2XL6A

Cytochrome c prime from alcaligenes xylosoxidans: ferrous r124a variant with bound no
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
126
structure length
126
Chain Sequence
EFAKPEDAVKYRQSALTLMASHFGRMTPVVKGQAPYDAAQIKANVEVLKTLSALPWAAFGPGTEGGDARPEIWSDAASFKQKQQAFQDNIVKLSAAADAGDLDKLRAAFGDVGASCKACHDAYAKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distal-to-Proximal No Conversion in Hemoproteins: The Role of the Proximal Pocket.
pubmed doi rcsb
source organism Achromobacter xylosoxidans
molecule tags Electron transport
molecule keywords CYTOCHROME C'
total genus 52
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2010-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01322 Cytochrom_C_2 Cytochrome C'
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 2xl6A00
3QW0A 3FOOA 1CPQA 2XL8A 2J9BA 3IQ5A 1CGNA 2XM0A 2XLMA 4EIYA 2QLAA 1CPRA 1JAFA 4CIPA 4L6RA 3HNIA 4CJOA 2XLWA 3DE9A 1YZAA 1CGOA 2BC5A 4D4XA 1M6TA 5JRAA 3ZTMA 3NMJA 5B3IA 2XLDA 4N4WA 3ZQVA 4WGYA 1A7VA 3HNLA 1E86A 1APCA 2YKZA 3DE8A 2XM4A 1EKYA 2YLDA 1BBHA 4WGZA 3NMIA 1YYJA 3VRCA 3ZWIA 3C62A 5JP7A 1LM3B 2YLGA 4CDVA 1E83A 4IAQA 4ER9A 4JE9A 1YZCA 1E84A 4CDAA 2YLIA 3C63A 4IARA 4CDYA 3U8PA 5JLIA 4CX9A 5JS5A 2YL1A 3QVZA 3TOMA 4JEAA 1E85A 4U9EA 5JSLA 3M4BA 2XLHA 2XL6A 4JKVA 3ZTZA 3HNJA 2XLVA 256BA 3TOLA 5JT4A 1NBBA 1GQAA 2J8WA 1RCPA 2XLEA 2YL0A 4NC3A 4D4NA 3HNKA 5JUAA 3M4CA 4CJGA 4N6HA 1S05A 3FOPA 4U9DA 3QVYA 4IB4A 5AGFA 1QPUA 3NMKA 2CCYA 2YL3A 3ZQYA 3IQ6A 5JVEA 2XLOA 1MQVA 4ULVA 4JEBA 3M15A 2YL7A 3L1MA 3M79A 1QQ3A 1YYXA 3QW1A
chains in the Genus database with same CATH superfamily
2VCCA 1Z5ZA 1FFHA 3L8IA 4JVSA 2CNWD 3TD7A 2LK4A 2UUIA 3FMSA 1LPEA 3JRTA 2J0XA 2NUPB 2CYDA 1H9TA 3PDMP 5L0GA 1BDJB 4RDAA 4BJ1A 2XM0A 2R7QA 1M56C 1O5HA 1U0BB 3U3BA 4XLPF 1ZHZA 3AJMA 1SR2A 3LNRA 4C7OB 3B0VC 4BJ5C 1A7EA 3ABLC 2HJMA 1ORYA 2KW3C 2MHRA 1FNTc 3SXMA 4NY3A 1QSPA 4EHPA 1NSGB 1OCCC 1SF8A 2R03A 2VH3A 2YQYA 4AL0A 3H2UA 4DBRA 5KYXA 2KK1A 1VYKA 1MNEA 3X2QC 2KQ9A 5T1DB 2J0WA 2HSBA 3GORA 2R7OA 3Q7GA 3KYJA 1OR2A 2XLDA 2HV7A 3JYYA 3ZDLA 3ZQVA 3L0IA 3GM2A 3OEOA 1BR4A 4BJ6A 2WB7A 3RQGA 2P6VA 4IWBA 3LNMB 5L0HA 4I3MA 4YL3A 4XPYA 1E86A 3CAXA 2M64A 5KYNA 4EBKA 2XXAB 5EK0A 2XM4A 3O10A 4PFOA 2R7WA 1I4YA 2VC9A 1EKYA 1ZHYA 2R7SA 4MVMA 1ORJA 4KC9A 3T9OA 5K0IA 2AU5A 2EINC 5COGA 3NDBB 2Q9CA 2R7RA 4Q7CA 3S28A 1GM5A 1U89A 2D5RB 4KI2A 2EIMC 4WGZA 3EJNA 4HE8D 3HLZA 3LEOA 1PD0A 2WVOA 4M63A 4MTOA 1D0ZA 2E87A 2OEVA 4HEAJ 4U5FE 1MMAA 2OQMA 3FAPB 3FHDA 1BR2A 1R4TA 1LKXA 2GWWA 4I1MA 2Q3TA 1SMYF 5A6KA 1T6QA 1YVIA 1YLMA 2H7BA 1CGME 2Q9BA 2L6HA 1E84A 3U9JA 2G3VA 4BG0A 1H9GA 1FMWA 3RKOF 3RYLA 3UNGC 2YLIA 4O79A 4OD4A 5EGYA 5JLIA 5A6AA 1D0XA 3BEHA 3DXJF 3K6BA 4JCZA 4YL1A 4AX2A 2TMVP 3R2PA 4X0RA 1EA8A 3AQBA 4XPWA 3E9VA 3H65A 3HKKA 3MYFA 2GFHA 1WN0A 5BQGA 3MYIA 4R32A 4YK5A 2XL6A 