2XL6A

Cytochrome c prime from alcaligenes xylosoxidans: ferrous r124a variant with bound no
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C'
publication title Distal-to-Proximal No Conversion in Hemoproteins: The Role of the Proximal Pocket.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
total genus 52
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2010-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2xl6A00
2J8WA 3C62A 4WGYA 2XLVA 5JRAA 3NMIA 3C63A 4JEBA 3HNLA 5JSLA 2XLEA 3ZWIA 1YYJA 5JT4A 5JS5A 2YLIA 2YL7A 2XL8A 4D4NA 3NMJA 3M15A 2YL0A 5B3IA 1CGOA 4L6RA 1CPRA 3IQ6A 3DE9A 1M6TA 1JAFA 2XL6A 4N4WA 1S05A 4ER9A 2XM0A 3ZTMA 4CDVA 1RCPA 1YZCA 3HNIA 3M4CA 4JE9A 2J9BA 3TOLA 1E86A 1YZAA 2XLWA 1LM3B 2YKZA 3TOMA 3DE8A 4JKVA 2YL3A 2XLMA 1MQVA 2XLHA 1QPUA 1A7VA 1E83A 1BBHA 5AGFA 3FOPA 3M4BA 5JP7A 1NBBA 2CCYA 2YLDA 3FOOA 4CDYA 5JLIA 1E85A 5JUAA 3IQ5A 3HNKA 4IARA 4CJGA 4CIPA 256BA 4JEAA 4U9DA 3M79A 4CJOA 3ZQVA 3VRCA 3U8PA 4D4XA 3ZQYA 3NMKA 3QVZA 4WGZA 1CPQA 2XLOA 1GQAA 1E84A 4IAQA 4EIYA 2XLDA 1EKYA 1APCA 4NC3A 1QQ3A 4CX9A 4CDAA 2BC5A 3ZTZA 1CGNA 2QLAA 3QW1A 3HNJA 2YLGA 4IB4A 4N6HA 2YL1A 5JVEA 3QW0A 1YYXA 4U9EA 4ULVA 2XM4A 3L1MA 3QVYA
chains in the Genus database with same CATH superfamily
1V54C 1OR3A 2LIGA 3GWNA 3H65A 3RIPA 3V5ZA 4EBJA 2IOQA 2MYSA 3AJMA 3LEOA 3SYNA 3NYMA 1JMWA 3RW0A 2I15A 4MW3A 2HS5A 4J7TA 4W8KA 2TMVP 2X51A 1HE9A 1YA7O 3WG7C 1OCOC 3JSZA 4P6IC 1U6HA 3S0XA 1G8XA 3K1HA 3KPHA 1ST6A 4AL1A 2ZXPA 1GS9A 1ZU5A 3ECSA 4JVSA 3U3FA 1RKCA 1VOMA 1PV3A 3ZWIA 1T5OA 2Y69C 1RKEA 3GM3A 4P9TA 1SZIA 5JS5A 2YLIA 1VYKA 3T6JA 3H2UA 3U9MA 4AL0A 4ANJA 4DVZA 2XL8A 4D4NA 3NMJA 1TFKB 2EPLX 3M15A 3ATPA 4I1OB 4MTFA 3T6BA 3EFOB 1VYIA 1WATA 2EPMX 2F22A 5GPGB 1CPRA 1Z23A 3ZDLA 4RDAA 2WL8A 1VK5A 2Q3TA 2DGJA 2WB7A 2XL6A 4Z9JA 2AU5A 5BQIA 4ZLDA 4YT4A 1S05A 3FVYA 4ER9A 1RJ9B 1B68A 2CGEA 2XM0A 4A4AA 1ZZPA 3C8ZA 4JZAA 2B0JA 1T6QA 3AGTA 3ZC4A 2OCCC 3RFYA 3RVZA 3W4YA 2Y3BA 1A7EA 3EHMA 1MNEA 4A2NB 1D1AA 4PJJA 4C3BA 1MMAA 2WZFA 3TOLA 1MNDA 4EWCA 4N06A 4JCZA 1EI7A 3L8JA 3C8GB 4ONSA 4Q7CA 2Y3DA 4MVMA 1FAPB 1S7ZA 2OU6A 4LLCA 3ASNC 3UNGC 4JIOA 2VH3A 2W4MA 4FAPB 1VTMP 1Y4CA 2OQMA 4BJ5C 4FX5A 3S27A 1BBHA 2YZSA 3FAPB 1VB5A 4PR9A 4BJ6A 4YK5A 3U8VA 5KYXA 2Q00A 4P9FA 1LS4A 2XL4A 5AGFA 2J9UA 3AG4C 5JP7A 1NG1A 1OXKA 1FFHA 2JD3A 4B6IA 4YN0B 1VLTA 2HKVA 2IM8A 2OJQA 1MMNA 1NZEA 4K0DA 3GEHA 1M57C 3I4UA 2KNHA 3EZIA 3T4RA 256BA 1ZVZA 2LSEA 4PJNA 4EKWA 3LLIA 3GEIA 1JPNA 4MVOA 4PFOA 1OR2A 2D5RB 4O6MA 4NY3A 1NFNA 3ZQVA 1AUEA 2NSGA 2GAQA 2BL2A 4IGGA 3N2ZB 2A0BA 4WGZA 1V4AA 4GQHA 5L3VA 3FAJA 2NUPB 1E84A 4IAQA 1TR2A 4BJTA 2G62A 5E3CA 3F47A 3KYIA 1Q0DA 3S90A 2HMZA 2PFDA 3B29A 4E0HA 3S29A 1K40A 2GA0A 3S9OA 5KYWB 4PJLA 2P1AA 3QW1A 3W2WA 2AWYA 3U9JA 2CNWA 2VCAA 4UDVA 2R02A 4WABA 1LE2A 3MLGA 