3L71 G;  3L70 E;  1BGY J;  2KK7 A;  3H1J E;  5DJU B;  3RL0 B;  1N73 A;  4AUW A;  2I1K A;  3GMA A;  2KZJ A;  1K8A Q;  4HKZ H;  1G1I A;  5CJ0 A;  1OX3 A;  4UB8 E;  5TJH A;  2OAR A;  4OGQ C;  5KAI E;  1ZOY C;  3VOP A;  3Q2Y A;  1AQ5 A;  2GM4 A;  1SQP K;  1LT9 B;  3L75 G;  2QJY B;  2N9B A;  4HH2 A;  1DD3 A;  3FXE A;  2JDI H;  3TNU B;  3L70 G;  3AEB C;  1SQB D;  1L4A B;  1W2B O;  1M1J B;  2Y9Y A;  2ZYG A;  5C39 A;  3CX5 I;  2KNC B;  2KUB A;  4I6M C;  4UB6 H;  1FZC B;  2KI7 B;  1NU1 E;  1KQL A;  3C8V A;  1EDK A;  2KS1 B;  4I7Z C;  1MFT A;  5TIS H;  4JYB A;  2QA4 P;  5AVS B;  2FYN C;  2ZT9 D;  3P8C E;  2P67 A;  2W90 A;  3M0D A;  3S9O A;  1KIL E;  4EI2 A;  5BVZ A;  4H13 C;  1VQM P;  5AVQ B;  3AEA C;  3HE4 A;  3PRJ A;  5E79 H;  3B5N A;  3OJA B;  2J58 A;  4PV1 D;  4BXL A;  4C46 A;  3Q5R A;  1JO5 A;  1X79 B;  3P8C D;  1FE6 A;  3CCU P;  4JQ0 D;  3IF4 A;  1RE4 C;  2W27 A;  2R3C A;  1K05 A;  3MGN A;  1GW4 A;  1N7S C;  4N6J A;  1DX7 A;  3ABV C;  2XNX A;  3U1C A;  1SLQ A;  3L4F A;  1DEE G;  1LP1 A;  4GDO A;  3TGU G;  4DZO A;  3VP9 A;  1GZL A;  1G2C A;  1NTM D;  2OTJ P;  1VQP P;  1J1E C;  1KQG B;  1XTG B;  1M57 D;  1RE4 A;  2RH0 A;  3CXH H;  2E5T A;  2IFM A;  3H1I E;  4H0L D;  1IFN A;  3B5N C;  1KMI Z;  3CWB G;  3M91 A;  4JBZ A;  1M1K Q;  3HTK A;  2DW3 A;  3H1K J;  5CMZ A;  3S4R A;  2G8Y A;  1BDD A;  2O01 J;  5KLV J;  3G4S P;  4U7J A;  1KB9 H;  2IX7 C;  3H1I D;  1JMB A;  2OYH C;  2E43 A;  2H7H A;  2ZYD A;  2FFD A;  4U3F D;  1R5S A;  1VF5 D;  2QJK B;  1T3J A;  3H1H G;  3HD7 A;  4BRY A;  1KTM A;  4EDF A;  1SQV G;  1VQ7 P;  1FAV A;  2KSJ A;  1P84 I;  5CCH D;  1L0L E;  2WSC H;  1MV8 A;  3A3Y B;  1AQT A;  4GOE A;  4KT0 J;  2N1T D;  3L71 J;  5APT A;  3V6I A;  2KLV A;  1VQO P;  1PZQ A;  2ZXX A;  1T2K C;  2ZJS E;  1Q86 Q;  1NHL A;  2FYN B;  2C9L Y;  1JY3 N;  2XDJ A;  1E5W A;  5APQ A;  1MZ9 A;  4GOF A;  5AVY B;  2WSF H;  4ZKP A;  2GUV A;  1NTZ J;  1G1J A;  1L4A D;  1LWU C;  3P32 A;  3VMY A;  5APW A;  1GK4 A;  1GK6 A;  3AE2 C;  1OVR A;  2C0W A;  3IFM A;  5APV A;  4NPD A;  3CXH D;  3MZW B;  2WMM A;  4H44 B;  5AVZ B;  3L75 E;  3LW5 H;  