3AQCA 3QTHA 3IQTA 2P7VA 3HNJA 3V7OA 1M2VB 1OCZC 4UDVA 5E2QA 2FGYA 5JT4A 4XPXA 1RCPA 2ZXOA 3DM9B 3JSZA 2XLEA 4LACB 4XEVA 3T6BA 3US6A 3ZVRA 1RKCA 4NC3A 3C8GA 4H54A 4Z9JA 4DRIB 4EBBA 3E70C 5DS6A 4PACA 5JUAA 2ZXWC 1OKKA 3AOUA 5KYUB 2GDCA 3N24A 3GWNA 4N6HA 2B0JA 2DB4A 2I8BA 2W4MA 1VYIA 2J9UA 1NG1A 2GAQA 3B0PA 2UUHA 4I1OB 1LS4A 1PV3A 4IB4A 4NTAA 5AGFA 1MMDA 3UR3C 2YRFA 4E7SA 3CZ6A 4I44A 1RJ9A 2A1DD 4FAPB 2YWAA 1ZHWA 3PCVA 1JPNA 2YL3A 3H2VA 3IQ6A 4JCHA 3ZQYA 4E17A 4LDKA 2XLOA 2PP4A 1Z23A 2XSEA 3AG2C 3IEEA 4HFFB 4KNVA 3S27A 3SXYA 1VOMA 5L0FA 3L1MA 2IXPA 2PX0A 3M79A 4C3DA 1QQ3A 1T6UA 4OIRF 3AG4C 3JRMO 3QZCA 3ECSA 4J7YA 1FFTC 1HE1A 4ULWA 3QW0A 5COFA 4MVSA 4K1OA 3W2VA 2J9WA 4A2NB 3EG9B 1Q0KA 1A41A 4QDLA 4BJTA 5A6BD 2HKVA 2A6EF 1QLEC 4W8KA 2ZD9A 2I15A 4MW3A 1WATA 2RD9A 3GM1A 3C8ZA 2QLAA 4FX5A 2B0HA 2R25A 2VASA 3U2LA 2FFHA 2PX3A 4O7GA 5T3WA 2Q4FA 3U5SA 1WTYA 3SXKA 4CJOA 1T6IA 2L6GA 2LP4A 1HY5A 3NYJA 4MTGA 2DYSC 4P9FA 4PK4A 2BC5A 2QNLA 1WWPA 4LLEA 2IXNA 1G4US 4FESA 5B1AC 1Q0GA 3S29A 3ZTMA 2EPKX 3ASOC 4G78A 4XWJA 5B3IA 5F5FA 1I4ZA 3LEVA 2HSQA 2R7XA 5FZTA 5AC4A 2C04A 4YT8A 1AVOB 3MLGA 4WGYA 4J32B 3U2MA 3DM5A 3TJ5A 4CBEA 2OJED 1Y6DA 2Y3GA 3HNLA 5CIVA 1A0BA 2DYRC 1APCA 1MMNA 2A0BA 2L7AA 4H4KC 4NQFA 2VCAA 1OCRC 1YA7O 1KNYA 1FMVA 4ZLCA 3ITFA 4CS9A 3K66A 3JZ0A 2VCBA 1NU9C 2OU6A 2EPNA 1K05A 1LIHA 3LESA 2HMQA 4U5DE 4YN0B 2MWQA 5KYWA 2YVKA 2J45A 3EG9A 1R5ID 3GM3A 5GPGB 3T6GB 1ZYRF 5DQTA 1TWHA 3VF0A 1OCOC 2DI3A 2HFIA 4Q5SF 3CQZA 2PF4E 4BEMJ 3C62A 3SEOA 4IJJA 4K0DA 5JP7A 3C7JA 4YL0A 5F5HA 2Q9AA 1JRAA 2IM8A 4IGGA 4JC7A 2KNHA 4IAQA 4ER9A 4JE9A 4U5CE 4YT2A 4U5BE 4O6NA 5TJ5E 4JJFA 1M57C 3C63A 4IARA 2A68F 3SXZA 3U3FA 1GS9A 4C3EA 4IRUA 2FAPB 3QVZA 2IOQA 2L6FA 4NCQA 2Y3DA 5L3QA 4JEAA 2WVQA 3F47A 3JYHA 4OIQF 3KH2A 1E85A 4U9EA 1JOGA 5JSLA 4MVUA 3EFOA 3LAYA 3O6XA 1S7ZA 1KU2A 3CEXA 4K7BA 5F28E 3NYLA 2A0UA 1DOVA 4G7OF 2AVKA 4N06A 3TULA 1NFOA 3Q6MA 1L7CA 2HJ3A 1ZU4A 2A6HF 3K1IA 2R9RB 4XEKA 2YL0A 1TWCA 3LLIA 5EHHA 2AWCA 3RH3A 3ABMC 5IY5C 2NUTB 1YJGA 1Y4CA 1M2OA 5DQZA 4AL1A 2W45A 3K1IC 4CJGA 4DRHB 1S05A 2XRHA 4AE4A 4A4AA 5FCLA 2CNWA 4U5HA 2WL8A 1QZXA 3R7CA 4DBQA 1Z63A 1OQCA 3PHF2 3DKAA 1QPUA 3NMKA 4MQ9F 2KC3A 2CCYA 3Q6NA 1NLXA 4JZAA 3W8HA 3EQLF 2P1AA 1VTMP 5JVEA 2WVNA 1T5OA 2XXAA 1LI7A 3M15A 4JEBA 1V74B 3DJNB 5D91A 4JRZA 5KYYA 1OW7A 1ST6A 4YT5A 3VAYA 1Q0DA 2HUJA 4CSAC 1LE2A 4NTFA 2OOCA 3WG7C 4YT4A 4ANJA 3LS0A 1HE9A 1TFOB 1HW2A 4MW8A 3TK0A 3QMKA 1OXKA 2H7OA 3GEIA 4MVRA 1N1CA 1CPQA 2EILC 4CSAA 3GWLA 1XWJA 2J9BA 1XZQA 1Z6AA 3JCUQ 5A69A 4JTDB 1CGNA 2J9VA 3OWTA 2OEXA 2XLMA 1LVKA 2EPOA 2WZGA 4JURI 4EIYA 1G4WR 3N2ZB 1CPRA 1L3PA 2YEVA 4GYTA 1TR2A 4CIPA 4L6RA 1YARO 3SZRA 3U9MA 1UFBA 2XLWA 2G62A 3LJBA 4OINF 1CGOA 3U8VA 4D4XA 3MBGA 1M6TA 1YA9A 5JRAA 1H7IA 2NUPA 4JTCB 4JTAB 3ZSUA 4XTKA 2M4EA 1VK5A 4Z9IA 1SYQA 1GGQA 1H6GA 2D4UA 3NMJA 1RMVA 