3NYLA 1WN0A 3JRMO 2OJED 4XWJA 3O39A 4PJMA 2YL1A 3ZVRA 4EBKA 5F5FA 3M1CB 3OA1A 3TULA 5L0CA 3O55A 1OW8A 4J7YA 5JVEA 2HSQA 3DXJF 4XTKA 4CS9A 3RVYA 1NLXA 1YDIA 4EHPA 2EILC 3LJBA 4CSAA 3EQLF 1OKKD 2PX3A 1RXQA 4DRIB 4PACA 3EPVA 2EINC 2KJGA 5FCLA 3B0VC 2PX0A 4I3MA 2XLVA 3B0PA 3CEXA 3NMIA 4DBRA 3DD7A 5AC5A 1OCZC 3LUTB 4MVRA 2L6FA 2J0WA 1ZU4A 1MMGA 2E87A 3PDMP 4G7HF 4JEBA 1JOGA 3IQCA 1DOWA 1TFOB 1I5NA 5JSLA 5KYYB 2J46A 2R7XA 3EGDB 1KU2A 2XLEA 3C8GD 2R05A 2P7VA 2WZGA 4YT2A 4MVSA 4CS8A 5HSWA 3Q7LA 1QLEC 3NRHA 3G4XA 3T9OA 4O79A 1HY5A 2YEVA 1Z6AA 2PP4A 3CZ6A 5L0IA 2ASRA 2YL0A 4KNVA 2A69F 3AQCA 1T01A 3EH1A 3CQZA 2Q9BA 4L6RA 1M6TA 2V26A 4OD4A 2MWQA 2KK1A 4MVUA 3TD7A 3U0CA 2C03A 3DKAA 3VAYA 1M56C 2J0XA 2KW3C 2HV7A 4IWBA 1PD0A 4HE8D 3ZTMA 1AVOB 2P6VA 3UR3C 2AP3A 1DOVA 2A6EF 2EPNA 3DM9B 4CDVA 3AQBA 1NFOA 1TWCA 5A6KA 3B9QA 3I5PA 3C7JA 4XPYA 3HLZA 3M4CA 2ZPAA 2FAPB 3IPMO 2XXAA 3NDBB 1SMYF 3LS1A 4U5BE 3S28A 1FTSA 2ZXOA 4OIRF 1I4ZA 1RKEB 2LK4A 3NYJA 2GDCA 2QTVA 4BEMJ 4BPMA 4OIOF 2XLWA 1LM3B 3LLKA 1A7DA 2W45A 3KL4A 2P61A 3TOMA 3SZRA 5A69A 3U2LA 2P0NA 2J7PA 2XLMA 3LS0A 5B3SC 3W8IA 2CDQA 4JC7A 5DLJA 1E2XA 4NTAA 1O5HA 2QUPA 4OINF 1GM5A 4U5HA 4U5CE 1YJGA 2EIJC 3L0IA 4BJ1A 3MBGA 4HFKB 3WAQA 4DVYP 1LE4A 2R7VA 3HTKC 1H9GA 2PF4E 2CNWD 1Q0FA 3ASOC 1BDJB 3WHNA 3G4ZA 4U5EE 1U89A 2VCBA 2CCYA 3UMIA 2CYDA 2VB6A 3JYYA 3NG1A 1I4YA 3FOOA 3IEEA 2Y39A 4MTGA 3UMKA 4XPXA 2JX0A 3LEVA 1VLSA 2WVNA 4W8PA 1EA8A 1JRAA 3K7DA 4I1MA 4JEAA 4U9DA 1H6GA 5KYUA 3O6XA 3Q6NA 3ZSUA 2AVKA 5CIVA 1G4WR 1VMAA 5E33A 1EQ1A 3GANA 3ZQYA 1YARO 3E9VA 3UGOA 4JW1A 2LD6A 3EG9A 2J9VA 3PHF2 2R7TA 2L6HA 5BQGA 4EIYA 3DAGA 1TWAA 3K1IA 4CS9C 2MHRA 3OWTA 2VASA 4NC3A 1QSPA 2HJ3A 5FZTA 3JCUQ 3JYHA 2V3CC 4QI2A 1L3PA 4CDAA 4PK4A 1XZQA 5TJ5E 4U5DE 3RYLA 4KNWA 5B1AC 3TQOA 4C3DA 4N6HA 1Z5ZA 5K0IA 5F28E 4RD9A 1ZHWA 3AG3C 5L0HA 3TJ5A 3R2PA 5IY5C 2Q4FA 4F4BA 3GM1A 3SXYA 4MVZA 1YYXA 1SYQA 4H4KC 4Z9HA 1R4TA 1CGME 1YVIA 1L7CA 4WJ0A 4BEJA 1ORJA 2XM4A 1UG7A 5T3TA 4C3EA 4JJFA 2B0HA 3QVYA 4I44A 2J9WA 4JCHA 3VF0A 4KI2A 2IYLD 3C62A 4WGYA 4PFPA 3UMHA 5JRAA 4Q4ZF 1JPJA 3US6A 3JSEO 3KH2A 3C63A 2OEVA 1PD1A 1Q0KA 2QNLA 4U5GA 5COMA 3RKOF 5DQZA 1ZW2A 3I5QA 2KYHA 1J8YF 2IXMA 3K33A 5T1DB 3HJCA 4XLPF 4OIPF 3HNLA 4QDLA 4X0RA 5L0FA 2J7PD 3AOUA 1HW1A 1ZHTA 4FWVA 5HV9A 2WVOA 1YYJA 1OCRC 2JPUA 5JT4A 2RD9A 3JT1A 3JZ0A 2YL7A 4E17A 1JR8A 1SF8A 4K1OA 4E18A 1F1MA 4ZLCA 1CGOA 1HE1A 2HMQA 2VC9A 3DE9A 1JAFA 3T6GB 2EIKC 2L6GA 2LP4A 2R25A 5DS5A 2LFFA 3NKDA 3FXHA 4N4WA 3LNMB 5F5HA 2R7RA 1H9TA 3AG2C 2KSFA 3SNHA 5A6BA 3N24A 3SXKA 1YZCA 1D1BA 3RQEA 2NUTA 2YRFA 4CBEA 1PCXA 3WODF 3S84A 4YL1A 1OW6A 2L7AA 4XEVA 5DS6A 5DS4A 3A11A 1LI5A 1BR2A 2G3VA 4XQ1A 2Q9CA 3N0TA 1R5ID 4DBQA 1D0YA 2LCHA 1BR1A 1MMDA 3L8IA 4C7OB 2YVKA 1M2VA 3W2VA 4FESA 5T3WA 3MX3A 2YHSA 1ZYRF 1C17M 2NPUA 2IXNA 