3TSI A;  3N4X A;  3M9B A;  2MKV A;  2WPR A;  4L73 A;  2A45 I;  1IFM A;  2Y0E A;  5AVW B;  2J5U A;  2IFN A;  2MJZ A;  1PPJ D;  2YO3 A;  1X8Y A;  1K73 Q;  5BU5 A;  2B87 B;  2WTY A;  2M5A B;  1J1D C;  1KB9 D;  1U7J A;  1PP9 D;  1SQQ J;  2FYU E;  3O6Q B;  5AW4 B;  3D6Z A;  2P58 A;  3H1L D;  3WUV A;  2GUS A;  2FXO A;  3SSU A;  3R2P A;  2GA1 A;  3H1J D;  1FU1 A;  3D70 A;  2RMZ A;  2Y0C A;  3U59 A;  3WUT A;  3AEC C;  4A7P A;  2E76 D;  4OGQ B;  1FZG A;  3CCE P;  5KJ7 C;  1FS0 E;  2FYU G;  5B5E H;  5B5E E;  3RK2 C;  1ZR2 A;  2AXC A;  1BE3 E;  2D2C C;  2FBW C;  3M06 A;  4WWI A;  1SQX E;  5AVR B;  4CPG A;  2QRX A;  4O9B A;  2OYO A;  1KQF B;  2Q3E A;  1CSB A;  2POH A;  5AW7 B;  4AQR D;  1S9K E;  1RE3 C;  1BE3 G;  2XKM A;  1LP1 B;  2WWW A;  1FJK A;  4WVZ A;  5CCG D;  2R3S A;  1YTZ I;  2QM8 A;  2C9N Y;  3VTP C;  2VRS A;  2Y0D A;  3MUD C;  4GT1 A;  4OWF A;  3H1K G;  3CCJ P;  2O3J A;  3CCV P;  3LIE A;  3CWB J;  3H32 B;  4I2L C;  1VF5 B;  4HJG H;  4OH8 B;  2KLU A;  3F5H A;  1R5L A;  3RBZ A;  1NTM J;  1L2P A;  1YTZ T;  1EZV I;  1LTI C; 
#chains in the Genus database with same CATH homology
 3KQG A;  1LTG C;  1KIL C;  1LGH B;  1SQX K;  4JF7 A;  2HPC B;  2HPC A;  1NOH A;  1FZC A;  2Q3I A;  5AW2 B;  3RL0 C;  4EOT A;  3E1I A;  2WT7 A;  3SWY A;  1JY3 O;  1JY2 P;  2HOD A;  1HTL C;  1SP4 A;  1LTJ B;  1NWQ A;  1A02 F;  5KLV K;  3BRT B;  3GHG B;  1FBM A;  2ZXE B;  2OYH B;  1CI6 A;  1KFN A;  1FZC C;  4LC1 A;  3N7N A;  1GU4 A;  2R5D A;  1IJD B;  2KYV A;  2IPP A;  4WY4 A;  1JCC A;  1N7L A;  3VMX A;  1RF0 C;  1URQ C;  2OYI B;  1H8A A;  1AFO A;  1JCD A;  2O1K A;  4AYC A;  3OA7 A;  3MIW A;  3KPE A;  3U1A A;  2H8P D;  1L0L K;  3TYY A;  1CI6 B;  1LT9 A;  1GDT A;  1DEB A;  2CPB A;  4WY4 D;  1M7L A;  3C9I A;  1ZR4 A;  1LTJ A;  4M3L A;  2Z5I A;  1J1D B;  1NTM K;  1LTJ C;  1IFJ A;  2A45 H;  1OXZ A;  1HH0 A;  1NH4 A;  1JTH B;  1GU5 A;  3V4Q A;  1GL2 A;  1RF1 B;  1FZB A;  3HD7 D;  1M1J C;  2WZ7 A;  3TK1 A;  2M8R A;  3CI9 A;  3WMM 0;  4ZKU A;  3KDP B;  3V2N A;  1SFC C;  2JJL A;  3VYI A;  1KFM A;  3HUS B;  2L5G B;  1FDM A;  3L35 A;  1JTH A;  2J59 