2XL6A

Cytochrome c prime from alcaligenes xylosoxidans: ferrous r124a variant with bound no
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Distal-to-Proximal No Conversion in Hemoproteins: The Role of the Proximal Pocket.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 52
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2010-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2xl6A00
3ZQVA 1LM3B 2XLEA 3L1MA 1YZCA 5JLIA 3VRCA 3M79A 4U9EA 4CIPA 3NMJA 3IQ6A 4JE9A 3M4BA 3ZWIA 3QW1A 2XLOA 2XLDA 3TOLA 3HNKA 1A7VA 3IQ5A 5JRAA 1QPUA 4N4WA 2XL8A 1RCPA 3HNJA 256BA 1E86A 4L6RA 2XL6A 2J9BA 5JP7A 3DE8A 4IARA 2XM0A 2CCYA 5AGFA 2XM4A 4CJOA 1QQ3A 4N6HA 2XLHA 1EKYA 1S05A 1MQVA 4JKVA 1GQAA 1M6TA 2YL7A 1E84A 4WGZA 3NMIA 2YLGA 1CPRA 1YZAA 5JS5A 3M4CA 2YL0A 3C63A 2YLIA 4D4NA 5JSLA 4EIYA 3ZTMA 2QLAA 1CGNA 3QVZA 1APCA 2YL1A 4ER9A 3HNIA 5JT4A 5JUAA 4WGYA 3QVYA 4CDYA 1YYXA 2YKZA 2XLMA 3ZQYA 2J8WA 3DE9A 4D4XA 2XLVA 4JEAA 4IAQA 4U9DA 2BC5A 4JEBA 3HNLA 3M15A 4ULVA 3FOOA 4IB4A 5JVEA 1E85A 4NC3A 1YYJA 2YL3A 1E83A 3TOMA 3QW0A 3FOPA 1CPQA 4CDVA 2XLWA 2YLDA 1BBHA 5B3IA 4CDAA 3ZTZA 4CX9A 3U8PA 1CGOA 1NBBA 3C62A 4CJGA 3NMKA 1JAFA
chains in the Genus database with same CATH superfamily
4MVSA 3ZQVA 1LM3B 4QDLA 4RBNA 2VB6A 3CZ6A 5BUOA 4LLCA 4CBEA 5DS4A 4U9EA 5L0DA 1LS1A 2FAPB 3POVA 1A41A 1PD1A 4MNDA 1VTMP 4MVRA 3VAYA 3EGXB 5E33A 3S9OA 4PK4A 3ZWIA 2B0HA 2ZXRA 3MBGA 3QW1A 1D1BA 1V74B 2E87A 2J9WA 1MMNA 2KW3C 3I5PA 3JSEO 2R7OA 4W8PA 4E7ZA 3O6XA 2C03A 1JPJA 4DXWA 3WAQA 2PX3A 1T01A 4IWBA 3AG3C 3HNKA 4WJ0A 3G4ZA 1LE4A 3GWNA 3EGXA 1A7VA 3ZVRA 2KNHA 4CS7A 5HSWA 2YWAA 1QPUA 3T6BA 3W2WA 1OW6A 2L6HA 4O6YA 2TMVP 1Q0GA 4AE4A 1RCPA 1VYKA 4G0HA 3UNGC 5L0CA 4L6RA 2IXNA 4O6MA 1ZYRF 4ONSA 4IARA 1L3PA 4U5BE 2CCYA 1Q0MA 3EHMA 2XM4A 2P0NA 4HE8D 4CJOA 5A6AA 2NSFA 1GGQA 1PD0A 2LFDA 3DJNB 1S7ZA 2I15A 3NYMA 4KNVA 4NTFA 3U8VA 3RH3A 4BPMA 1T6IA 4HFKB 1ORJA 4I1MA 1OCOC 2HZ8A 3DM5A 4PACA 4OIPF 2Y3BA 3LESA 1YA7O 2YL7A 1M6TA 3G4XA 3HKKA 2FGYA 3SYNA 5L3QA 2KGOA 2VCCA 3WHNA 2AWYA 4E0IA 1RKEA 4MTGA 1VLSA 3A11A 5JS5A 3M4CA 3C63A 3K1IA 3AOUA 4D4NA 2CNWD 4BJ5C 1YDIA 1D0ZA 3U2MA 1D0YA 1C02A 2OJED 4BJTA 4EIYA 3FDQA 1TR2A 3GEHA 3ZTMA 2QLAA 3BEHA 3EG9B 1J8MF 1CGNA 2Z15A 1ORYA 3L8JA 3LEOA 3ZIBA 3AG1C 2D5RB 2M64A 3FAPB 3LAYA 4ER9A 3HNIA 2ZXWC 3C8ZA 4ZLCA 1FTSA 5COMA 4CS8C 4I44A 4AL1A 3C8GD 2R05A 3U9JA 2JD3A 1TFOB 1NLXA 2EIKC 3EG9A 3GORA 4FESA 2R03A 4PFPA 3T6JA 2YKZA 4JVSA 2XS1A 3DXJF 2CNWA 1ZVZA 3UMHA 1YAUO 4D4XA 2OJQA 2XLVA 1OCCC 3H65A 1TWCA 4JEAA 5CI8A 2ZXOA 1E83A 1Z63A 1FMWA 1AEPA 2L6FA 3MYFA 1O5HA 4ULVA 3US6A 4I3MA 1G4US 4IB4A 4RDAA 2Q3TA 2CYDA 2EIMC 1IW7F 2PP4A 4MVZA 3C8GA 4C7OA 3KKBA 4BEMJ 1O87A 1YYJA 4GYTA 4OIQF 2H7BA 5T3TA 1BR1A 4YT2A 5KYWB 1BR2A 1XZPA 1Y6DA 2QNLA 1Y4CA 1W2WA 1A7DA 1ST6A 2GAQA 