3V7OA 3FDQA 2XLHA 1MQVA 3MYFA 4JTDB 3MFNA 5B1BC 4GEHA 4G0HA 1D0ZA 1A7VA 4IAOA 4O6NA 2R03A 4DJ9A 1E83A 2W4BA 2CW0F 5E2QA 2A6HF 2GWWA 4E7ZA 1C03A 1NU9C 2XRHA 4EUKB 2NG1A 4MW8A 3SXZA 4DXWA 3BEHA 3GODA 4R32A 1T6IA 4BJ6C 4YT8A 2XXAB 1A41A 1QVXA 2DI3A 2YLDA 3SEOA 4CDYA 3E70C 3RF3A 1Z3IX 3K1IC 3PMRA 1RMVA 3ABKC 2ICWG 2ZXWC 3DMDA 1H7IA 4CJGA 4CIPA 3JRTA 4KBLA 3BRJA 2A0UA 1K04A 1FFTC 2EPOA 2Q9AA 1ORYA 3H2VA 1K05A 3M79A 2AWCA 1LVKA 4CJOA 4Q5SF 1WTYA 4XEKA 1XWJA 2DB4A 1QKRA 1WOLA 1LKXA 2A1DD 1UFBA 3EH2A 5BQHA 4HEAJ 3OEOA 2DYSC 4YT5A 3EGXA 1LIHA 3ZIBA 4XLNF 1O87A 2IBFA 1YAUO 4AE4A 1W2WA 4MS2A 4BG0A 2XLDA 1EKYA 2XS1A 3MYIA 1APCA 1OQCA 3C18A 2VCCA 1HW2A 1QQ3A 4IJJA 2FGYA 4CX9A 4K7BA 4JTCB 3POVA 3B0UX 2ETSA 4LACB 1A0BA 2BC5A 4QI0A 1CGNA 2H7VC 2R7UA 1KNYA 5KYUB 4IB4A 1NSGB 2L81A 2ZD9A 2C04A 1TQGA 4RBNA 1TWHA 1TKNA 2QY9A 1FMWA 3K6BA 2FFHA 2R7QA 3KKBA 4U5FE 3GM2A 4NTFA 4YJWA 3SP1A 3L34A 2HSBA 4MTOA 4O6YA 3QW0A 3EZHA 3IHUA 5A6BD 2R7WA 2HFIA 3EG9B 4U9EA 1TWGA 5COFA 1AEPA 1HMDA 5KYXB 2G3KA 3EFOA 3Q6MA 4GYTA 4J30B 2X0CA 3KMIA 2UUHA 1ORSC 4CIHA 2Y3GA 4N6CA 2J8WA 5AC4A 1OW7A 2UUIA 2RSEB 4J32B 4DOZA 1OKKA 1RJ9A 2OOCA 3DI5A 4MVQA 1LS1A 3LESA 2M4EA 4CSAC 1BR4A 1ZHZA 1T6UA 4JRZA 2HZ8A 1KTMA 2L9JA 3HKKA 4XPWA 2H8AA 3CAXA 1FNTc 1WASA 4AX2A 2YQYA 3JTLO 4MNDA 4YL0A 1YA9A 3IQTA 3QZCA 5E3AA 4Z9IA 4G7ZF 2R9RB 4EBBA 3EHNA 3VYWA 1U0BB 2DYRC 2IXOA 3C8GA 5B3IA 4YL3A 2H7BA 5A6AA 5L3QA 3DJNB 1J8MF 3G50A 3IQ6A 3GORA 4JTAB 4CS8C 2ZXRA 4OIQF 1T9KA 3F46A 5L0GA 2NSFA 2O9XA 3ABLC 4LDKA 5L0DA 2PNOA 5D91A 3DM5A 4IRUA 3GWLA 1RCPA 3V5XA 3LNRA 3EJNA 1Z7Qc 1QZXA 3AG1C 3HNIA 4HFFB 4LLEA 4JE9A 4M63A 1D1CA 2J9BA 2GFHA 1E86A 1O3UA 3RH3A 2J45A 3O10A 2Y3HA 1YZAA 4LDQA 3FHDA 2H7OA 1G4US 2YKZA 3A9CA 3J06A 2W9YA 1NU7D 1V55C 2HJMA 1GGQA 3DE8A 3FMSA 4JKVA 2YL3A 3RQFA 5EGYA 5KYNA 1Y6DA 2D4UA 4DRHB 1QPUA 5CI8A 4ULWA 4DRJB 2XS8A 3ITFA 5EHHA 3UGPA 4H54A 3V5YA 3ZG1A 4CS7A 2LQGA 1G5ZA 2IXPA 3DWWA 1C02A 1FR0A 5COGA 3KYJA 3FOPA 2NUTB 3M4BA 2NUPA 1WGWA 2HUJA 2KC3A 3QTHA 1NBBA 1IW7F 1Q0MA 4JJGA 3U5SA 2A68F 5JLIA 2WZLA 4G7OF 3CSKA 1E85A 5JUAA 3IQ5A 1Z63A 1M2VB 3HNKA 4IARA 5KYWA 2EPKX 2Z15A 4XEFA 4BJ5A 3B71A 4KC9A 5A6JA 1ZHXA 5BUOA 2QE9A 2OG2A 2OKUA 3AGUA 3VM6A 3PCVA 1M2OA 3TJ6A 3VRCA 1FMVA 2Q7RA 2WVQA 3U8PA 3DZAA 3QMKA 4D4XA 3NMKA 1ZHYA 3R7CA 3QVZA 3DAFA 2HV6A 1CPQA 2PBEA 2XLOA 4JURI 4MQ9F 3X2QC 1GQAA 5D92A 5DVWA 3SXMA 1N1CA 1WWPA 2KGOA 2XSEA 3GEEA 3RQGA 2KQ9A 4NTBA 1LI7A 3X1OA 4E0IA 4NQFA 5EK0A 1LPEA 2BE5F 4E7SA 1V74B 4O7GA 3W8HA 3TK0A 2EIMC 4LDRA 4LERA 3ZTZA 5L0JA 2QLAA 1OXBA 2YWAA 1HMOA 2R7SA 3HNJA 3Q7GA 2LFDA 5CI9A 2YLGA 1SR2A 2R7OA 4NCQA 2I8BA 3LAYA 2OEXA 5KYYA 1OCCC 1D0XA 3DJUB 3EGDA 3U2MA 4C7OA 3K66A 1BZ4A 1YLMA 5DQTA 3ABMC 4AK9A 2M64A 4YWQA 3U3BA 3EGXB 1XZPA 3NKEA 4ULVA 4G78A 1ZW3A 1IZMA 4AE4B 4OD5A 1Q0GA 3L1MA