M;  1SVF A;  2WSE H;  3NXS A;  2Q7C A;  1NTZ K;  3TNU A;  3BAT A;  4IFM A;  5AVU B;  5CCG A;  1KZU B;  1N7S B;  1T2K D;  2YKQ A;  1HGV A;  1JY3 P;  1EQ7 A;  1T3U A;  2GM4 A;  4WB4 A;  2FYZ A;  1NO4 A;  4AUW A;  1SQQ K;  2NPS B;  5AVV B;  5APY A;  2KB7 P;  3SWF A;  1A02 J;  1QL2 A;  1N7S D;  2JEE A;  4B86 A;  2M3B A;  4LLH A;  1NKN A;  2HFE D;  2QM7 A;  3G3Z A;  1IO4 A;  2XU6 A;  1RE3 A;  5AW0 B;  4HYT B;  5AW5 B;  3PP5 A;  3RK3 D;  3V2P A;  1KIL A;  4W80 A;  3VP8 A;  3HUS C;  3HE5 A;  2FXM A;  5APX A;  5AVT B;  2OYH A;  1GL2 D;  3HRN A;  1HVV A;  3V2R A;  5BU8 B;  1T8Z A;  1FZF A;  3MUD A;  2KOG A;  2N1T A;  5CCH C;  1KIL B;  1N73 B;  3MD0 A;  3V5B A;  5AW1 B;  1FZA A;  3P7K A;  1IK9 A;  1VDF A;  3EFG A;  4RES B;  2HLO A;  1HJB A;  2NPS C;  5KJ7 A;  3HD7 B;  2P2U A;  3VMZ A;  1LWU A;  1MUU A;  4N3Y B;  4LGD E;  3CL3 D;  4XE5 B;  1SQV K;  2O1J A;  2WIT A;  3KYQ A;  3NFQ A;  2W6A A;  1LTS C;  1Z56 A;  2YNY A;  2R32 A;  3RL0 D;  3M9Q A;  4C7N A;  5AW3 B;  1ZN5 A;  3BVH A;  2WPS A;  1URQ B;  2YKP A;  5AVX B;  2HOD B;  1SFC B;  1W2E A;  1FZE A;  2P1J A;  1CW5 A;  3OAK A;  5KJ7 D;  4JYC A;  1HUC A;  1N73 C;  2FKW B;  4N78 D;  1MFZ A;  5APS A;  2I1J A;  2NPS A;  4W7Z A;  2YKO A;  4GKG A;  3UIA A;  1N7S A;  3A5T A;  4C7N B;  1FOS E;  4I1L A;  2FFD C;  3GHG A;  1SQB K;  2YMY A;  2N1T C;  5CCH A;  4WBA A;  3EQ2 A;  1QL1 A;  2Z5H A;  2A45 G;  4XA4 A;  2FYU K;  3II6 A;  1NAF A;  1JY2 N;  4W7Y A;  1GTW A;  3O8Z A;  3HUS A;  1GW3 A;  1LTA C;  3NTN A;  1IC2 A;  1L4A C;  4IFD K;  3LID A;  3MTU E;  2PP6 A;  1LTB C;  1WT6 A;  1WRG A;  5CJ4 A;  1J2J B;  2PAJ A;  2OYI C;  3M9H A;  4WY4 B;  3B5N D;  1FOS F;  1HGZ A;  3M0D C;  3H32 A;  4GIF A;  5AW8 B;  2BAS A;  1VPC A;  1SFC D;  1XTC C;  1URQ D;  2CPS A;  5CCG C;  3A2A A;  1DH3 A;  2P7J A;  2WPQ A;  1CZQ A;  2Q9I A;  3B5N B;  1OWA A;  1RF0 A;  1H88 A;  2R5B A;  5AW9 B;  2KP8 A;  2XZR A;  1ZLL A;  1HWT C;  3RK2 B;  2LKM A;  1JUN A;  1RF1 C;  1SFC A;  1N2D C;  3H6P A;  2HG5 D;  1JOC A;  1ZV8 A;  1M1J A;  1KIL D;  2Z4E A;  3BAS A;  2HYN A;  4EIJ A;  3HE5 B;  2W6B A;  1NKZ B;  1RY3 