2XLCA

Acetyl xylan esterase from bacillus pumilus cect5072 bound to paraoxon
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
311
structure length
311
Chain Sequence
b'SLEELKKYKPKKTARPDFADFWKKSLEELRQVEAEPTLESYDYPVKGVKVYRLTYQSFGHSKIEGFYAVPDQTGPHPALVRFHGYNASYDDGIHDIVNWALHGYATFGMLVRGQGGSEDTSVTPGGHALGWMTKGILSKDTYYYRGVYLDAVRALEVIQSFPEVDEHRIGVIGGSQGGALAIAAAALSDIPKVVVADYPYLSNFERAVDVALEQPYLEINSYFRRNSDPEVEEKAFETLSYFDLINLAGWVKQPTLMAIGLIDQVTPPSTVFAAYNHLETDKELKVYRYFGHEFIPAFQTEKLSFLQKHLL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACETYL XYLAN ESTERASE
publication title The Crystal Structure of the Cephalosporin Deacetylating Enzyme Acetyl Xylan Esterase Bound to Paraoxon Explains the Low Sensitivity of This Serine Hydrolase to Organophosphate Inactivation.
pubmed doi rcsb
source organism Bacillus pumilus
molecule tags Hydrolase
total genus 107
structure length 311
sequence length 311
chains with identical sequence B, C, D, E, F
ec nomenclature ec 3.1.1.72: Acetylxylan esterase.
pdb deposition date 2010-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05448 AXE1 Acetyl xylan esterase (AXE1)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xlcA00
2WILA 1JU3A 2WLSA 3I2HA 4BP9A 3HXKA 4UBLA 4BYMA 2WG0A 4AQDA 3WKAA 2OLEA 4DNOA 3WK6A 5ALIA 3DEAA 4NMWA 3CCBA 5ESRA 1XZJA 4GHWA 2VA9A 3EQ9A 1JFRA 4X7BA 1W1IA 4GECA 2Y2UA 4JYMA 1Q0ZA 5AICA 5K3BA 2VEOA 5HQ3B 3WJ2A 5ALVA 2D0DA 4CCYB 5JAUA 3A2NA 2G4LA 4WFKA 4NS4A 3NGMA 2H7YA 3P2MA 2C0QA 5CMLA 2VJDA 3B5EA 2VATA 3TRDA 5FLKA 1VZ2A 4Y2PA 4B0OA 2QR5A 3M83A 1W4LA 1WOMA 3FLEA 2QM0A 4MEAA 3FOBA 2RI6A 4LHEA 1TIBA 3S8YA 4H7IA 3H18A 1Q0RA 1OILA 4QE3A 4BTVA 4JYPA 4K2AA 4GI1A 3R41A 4QLAA 2PBLA 1XZDA 1CUBA 2Y2VA 3K6KA 1FFDA 2GYVA 2BGRA 2H7CA 3ESCA 2K2QB 4IHAA 4E46A 1VOTA 3DOHA 1IUNA 2V98A 4TPKA 1M33A 1YR2A 4H35A 5LZ8A 4FHZA 3WK5A 1E5TA 3PFCA 4WDRA 