3GEEA 1AUEA 2LFDA 1BR1A 2QY9A 4N4WA 3RVZA 3SP1A 1E2XA 2ZXPA 4Q4ZF 3T4RA 2F22A 2HS5A 3UMHA 4CS8A 2VB6A 5B1BC 3KMIA 4CS7A 1C02A 5HSWA 5CI9A 1I5NA 2W4BA 3WAQA 4MS2A 2AP3A 1WASA 2YKZA 3DE8A 3EHMA 5T3TA 2J46A 4RBNA 4Z9HA 4DXWA 5KYWB 3K1HA 4YJWA 5E33A 3JT1A 2LFFA 1B68A 3B71A 3WHNA 3WODF 3UGPA 1PD1A 2OJQA 2EPLX 1ZU5A 4J7TA 2HZ8A 1BBHA 1J8MF 1LE4A 1RKEA 2DGJA 2PBEA 3EFOB 4DRJB 2BE5F 2R02A 2PFDA 3NMIA 5L3VA 3DMDA 2CW0F 3KKBA 3OA1A 2LCHA 1LM3B 1ZW2A 2ZXRA 4J30B 2IBFA 4DVZA 3J06A 3V5YA 3M1CB 3K33A 4OD5A 1JPJA 2P0NA 3EGDB 3B9QA 3RF3A 1YZCA 1G5ZA 4CS8C 1MMGA 1W2WA 1O87A 2Z15A 3KPHA 4GEHA 4PJNA 2R7UA 4B6IA 2L81A 4CDYA 3ZG1A 5COMA 4CX9A 3C8GD 3NYMA 2YL1A 3F46A 3GEHA 3L34A 1J8YF 1T9KA 1OXBA 4MVQA 3DWWA 3JSEO 1JR8A 3I5PA 1ZHTA 4P9TA 2XLHA 5DVWA 5DLJA 4RD9A 2LIGA 2IYLD 3POVA 4PR9A 2Q7RA 3W2WA 3TQOA 3ZTZA 4DVYP 2QUPA 2NG1A 3EGDA 4G0HA 3UMIA 4DJ9A 3DAGA 3NRHA 4C7OA 1FR0A 256BA 2NSFA 3Q7LA 5D92A 3TOLA 2ASRA 3ATPA 1NBBA 2PNOA 4CIHA 2EPMX 4F4BA 2J8WA 1TQGA 3EZHA 3LS1A 4ZLDA 3W4YA 3ZC4A 3EPVA 3I5QA 1EQ1A 3IQCA 3EZIA 4D4NA 3BRJA 4G7ZF 3X1OA 4XEFA 4YWQA 5BQIA 1F1MA 2RSEB 4P6IC 1YAUO 1A7DA 4KBLA 5AC5A 2OG2A 5L0JA 4N6CA 1IZMA 3M4CA 1FAPB 5E3CA 3C18A 1TFKB 1TWAA 2WZFA 3FOPA 1Q0MA 3EH2A 3O39A 3RIPA 3G4ZA 3QVYA 4LDQA 3G4XA 3IHUA 5E3AA 4E18A 4MVOA 2YHSA 4BEJA 1RXQA 2A69F 3AGTA 4U5GA 2Y3HA 3V5XA 1VMAA 1RJ9B 4JJGA 3O55A 4ULVA 2ETSA 3FVYA 4ONSA 3S0XA 3KL4A 4EBJA 3DD7A 1IW7F 3I4UA 4G7HF 1ZHXA 4WJ0A 1YYXA 1D1AA 1ZW3A 3RFYA 3QW1A 1Z3IX 4OIOF 1V55C 3S90A 1OW8A 1NFNA 1Z7Qc 1TKNA 2H8AA 4E0IA 4JW1A 1WGWA 2QTVA 3RW0A 2ICWG 3EGXA 2EIKC 1OW6A 2LD6A 2XL8A 3FOOA 4GQHA 3A11A 1LI5A 3IQ5A 1OR3A 3FXHA 3JTLO 4WABA 2JX0A 1BZ4A 2R05A 1NZEA 1HW1A 3AG1C 4PJJA 2QE9A 2G3KA 5L0DA 1JAFA 3B29A 3HNIA 4EKWA 5HV9A 3VYWA 3K7DA 3DE9A 2P61A 4O6MA 2BL2A 1YZAA 4PJLA 4O6YA 2H7VC 1MNDA 2OKUA 3ABKC 1V54C 1K40A 1RKEB 3GANA 1KTMA 3HJCA 4DOZA 2IXOA 1SZIA 2V26A 5A6BA 3TJ6A 1VLSA 1C03A 1JMWA 1ZVZA 2CGEA 2NSGA 3ASNC 3DZAA 3KYIA 4W8PA 2HMZA 4E7ZA 3FDQA 1D0YA 1HMDA 4PJMA 1A7VA 3G50A 4AK9A 1DOWA 1TWGA 1G8XA 1YDIA 2J7PA 2OCCC 3DAFA 3SYNA 1V4AA 3VM6A 5KYYB 1UG7A 5L0CA 2EIJC 3AGUA 3DJUB 4EUKB 2YLDA 3MX3A 3LUTB 4PFPA 2KYHA 3EH1A 4AE4B 3B0UX 1HMOA 1O3UA 1YYJA 2C03A 2JD3A 2CDQA 4JIOA 3VRCA 3ZWIA 4BPMA 3EHNA 2YLGA 4BJ6C 4CDVA 1WOLA 1E83A 2W9YA 1VLTA 2L9JA 3N0TA 1QKRA 2J7PD 2GA0A 2XS8A 1VB5A 3CSKA 2WZLA 1ORSC 3C8GB 4MNDA 3A9CA 4CDAA 4MTFA 5KYUA 1LS1A 4C3BA 4NTBA 3U8PA 4EWCA 2O9XA 3MFNA 5JS5A 3TOMA 3PMRA 5KYXB 5BQHA 2LQGA 4OIPF 2YZSA 3M4BA 3DI5A 3NG1A 3W8IA 2R7VA 4XLNF 3UGOA 5DS5A 4HFKB 4JKVA 1K04A 1XZPA 4QI0A 2XS1A 3V5ZA 4E0HA 2XLVA 5L0IA 1ZZPA 1D1BA 3HTKC 1T01A 1GQAA 4IAOA 1PCXA 3NKDA 1Q0FA 1QVXA 1FTSA 2IXMA 4U5EE 2Y39A 4XQ1A 3RVYA 3SNHA 2X51A 2KJGA 3NKEA 2NPUA 3S9OA 2KGOA 2LSEA 2V3CC 4QI2A 2Y3BA 2AWYA 3HNKA 2JPUA 1C17M 2NUTA 2HV6A 4LERA 3EGXB 4LDRA 1AEPA 1EI7A 3L8JA 3GODA 3AG3C 1NU7D 4U9DA 2Q00A 2XL4A 5DS4A 5BUOA 2Y69C 4MVZA 1OKKD 4FWVA 3FAJA 3T6JA 4BJ5A 1U6HA 4LLCA 2R7TA 2ZPAA 2X0CA 3RQFA 1M2VA 1MQVA 3S84A 2YL7A 3LLKA 3U0CA 5CI8A 3IPMO 2MYSA 3RQEA 4CS9C 5A6JA 3UMKA 4KNWA 5B3SC 2KSFA 3ZIBA 1D1CA