2IXPA 3FOPA 4C3BA 4UDVA 2AWCA 3V5XA 3W8HA 1WGWA 2YHSA 1T9KA 3ASOC 5FCLA 4XPYA 2LSEA 2PFDA 3N24A 3QZCA 2R25A 1RKCA 5KYWA 4JURI 2LQGA 3HJCA 2R7QA 3U8PA 4JZAA 4BJ5A 4PR9A 5F5HA 4Z9JA 3GEEA 1RJ9B 4KNWA 4CJGA 3NMKA 3RW0A 2R7RA 1ZHTA 5A6KA 1FMVA 1PCXA 1Q0FA 4PJLA 1H9GA 4BEJA 2XXAA 1TWAA 1ZW3A 1B68A 1T5OA 3L1MA 3CEXA 1XZQA 3VYWA 2AVKA 3DJUB 2OOCA 3VRCA 4J30B 2WVOA 1D1CA 3RQGA 4CIPA 2EPKX 2R02A 1PV3A 2XS8A 2PBEA 3K7DA 4K1OA 4JE9A 3FMSA 3X1OA 5L0JA 2RSEB 2KK1A 2HS5A 3GWLA 3U5SA 4K0DA 3GODA 3L8IA 1T6QA 4XPWA 3M1CB 3W2VA 3Q6MA 4DJ9A 2XLOA 3EZIA 1HW2A 4ULWA 1LVKA 2WZFA 3TOLA 3JRMO 1O3UA 4P9TA 5BQGA 1HE1A 2Q7RA 4YK5A 3IQ5A 1GS9A 4JRZA 1BDJB 1LPEA 3NKEA 1MNEA 3MX3A 3ZG1A 1Z6AA 2EILC 1KTMA 3LS0A 3K1IC 5E2QA 2JX0A 4RD9A 3NYJA 2J9BA 2NG1A 4C3DA 3UGPA 2R7UA 4AL0A 2PX0A 2R7WA 2W4MA 4DRJB 4BJ6C 1E84A 5AGFA 1MMGA 4MW8A 1VYIA 3DMDA 2YRFA 3C7JA 3PDMP 4W8KA 1MMAA 3RQFA 3A9CA 3SZRA 2Y3DA 1NG1A 2G62A 3EFOA 4IAOA 4XQ1A 5CIVA 2ETSA 4JKVA 2QTVA 3W4YA 3KPHA 4WGZA 4EBKA 3NMIA 3LLKA 3ABLC 4IGGA 5COGA 3DI5A 4JJGA 4PJMA 3T4RA 2B0JA 5B1AC 4EWCA 5HV9A 2YL0A 2YLIA 4Z9IA 3S28A 1DOVA 2ASRA 1LI5A 4MVOA 4EBJA 4E0HA 4JCHA 3QVZA 1APCA 1VOMA 1WWPA 3ZDLA 5AC4A 1XWJA 1QSPA 3DWWA 1VMAA 2ZXPA 4DVYP 5DS5A 2WB7A 2MHRA 5JT4A 5JUAA 1RKEB 4NQFA 3TK0A 1GM5A 1RMVA 1JMWA 3GM2A 1Q0DA 4U5FE 1LKXA 1YYXA 2HMQA 4LLEA 4OD5A 1K40A 4U5CE 2XLMA 3ZQYA 3DE9A 1G4WR 4CS9A 2W45A 5B3SC 4H54A 4IRUA 4OIOF 3PHF2 5D91A 4KI2A 1NSGB 4ANJA 4NTAA 4YT5A 4YJWA 1ZHWA 3RKOF 3M15A 2EPOA 4XEKA 1SR2A 2O9XA 4DRIB 2LFFA 4BJ6A 1FAPB 4XPXA 3LLIA 3SXZA 3LUTB 1E85A 4K7BA 4NC3A 5KYUA 1OCRC 1U89A 4PJNA 2LK4A 3B0UX 2J7PD 2AP3A 3SXMA 2IOQA 2G3KA 1KNYA 2J0XA 1Z7Qc 4BJ1A 2AU5A 2Q00A 2VCAA 3U3FA 3QW0A 3ATPA 1ZHYA 2R9RB 1BBHA 2XLWA 2YLDA 3AG2C 4MVUA 3S0XA 4CDAA 3H2UA 4X0RA 2OG2A 3V7OA 2L7AA 3GANA 4LDQA 3ZTZA 4YN0B 5KYXA 1CGME 4WABA 4CX9A 1KU2A 3OEOA 3C8GB 3W8IA 3MYIA 4C7OB 3AQBA 3EGDB 3ZC4A 3C62A 2LP4A 5K0IA 1V4AA 5GPGB 3K66A 4N06A 2IYLD 1SF8A 2EINC 2W4BA 1JAFA 2H7VC 3EPVA 4LERA 3S90A 2J7PA 2XL4A 1QVXA 2XLEA 4Z9HA 1YZCA 1HY5A 3NYLA 3SEOA 5JLIA 1WATA 2J9UA 1HE9A 2YEVA 4E7SA 2RD9A 3EGDA 2HUJA 5A69A 1H6GA 4HEAJ 5DVWA 1EI7A 3K1HA 3NMJA 2J9VA 4JC7A 2P1AA 2V26A 3LS1A 3AQCA 2UUHA 5B1BC 2PNOA 4EBBA 3DD7A 1H9TA 1OR3A 2L9JA 3QMKA 1QKRA 5BQIA 1TFKB 3UR3C 3I4UA 4YL3A 5F5FA 2EIJC 4G7ZF 2QE9A 3CQZA 2XXAB 3IPMO 3KYIA 1NU9C 2R7VA 4LDKA 2HJ3A 3LNMB 1ZU4A 4N4WA 1Z23A 4Q4ZF 3L0IA 3O39A 5EHHA 3MFNA 3JTLO 5D92A 3HNJA 2NUPA 4LDRA 2P7VA 1E86A 2XL6A 2HSQA 2ICWG 2CW0F 3FXHA 3RQEA 3SXYA 4EHPA 2XM0A 3GM3A 3R7CA 1SZIA 3CSKA 2R7SA 3R2PA 5IY5C 3ITFA 2Y39A 4A2NB 4DBRA 1QQ3A 2PF4E 2V3CC 2VC9A 4MTFA 2OQMA 3KYJA 3DM9B 1LIHA 1OKKD 4N6HA 2A68F 2J45A 2XLHA 4E18A 5BQHA 4QI2A 1S05A 1EKYA 3GM1A 5L0IA 1EA8A 3RIPA 1A7EA 1QZXA 4MTOA 1J8YF 2OKUA 3PMRA 4JTAB 2YLGA 2GDCA 4QI0A 3VF0A 5E3CA 