1MNAA 1QFSA 3JW8A 2OAEA 3IBTA 3WWCA 3S2ZA 2WIKA 5IVDA 2D5LA 5EHZA 3N2ZB 2DSNA 2ORYA 1BU8A 3O9VA 4FDMA 4FWBA 1THTA 4J3JA 5FPPA 1EINA 4QDXA 5JALA 5EHNA 3O9MA 4FBMA 4BBZA 2PSJA 1XZGA 5J3JA 3F97A 2RONA 3BJRA 4EY7A 3I28A 1CPYA 2CUTA 1UWCA 2YYSA 4LXGA 2QKYA 3BXPA 5DJ5A 4K6KA 3H1BA 1H2YA 2XMCA 3ZLTA 1UXOA 5AK6A 1YA4A 2VT7A 3EIOA 2WUDA 3DQZA 3WKEA 2DHCA 4H7JA 4HRYA 2XI4A 2CZQA 3IVMA 2XUAA 3SWWA 3HC7A 4U2CA 4BZZA 4UBIA 3O0DA 4X92A 2JEZA 3I1IA 1K6EA 4BRZA 4ZRDA 1GQRA 4FMPA 1ZI6A 1TCCA 4Y9SA 2RHWA 4CIAA 5LKAA 1T2NA 5FPQA 3ESDA 2CKMA 3W2TA 4G8CA 1ZD2P 1Y7HA 4N8DA 4U2FA 4K6HA 2LIPA 4WJLA 3TEJA 4KR0A 5AKJA 3G9ZA 1QTRA 2W22A 1VXOA 1QJ4A 3GFFA 5EGNA 2XQIA 3I2KA 1K8QA 1E8NA 1T4MA 1ORVA 2G5PA 5A7FA 3A70A 3OTQA 2XMZA 1UK6A 4AMZA 2HU7A 2WHRA 1RP1A 3ANSA 2Y1KA 2WU4A 1UZAA 1EA5A 3A2LA 4B9EA 3CN9A 2AJBA 1JKMA 4C89A 5ALYA 3QPAA 4Q3OA 5JANA 4WY8A 1ZIYA 5ALWA 4CIBA 3JYHA 4LXHA 5FP0A 1C4XA 1LLFA 3AJAA 3DD5A 3IIIA 2WFZA 1BS9A 4H7DA 2RHTA 1ODCA 1YA8A 4N5HX 1DT5A 4BAGA 3CXUA 2XUFA 2XUOA 2VF2A 4UFNA 4KE7A 4S0XA 3BIXA 4Y2SA 4I19A 1E66A 4QDOA 4X97A 2GYUA 4CI9A 3H2HA 4QWMA 5HFNA 4XJVA 2PX6A 4Y2JA 1F8UA 5ALEA 4GDMA 4QEKA 2ONCA 3YASA 1QO9A 5BWBA 3V9AA 1D07A 2OCLA 5AK4A 2ZYRA 5EHXA 3F96A 1Q84A 3BE8A 3LIIA 2WKWA 5KBYA 4X85A 2BCEA 1N5RA 1YS1X 5AKLA 3AIKA 2WJ3A 3C5VA 4ETWA 3QMWA 3WL6A 3QITA 4W9RA 4X91A 1MX5A 2ACKA 1UK8A 4G4JA 3D2BA 1VKHA 1HL7A 2PSFA 4H7KA 1XROA 4QWWA 4C4YA 3D7RA 5IVHA 4DNPA 4BE9A 3SK0A 4E14A 4MQLA 3EQ7A 5ALXA 1EB9A 2DQZA 3R3VA 4BCCA 2WJ4A 4KAAA 2PKYX 5HZGA 3R3UA 1QIMA 4UHDA 1PJAA 4DTCA 4H7HA 1GQSA 4HS9A 2OCKA 2HU8A 2OPHA 4WY5A 1EVEA 5A71A 3HRHA 3I2JA 3W9BA 2PUHA 2ZSHA 3PDCA 4OSEA 1CFJA 5ALZA 3HSSA 5FKJA 4BZWA 4J0CA 1GXSA 5K3DA 5AOAA 4MWSA 3WZMA 4ZI5A 2QRUA 4NZZA 3L1IA 4ARAA 3QZUA 3WZLA 4H18A 1U8EA 3B3QA 2WHQA 3KWJA 4KRXA 2V9ZA 3SC2A 1KU0A 4J7AA 4L3WA 4PF1A 4Q1VA 5JYCA 1PV1A 1XRQA 3G0BA 5CXXA 2YH2A 3WA7A 