chains in the Genus database with same CATH topology
3QW0A 3FOOA 1CPQA 2XL8A 2J9BA 3IQ5A 1CGNA 2XM0A 2XLMA 4EIYA 2QLAA 1CPRA 1JAFA 4CIPA 4L6RA 3HNIA 4CJOA 2XLWA 3DE9A 1YZAA 1CGOA 2BC5A 4D4XA 1M6TA 5JRAA 3ZTMA 3NMJA 5B3IA 2XLDA 4N4WA 3ZQVA 4WGYA 1A7VA 3HNLA 1E86A 1APCA 2YKZA 3DE8A 2XM4A 1EKYA 2YLDA 1BBHA 4WGZA 3NMIA 1YYJA 3VRCA 3ZWIA 3C62A 5JP7A 1LM3B 2YLGA 4CDVA 1E83A 4IAQA 4ER9A 4JE9A 1YZCA 1E84A 4CDAA 2YLIA 3C63A 4IARA 4CDYA 3U8PA 5JLIA 4CX9A 5JS5A 2YL1A 3QVZA 3TOMA 4JEAA 1E85A 4U9EA 5JSLA 3M4BA 2XLHA 2XL6A 4JKVA 3ZTZA 3HNJA 2XLVA 256BA 3TOLA 5JT4A 1NBBA 1GQAA 2J8WA 1RCPA 2XLEA 2YL0A 4NC3A 4D4NA 3HNKA 5JUAA 3M4CA 4CJGA 4N6HA 1S05A 3FOPA 4U9DA 3QVYA 4IB4A 5AGFA 1QPUA 3NMKA 2CCYA 2YL3A 3ZQYA 3IQ6A 5JVEA 2XLOA 1MQVA 4ULVA 4JEBA 3M15A 2YL7A 3L1MA 3M79A 1QQ3A 1YYXA 3QW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QW0 A;  3FOO A;  1CPQ A;  2XL8 A;  2J9B A;  3IQ5 A;  1CGN A;  2XM0 A;  2XLM A;  4EIY A;  2QLA A;  1CPR A;  1JAF A;  4CIP A;  4L6R A;  3HNI A;  4CJO A;  2XLW A;  3DE9 A;  1YZA A;  1CGO A;  2BC5 A;  4D4X A;  1M6T A;  5JRA A;  3ZTM A;  3NMJ A;  5B3I A;  2XLD A;  4N4W A;  3ZQV A;  4WGY A;  1A7V A;  3HNL A;  1E86 A;  1APC A;  2YKZ A;  3DE8 A;  2XM4 A;  1EKY A;  2YLD A;  1BBH A;  4WGZ A;  3NMI A;  1YYJ A;  3VRC A;  3ZWI A;  3C62 A;  5JP7 A;  1LM3 B;  2YLG A;  4CDV A;  1E83 A;  4IAQ A;  4ER9 A;  4JE9 A;  1YZC A;  1E84 A;  4CDA A;  2YLI A;  3C63 A;  4IAR A;  4CDY A;  3U8P A;  5JLI A;  4CX9 A;  5JS5 A;  2YL1 A;  3QVZ A;  3TOM A;  4JEA A;  1E85 A;  4U9E A;  5JSL A;  3M4B A;  2XLH A;  2XL6 A;  4JKV A;  3ZTZ A;  3HNJ A;  2XLV A;  256B A;  3TOL A;  5JT4 A;  1NBB A;  1GQA A;  2J8W A;  1RCP A;  2XLE A;  2YL0 A;  4NC3 A;  4D4N A;  3HNK A;  5JUA A;  3M4C A;  4CJG A;  4N6H A;  1S05 A;  3FOP A;  4U9D A;  3QVY A;  4IB4 A;  5AGF A;  1QPU A;  3NMK A;  2CCY A;  2YL3 A;  3ZQY A;  3IQ6 A;  5JVE A;  2XLO A;  1MQV A;  4ULV A;  4JEB A;  3M15 A;  2YL7 A;  3L1M A;  3M79 A;  1QQ3 A;  1YYX A;  3QW1 A; 
#chains in the Genus database with same CATH topology
 2VCC A;  1Z5Z A;  1FFH A;  3L8I A;  4JVS A;  2CNW D;  3TD7 A;  2LK4 A;  2UUI A;  3FMS A;  1LPE A;  3JRT A;  2J0X A;  2NUP B;  2CYD A;  1H9T A;  3PDM P;  5L0G A;  1BDJ B;  4RDA A;  4BJ1 A;  2XM0 A;  2R7Q A;  1M56 C;  1O5H A;  1U0B B;  3U3B A;  4XLP F;  1ZHZ A;  3AJM A;  1SR2 A;  3LNR A;  4C7O B;  3B0V C;  4BJ5 C;  1A7E A;  3ABL C;  2HJM A;  1ORY A;  2KW3 C;  2MHR A;  1FNT c;  3SXM A;  4NY3 A;  1QSP A;  4EHP A;  1NSG B;  1OCC C;  1SF8 A;  2R03 A;  2VH3 A;  2YQY A;  4AL0 A;  3H2U A;  4DBR A;  5KYX A;  2KK1 A;  1VYK A;  1MNE A;  3X2Q C;  