1FR0A 2HMZA 3EH1A 3ZSUA 2MWQA 1UFBA 1D1AA 2X51A 3NRHA 2P61A 4KC9A 4CS9C 5L0FA 5JSLA 2MYSA 3MLGA 3F46A 4F4BA 2A0UA 3Q6NA 1U0BB 1QLEC 2GFHA 3TJ6A 2R7TA 3EFOB 3JZ0A 3RFYA 4J32B 5T1DB 1L7CA 3CAXA 3GEIA 3FAJA 5KYYA 2A69F 2R7XA 1OKKA 1VB5A 2L81A 4XLPF 3OA1A 1RXQA 2IXMA 4EUKB 4R32A 2A0BA 3QVYA 2IM8A 5L0GA 3O10A 3UMIA 1G5ZA 1Q0KA 2KYHA 3HTKC 5F28E 3X2QC 3TULA 2YQYA 4MS2A 3RVYA 3SXKA 1SMYF 1Z3IX 3UGOA 3UMKA 3B0VC 4DRHB 3IHUA 3VM6A 5DLJA 4AE4B 4B6IA 5DQTA 1OW7A 4Q5SF 2ZPAA 1U6HA 3JT1A 3RYLA 4DBQA 3PCVA 4CIHA 2BC5A 4GQHA 2I8BA 2P6VA 1ORSC 2YZSA 1YLMA 5L3VA 3JYHA 1LI7A 5JVEA 5CI9A 4PFOA 1F1MA 1OCZC 1G8XA 1C03A 5E3AA 1NU7D 1BR4A 1M57C 2DYSC 1E2XA 2WVNA 1M2VB 2YL3A 1TWGA 5FZTA 5TJ5E 5AC5A 3ECSA 3ASNC 3EJNA 2Q9AA 4JCZA 4NY3A 4P6IC 2H7OA 4MW3A 3TOMA 4YT8A 2VCBA 4G7HF 2DGJA 3AGUA 4CDVA 2DYRC 1WASA 3EQLF 2DI3A 2KJGA 1NFNA 2Q9BA 3E70C 3HLZA 3Q7LA 2J46A 1I4YA 2C04A 4JTDB 4LACB 3BRJA 4P9FA 2IXOA 3FHDA 4EKWA 1M2VA 1ZU5A 2LD6A 1WOLA 1C17M 4GEHA 4BG0A 2YVKA 5KYUB 3KMIA 1VK5A 1CGOA 2A6EF 1NBBA 4FX5A 4IJJA 5KYNA 1R5ID 2ZD9A 4XLNF 1LE2A 1JOGA 2Q4FA 3Q7GA 4H4KC 4ZLDA 1OXKA 2WZLA 3U9MA 3ABMC 2L6GA 4MVQA 3I5QA 3SNHA 4YWQA 3IQCA 3V5YA 4AX2A 4MQ9F 5A6BD 2WVQA 1BZ4A 1YA9A 2Y69C 3M79A 4Q7CA 1HW1A 4FAPB 2A1DD 4O79A 3AJMA 2BE5F 5KYXB 3DKAA 2NPUA 3EZHA 3IQ6A 5L0HA 3JRTA 1HMOA 3AG4C 2GWWA 3M4BA 3S29A 3WG7C 3RF3A 2JPUA 1JRAA 3LNRA 3TQOA 4NTBA 1Z5ZA 1I4ZA 3WODF 3S27A 4FWVA 4O7GA 3IEEA 4C3EA 4CSAC 4G78A 2XLDA 4DVZA 2F22A 4N6CA 2KC3A 4M63A 1AVOB 2OCCC 4MVMA 4O6NA 4E17A 5JRAA 1H7IA 2XL8A 3JSZA 1ZHXA 4U5GA 2BL2A 4I1OB 2OEXA 5A6BA 3SP1A 1OR2A 256BA 2HV6A 5T3WA 2Y3HA 3N2ZB 5JP7A 2KQ9A 3DE8A 4OINF 1OXBA 2D4UA 2M4EA 3DAFA 3JYYA 4JW1A 4YT4A 3N0TA 2HJMA 4U5HA 1NZEA 1NFOA 2NUTB 2Y3GA 2CDQA 1HMDA 4YL0A 1FNTc 3ABKC 3B29A 1UG7A 3LJBA 3H2VA 1FFHA 1MMDA 1WTYA 2HSBA 2EPLX 1MNDA 4HFFB 1MQVA 4AK9A 2GA0A 1FFTC 1GQAA 2KSFA 3FVYA 3KH2A 2W9YA 3DAGA 2NUPB 3C18A 3L34A 4XWJA 3T9OA 4DOZA 4U5EE 3B71A 3K33A 2NUTA 2H8AA 1LS4A 2A6HF 1OQCA 1CPRA 2DB4A 1IZMA 1YZAA 2XSEA 3U0CA 4JIOA 4KBLA 2WZGA 1V55C 4A4AA 2HFIA 3G50A 4U5DE 1OW8A 2HV7A 1AUEA 1M56C 1WN0A 1YARO 4YL1A 3NG1A 3T6GB 1TWHA 2YL1A 2QUPA 1DOWA 4XTKA 3B9QA 5DQZA 1T6UA 4WGYA 1JPNA 3K6BA 4CDYA 5COFA 3LEVA 3B0PA 3U3BA 4CSAA 3EHNA 1TQGA 2J8WA 3F47A 4OIRF 1R4TA 5EGYA 5EK0A 3U2LA 1D0XA 1K04A 4IAQA 2X0CA 3J06A 2EPNA 4U9DA 5KYYB 4J7TA 3IQTA 2VH3A 4JEBA 2OEVA 3HNLA 2CGEA 2UUIA 1TKNA 2OU6A 2VASA 2LCHA 2HKVA 3JCUQ 2EPMX 2FFHA 3FOOA 3KL4A 4XEFA 3O55A 1EQ1A 1JR8A 2G3VA 4CS8A 1ZW2A 2XRHA 5A6JA 4XEVA 2WL8A 1A0BA 1RJ9A 3DZAA 1ZZPA 2LIGA 2J0WA 4G7OF 3OWTA 2NSGA 4JJFA 3E9VA 3RVZA 1CPQA 2Q9CA 3QTHA 3TD7A 3V5ZA 1YJGA 4JTCB 5B3IA 4PJJA 1YVIA 1I5NA 3TJ5A 3EH2A 4J7YA 1V54C 1K05A 1VLTA 5DS6A 2QY9A 1N1CA 3NKDA 3AGTA 1ZHZA 3NDBB 2IBFA 4OD4A 1SYQA 4NCQA 1M2OA 3S84A