1K4YA 1F6WA 2RIPA 1HQDA 3ESAA 5C8ZA 4JH0A 1ZD4A 4K5QA 3R3YA 4UBJA 4MQMA 1GPLA 3O4JA 2QUAA 2BUAA 4L0CA 2G5TA 4P93A 3VKFA 5AO9A 3IDAA 3HEAA 1QZ3A 4B0PA 3WYDA 4EY6A 1U4NA 1SCIA 4AO6A 1R4ZA 1HKHA 1CR6A 3X3HA 3STYA 2WQZA 3WQHA 1I6WA 4W1SA 3L1HA 4HVTA 4J0IA 5CT5A 5JASA 2YXPX 3AZQA 3D4LA 2FUKA 2HRRA 3UUEA 3W04A 2XUDA 3R3ZA 1QOZA 1UKBA 3V1MA 1WB6A 1W52X 4HXFB 4EY4A 4ZV7A 1QIIA 2GBCA 2XUJA 4BB0A 5CTAA 1NU8A 2ZYHA 5ALTA 1FSSA 4BDSA 5JAPA 2W6CX 2ZYIA 1DWOA 5EFZA 3RKSA 4LYDA 4G1FA 1LZLA 5AI5A 4KAFA 4FNGA 1LPMA 2JGIA 2OQVA 1P0MA 5CH3A 1ZJ5A 2WFMA 2HL6A 5H3HA 1J2EA 4UHBA 1ZICA 1EX9A 2HFJA 5BOVA 2XLCA 2DHDA 1XZHA 3O4GA 5D3KA 3R3XA 1A88A 4G4GA 4F60A 4LXIA 3W05A 1YAJA 3WA6A 4BATA 3D59A 4UHEA 4DM7A 3PUHA 5EIHA 3WI7A 2ZJFA 1J1IA 4U2DA 3HACA 5I7UA 4UPDA 1EB8A 4F21A 1OXMA 3W06A 5DTIA 5HCUA 1F0PA 3WKDA 2XQGA 2JEYA 1CUFA 4FLFA 5DNWA 3ZI7A 5C7YA 2UZ0A 1N8SA 1R50A 1HPLA 5C81A 4A16A 4LKOA 2O2GA 1XZLA 4W1RA 3I6YA 3PF8A 3VXKA 3QPDA 5CBKA 4QLOA 2X76A 4QZVA 3TJMA 2QXTA 1XQWA 2V97A 3ICVA 1LPAB 4Y2YA 3FYUA 3C45A 3WJ1A 4Q3LA 2HA0A 3FVTA 1MX1A 3MVEA 4EB0A 1EI9A 1G4HA 2WUGA 4XWGA 5ALMA 2VJAA 3DKKA 3G0DA 1CLEA 2QUBA 1X2EA 4DSAA 4EY5A 5ALDA 3BL8A 2XUGA 5ISMA 3FLAA 4V2IA 2CB9A 2JGFA 4OB8A 2XMSA 5JADA 5LKRA 4P08A 3G9XA 5AKZA 2BUCA 5K3AA 3DLTA 4DMFA 1ZI9A 1AKNA 4TVKA 5AK3A 3STUA 4UBNA 3WIOA 3B12A 4J0HA 4AN1A 1HDEA 3KXPA 1GKKA 3BF7A 3STTA 5JD6A 2ECFA 3STWA 1UFOA 1EVQA 4ZWNA 1EH5A 5AM1A 4DIUA 1ODSA 1RWQA 1E89A 2PSEA 1CIJA 2WSLA 1L7RA 2XLBA 3DOIA 3G0CA 1XZFA 4KJXA 3GUUA 3IUNA 4AN0A 3C6YA 4AO7A 4E15A 1EDBA 3DJYA 1UKCA 5DYYA 4Y2RA 2IX9A 3HZOA 7YASA 1CUZA 5AJHA 4BCBA 1QO7A 5FXMA 2QS9A 4EUSA 2C5FA 1VZ3A 5LZ9A 1XZBA 5FRDA 3CCCA 1QIEA 3BDIA 1QIKA 3WL5A 2XQJA 3U0VA 4Y7DA 5IKXA 5HFAA 1CVLA 2ACEA 5FUMA 5JD4A 4FTWA 5SYMA 1XLUA 5CT4A 2WHPA 1CUJA 1BEZA 1QTIA 3UUFA 3WK7A 2B9VA 3RM3A 4RGYA 3PICA 1NX9A 4HXGA 4C4ZA 1QONA 4H7FA 1RYYA 4IH4A 