2KQ9 A;  5T1D B;  2J0W A;  2HSB A;  3GOR A;  2R7O A;  3Q7G A;  3KYJ A;  1OR2 A;  2XLD A;  2HV7 A;  3JYY A;  3ZDL A;  3ZQV A;  3L0I A;  3GM2 A;  3OEO A;  1BR4 A;  4BJ6 A;  2WB7 A;  3RQG A;  2P6V A;  4IWB A;  3LNM B;  5L0H A;  4I3M A;  4YL3 A;  4XPY A;  1E86 A;  3CAX A;  2M64 A;  5KYN A;  4EBK A;  2XXA B;  5EK0 A;  2XM4 A;  3O10 A;  4PFO A;  2R7W A;  1I4Y A;  2VC9 A;  1EKY A;  1ZHY A;  2R7S A;  4MVM A;  1ORJ A;  4KC9 A;  3T9O A;  5K0I A;  2AU5 A;  2EIN C;  5COG A;  3NDB B;  2Q9C A;  2R7R A;  4Q7C A;  3S28 A;  1GM5 A;  1U89 A;  2D5R B;  4KI2 A;  2EIM C;  4WGZ A;  3EJN A;  4HE8 D;  3HLZ A;  3LEO A;  1PD0 A;  2WVO A;  4M63 A;  4MTO A;  1D0Z A;  2E87 A;  2OEV A;  4HEA J;  4U5F E;  1MMA A;  2OQM A;  3FAP B;  3FHD A;  1BR2 A;  1R4T A;  1LKX A;  2GWW A;  4I1M A;  2Q3T A;  1SMY F;  5A6K A;  1T6Q A;  1YVI A;  1YLM A;  2H7B A;  1CGM E;  2Q9B A;  2L6H A;  1E84 A;  3U9J A;  2G3V A;  4BG0 A;  1H9G A;  1FMW A;  3RKO F;  3RYL A;  3UNG C;  2YLI A;  4O79 A;  4OD4 A;  5EGY A;  5JLI A;  5A6A A;  1D0X A;  3BEH A;  3DXJ F;  3K6B A;  4JCZ A;  4YL1 A;  4AX2 A;  2TMV P;  3R2P A;  4X0R A;  1EA8 A;  3AQB A;  4XPW A;  3E9V A;  3H65 A;  3HKK A;  3MYF A;  2GFH A;  1WN0 A;  5BQG A;  3MYI A;  4R32 A;  4YK5 A;  2XL6 A;  3AQC A;  3QTH A;  3IQT A;  2P7V A;  3HNJ A;  3V7O A;  1M2V B;  1OCZ C;  4UDV A;  5E2Q A;  2FGY A;  5JT4 A;  4XPX A;  1RCP A;  2ZXO A;  3DM9 B;  3JSZ A;  2XLE A;  4LAC B;  4XEV A;  3T6B A;  3US6 A;  3ZVR A;  1RKC A;  4NC3 A;  3C8G A;  4H54 A;  4Z9J A;  4DRI B;  4EBB A;  3E70 C;  5DS6 A;  4PAC A;  5JUA A;  2ZXW C;  1OKK A;  3AOU A;  5KYU B;  2GDC A;  3N24 A;  3GWN A;  4N6H A;  2B0J A;  2DB4 A;  2I8B A;  2W4M A;  1VYI A;  2J9U A;  1NG1 A;  2GAQ A;  3B0P A;  2UUH A;  4I1O B;  1LS4 A;  1PV3 A;  4IB4 A;  4NTA A;  5AGF A;  1MMD A;  3UR3 C;  2YRF A;  4E7S A;  3CZ6 A;  4I44 A;  1RJ9 A;  2A1D D;  4FAP B;  2YWA A;  1ZHW A;  3PCV A;  1JPN A;  2YL3 A;  3H2V A;  3IQ6 A;  4JCH A;  3ZQY A;  4E17 A;  4LDK A;  2XLO A;  2PP4 A;  1Z23 A;  2XSE A;  3AG2 C;  3IEE A;  4HFF B;  4KNV A;  3S27 A;  3SXY A;  1VOM A;  5L0F A;  3L1M A;  2IXP A;  2PX0 A;  3M79 A;  4C3D A;  1QQ3 A;  1T6U A;  4OIR F;  3AG4 C;  3JRM O;  3QZC A;  3ECS A;  4J7Y A;  1FFT C;  1HE1 A;  4ULW A;  3QW0 A;  5COF A;  4MVS A;  4K1O A;  3W2V A;  2J9W A;  4A2N B;  3EG9 B;  1Q0K A;  1A41 A;  4QDL A;  4BJT A;  5A6B D;  2HKV A;  2A6E F;  1QLE C;  4W8K A;  2ZD9 A;  2I15 A;  4MW3 A;  1WAT A;  2RD9 A;  3GM1 A;  3C8Z A;  2QLA A;  4FX5 A;  2B0H A;  2R25 A;  2VAS A;  3U2L A;  2FFH A;  2PX3 A;  4O7G A;  5T3W A;  2Q4F A;  3U5S A;  1WTY A;  3SXK A;  4CJO A;  1T6I A;  2L6G A;  2LP4 A;  1HY5 A;  3NYJ A;  4MTG A;  2DYS C;  4P9F A;  4PK4 A;  2BC5 A;  2QNL A;  1WWP A;  4LLE A;  2IXN A;  1G4U S;  4FES A;  5B1A C;  1Q0G A;  3S29 A;  3ZTM A;  2EPK X;  3ASO C;  4G78 A;  4XWJ A;  5B3I A;  