chains in the Genus database with same CATH topology
3ZQVA 1LM3B 2XLEA 3L1MA 1YZCA 5JLIA 3VRCA 3M79A 4U9EA 4CIPA 3NMJA 3IQ6A 4JE9A 3M4BA 3ZWIA 3QW1A 2XLOA 2XLDA 3TOLA 3HNKA 1A7VA 3IQ5A 5JRAA 1QPUA 4N4WA 2XL8A 1RCPA 3HNJA 256BA 1E86A 4L6RA 2XL6A 2J9BA 5JP7A 3DE8A 4IARA 2XM0A 2CCYA 5AGFA 2XM4A 4CJOA 1QQ3A 4N6HA 2XLHA 1EKYA 1S05A 1MQVA 4JKVA 1GQAA 1M6TA 2YL7A 1E84A 4WGZA 3NMIA 2YLGA 1CPRA 1YZAA 5JS5A 3M4CA 2YL0A 3C63A 2YLIA 4D4NA 5JSLA 4EIYA 3ZTMA 2QLAA 1CGNA 3QVZA 1APCA 2YL1A 4ER9A 3HNIA 5JT4A 5JUAA 4WGYA 3QVYA 4CDYA 1YYXA 2YKZA 2XLMA 3ZQYA 2J8WA 3DE9A 4D4XA 2XLVA 4JEAA 4IAQA 4U9DA 2BC5A 4JEBA 3HNLA 3M15A 4ULVA 3FOOA 4IB4A 5JVEA 1E85A 4NC3A 1YYJA 2YL3A 1E83A 3TOMA 3QW0A 3FOPA 1CPQA 4CDVA 2XLWA 2YLDA 1BBHA 5B3IA 4CDAA 3ZTZA 4CX9A 3U8PA 1CGOA 1NBBA 3C62A 4CJGA 3NMKA 1JAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQV A;  1LM3 B;  2XLE A;  3L1M A;  1YZC A;  5JLI A;  3VRC A;  3M79 A;  4U9E A;  4CIP A;  3NMJ A;  3IQ6 A;  4JE9 A;  3M4B A;  3ZWI A;  3QW1 A;  2XLO A;  2XLD A;  3TOL A;  3HNK A;  1A7V A;  3IQ5 A;  5JRA A;  1QPU A;  4N4W A;  2XL8 A;  1RCP A;  3HNJ A;  256B A;  1E86 A;  4L6R A;  2XL6 A;  2J9B A;  5JP7 A;  3DE8 A;  4IAR A;  2XM0 A;  2CCY A;  5AGF A;  2XM4 A;  4CJO A;  1QQ3 A;  4N6H A;  2XLH A;  1EKY A;  1S05 A;  1MQV A;  4JKV A;  1GQA A;  1M6T A;  2YL7 A;  1E84 A;  4WGZ A;  3NMI A;  2YLG A;  1CPR A;  1YZA A;  5JS5 A;  3M4C A;  2YL0 A;  3C63 A;  2YLI A;  4D4N A;  5JSL A;  4EIY A;  3ZTM A;  2QLA A;  1CGN A;  3QVZ A;  1APC A;  2YL1 A;  4ER9 A;  3HNI A;  5JT4 A;  5JUA A;  4WGY A;  3QVY A;  4CDY A;  1YYX A;  2YKZ A;  2XLM A;  3ZQY A;  2J8W A;  3DE9 A;  4D4X A;  2XLV A;  4JEA A;  4IAQ A;  4U9D A;  2BC5 A;  4JEB A;  3HNL A;  3M15 A;  4ULV A;  3FOO A;  4IB4 A;  5JVE A;  1E85 A;  4NC3 A;  1YYJ A;  2YL3 A;  1E83 A;  3TOM A;  3QW0 A;  3FOP A;  1CPQ A;  4CDV A;  2XLW A;  2YLD A;  1BBH A;  5B3I A;  4CDA A;  3ZTZ A;  4CX9 A;  3U8P A;  1CGO A;  1NBB A;  3C62 A;  4CJG A;  3NMK A;  1JAF A; 
#chains in the Genus database with same CATH topology
 4MVS A;  3ZQV A;  1LM3 B;  4QDL A;  4RBN A;  2VB6 A;  3CZ6 A;  5BUO A;  4LLC A;  4CBE A;  5DS4 A;  4U9E A;  5L0D A;  1LS1 A;  2FAP B;  3POV A;  1A41 A;  1PD1 A;  4MND A;  1VTM P;  4MVR A;  3VAY A;  3EGX B;  5E33 A;  3S9O A;  4PK4 A;  3ZWI A;  2B0H A;  2ZXR A;  3MBG A;  3QW1 A;  1D1B A;  1V74 B;  2E87 A;  2J9W A;  1MMN A;  2KW3 C;  3I5P A;  3JSE O;  2R7O A;  4W8P A;  4E7Z A;  3O6X A;  2C03 A;  1JPJ A;  4DXW A;  3WAQ A;  2PX3 A;  1T01 A;  4IWB A;  3AG3 C;  3HNK A;  4WJ0 A;  3G4Z A;  1LE4 A;  3GWN A;  3EGX A;  1A7V A;  3ZVR A;  2KNH A;  4CS7 A;  5HSW A;  2YWA A;  1QPU A;  3T6B A;  3W2W A;  1OW6 A;  2L6H A;  4O6Y A;  2TMV P;  1Q0G A;  4AE4 A;  1RCP A;  1VYK A;  4G0H A;  3UNG C;  5L0C A;  4L6R A;  2IXN A;  4O6M A;  1ZYR F;  4ONS