1ORWA 4C6HA 3OG9A 3VJMA 3SX4A 4JEIA 1CEXA 4PSCA 4X71A 4OU5A 1IZ7A 3AUKA 4G4IA 2X5XA 4EHBA 3VVLA 5C8VA 5FV4A 5AI6A 3WYNA 1C7JA 3O4HA 4BC1A 2J3DA 2JF0A 5AKGA 1GZ7A 4MEBA 4MYDA 5AKYA 2XMRA 4X94A 3H2IA 3H17A 2WTNA 4KAJA 2GBIA 3ILSA 1QIJA 4MWTA 1A8SA 1J07A 3V1KA 4AZ3A 3D0KA 3TGLA 1XZKA 2G63A 4N5IX 5AM2A 4Y2XA 5E4YA 4RNCA 5K5EA 1E8DA 4M0MA 5JAOA 5E4JA 4OUKX 1BRTA 3WMRA 4N8SA 5LP1A 3VJLA 3C5WP 2HDWA 4AB1A 2CBGA 1Z68A 3WLAA 3WK4A 4X95A 2H1IA 4Z49A 1H23A 1JI3A 1G66A 1WCYA 2OXEA 2VSQA 1VE6A 1GKLA 3QMVA 4YASA 1JJBA 4C88A 5DNUA 2AJCA 4B84A 4BVKA 5HF6A 2VTVA 2P8SA 1WPRA 3ED1A 3KSRA 2XUHA 4PSDA 1KU6A 2ZJ6A 5DTJA 4EBBA 1XRPA 4X00A 1X70A 4QNNA 1XRRA 4KYVA 2QTBA 2O7VA 4G9EA 3T52A 5ALOA 5JATA 2HA6A 4BVJA 4MYSA 1QIHA 3IB3A 2C7BA 3OM8A 1N5MA 3C70A 3H04A 2Z3ZA 2WTMA 5ALFA 2WIDA 3E3AA 2HU5A 5D7BA 2GZRA 1O6GA 3C6ZA 4FKBA 2CMFA 3OC0A 3FNBA 4ZV9A 5K3CA 1YS2X 4J0GA 4HZGA 4X90A 4W1PA 1GPNA 1WM1A 2WG1A 1L7AA 3R0VA 4Y2UA 3QH4A 4UFPA 1XKTA 4Y2QA 4B6GA 5K3EA 3WL7A 3FWHA 1HBJA 1TCAA 1LNSA 4HTAA 5AM5A 2B61A 2OGSA 4EZIA 3H1AA 2QT9A 1QLWA 3STVA 2Z8ZA 4WFJA 3C87A 3D3NA 4BRSA 3VDXA 2PL5A 2FJPA 4N8EA 3UMJA 3V1LA 4ARBA 4XVCA 1S8OA 5ALLA 5FOQA 4DNQA 5JIBA 1BEEA 2OGTA 2JIDA 4WDQA 4K6GA 5E4TA 4FOLA 3AIOA 4AO8A 2WU3A 2XMBA 2HA2A 4ITVA 4UBOA 4OYLA 4RE5A 2HA7A 5A2GA 2I03A 4LYEA 3DYVA 2OG1A 3LP5A 1LBSA 3R40A 1R9MA 1YB6A 5ALJA 1QFMA 3H2KA 1GPKA 3FYUC 1WB4A 3FCYA 3H2GA 3VISA 5AM0A 2QZPA 5AKHA 5JZ9A 1E3QA 1CV2A 4M0EA 1DQYA 3FSGD 3ZV7A 3WWDA 4CFSA 5CW2A 4ZXFA 1BN6A 2WHPB 1W76A 3EF3A 4YPVA 4HRXA 5HKBA 4PV7A 3NOXA 1ISPA 1CQZA 2CJPA 5AKXA 3NUZA 3QYJA 2XQKA 5EIAA 1XRMA 1A8QA 1B41A 4UHHA 4DNFA 1G42A 2QJRA 4XX1A 3PE6A 6YASA 2VJBA 4UHFA 5CRIA 4Y2TA 1DWPA 2XE4A 1TQHA 1J06A 3WKBA 2CEKA 1XQVA 2VAXA 3C8HA 2JGKA 3EQ8A 4B85A 2HRQA 4P92A 3U1TA 3PI6A 4BE4A 4H7EA 2GBFA 1H2WA 1CUYA 2J3QA 4OD0A 5AKEA 1MAAA 1CUGA 4DMKA 4QDUA 5CXUA 4H77A 3ESBA 