5F5F A;  1I4Z A;  3LEV A;  2HSQ A;  2R7X A;  5FZT A;  5AC4 A;  2C04 A;  4YT8 A;  1AVO B;  3MLG A;  4WGY A;  4J32 B;  3U2M A;  3DM5 A;  3TJ5 A;  4CBE A;  2OJE D;  1Y6D A;  2Y3G A;  3HNL A;  5CIV A;  1A0B A;  2DYR C;  1APC A;  1MMN A;  2A0B A;  2L7A A;  4H4K C;  4NQF A;  2VCA A;  1OCR C;  1YA7 O;  1KNY A;  1FMV A;  4ZLC A;  3ITF A;  4CS9 A;  3K66 A;  3JZ0 A;  2VCB A;  1NU9 C;  2OU6 A;  2EPN A;  1K05 A;  1LIH A;  3LES A;  2HMQ A;  4U5D E;  4YN0 B;  2MWQ A;  5KYW A;  2YVK A;  2J45 A;  3EG9 A;  1R5I D;  3GM3 A;  5GPG B;  3T6G B;  1ZYR F;  5DQT A;  1TWH A;  3VF0 A;  1OCO C;  2DI3 A;  2HFI A;  4Q5S F;  3CQZ A;  2PF4 E;  4BEM J;  3C62 A;  3SEO A;  4IJJ A;  4K0D A;  5JP7 A;  3C7J A;  4YL0 A;  5F5H A;  2Q9A A;  1JRA A;  2IM8 A;  4IGG A;  4JC7 A;  2KNH A;  4IAQ A;  4ER9 A;  4JE9 A;  4U5C E;  4YT2 A;  4U5B E;  4O6N A;  5TJ5 E;  4JJF A;  1M57 C;  3C63 A;  4IAR A;  2A68 F;  3SXZ A;  3U3F A;  1GS9 A;  4C3E A;  4IRU A;  2FAP B;  3QVZ A;  2IOQ A;  2L6F A;  4NCQ A;  2Y3D A;  5L3Q A;  4JEA A;  2WVQ A;  3F47 A;  3JYH A;  4OIQ F;  3KH2 A;  1E85 A;  4U9E A;  1JOG A;  5JSL A;  4MVU A;  3EFO A;  3LAY A;  3O6X A;  1S7Z A;  1KU2 A;  3CEX A;  4K7B A;  5F28 E;  3NYL A;  2A0U A;  1DOV A;  4G7O F;  2AVK A;  4N06 A;  3TUL A;  1NFO A;  3Q6M A;  1L7C A;  2HJ3 A;  1ZU4 A;  2A6H F;  3K1I A;  2R9R B;  4XEK A;  2YL0 A;  1TWC A;  3LLI A;  5EHH A;  2AWC A;  3RH3 A;  3ABM C;  5IY5 C;  2NUT B;  1YJG A;  1Y4C A;  1M2O A;  5DQZ A;  4AL1 A;  2W45 A;  3K1I C;  4CJG A;  4DRH B;  1S05 A;  2XRH A;  4AE4 A;  4A4A A;  5FCL A;  2CNW A;  4U5H A;  2WL8 A;  1QZX A;  3R7C A;  4DBQ A;  1Z63 A;  1OQC A;  3PHF 2;  3DKA A;  1QPU A;  3NMK A;  4MQ9 F;  2KC3 A;  2CCY A;  3Q6N A;  1NLX A;  4JZA A;  3W8H A;  3EQL F;  2P1A A;  1VTM P;  5JVE A;  2WVN A;  1T5O A;  2XXA A;  1LI7 A;  3M15 A;  4JEB A;  1V74 B;  3DJN B;  5D91 A;  4JRZ A;  5KYY A;  1OW7 A;  1ST6 A;  4YT5 A;  3VAY A;  1Q0D A;  2HUJ A;  4CSA C;  1LE2 A;  4NTF A;  2OOC A;  3WG7 C;  4YT4 A;  4ANJ A;  3LS0 A;  1HE9 A;  1TFO B;  1HW2 A;  4MW8 A;  3TK0 A;  3QMK A;  1OXK A;  2H7O A;  3GEI A;  4MVR A;  1N1C A;  1CPQ A;  2EIL C;  4CSA A;  3GWL A;  1XWJ A;  2J9B A;  1XZQ A;  1Z6A A;  3JCU Q;  5A69 A;  4JTD B;  1CGN A;  2J9V A;  3OWT A;  2OEX A;  2XLM A;  1LVK A;  2EPO A;  2WZG A;  4JUR I;  4EIY A;  1G4W R;  3N2Z B;  1CPR A;  1L3P A;  2YEV A;  4GYT A;  1TR2 A;  4CIP A;  4L6R A;  1YAR O;  3SZR A;  3U9M A;  1UFB A;  2XLW A;  2G62 A;  3LJB A;  4OIN F;  1CGO A;  3U8V A;  4D4X A;  3MBG A;  1M6T A;  1YA9 A;  5JRA A;  1H7I A;  2NUP A;  4JTC B;  4JTA B;  3ZSU A;  4XTK A;  2M4E A;  1VK5 A;  4Z9I A;  1SYQ A;  1GGQ A;  1H6G A;  2D4U A;  3NMJ A;  1RMV A;  3GEE A;  1AUE A;  2LFD A;  1BR1 A;  2QY9 A;  4N4W A;  3RVZ A;  3SP1 A;  1E2X A;  2ZXP A;  4Q4Z F;  3T4R A;  2F22 A;  2HS5 A;  3UMH A;  4CS8 A;  2VB6 A;  5B1B C;  