chains in the Genus database with same CATH topology
2J8WA 3C62A 4WGYA 2XLVA 5JRAA 3NMIA 3C63A 4JEBA 3HNLA 5JSLA 2XLEA 3ZWIA 1YYJA 5JT4A 5JS5A 2YLIA 2YL7A 2XL8A 4D4NA 3NMJA 3M15A 2YL0A 5B3IA 1CGOA 4L6RA 1CPRA 3IQ6A 3DE9A 1M6TA 1JAFA 2XL6A 4N4WA 1S05A 4ER9A 2XM0A 3ZTMA 4CDVA 1RCPA 1YZCA 3HNIA 3M4CA 4JE9A 2J9BA 3TOLA 1E86A 1YZAA 2XLWA 1LM3B 2YKZA 3TOMA 3DE8A 4JKVA 2YL3A 2XLMA 1MQVA 2XLHA 1QPUA 1A7VA 1E83A 1BBHA 5AGFA 3FOPA 3M4BA 5JP7A 1NBBA 2CCYA 2YLDA 3FOOA 4CDYA 5JLIA 1E85A 5JUAA 3IQ5A 3HNKA 4IARA 4CJGA 4CIPA 256BA 4JEAA 4U9DA 3M79A 4CJOA 3ZQVA 3VRCA 3U8PA 4D4XA 3ZQYA 3NMKA 3QVZA 4WGZA 1CPQA 2XLOA 1GQAA 1E84A 4IAQA 4EIYA 2XLDA 1EKYA 1APCA 4NC3A 1QQ3A 4CX9A 4CDAA 2BC5A 3ZTZA 1CGNA 2QLAA 3QW1A 3HNJA 2YLGA 4IB4A 4N6HA 2YL1A 5JVEA 3QW0A 1YYXA 4U9EA 4ULVA 2XM4A 3L1MA 3QVYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J8W A;  3C62 A;  4WGY A;  2XLV A;  5JRA A;  3NMI A;  3C63 A;  4JEB A;  3HNL A;  5JSL A;  2XLE A;  3ZWI A;  1YYJ A;  5JT4 A;  5JS5 A;  2YLI A;  2YL7 A;  2XL8 A;  4D4N A;  3NMJ A;  3M15 A;  2YL0 A;  5B3I A;  1CGO A;  4L6R A;  1CPR A;  3IQ6 A;  3DE9 A;  1M6T A;  1JAF A;  2XL6 A;  4N4W A;  1S05 A;  4ER9 A;  2XM0 A;  3ZTM A;  4CDV A;  1RCP A;  1YZC A;  3HNI A;  3M4C A;  4JE9 A;  2J9B A;  3TOL A;  1E86 A;  1YZA A;  2XLW A;  1LM3 B;  2YKZ A;  3TOM A;  3DE8 A;  4JKV A;  2YL3 A;  2XLM A;  1MQV A;  2XLH A;  1QPU A;  1A7V A;  1E83 A;  1BBH A;  5AGF A;  3FOP A;  3M4B A;  5JP7 A;  1NBB A;  2CCY A;  2YLD A;  3FOO A;  4CDY A;  5JLI A;  1E85 A;  5JUA A;  3IQ5 A;  3HNK A;  4IAR A;  4CJG A;  4CIP A;  256B A;  4JEA A;  4U9D A;  3M79 A;  4CJO A;  3ZQV A;  3VRC A;  3U8P A;  4D4X A;  3ZQY A;  3NMK A;  3QVZ A;  4WGZ A;  1CPQ A;  2XLO A;  1GQA A;  1E84 A;  4IAQ A;  4EIY A;  2XLD A;  1EKY A;  1APC A;  4NC3 A;  1QQ3 A;  4CX9 A;  4CDA A;  2BC5 A;  3ZTZ A;  1CGN A;  2QLA A;  3QW1 A;  3HNJ A;  2YLG A;  4IB4 A;  4N6H A;  2YL1 A;  5JVE A;  3QW0 A;  1YYX A;  4U9E A;  4ULV A;  2XM4 A;  3L1M A;  3QVY A; 
#chains in the Genus database with same CATH topology
 1V54 C;  1OR3 A;  2LIG A;  3GWN A;  3H65 A;  3RIP A;  3V5Z A;  4EBJ A;  2IOQ A;  2MYS A;  3AJM A;  3LEO A;  3SYN A;  3NYM A;  1JMW A;  3RW0 A;  2I15 A;  4MW3 A;  2HS5 A;  4J7T A;  4W8K A;  2TMV P;  2X51 A;  1HE9 A;  1YA7 O;  3WG7 C;  1OCO C;  3JSZ A;  4P6I C;  1U6H A;  3S0X A;  1G8X A;  3K1H A;  3KPH A;  1ST6 A;  4AL1 A;  2ZXP A;  1GS9 A;  1ZU5 A;  3ECS A;  4JVS A;  3U3F A;  1RKC A;  1VOM A;  1PV3 A;  3ZWI A;  1T5O A;  2Y69 C;  1RKE A;  3GM3 A;  4P9T A;  1SZI A;  5JS5 A;  2YLI A;  1VYK A;  3T6J A;  3H2U A;  3U9M A;  4AL0 A;  4ANJ A;  4DVZ A;  2XL8 A;  4D4N A;  3NMJ A;  1TFK B;  2EPL X;  3M15 A;  3ATP A;  4I1O B;  4MTF A;  3T6B A;  3EFO B;  1VYI A;  1WAT A;  2EPM X;  2F22 A;  5GPG B;  1CPR A;  1Z23 A;  3ZDL