2FX5A 4FBLA 4IH9A 4J0DA 5ALPA 3GA7A 5LZ7A 1XZEA 3D5EA 1VLQA 2XT0A 2GZSA 2OQIA 1ETHA 1LPOA 2XMQA 1UK7A 3G9UA 4B83A 3V48A 1XLVA 1CQWA 3RARA 1WPXA 2C5GA 4AX4A 1BROA 4XIIA 2WM2A 1AZWA 3BWXA 3LCRA 1MPXA 4QA9A 1FFEA 1K63A 4IH1A 4ZREA 1ODTC 4C87A 5DYTA 5ALNA 4C4XA 2XUKA 3WWPA 4CCWA 1XZMA 5AOBA 2DQYA 1R3DA 1L7QA 2Q0XA 3MUOA 5BWCA 4M0FA 3RK4A 1YCDA 2H9YA 5T4BA 2O7RA 3WIBA 1FJ2A 1LPPA 3QPCA 1JJFA 4PW0A 1XQYA 1Y37A 2AJLI 1P0PA 5JARA 4QDTA 1LBTA 3G9TA 3L1JA 1O6FA 2QJWA 1E8MA 4OB7A 1N1MA 4RE6A 4GEGA 3K2IA 1UOPA 5CT9A 4U2BA 2DR0A 1VXRA 2XUIA 3A6ZA 3HJUA 4CG1A 1WHSA 1CUAA 3T4UA 2NW6A 3ZPXA 3ZLVA 4AMYA 4J03A 2JBWA 3OURA 4DMHA 1H22A 4AZ0A 5YASA 1EHYA 4DSZA 1CUXA 3G7NA 1CUSA 1MT3A 1YB7A 3GROA 3O4IA 2WIGA 5CH8A 4KACA 4F5ZA 1CRLA 3LS2A 2AXEA 3DDUA 1KEZA 3QBJA 3AZOA 1EXWA 1FFCA 1YASA 4JNCA 4UHCA 4BAZA 1UOQA 2QXUA 5D6OA 3PUIA 2BAGA 5A62A 2XMDA 3WL8A 4A23A 2OCIA 4B81A 1CUWA 3KDAA 1GT6A 1CUUA 2ZYSA 1CUCA 3G8YA 4G8DA 4LIPD 2H7XA 1SOMA 3WK8A 2PPLA 3QMMA 3Q0TA 4DYHA 3AIMA 1ZIXA 2BKLA 4L72A 1WB5A 5EI5A 5IVIA 2WFLA 5LLSA 2JGLA 3E0XA 5IVKA 5KWJA 1MX9A 1YAHA 3BJMA 1R88A 2ZSIA 2DHEA 4KE8A 1ZGBA 2PM8A 1EK2A 3I6ZA 1VE7A 4BTLA 1ZD3A 3H19A 1WHTA 1MJ5A 4GW3A 5LZ2A 1ACLA 2C0PA 2JGEA 4GBGA 5AOCA 1LGYA 4A5SA 3HLKA 3AFIA 2VQ6A 4Q34A 1DU4A 3K9BA 1MNQA 3C8DA 4FNMA 5ALKA 2DCMA 2WJ6A 3F8SA 4GWLA 1Y7IA 3DKRA 1JMKC 2Y6VA 2IIVA 4W63A 1AURA 1X2BA 4EY8A 5KREA 1DWQA 5T4HA 4IO0A 4Y2VA 1UOOA 3I2IA 2JGMA 1FFBA 2HA5A 3I1YA 4L9AA 1EK1A 1CUEA 4UFOA 4YK7A 3GBSA 2HADA 1ACJA 5A7HA 4CG2A 2BGNA 1EDEA 4ZGBA 3IULA 3AZPA 2VAVA 1QIGA 5AKKA 5JZSA 1JT2A 3WWEA 4KEAA 3STXA 2EEPA 1XRNA 1R9NA 4GLBA 5T4EA 2VT6A 4TGLA 4B82A 1A7UA 1XKLA 3GELA 1BE0A 1BCSA 4OPMA 1UKAA 5HF5A 4MXDA 3LLCA 1DX4A 2EDAA 3QVMA 1HLGA 1B6GA 2Y6UA 1VA4A 1NU6A 3IUMA 4KE9A 4DLNA 1LPNA 5K3FA 5HK9A 3VVMA 1OCEA 3FVRA 4HXEB 4X6XA 4FFWA 2I78A 4Q82A 1TK3A 4NVRA 4ROTA 5JZBA 5LZ4A 4W1QA 2VJCA 