3KMI A;  4CS7 A;  1C02 A;  5HSW A;  5CI9 A;  1I5N A;  2W4B A;  3WAQ A;  4MS2 A;  2AP3 A;  1WAS A;  2YKZ A;  3DE8 A;  3EHM A;  5T3T A;  2J46 A;  4RBN A;  4Z9H A;  4DXW A;  5KYW B;  3K1H A;  4YJW A;  5E33 A;  3JT1 A;  2LFF A;  1B68 A;  3B71 A;  3WHN A;  3WOD F;  3UGP A;  1PD1 A;  2OJQ A;  2EPL X;  1ZU5 A;  4J7T A;  2HZ8 A;  1BBH A;  1J8M F;  1LE4 A;  1RKE A;  2DGJ A;  2PBE A;  3EFO B;  4DRJ B;  2BE5 F;  2R02 A;  2PFD A;  3NMI A;  5L3V A;  3DMD A;  2CW0 F;  3KKB A;  3OA1 A;  2LCH A;  1LM3 B;  1ZW2 A;  2ZXR A;  4J30 B;  2IBF A;  4DVZ A;  3J06 A;  3V5Y A;  3M1C B;  3K33 A;  4OD5 A;  1JPJ A;  2P0N A;  3EGD B;  3B9Q A;  3RF3 A;  1YZC A;  1G5Z A;  4CS8 C;  1MMG A;  1W2W A;  1O87 A;  2Z15 A;  3KPH A;  4GEH A;  4PJN A;  2R7U A;  4B6I A;  2L81 A;  4CDY A;  3ZG1 A;  5COM A;  4CX9 A;  3C8G D;  3NYM A;  2YL1 A;  3F46 A;  3GEH A;  3L34 A;  1J8Y F;  1T9K A;  1OXB A;  4MVQ A;  3DWW A;  3JSE O;  1JR8 A;  3I5P A;  1ZHT A;  4P9T A;  2XLH A;  5DVW A;  5DLJ A;  4RD9 A;  2LIG A;  2IYL D;  3POV A;  4PR9 A;  2Q7R A;  3W2W A;  3TQO A;  3ZTZ A;  4DVY P;  2QUP A;  2NG1 A;  3EGD A;  4G0H A;  3UMI A;  4DJ9 A;  3DAG A;  3NRH A;  4C7O A;  1FR0 A;  256B A;  2NSF A;  3Q7L A;  5D92 A;  3TOL A;  2ASR A;  3ATP A;  1NBB A;  2PNO A;  4CIH A;  2EPM X;  4F4B A;  2J8W A;  1TQG A;  3EZH A;  3LS1 A;  4ZLD A;  3W4Y A;  3ZC4 A;  3EPV A;  3I5Q A;  1EQ1 A;  3IQC A;  3EZI A;  4D4N A;  3BRJ A;  4G7Z F;  3X1O A;  4XEF A;  4YWQ A;  5BQI A;  1F1M A;  2RSE B;  4P6I C;  1YAU O;  1A7D A;  4KBL A;  5AC5 A;  2OG2 A;  5L0J A;  4N6C A;  1IZM A;  3M4C A;  1FAP B;  5E3C A;  3C18 A;  1TFK B;  1TWA A;  2WZF A;  3FOP A;  1Q0M A;  3EH2 A;  3O39 A;  3RIP A;  3G4Z A;  3QVY A;  4LDQ A;  3G4X A;  3IHU A;  5E3A A;  4E18 A;  4MVO A;  2YHS A;  4BEJ A;  1RXQ A;  2A69 F;  3AGT A;  4U5G A;  2Y3H A;  3V5X A;  1VMA A;  1RJ9 B;  4JJG A;  3O55 A;  4ULV A;  2ETS A;  3FVY A;  4ONS A;  3S0X A;  3KL4 A;  4EBJ A;  3DD7 A;  1IW7 F;  3I4U A;  4G7H F;  1ZHX A;  4WJ0 A;  1YYX A;  1D1A A;  1ZW3 A;  3RFY A;  3QW1 A;  1Z3I X;  4OIO F;  1V55 C;  3S90 A;  1OW8 A;  1NFN A;  1Z7Q c;  1TKN A;  2H8A A;  4E0I A;  4JW1 A;  1WGW A;  2QTV A;  3RW0 A;  2ICW G;  3EGX A;  2EIK C;  1OW6 A;  2LD6 A;  2XL8 A;  3FOO A;  4GQH A;  3A11 A;  1LI5 A;  3IQ5 A;  1OR3 A;  3FXH A;  3JTL O;  4WAB A;  2JX0 A;  1BZ4 A;  2R05 A;  1NZE A;  1HW1 A;  3AG1 C;  4PJJ A;  2QE9 A;  2G3K A;  5L0D A;  1JAF A;  3B29 A;  3HNI A;  4EKW A;  5HV9 A;  3VYW A;  3K7D A;  3DE9 A;  2P61 A;  4O6M A;  2BL2 A;  1YZA A;  4PJL A;  4O6Y A;  2H7V C;  1MND A;  2OKU A;  3ABK C;  1V54 C;  1K40 A;  1RKE B;  3GAN A;  1KTM A;  3HJC A;  4DOZ A;  2IXO A;  1SZI A;  2V26 A;  5A6B A;  3TJ6 A;  1VLS A;  1C03 A;  1JMW A;  1ZVZ A;  2CGE A;  2NSG A;  3ASN C;  3DZA A;  3KYI A;  4W8P A;  2HMZ A;  4E7Z A;  3FDQ A;  1D0Y A;  1HMD A;  4PJM A;  1A7V A;  3G50 