A;  4IAR A;  1L3P A;  4U5B E;  2CCY A;  1Q0M A;  3EHM A;  2XM4 A;  2P0N A;  4HE8 D;  4CJO A;  5A6A A;  2NSF A;  1GGQ A;  1PD0 A;  2LFD A;  3DJN B;  1S7Z A;  2I15 A;  3NYM A;  4KNV A;  4NTF A;  3U8V A;  3RH3 A;  4BPM A;  1T6I A;  4HFK B;  1ORJ A;  4I1M A;  1OCO C;  2HZ8 A;  3DM5 A;  4PAC A;  4OIP F;  2Y3B A;  3LES A;  1YA7 O;  2YL7 A;  1M6T A;  3G4X A;  3HKK A;  2FGY A;  3SYN A;  5L3Q A;  2KGO A;  2VCC A;  3WHN A;  2AWY A;  4E0I A;  1RKE A;  4MTG A;  1VLS A;  3A11 A;  5JS5 A;  3M4C A;  3C63 A;  3K1I A;  3AOU A;  4D4N A;  2CNW D;  4BJ5 C;  1YDI A;  1D0Z A;  3U2M A;  1D0Y A;  1C02 A;  2OJE D;  4BJT A;  4EIY A;  3FDQ A;  1TR2 A;  3GEH A;  3ZTM A;  2QLA A;  3BEH A;  3EG9 B;  1J8M F;  1CGN A;  2Z15 A;  1ORY A;  3L8J A;  3LEO A;  3ZIB A;  3AG1 C;  2D5R B;  2M64 A;  3FAP B;  3LAY A;  4ER9 A;  3HNI A;  2ZXW C;  3C8Z A;  4ZLC A;  1FTS A;  5COM A;  4CS8 C;  4I44 A;  4AL1 A;  3C8G D;  2R05 A;  3U9J A;  2JD3 A;  1TFO B;  1NLX A;  2EIK C;  3EG9 A;  3GOR A;  4FES A;  2R03 A;  4PFP A;  3T6J A;  2YKZ A;  4JVS A;  2XS1 A;  3DXJ F;  2CNW A;  1ZVZ A;  3UMH A;  1YAU O;  4D4X A;  2OJQ A;  2XLV A;  1OCC C;  3H65 A;  1TWC A;  4JEA A;  5CI8 A;  2ZXO A;  1E83 A;  1Z63 A;  1FMW A;  1AEP A;  2L6F A;  3MYF A;  1O5H A;  4ULV A;  3US6 A;  4I3M A;  1G4U S;  4IB4 A;  4RDA A;  2Q3T A;  2CYD A;  2EIM C;  1IW7 F;  2PP4 A;  4MVZ A;  3C8G A;  4C7O A;  3KKB A;  4BEM J;  1O87 A;  1YYJ A;  4GYT A;  4OIQ F;  2H7B A;  5T3T A;  1BR1 A;  4YT2 A;  5KYW B;  1BR2 A;  1XZP A;  1Y6D A;  2QNL A;  1Y4C A;  1W2W A;  1A7D A;  1ST6 A;  2GAQ A;  2IXP A;  3FOP A;  4C3B A;  4UDV A;  2AWC A;  3V5X A;  3W8H A;  1WGW A;  2YHS A;  1T9K A;  3ASO C;  5FCL A;  4XPY A;  2LSE A;  2PFD A;  3N24 A;  3QZC A;  2R25 A;  1RKC A;  5KYW A;  4JUR I;  2LQG A;  3HJC A;  2R7Q A;  3U8P A;  4JZA A;  4BJ5 A;  4PR9 A;  5F5H A;  4Z9J A;  3GEE A;  1RJ9 B;  4KNW A;  4CJG A;  3NMK A;  3RW0 A;  2R7R A;  1ZHT A;  5A6K A;  1FMV A;  1PCX A;  1Q0F A;  4PJL A;  1H9G A;  4BEJ A;  2XXA A;  1TWA A;  1ZW3 A;  1B68 A;  1T5O A;  3L1M A;  3CEX A;  1XZQ A;  3VYW A;  2AVK A;  3DJU B;  2OOC A;  3VRC A;  4J30 B;  2WVO A;  1D1C A;  3RQG A;  4CIP A;  2EPK X;  2R02 A;  1PV3 A;  2XS8 A;  2PBE A;  3K7D A;  4K1O A;  4JE9 A;  3FMS A;  3X1O A;  5L0J A;  2RSE B;  2KK1 A;  2HS5 A;  3GWL A;  3U5S A;  4K0D A;  3GOD A;  3L8I A;  1T6Q A;  4XPW A;  3M1C B;  3W2V A;  3Q6M A;  4DJ9 A;  2XLO A;  3EZI A;  1HW2 A;  4ULW A;  1LVK A;  2WZF A;  3TOL A;  3JRM O;  1O3U A;  4P9T A;  5BQG A;  1HE1 A;  2Q7R A;  4YK5 A;  3IQ5 A;  1GS9 A;  4JRZ A;  1BDJ B;  1LPE A;  3NKE A;  1MNE A;  3MX3 A;  3ZG1 A;  1Z6A A;  2EIL C;  1KTM A;  3LS0 A;  3K1I C;  5E2Q A;  2JX0 A;  4RD9 A;  3NYJ A;  2J9B A;  2NG1 A;  4C3D A;  3UGP A;  2R7U A;  4AL0 A;  2PX0 A;  2R7W A;  2W4M A;  4DRJ B;  4BJ6 