3HYSA 3IA2A 2J4CA 3HABA 4YX9A 4P9NA 1LPSA 4IQ4A 3WKCA 3JWEA 3FSGA 4PSUA 1XRLA 1XZCA 5AH0A 2BUBA 3D2AA 1XFDA 3BDVA 4BDTA 4BAUA 1W75A 4H0CA 3G0GA 5JAHA 3EBLA 3M82A 5AI4A 3IUQA 3M81A 1F0NA 2QMQA 3AILA 1USWA 2XUQA 4E11A 3DL4A 4FFVA 4FLMA 5ALRA 4B80A 4UBMA 3KWFA 1JJIA 5F4ZA 3W9UA 3C6BA 5AM4A 3ANTA 4EA6A 3A2MA 3R3WA 1CUDA 1XLWA 2X8BA 4U2GA 2ZJ7A 1MAHA 1ZI8A 5CT8A 2I3ZA 3GZJA 5ALSA 2J4FA 1QIFA 1DTEA 1CUIA 2B20A 1MU0A 2XB6A 2PSDA 1AQLA 2C4HA 5D3ZA 1IMJA 1TAHA 1UK9A 2O2HA 3FYUB 5EIEA 3LIPA 1MN6A 5CURA 3RLIA 2RGUA 1ZJ4A 1JU4A 1DINA 2XMGA 2V96A 1QGED 3FBWA 3O95A 1G5FA 1ZD5A 4J0JA 5BV7A 4BC0A 1K5PA 2FJ0A 5A6VA 4B9AA 5IH7A 2YASA 3G0IA 4MJ3A 4KRYA 3FCXA 5AKIA 4JUIA 3H2JA 4WFIA 5HF8A 1SC9A 2C58A 4CG3A 4QDZA 1AMNA 5C8XA 5I8PA 2HA3A 1W6RA 3I2GA 4B7ZA 2WFLB 5E2IA 4X6UA 2XQFA 2AJDA 3OPMA 3I6MA 2AJ8A 4G5XA 5CT6A 1SFRA 2ES4A 3F9CA 3OOSA 5SYNA 4I3FA 3I2FA 2WIJA 2PU5A 1VA5A 1DT3A 2XUPA 3IUJA 1THGA 4OYYA 4BCDA 1ZGCA 3ICWA 5DWDA 2HA4A 3WWOA 1AX9A 1IVYA 1CUHA 5HQ3A 4X93A 1IUPA 2PU7A 4CCYA 1IZ8A 1LPBB 4Q05A 1FFAA 3MGAA 4D9JA 5I9IA 3KD2A 2OAGA 4X3CA 1AUOA 1JMYA 4FLEA 1H2ZA 4F0JA 3HI4A 1MTZA 4DMCA 4PNZA 2HFKA 4G8BA 1R1DA 3FYTA 5AIAA 1AGYA 4C01A 2GBGA 1UT6A 4UBKA 3IURA 1GGVA 2EDCA 5T4FA 1A8UA 4GXNA 1U2EA 1PFQA 2QOEA 1EDDA 1XQXA 2BJHA 2WUFA 1AC5A 1XZIA 2OCGA 3H0CA 1QIDA 2I3DA 3WK9A 3F98A 1QE3A 2B4KA 5KWIA 4INZA 1DX6A 5CH5A 5K3FB 5AP9A 4DGQA 5AI0A 3FLBA 2ROQA 1CUVA 3DCNA 2OGZA 1BCRA 2R11A 3DNMA 4PO3X 5LZ5A 3PF9A 5A7GA 5JD5A 4I4CA 4KE6A 1SCKA 1IUOA 1Q83A 5FDFA 3C6XA 3ZLUA 3AINA 5AM3A 2O2IA 2PVSA 2DFPA 3FAKA 3NWOA 2WIFA 2Z8XA 2HM7A 4WCVA 1SCQA 4U2EA 1P0QA 4J0KA 1DQZA 4RPCA 2WUEA 1C7IA 2GYWA 5AI8A 2HIHA 5AK5A 5HF9A 1XZAA 3PFBA 3QM1A 3Q8WA 3CN7A 5AIBA 3DL7A 1TKRA 4UUQA 3D2CA 4X6YA 2E3JA 2PSHA 3E4DA 1ZOIA 5ALUA 3DYIA 1VJ5A 4AXBA 2HHAA 5LIPA 2WG2A 3F67A 1P0IA 2QVBA 1BN7A 2PUJA 5ALGA 5AI9A 3N0TA 4G9GA 5DYWA 5AHXA 3VJKA 3E1GA 5LYYA 5ALQA 2BFNA 4OB6A 1TCBA 2R8BA 4O08A 4Q3KA 1MO2A 5DLPA 4PQEA 2IITA 4HAIA 1YSCA 2ZVDA 3MUNA 3V1NA 2Z3WA 4BVLA 3M3DA 2XDWA 5EHQA 2RAUA 5ALHA 5DNVA 2Z5GA 3DS8A 3KOOA 1U65A 4BP8A 4OU4A 1LZKA 3BIWA 3C43A 5HKAA 5HK8A 3ZWQA 1TRHA 3G02A 3BF8A 2JGJA 1H2XA 4OCZA