A;  4RDA A;  2WL8 A;  1VK5 A;  2Q3T A;  2DGJ A;  2WB7 A;  2XL6 A;  4Z9J A;  2AU5 A;  5BQI A;  4ZLD A;  4YT4 A;  1S05 A;  3FVY A;  4ER9 A;  1RJ9 B;  1B68 A;  2CGE A;  2XM0 A;  4A4A A;  1ZZP A;  3C8Z A;  4JZA A;  2B0J A;  1T6Q A;  3AGT A;  3ZC4 A;  2OCC C;  3RFY A;  3RVZ A;  3W4Y A;  2Y3B A;  1A7E A;  3EHM A;  1MNE A;  4A2N B;  1D1A A;  4PJJ A;  4C3B A;  1MMA A;  2WZF A;  3TOL A;  1MND A;  4EWC A;  4N06 A;  4JCZ A;  1EI7 A;  3L8J A;  3C8G B;  4ONS A;  4Q7C A;  2Y3D A;  4MVM A;  1FAP B;  1S7Z A;  2OU6 A;  4LLC A;  3ASN C;  3UNG C;  4JIO A;  2VH3 A;  2W4M A;  4FAP B;  1VTM P;  1Y4C A;  2OQM A;  4BJ5 C;  4FX5 A;  3S27 A;  1BBH A;  2YZS A;  3FAP B;  1VB5 A;  4PR9 A;  4BJ6 A;  4YK5 A;  3U8V A;  5KYX A;  2Q00 A;  4P9F A;  1LS4 A;  2XL4 A;  5AGF A;  2J9U A;  3AG4 C;  5JP7 A;  1NG1 A;  1OXK A;  1FFH A;  2JD3 A;  4B6I A;  4YN0 B;  1VLT A;  2HKV A;  2IM8 A;  2OJQ A;  1MMN A;  1NZE A;  4K0D A;  3GEH A;  1M57 C;  3I4U A;  2KNH A;  3EZI A;  3T4R A;  256B A;  1ZVZ A;  2LSE A;  4PJN A;  4EKW A;  3LLI A;  3GEI A;  1JPN A;  4MVO A;  4PFO A;  1OR2 A;  2D5R B;  4O6M A;  4NY3 A;  1NFN A;  3ZQV A;  1AUE A;  2NSG A;  2GAQ A;  2BL2 A;  4IGG A;  3N2Z B;  2A0B A;  4WGZ A;  1V4A A;  4GQH A;  5L3V A;  3FAJ A;  2NUP B;  1E84 A;  4IAQ A;  1TR2 A;  4BJT A;  2G62 A;  5E3C A;  3F47 A;  3KYI A;  1Q0D A;  3S90 A;  2HMZ A;  2PFD A;  3B29 A;  4E0H A;  3S29 A;  1K40 A;  2GA0 A;  3S9O A;  5KYW B;  4PJL A;  2P1A A;  3QW1 A;  3W2W A;  2AWY A;  3U9J A;  2CNW A;  2VCA A;  4UDV A;  2R02 A;  4WAB A;  1LE2 A;  3MLG A;  3NYL A;  1WN0 A;  3JRM O;  2OJE D;  4XWJ A;  3O39 A;  4PJM A;  2YL1 A;  3ZVR A;  4EBK A;  5F5F A;  3M1C B;  3OA1 A;  3TUL A;  5L0C A;  3O55 A;  1OW8 A;  4J7Y A;  5JVE A;  2HSQ A;  3DXJ F;  4XTK A;  4CS9 A;  3RVY A;  1NLX A;  1YDI A;  4EHP A;  2EIL C;  3LJB A;  4CSA A;  3EQL F;  1OKK D;  2PX3 A;  1RXQ A;  4DRI B;  4PAC A;  3EPV A;  2EIN C;  2KJG A;  5FCL A;  3B0V C;  2PX0 A;  4I3M A;  2XLV A;  3B0P A;  3CEX A;  3NMI A;  4DBR A;  3DD7 A;  5AC5 A;  1OCZ C;  3LUT B;  4MVR A;  2L6F A;  2J0W A;  1ZU4 A;  1MMG A;  2E87 A;  3PDM P;  4G7H F;  4JEB A;  1JOG A;  3IQC A;  1DOW A;  1TFO B;  1I5N A;  5JSL A;  5KYY B;  2J46 A;  2R7X A;  3EGD B;  1KU2 A;  2XLE A;  3C8G D;  2R05 A;  2P7V A;  2WZG A;  4YT2 A;  4MVS A;  4CS8 A;  5HSW A;  3Q7L A;  1QLE C;  3NRH A;  3G4X A;  3T9O A;  4O79 A;  1HY5 A;  2YEV A;  1Z6A A;  2PP4 A;  3CZ6 A;  5L0I A;  2ASR A;  2YL0 A;  4KNV A;  2A69 F;  3AQC A;  1T01 A;  3EH1 A;  3CQZ A;  2Q9B A;  4L6R A;  1M6T A;  2V26 A;  4OD4 A;  2MWQ A;  2KK1 A;  4MVU A;  3TD7 A;  3U0C A;  2C03 A;  3DKA A;  3VAY A;  1M56 C;  2J0X A;  2KW3 C;  2HV7 A;  4IWB A;  1PD0 A;  4HE8 D;  3ZTM A;  1AVO B;  2P6V A;  3UR3 C;  2AP3 A;  1DOV A;  2A6E F;  2EPN A;  3DM9 B;  4CDV A;  3AQB A;  1NFO A;  