C;  1E84 A;  5AGF A;  1MMG A;  4MW8 A;  1VYI A;  3DMD A;  2YRF A;  3C7J A;  3PDM P;  4W8K A;  1MMA A;  3RQF A;  3A9C A;  3SZR A;  2Y3D A;  1NG1 A;  2G62 A;  3EFO A;  4IAO A;  4XQ1 A;  5CIV A;  2ETS A;  4JKV A;  2QTV A;  3W4Y A;  3KPH A;  4WGZ A;  4EBK A;  3NMI A;  3LLK A;  3ABL C;  4IGG A;  5COG A;  3DI5 A;  4JJG A;  4PJM A;  3T4R A;  2B0J A;  5B1A C;  4EWC A;  5HV9 A;  2YL0 A;  2YLI A;  4Z9I A;  3S28 A;  1DOV A;  2ASR A;  1LI5 A;  4MVO A;  4EBJ A;  4E0H A;  4JCH A;  3QVZ A;  1APC A;  1VOM A;  1WWP A;  3ZDL A;  5AC4 A;  1XWJ A;  1QSP A;  3DWW A;  1VMA A;  2ZXP A;  4DVY P;  5DS5 A;  2WB7 A;  2MHR A;  5JT4 A;  5JUA A;  1RKE B;  4NQF A;  3TK0 A;  1GM5 A;  1RMV A;  1JMW A;  3GM2 A;  1Q0D A;  4U5F E;  1LKX A;  1YYX A;  2HMQ A;  4LLE A;  4OD5 A;  1K40 A;  4U5C E;  2XLM A;  3ZQY A;  3DE9 A;  1G4W R;  4CS9 A;  2W45 A;  5B3S C;  4H54 A;  4IRU A;  4OIO F;  3PHF 2;  5D91 A;  4KI2 A;  1NSG B;  4ANJ A;  4NTA A;  4YT5 A;  4YJW A;  1ZHW A;  3RKO F;  3M15 A;  2EPO A;  4XEK A;  1SR2 A;  2O9X A;  4DRI B;  2LFF A;  4BJ6 A;  1FAP B;  4XPX A;  3LLI A;  3SXZ A;  3LUT B;  1E85 A;  4K7B A;  4NC3 A;  5KYU A;  1OCR C;  1U89 A;  4PJN A;  2LK4 A;  3B0U X;  2J7P D;  2AP3 A;  3SXM A;  2IOQ A;  2G3K A;  1KNY A;  2J0X A;  1Z7Q c;  4BJ1 A;  2AU5 A;  2Q00 A;  2VCA A;  3U3F A;  3QW0 A;  3ATP A;  1ZHY A;  2R9R B;  1BBH A;  2XLW A;  2YLD A;  3AG2 C;  4MVU A;  3S0X A;  4CDA A;  3H2U A;  4X0R A;  2OG2 A;  3V7O A;  2L7A A;  3GAN A;  4LDQ A;  3ZTZ A;  4YN0 B;  5KYX A;  1CGM E;  4WAB A;  4CX9 A;  1KU2 A;  3OEO A;  3C8G B;  3W8I A;  3MYI A;  4C7O B;  3AQB A;  3EGD B;  3ZC4 A;  3C62 A;  2LP4 A;  5K0I A;  1V4A A;  5GPG B;  3K66 A;  4N06 A;  2IYL D;  1SF8 A;  2EIN C;  2W4B A;  1JAF A;  2H7V C;  3EPV A;  4LER A;  3S90 A;  2J7P A;  2XL4 A;  1QVX A;  2XLE A;  4Z9H A;  1YZC A;  1HY5 A;  3NYL A;  3SEO A;  5JLI A;  1WAT A;  2J9U A;  1HE9 A;  2YEV A;  4E7S A;  2RD9 A;  3EGD A;  2HUJ A;  5A69 A;  1H6G A;  4HEA J;  5DVW A;  1EI7 A;  3K1H A;  3NMJ A;  2J9V A;  4JC7 A;  2P1A A;  2V26 A;  3LS1 A;  3AQC A;  2UUH A;  5B1B C;  2PNO A;  4EBB A;  3DD7 A;  1H9T A;  1OR3 A;  2L9J A;  3QMK A;  1QKR A;  5BQI A;  1TFK B;  3UR3 C;  3I4U A;  4YL3 A;  5F5F A;  2EIJ C;  4G7Z F;  2QE9 A;  3CQZ A;  2XXA B;  3IPM O;  3KYI A;  1NU9 C;  2R7V A;  4LDK A;  2HJ3 A;  3LNM B;  1ZU4 A;  4N4W A;  1Z23 A;  4Q4Z F;  3L0I A;  3O39 A;  5EHH A;  3MFN A;  3JTL O;  5D92 A;  3HNJ A;  2NUP A;  4LDR A;  2P7V A;  1E86 A;  2XL6 A;  2HSQ A;  2ICW G;  2CW0 F;  3FXH A;  3RQE A;  3SXY A;  4EHP A;  2XM0 A;  3GM3 A;  3R7C A;  1SZI A;  3CSK A;  2R7S A;  3R2P A;  5IY5 C;  3ITF A;  2Y39 A;  4A2N B;  4DBR A;  1QQ3 A;  2PF4 E;  2V3C C;  2VC9 A;  4MTF A;  2OQM A;  3KYJ A;  3DM9 B;  1LIH A;  1OKK D;  4N6H A;  2A68 F;  2J45 A;  2XLH A;  4E18 A;  