chains in the Genus database with same CATH superfamily
2FSSA 1T6YA 4NSNA 1Y1QA 2PX3A 1U1GA 3KAJA 3VPCA 3RS2A 4DLBA 3AQIA 3SJCA 1SUAA 4UMFA 2YY5A 1EP9A 2BHRA 2EP8A 1PUIA 4L4XA 3HXKA 1J39A 1Z0AA 2EKQA 2HXYA 2JASA 1ODKA 3ZDFA 2VYCA 1N6RA 5TQ2B 2IVFA 2F3UA 2PR7A 1P44A 3U2QA 3RRNA 2BEVA 2BFCB 2G6TA 4AW9A 5KSOA 1QH1B 4MWOA 2XKKA 3I8XA 4K1LA 2BKEA 4DTIA 4D0RA 3HO1A 5ESRA 1XZJA 2WD7A 1H3NA 4M1WA 1CXZA 2PLRA 3HO6A 4GHWA 4A82A 1I4TD 2GM5A 5FHRA 5A4DA 4H3KB 1SVSA 2ZI6A 1SM4A 4X7BA 1NG1A 3FOCA 2IYWA 4EX6A 1E77A 2EJUA 5J2UB 4PE5B 5ITZA 2Y2UA 4JVMA 1N0HA 7REQB 1S02A 1U5BB 2VT2A 4KQEA 4RVDA 5AICA 5E6SB 3WADA 3L02A 4C2AA 4CKBB 2CXSA 2G8LA 4DUGA 1YR8A 1T2VA 4QTXA 2VEOA 5HMMA 2EEZA 4D98A 5GV8A 3AVXA 4ADSG 5F2EA 3ZDYB 2ZE5A 5ALVA 2EFYA 3TBFA 1UH5A 1W9MA 1N9ZA 5TQVA 1UDWA 4CM6A 3U5TA 3GLFE 1CJMA 1DKQA 2G4LA 2HBQA 5IM4F 3OKCA 2Y27A 3ZGOA 1N7GA 1RQRA 3FTNA 1ZH0A 5K0TA 3N8IA 3B82A 2MSCB 3EGOA 3VI4B 1K0UA 4XSGA 1IAVA 1MC1A 1P6UA 2PD6A 2VJDA 1G8JA 1GNRA 3B5EA 4MUNA 3TJZA 1KMNA 1VZ2A 3JQFA 3RRYA 2HQRA 1MABA 1PTKA 1M34E 2B1GA 5EIFA 4B0OA 4JUCA 3TFQA 1C7ZA 1U6IA 2A35A 4WXMA 2XNDD 4D8WA 2B2NA 4X44A 2WK1A 1BA2A 4GLJA 3OJXA 3FLEA 5FBLB 1S3IA 2PS1A 3Q41A 4MEAA 3OIDA 3TLZA 3W8EA 4URVR 2QZ9A 3CFYA 3IUEA 1I36A 2WPDD 5F5XA 1V5FA 4G07A 4MWCA 2GZ2A 3GLQA 4TKLA 3ZVKA 4US2R 3S8YA 4LYJA 1P5RA 4D44A 2R5NA 3TCNA 3OH8A 4H7IA 4B79A 3AFOA 3WAKA 2QM7A 1Q0RA 3CS3A 3EXHC 3K0FB 1TVKA 1IM8A 1ZMBA 5IKMA 1ISFA 1CR1A 1OILA 2FMUA 4GI2A 4CT5A 3K6RA 5JFTA 2W11A 1IPEA 1IB0A 1OU4A 2EC5A 4DY6A 4Y98A 3U60B 1DC7A 5DN6D 1M2OA 2R6CA 3PLRA 5JMPA 5BQFA 1XZDA 4POOA 4DSOA 1S8AA 3OMXA 