1TWC A;  5A6K A;  3B9Q A;  3I5P A;  3C7J A;  4XPY A;  3HLZ A;  3M4C A;  2ZPA A;  2FAP B;  3IPM O;  2XXA A;  3NDB B;  1SMY F;  3LS1 A;  4U5B E;  3S28 A;  1FTS A;  2ZXO A;  4OIR F;  1I4Z A;  1RKE B;  2LK4 A;  3NYJ A;  2GDC A;  2QTV A;  4BEM J;  4BPM A;  4OIO F;  2XLW A;  1LM3 B;  3LLK A;  1A7D A;  2W45 A;  3KL4 A;  2P61 A;  3TOM A;  3SZR A;  5A69 A;  3U2L A;  2P0N A;  2J7P A;  2XLM A;  3LS0 A;  5B3S C;  3W8I A;  2CDQ A;  4JC7 A;  5DLJ A;  1E2X A;  4NTA A;  1O5H A;  2QUP A;  4OIN F;  1GM5 A;  4U5H A;  4U5C E;  1YJG A;  2EIJ C;  3L0I A;  4BJ1 A;  3MBG A;  4HFK B;  3WAQ A;  4DVY P;  1LE4 A;  2R7V A;  3HTK C;  1H9G A;  2PF4 E;  2CNW D;  1Q0F A;  3ASO C;  1BDJ B;  3WHN A;  3G4Z A;  4U5E E;  1U89 A;  2VCB A;  2CCY A;  3UMI A;  2CYD A;  2VB6 A;  3JYY A;  3NG1 A;  1I4Y A;  3FOO A;  3IEE A;  2Y39 A;  4MTG A;  3UMK A;  4XPX A;  2JX0 A;  3LEV A;  1VLS A;  2WVN A;  4W8P A;  1EA8 A;  1JRA A;  3K7D A;  4I1M A;  4JEA A;  4U9D A;  1H6G A;  5KYU A;  3O6X A;  3Q6N A;  3ZSU A;  2AVK A;  5CIV A;  1G4W R;  1VMA A;  5E33 A;  1EQ1 A;  3GAN A;  3ZQY A;  1YAR O;  3E9V A;  3UGO A;  4JW1 A;  2LD6 A;  3EG9 A;  2J9V A;  3PHF 2;  2R7T A;  2L6H A;  5BQG A;  4EIY A;  3DAG A;  1TWA A;  3K1I A;  4CS9 C;  2MHR A;  3OWT A;  2VAS A;  4NC3 A;  1QSP A;  2HJ3 A;  5FZT A;  3JCU Q;  3JYH A;  2V3C C;  4QI2 A;  1L3P A;  4CDA A;  4PK4 A;  1XZQ A;  5TJ5 E;  4U5D E;  3RYL A;  4KNW A;  5B1A C;  3TQO A;  4C3D A;  4N6H A;  1Z5Z A;  5K0I A;  5F28 E;  4RD9 A;  1ZHW A;  3AG3 C;  5L0H A;  3TJ5 A;  3R2P A;  5IY5 C;  2Q4F A;  4F4B A;  3GM1 A;  3SXY A;  4MVZ A;  1YYX A;  1SYQ A;  4H4K C;  4Z9H A;  1R4T A;  1CGM E;  1YVI A;  1L7C A;  4WJ0 A;  4BEJ A;  1ORJ A;  2XM4 A;  1UG7 A;  5T3T A;  4C3E A;  4JJF A;  2B0H A;  3QVY A;  4I44 A;  2J9W A;  4JCH A;  3VF0 A;  4KI2 A;  2IYL D;  3C62 A;  4WGY A;  4PFP A;  3UMH A;  5JRA A;  4Q4Z F;  1JPJ A;  3US6 A;  3JSE O;  3KH2 A;  3C63 A;  2OEV A;  1PD1 A;  1Q0K A;  2QNL A;  4U5G A;  5COM A;  3RKO F;  5DQZ A;  1ZW2 A;  3I5Q A;  2KYH A;  1J8Y F;  2IXM A;  3K33 A;  5T1D B;  3HJC A;  4XLP F;  4OIP F;  3HNL A;  4QDL A;  4X0R A;  5L0F A;  2J7P D;  3AOU A;  1HW1 A;  1ZHT A;  4FWV A;  5HV9 A;  2WVO A;  1YYJ A;  1OCR C;  2JPU A;  5JT4 A;  2RD9 A;  3JT1 A;  3JZ0 A;  2YL7 A;  4E17 A;  1JR8 A;  1SF8 A;  4K1O A;  4E18 A;  1F1M A;  4ZLC A;  1CGO A;  1HE1 A;  2HMQ A;  2VC9 A;  3DE9 A;  1JAF A;  3T6G B;  2EIK C;  2L6G A;  2LP4 A;  2R25 A;  5DS5 A;  2LFF A;  3NKD A;  3FXH A;  4N4W A;  3LNM B;  5F5H A;  2R7R A;  1H9T A;  3AG2 C;  2KSF A;  3SNH A;  5A6B A;  3N24 A;  3SXK A;  1YZC A;  1D1B A;  3RQE A;  2NUT A;  2YRF A;  4CBE A;  1PCX A;  3WOD F;  3S84 A;  4YL1 A;  1OW6 A;  2L7A A;  4XEV A;  5DS6 A;  5DS4 A;  3A11 A;  1LI5 A;  1BR2 A;  2G3V A;  4XQ1 A;  2Q9C A;  3N0T A;  1R5I D;  4DBQ A;  