5BQH A;  4QI2 A;  1S05 A;  1EKY A;  3GM1 A;  5L0I A;  1EA8 A;  3RIP A;  1A7E A;  1QZX A;  4MTO A;  1J8Y F;  2OKU A;  3PMR A;  4JTA B;  2YLG A;  2GDC A;  4QI0 A;  3VF0 A;  5E3C A;  1FR0 A;  2HMZ A;  3EH1 A;  3ZSU A;  2MWQ A;  1UFB A;  1D1A A;  2X51 A;  3NRH A;  2P61 A;  4KC9 A;  4CS9 C;  5L0F A;  5JSL A;  2MYS A;  3MLG A;  3F46 A;  4F4B A;  2A0U A;  3Q6N A;  1U0B B;  1QLE C;  2GFH A;  3TJ6 A;  2R7T A;  3EFO B;  3JZ0 A;  3RFY A;  4J32 B;  5T1D B;  1L7C A;  3CAX A;  3GEI A;  3FAJ A;  5KYY A;  2A69 F;  2R7X A;  1OKK A;  1VB5 A;  2L81 A;  4XLP F;  3OA1 A;  1RXQ A;  2IXM A;  4EUK B;  4R32 A;  2A0B A;  3QVY A;  2IM8 A;  5L0G A;  3O10 A;  3UMI A;  1G5Z A;  1Q0K A;  2KYH A;  3HTK C;  5F28 E;  3X2Q C;  3TUL A;  2YQY A;  4MS2 A;  3RVY A;  3SXK A;  1SMY F;  1Z3I X;  3UGO A;  3UMK A;  3B0V C;  4DRH B;  3IHU A;  3VM6 A;  5DLJ A;  4AE4 B;  4B6I A;  5DQT A;  1OW7 A;  4Q5S F;  2ZPA A;  1U6H A;  3JT1 A;  3RYL A;  4DBQ A;  3PCV A;  4CIH A;  2BC5 A;  4GQH A;  2I8B A;  2P6V A;  1ORS C;  2YZS A;  1YLM A;  5L3V A;  3JYH A;  1LI7 A;  5JVE A;  5CI9 A;  4PFO A;  1F1M A;  1OCZ C;  1G8X A;  1C03 A;  5E3A A;  1NU7 D;  1BR4 A;  1M57 C;  2DYS C;  1E2X A;  2WVN A;  1M2V B;  2YL3 A;  1TWG A;  5FZT A;  5TJ5 E;  5AC5 A;  3ECS A;  3ASN C;  3EJN A;  2Q9A A;  4JCZ A;  4NY3 A;  4P6I C;  2H7O A;  4MW3 A;  3TOM A;  4YT8 A;  2VCB A;  4G7H F;  2DGJ A;  3AGU A;  4CDV A;  2DYR C;  1WAS A;  3EQL F;  2DI3 A;  2KJG A;  1NFN A;  2Q9B A;  3E70 C;  3HLZ A;  3Q7L A;  2J46 A;  1I4Y A;  2C04 A;  4JTD B;  4LAC B;  3BRJ A;  4P9F A;  2IXO A;  3FHD A;  4EKW A;  1M2V A;  1ZU5 A;  2LD6 A;  1WOL A;  1C17 M;  4GEH A;  4BG0 A;  2YVK A;  5KYU B;  3KMI A;  1VK5 A;  1CGO A;  2A6E F;  1NBB A;  4FX5 A;  4IJJ A;  5KYN A;  1R5I D;  2ZD9 A;  4XLN F;  1LE2 A;  1JOG A;  2Q4F A;  3Q7G A;  4H4K C;  4ZLD A;  1OXK A;  2WZL A;  3U9M A;  3ABM C;  2L6G A;  4MVQ A;  3I5Q A;  3SNH A;  4YWQ A;  3IQC A;  3V5Y A;  4AX2 A;  4MQ9 F;  5A6B D;  2WVQ A;  1BZ4 A;  1YA9 A;  2Y69 C;  3M79 A;  4Q7C A;  1HW1 A;  4FAP B;  2A1D D;  4O79 A;  3AJM A;  2BE5 F;  5KYX B;  3DKA A;  2NPU A;  3EZH A;  3IQ6 A;  5L0H A;  3JRT A;  1HMO A;  3AG4 C;  2GWW A;  3M4B A;  3S29 A;  3WG7 C;  3RF3 A;  2JPU A;  1JRA A;  3LNR A;  3TQO A;  4NTB A;  1Z5Z A;  1I4Z A;  3WOD F;  3S27 A;  4FWV A;  4O7G A;  3IEE A;  4C3E A;  4CSA C;  4G78 A;  2XLD A;  4DVZ A;  2F22 A;  4N6C A;  2KC3 A;  4M63 A;  1AVO B;  2OCC C;  4MVM A;  4O6N A;  4E17 A;  5JRA A;  1H7I A;  2XL8 A;  3JSZ A;  1ZHX A;  4U5G A;  2BL2 A;  4I1O B;  2OEX A;  5A6B A;  3SP1 A;  1OR2 A;  256B A;  2HV6 A;  5T3W A;  2Y3H A;  3N2Z B;  5JP7 A;  2KQ9 A;  3DE8 A;  4OIN F;  1OXB A;  2D4U A;  2M4E A;  3DAF A;  3JYY A;  4JW1 A;  4YT4 A;  3N0T A;  2HJM A;  4U5H A;  1NZE A;  1NFO A;  2NUT B;  2Y3G A;  2CDQ A;  1HMD A;  