A;  4AK9 A;  1DOW A;  1TWG A;  1G8X A;  1YDI A;  2J7P A;  2OCC C;  3DAF A;  3SYN A;  1V4A A;  3VM6 A;  5KYY B;  1UG7 A;  5L0C A;  2EIJ C;  3AGU A;  3DJU B;  4EUK B;  2YLD A;  3MX3 A;  3LUT B;  4PFP A;  2KYH A;  3EH1 A;  4AE4 B;  3B0U X;  1HMO A;  1O3U A;  1YYJ A;  2C03 A;  2JD3 A;  2CDQ A;  4JIO A;  3VRC A;  3ZWI A;  4BPM A;  3EHN A;  2YLG A;  4BJ6 C;  4CDV A;  1WOL A;  1E83 A;  2W9Y A;  1VLT A;  2L9J A;  3N0T A;  1QKR A;  2J7P D;  2GA0 A;  2XS8 A;  1VB5 A;  3CSK A;  2WZL A;  1ORS C;  3C8G B;  4MND A;  3A9C A;  4CDA A;  4MTF A;  5KYU A;  1LS1 A;  4C3B A;  4NTB A;  3U8P A;  4EWC A;  2O9X A;  3MFN A;  5JS5 A;  3TOM A;  3PMR A;  5KYX B;  5BQH A;  2LQG A;  4OIP F;  2YZS A;  3M4B A;  3DI5 A;  3NG1 A;  3W8I A;  2R7V A;  4XLN F;  3UGO A;  5DS5 A;  4HFK B;  4JKV A;  1K04 A;  1XZP A;  4QI0 A;  2XS1 A;  3V5Z A;  4E0H A;  2XLV A;  5L0I A;  1ZZP A;  1D1B A;  3HTK C;  1T01 A;  1GQA A;  4IAO A;  1PCX A;  3NKD A;  1Q0F A;  1QVX A;  1FTS A;  2IXM A;  4U5E E;  2Y39 A;  4XQ1 A;  3RVY A;  3SNH A;  2X51 A;  2KJG A;  3NKE A;  2NPU A;  3S9O A;  2KGO A;  2LSE A;  2V3C C;  4QI2 A;  2Y3B A;  2AWY A;  3HNK A;  2JPU A;  1C17 M;  2NUT A;  2HV6 A;  4LER A;  3EGX B;  4LDR A;  1AEP A;  1EI7 A;  3L8J A;  3GOD A;  3AG3 C;  1NU7 D;  4U9D A;  2Q00 A;  2XL4 A;  5DS4 A;  5BUO A;  2Y69 C;  4MVZ A;  1OKK D;  4FWV A;  3FAJ A;  3T6J A;  4BJ5 A;  1U6H A;  4LLC A;  2R7T A;  2ZPA A;  2X0C A;  3RQF A;  1M2V A;  1MQV A;  3S84 A;  2YL7 A;  3LLK A;  3U0C A;  5CI8 A;  3IPM O;  2MYS A;  3RQE A;  4CS9 C;  5A6J A;  3UMK A;  4KNW A;  5B3S C;  2KSF A;  3ZIB A;  1D1C A; 
#chains in the Genus database with same CATH homology
 3QW0 A;  3FOO A;  1CPQ A;  2XL8 A;  2J9B A;  3IQ5 A;  1CGN A;  2XM0 A;  2XLM A;  4EIY A;  2QLA A;  1CPR A;  1JAF A;  4CIP A;  4L6R A;  3HNI A;  4CJO A;  2XLW A;  3DE9 A;  1YZA A;  1CGO A;  2BC5 A;  4D4X A;  1M6T A;  5JRA A;  3ZTM A;  3NMJ A;  5B3I A;  2XLD A;  4N4W A;  3ZQV A;  4WGY A;  1A7V A;  3HNL A;  1E86 A;  1APC A;  2YKZ A;  3DE8 A;  2XM4 A;  1EKY A;  2YLD A;  1BBH A;  4WGZ A;  3NMI A;  1YYJ A;  3VRC A;  3ZWI A;  3C62 A;  5JP7 A;  1LM3 B;  2YLG A;  4CDV A;  1E83 A;  4IAQ A;  4ER9 A;  4JE9 A;  1YZC A;  1E84 A;  4CDA A;  2YLI A;  3C63 A;  4IAR A;  4CDY A;  3U8P A;  5JLI A;  4CX9 A;  5JS5 A;  2YL1 A;  3QVZ A;  3TOM A;  4JEA A;  1E85 A;  4U9E A;  5JSL A;  3M4B A;  2XLH A;  2XL6 A;  4JKV A;  3ZTZ A;  3HNJ A;  2XLV A;  256B A;  3TOL A;  5JT4 A;  1NBB A;  1GQA A;  2J8W A;  1RCP A;  2XLE A;  2YL0 A;  4NC3 A;  4D4N A;  3HNK A;  5JUA A;  3M4C A;  4CJG A;  4N6H A;  1S05 A;  3FOP A;  4U9D A;  3QVY A;  4IB4 A;  5AGF A;  1QPU A;  3NMK A;  2CCY A;  2YL3 A;  3ZQY A;  3IQ6 A;  5JVE A;  2XLO A;  1MQV A;  4ULV A;  4JEB A;  3M15 A;  2YL7 A;  3L1M A;  3M79 A;  1QQ3 A;  1YYX A;  3QW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...