1D0Y A;  2LCH A;  1BR1 A;  1MMD A;  3L8I A;  4C7O B;  2YVK A;  1M2V A;  3W2V A;  4FES A;  5T3W A;  3MX3 A;  2YHS A;  1ZYR F;  1C17 M;  2NPU A;  2IXN A;  3V7O A;  3FDQ A;  2XLH A;  1MQV A;  3MYF A;  4JTD B;  3MFN A;  5B1B C;  4GEH A;  4G0H A;  1D0Z A;  1A7V A;  4IAO A;  4O6N A;  2R03 A;  4DJ9 A;  1E83 A;  2W4B A;  2CW0 F;  5E2Q A;  2A6H F;  2GWW A;  4E7Z A;  1C03 A;  1NU9 C;  2XRH A;  4EUK B;  2NG1 A;  4MW8 A;  3SXZ A;  4DXW A;  3BEH A;  3GOD A;  4R32 A;  1T6I A;  4BJ6 C;  4YT8 A;  2XXA B;  1A41 A;  1QVX A;  2DI3 A;  2YLD A;  3SEO A;  4CDY A;  3E70 C;  3RF3 A;  1Z3I X;  3K1I C;  3PMR A;  1RMV A;  3ABK C;  2ICW G;  2ZXW C;  3DMD A;  1H7I A;  4CJG A;  4CIP A;  3JRT A;  4KBL A;  3BRJ A;  2A0U A;  1K04 A;  1FFT C;  2EPO A;  2Q9A A;  1ORY A;  3H2V A;  1K05 A;  3M79 A;  2AWC A;  1LVK A;  4CJO A;  4Q5S F;  1WTY A;  4XEK A;  1XWJ A;  2DB4 A;  1QKR A;  1WOL A;  1LKX A;  2A1D D;  1UFB A;  3EH2 A;  5BQH A;  4HEA J;  3OEO A;  2DYS C;  4YT5 A;  3EGX A;  1LIH A;  3ZIB A;  4XLN F;  1O87 A;  2IBF A;  1YAU O;  4AE4 A;  1W2W A;  4MS2 A;  4BG0 A;  2XLD A;  1EKY A;  2XS1 A;  3MYI A;  1APC A;  1OQC A;  3C18 A;  2VCC A;  1HW2 A;  1QQ3 A;  4IJJ A;  2FGY A;  4CX9 A;  4K7B A;  4JTC B;  3POV A;  3B0U X;  2ETS A;  4LAC B;  1A0B A;  2BC5 A;  4QI0 A;  1CGN A;  2H7V C;  2R7U A;  1KNY A;  5KYU B;  4IB4 A;  1NSG B;  2L81 A;  2ZD9 A;  2C04 A;  1TQG A;  4RBN A;  1TWH A;  1TKN A;  2QY9 A;  1FMW A;  3K6B A;  2FFH A;  2R7Q A;  3KKB A;  4U5F E;  3GM2 A;  4NTF A;  4YJW A;  3SP1 A;  3L34 A;  2HSB A;  4MTO A;  4O6Y A;  3QW0 A;  3EZH A;  3IHU A;  5A6B D;  2R7W A;  2HFI A;  3EG9 B;  4U9E A;  1TWG A;  5COF A;  1AEP A;  1HMD A;  5KYX B;  2G3K A;  3EFO A;  3Q6M A;  4GYT A;  4J30 B;  2X0C A;  3KMI A;  2UUH A;  1ORS C;  4CIH A;  2Y3G A;  4N6C A;  2J8W A;  5AC4 A;  1OW7 A;  2UUI A;  2RSE B;  4J32 B;  4DOZ A;  1OKK A;  1RJ9 A;  2OOC A;  3DI5 A;  4MVQ A;  1LS1 A;  3LES A;  2M4E A;  4CSA C;  1BR4 A;  1ZHZ A;  1T6U A;  4JRZ A;  2HZ8 A;  1KTM A;  2L9J A;  3HKK A;  4XPW A;  2H8A A;  3CAX A;  1FNT c;  1WAS A;  4AX2 A;  2YQY A;  3JTL O;  4MND A;  4YL0 A;  1YA9 A;  3IQT A;  3QZC A;  5E3A A;  4Z9I A;  4G7Z F;  2R9R B;  4EBB A;  3EHN A;  3VYW A;  1U0B B;  2DYR C;  2IXO A;  3C8G A;  5B3I A;  4YL3 A;  2H7B A;  5A6A A;  5L3Q A;  3DJN B;  1J8M F;  3G50 A;  3IQ6 A;  3GOR A;  4JTA B;  4CS8 C;  2ZXR A;  4OIQ F;  1T9K A;  3F46 A;  5L0G A;  2NSF A;  2O9X A;  3ABL C;  4LDK A;  5L0D A;  2PNO A;  5D91 A;  3DM5 A;  4IRU A;  3GWL A;  1RCP A;  3V5X A;  3LNR A;  3EJN A;  1Z7Q c;  1QZX A;  3AG1 C;  3HNI A;  4HFF B;  4LLE A;  4JE9 A;  4M63 A;  1D1C A;  2J9B A;  2GFH A;  1E86 A;  1O3U A;  3RH3 A;  2J45 A;  3O10 A;  2Y3H A;  1YZA A;  4LDQ A;  3FHD A;  2H7O A;  1G4U S;  2YKZ A;  3A9C A;  3J06 A;  2W9Y A;  1NU7 D;  1V55 C;  2HJM