A;  3RK3 B;  1NU1 K;  1JMM A;  1LWU B;  1JY2 O;  4Y99 C;  3VN0 A;  5CHX A;  3RK2 D;  1GL2 C;  3NMD A;  5KTB A;  2H43 A;  1X9V A;  2E42 A;  2ZFC A;  4IFF A;  1H89 A;  2OYI A;  1FJP A;  1YYC A;  2N1T B;  1IFI A;  3GHG C;  1NTK K;  1URQ A;  1LT9 C;  1N86 A;  3HTK B;  5AW6 B;  3IR9 A;  1IFD A;  1L4A A;  2O01 H;  4N78 E;  2YO2 A;  2NPS D;  1G2C B;  3I5C A;  3V4W A;  4KHX A;  5APU A;  3L36 A;  3B8E B;  3L37 A;  3M0A A;  1JNM A;  3V2Q A;  1GD2 E;  2Q5U A;  3CLQ A;  3BRV B;  3HE4 B;  3A7O A;  4WY4 C;  1PFI A;  3RK3 C;  4C7R A;  4Y99 B;  1LTT C;  2XV5 A;  4DOJ A;  1L0N K;  3T97 A;  1S9K D;  1GL2 B;  2C0X A;  1RF1 A;  2FFD B;  3P8M C;  1J1E B;  3HD7 C;  1N73 A;  3RL0 B;  2I1K A;  1G1I A;  5CJ0 A;  3VOP A;  2OAR A;  1AQ5 A;  1SQP K;  1LT9 B;  1HBW A;  4HH2 A;  2N9B A;  3TNU B;  1L4A B;  1M1J B;  4I6M C;  1FZC B;  1KQL A;  4JYB A;  5AVS B;  3P8C E;  2P67 A;  3M0D A;  5BVZ A;  5AVQ B;  4C46 A;  3HE4 A;  1JO5 A;  3B5N A;  3OJA B;  2J58 A;  1X79 B;  3P8C D;  1RE4 C;  2W27 A;  2R3C A;  3MGN A;  4N6J A;  1GW4 A;  1N7S C;  1DX7 A;  3U1C A;  2XNX A;  1SLQ A;  3L4F A;  4DZO A;  3VP9 A;  1GZL A;  1G2C A;  1J1E C;  1XTG B;  1RE4 A;  2IFM A;  1IFN A;  3B5N C;  3M91 A;  3HTK A;  5CMZ A;  2IX7 C;  2E43 A;  2H7H A;  2OYH C;  2FFD A;  1T3J A;  3HD7 A;  1FAV A;  2KSJ A;  5CCH D;  2WSC H;  3A3Y B;  1MV8 A;  5APT A;  2N1T D;  2KLV A;  1T2K C;  1NHL A;  2C9L Y;  1JY3 N;  2XDJ A;  1E5W A;  5APQ A;  1MZ9 A;  5AVY B;  2WSF H;  4ZKP A;  2GUV A;  1G1J A;  1L4A D;  3P32 A;  1LWU C;  5APW A;  1GK4 A;  1GK6 A;  3IFM A;  5APV A;  2C0W A;  5AVZ B;  3LW5 H;  3TSI A;  3N4X A;  3M9B A;  2WPR A;  2A45 I;  1IFM A;  5AVW B;  2IFN A;  2MJZ A;  2YO3 A;  1X8Y A;  5BU5 A;  2WTY A;  1J1D C;  5AW4 B;  2GUS A;  3R2P A;  1FU1 A;  3U59 A;  1FZG A;  5KJ7 C;  3RK2 C;  1ZR2 A;  5CCG D;  3M06 A;  5AVR B;  4O9B A;  1CSB A;  2POH A;  5AW7 B;  4AQR D;  1S9K E;  1RE3 C;  2XKM A;  2WWW A;  1FJK A;  1YTZ I;  2QM8 A;  2C9N Y;  3VTP C;  2VRS A;  4GT1 A;  3LIE A;  3H32 B;  4I2L C;  4OH8 B;  2WT7 B;  3VMY A;  1YTZ T;  1LTI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...