4YL0 A;  1FNT c;  3ABK C;  3B29 A;  1UG7 A;  3LJB A;  3H2V A;  1FFH A;  1MMD A;  1WTY A;  2HSB A;  2EPL X;  1MND A;  4HFF B;  1MQV A;  4AK9 A;  2GA0 A;  1FFT C;  1GQA A;  2KSF A;  3FVY A;  3KH2 A;  2W9Y A;  3DAG A;  2NUP B;  3C18 A;  3L34 A;  4XWJ A;  3T9O A;  4DOZ A;  4U5E E;  3B71 A;  3K33 A;  2NUT A;  2H8A A;  1LS4 A;  2A6H F;  1OQC A;  1CPR A;  2DB4 A;  1IZM A;  1YZA A;  2XSE A;  3U0C A;  4JIO A;  4KBL A;  2WZG A;  1V55 C;  4A4A A;  2HFI A;  3G50 A;  4U5D E;  1OW8 A;  2HV7 A;  1AUE A;  1M56 C;  1WN0 A;  1YAR O;  4YL1 A;  3NG1 A;  3T6G B;  1TWH A;  2YL1 A;  2QUP A;  1DOW A;  4XTK A;  3B9Q A;  5DQZ A;  1T6U A;  4WGY A;  1JPN A;  3K6B A;  4CDY A;  5COF A;  3LEV A;  3B0P A;  3U3B A;  4CSA A;  3EHN A;  1TQG A;  2J8W A;  3F47 A;  4OIR F;  1R4T A;  5EGY A;  5EK0 A;  3U2L A;  1D0X A;  1K04 A;  4IAQ A;  2X0C A;  3J06 A;  2EPN A;  4U9D A;  5KYY B;  4J7T A;  3IQT A;  2VH3 A;  4JEB A;  2OEV A;  3HNL A;  2CGE A;  2UUI A;  1TKN A;  2OU6 A;  2VAS A;  2LCH A;  2HKV A;  3JCU Q;  2EPM X;  2FFH A;  3FOO A;  3KL4 A;  4XEF A;  3O55 A;  1EQ1 A;  1JR8 A;  2G3V A;  4CS8 A;  1ZW2 A;  2XRH A;  5A6J A;  4XEV A;  2WL8 A;  1A0B A;  1RJ9 A;  3DZA A;  1ZZP A;  2LIG A;  2J0W A;  4G7O F;  3OWT A;  2NSG A;  4JJF A;  3E9V A;  3RVZ A;  1CPQ A;  2Q9C A;  3QTH A;  3TD7 A;  3V5Z A;  1YJG A;  4JTC B;  5B3I A;  4PJJ A;  1YVI A;  1I5N A;  3TJ5 A;  3EH2 A;  4J7Y A;  1V54 C;  1K05 A;  1VLT A;  5DS6 A;  2QY9 A;  1N1C A;  3NKD A;  3AGT A;  1ZHZ A;  3NDB B;  2IBF A;  4OD4 A;  1SYQ A;  4NCQ A;  1M2O A;  3S84 A; 
#chains in the Genus database with same CATH homology
 3ZQV A;  1LM3 B;  2XLE A;  3L1M A;  1YZC A;  5JLI A;  3VRC A;  3M79 A;  4U9E A;  4CIP A;  3NMJ A;  3IQ6 A;  4JE9 A;  3M4B A;  3ZWI A;  3QW1 A;  2XLO A;  2XLD A;  3TOL A;  3HNK A;  1A7V A;  3IQ5 A;  5JRA A;  1QPU A;  4N4W A;  2XL8 A;  1RCP A;  3HNJ A;  256B A;  1E86 A;  4L6R A;  2XL6 A;  2J9B A;  5JP7 A;  3DE8 A;  4IAR A;  2XM0 A;  2CCY A;  5AGF A;  2XM4 A;  4CJO A;  1QQ3 A;  4N6H A;  2XLH A;  1EKY A;  1S05 A;  1MQV A;  4JKV A;  1GQA A;  1M6T A;  2YL7 A;  1E84 A;  4WGZ A;  3NMI A;  2YLG A;  1CPR A;  1YZA A;  5JS5 A;  3M4C A;  2YL0 A;  3C63 A;  2YLI A;  4D4N A;  5JSL A;  4EIY A;  3ZTM A;  2QLA A;  1CGN A;  3QVZ A;  1APC A;  2YL1 A;  4ER9 A;  3HNI A;  5JT4 A;  5JUA A;  4WGY A;  3QVY A;  4CDY A;  1YYX A;  2YKZ A;  2XLM A;  3ZQY A;  2J8W A;  3DE9 A;  4D4X A;  2XLV A;  4JEA A;  4IAQ A;  4U9D A;  2BC5 A;  4JEB A;  3HNL A;  3M15 A;  4ULV A;  3FOO A;  4IB4 A;  5JVE A;  1E85 A;  4NC3 A;  1YYJ A;  2YL3 A;  1E83 A;  3TOM A;  3QW0 A;  3FOP A;  1CPQ A;  4CDV A;  2XLW A;  2YLD A;  1BBH A;  5B3I A;  4CDA A;  3ZTZ A;  4CX9 A;  3U8P A;  1CGO A;  1NBB A;  3C62 A;  4CJG A;  3NMK A;  1JAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...