A;  1GGQ A;  3DE8 A;  3FMS A;  4JKV A;  2YL3 A;  3RQF A;  5EGY A;  5KYN A;  1Y6D A;  2D4U A;  4DRH B;  1QPU A;  5CI8 A;  4ULW A;  4DRJ B;  2XS8 A;  3ITF A;  5EHH A;  3UGP A;  4H54 A;  3V5Y A;  3ZG1 A;  4CS7 A;  2LQG A;  1G5Z A;  2IXP A;  3DWW A;  1C02 A;  1FR0 A;  5COG A;  3KYJ A;  3FOP A;  2NUT B;  3M4B A;  2NUP A;  1WGW A;  2HUJ A;  2KC3 A;  3QTH A;  1NBB A;  1IW7 F;  1Q0M A;  4JJG A;  3U5S A;  2A68 F;  5JLI A;  2WZL A;  4G7O F;  3CSK A;  1E85 A;  5JUA A;  3IQ5 A;  1Z63 A;  1M2V B;  3HNK A;  4IAR A;  5KYW A;  2EPK X;  2Z15 A;  4XEF A;  4BJ5 A;  3B71 A;  4KC9 A;  5A6J A;  1ZHX A;  5BUO A;  2QE9 A;  2OG2 A;  2OKU A;  3AGU A;  3VM6 A;  3PCV A;  1M2O A;  3TJ6 A;  3VRC A;  1FMV A;  2Q7R A;  2WVQ A;  3U8P A;  3DZA A;  3QMK A;  4D4X A;  3NMK A;  1ZHY A;  3R7C A;  3QVZ A;  3DAF A;  2HV6 A;  1CPQ A;  2PBE A;  2XLO A;  4JUR I;  4MQ9 F;  3X2Q C;  1GQA A;  5D92 A;  5DVW A;  3SXM A;  1N1C A;  1WWP A;  2KGO A;  2XSE A;  3GEE A;  3RQG A;  2KQ9 A;  4NTB A;  1LI7 A;  3X1O A;  4E0I A;  4NQF A;  5EK0 A;  1LPE A;  2BE5 F;  4E7S A;  1V74 B;  4O7G A;  3W8H A;  3TK0 A;  2EIM C;  4LDR A;  4LER A;  3ZTZ A;  5L0J A;  2QLA A;  1OXB A;  2YWA A;  1HMO A;  2R7S A;  3HNJ A;  3Q7G A;  2LFD A;  5CI9 A;  2YLG A;  1SR2 A;  2R7O A;  4NCQ A;  2I8B A;  3LAY A;  2OEX A;  5KYY A;  1OCC C;  1D0X A;  3DJU B;  3EGD A;  3U2M A;  4C7O A;  3K66 A;  1BZ4 A;  1YLM A;  5DQT A;  3ABM C;  4AK9 A;  2M64 A;  4YWQ A;  3U3B A;  3EGX B;  1XZP A;  3NKE A;  4ULV A;  4G78 A;  1ZW3 A;  1IZM A;  4AE4 B;  4OD5 A;  1Q0G A;  3L1M A; 
#chains in the Genus database with same CATH homology
 2J8W A;  3C62 A;  4WGY A;  2XLV A;  5JRA A;  3NMI A;  3C63 A;  4JEB A;  3HNL A;  5JSL A;  2XLE A;  3ZWI A;  1YYJ A;  5JT4 A;  5JS5 A;  2YLI A;  2YL7 A;  2XL8 A;  4D4N A;  3NMJ A;  3M15 A;  2YL0 A;  5B3I A;  1CGO A;  4L6R A;  1CPR A;  3IQ6 A;  3DE9 A;  1M6T A;  1JAF A;  2XL6 A;  4N4W A;  1S05 A;  4ER9 A;  2XM0 A;  3ZTM A;  4CDV A;  1RCP A;  1YZC A;  3HNI A;  3M4C A;  4JE9 A;  2J9B A;  3TOL A;  1E86 A;  1YZA A;  2XLW A;  1LM3 B;  2YKZ A;  3TOM A;  3DE8 A;  4JKV A;  2YL3 A;  2XLM A;  1MQV A;  2XLH A;  1QPU A;  1A7V A;  1E83 A;  1BBH A;  5AGF A;  3FOP A;  3M4B A;  5JP7 A;  1NBB A;  2CCY A;  2YLD A;  3FOO A;  4CDY A;  5JLI A;  1E85 A;  5JUA A;  3IQ5 A;  3HNK A;  4IAR A;  4CJG A;  4CIP A;  256B A;  4JEA A;  4U9D A;  3M79 A;  4CJO A;  3ZQV A;  3VRC A;  3U8P A;  4D4X A;  3ZQY A;  3NMK A;  3QVZ A;  4WGZ A;  1CPQ A;  2XLO A;  1GQA A;  1E84 A;  4IAQ A;  4EIY A;  2XLD A;  1EKY A;  1APC A;  4NC3 A;  1QQ3 A;  4CX9 A;  4CDA A;  2BC5 A;  3ZTZ A;  1CGN A;  2QLA A;  3QW1 A;  3HNJ A;  2YLG A;  4IB4 A;  4N6H A;  2YL1 A;  5JVE A;  3QW0 A;  1YYX A;  4U9E A;  4ULV A;  2XM4 A;  3L1M A;  3QVY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...