4LMAA 3RFUA 4BZPA 4YAIA 2W6MA 3FE2A 2AMLA 2Y2VA 4KO4S 2OZEA 5TPWA 3RJ5A 2XRFA 1FFDA 2Z5LA 5AR1A 1T5SA 3UYKA 4OI0A 3CHYA 3OEED 4EPXA 3WLMA 3E9QA 2K2QB 4IHAA 2AOTB 4IOMA 1A9RA 2VAWA 2HQOA 3B60A 3W2FA 1IUNA 1YUNA 1XAIA 5EVJA 4TPKA 1TMYA 3AXSA 3ZW8A 1QYRA 5GGYA 4FFLA 4W6QA 3GGSA 3GX1A 1V5GA 2XJ4A 5LZ8A 1JG6A 2QDKA 4B4WA 3GRFA 3KJHA 4JLNA 1GY8A 1I5RA 2Y1XA 1V2GA 5JWHA 3UIEA 1WMSA 2LPMA 3MA0A 1YMQA 2B7CA 3H8SA 4FHZA 2YICA 3PFCA 5TQ0B 3WK5A 4JX9A 1W1WA 4UZEA 1H5NA 2JKZA 3QP9A 1E3TA 1L5WA 3D6JA 4K9MA 4NJEA 2FZ5A 3IBTA 2B8NA 2O8DA 1G3MA 3K2QA 3ADKA 1G1MA 3WYGA 3WWCA 3F6EX 4Q7QA 1YF3A 3NKVA 2SKDA 4ZCQA 3VR3A 3CZ5A 3C98A 2WIKA 1JHMA 2JAWA 1OPXA 3P71T 4I55B 2A7XA 3H11A 2BIFA 4Q15A 4QTZA 3N2ZB 3ZVMA 4NXNB 4W5QA 2A7QA 3GHYA 3MQ2A 4TSKA 3OHSX 4NPHA 1QVWA 1ITZA 4B7AA 3EBOA 4CTJA 3NDPA 1PDVA 3FB4A 1JXQA 2QJFA 3GZTB 2HCBA 4F2DA 1GLNA 2GMWA 4QGFA 4EGSA 2VS1A 4FZ5A 5LM3A 2RGCA 1HR0B 1S01A 2C8KA 1ZK0A 3DFMA 5FPPA 1EINA 5LD2B 1M6WA 2LE0A 4PG8A 3VNUA 3BFXA 3FMFA 2EBFX 2QI9C 2Z4TA 3H8WA 4HX2A 2F3RA 4BBZA 1DBIA 3SE0A 1KNXA 4MINA 2QRZA 2JKVA 2IHUA 3CB4A 1PR5A 2J45A 2R79A 2X5KO 3BJRA 3F97A 3DLIA 4KXNA 4OA8A 4R01A 1DDGA 5P21A 1H69A 4NI5A 5A9TA 4EY7A 3I6IA 3I28A 3UGJA 1C4OA 3CH5A 2FG5A 4HX5A 1UWCA 4MUIA 4OUDB 2ATEA 5DO9A 2VJYA 4KOEC 1F2UA 2MJLA 3PQ3A 3KVVA 1Y7PA 1UPTA 4DXAA 3RR2A 1DQRA 3WB9A 1JWBB 5PNTA 3ZY4A 2IHNA 4IJMA 1BFKA 1ZM2A 3VKHA 1E4VA 1MHPA 3PCXA 5B55A 1NT2A 3OT4A 1T4CB 3CNQS 3ICOA 3PEFA 1XZ8A 4IRXA 1WDWB 4BMCA 2FGKA 5AWFC 2PUFA 4L5YA 1EESA 3NO4A 4Q9LA 5CPFA 1G2QA 2ECKA 3MGKA 3DQZA 3WKEA 2DHCA 3UGQA 1DAIA 2X77A 5JCZA 4KPEC 1C7RA 1ZOSA 3EIXA 2C98A 3DVQX 3IVMA 2XUAA 2F64A 4FXOA 1UUFA 4BZZA 1V5WA 1RZRD 4X92A 2JEZA 3I1IA 4PAWA 4P1ZA 4EI9A 1K6EA 2BH2A 2D4AA 1F1BA 4I4TF 1NNUA 2YNMD 3BIOA 4Y1GA 4ZRDA 5DM60 1CDZA 1GQRA 5D3MB 1WNFA 2GM4A 1M73E 1M8PA 2CF6A 1XN4A 4GKBA 3A26A 1TCCA 5E2BA 4FNOA 2FDXA 4HFNA 3U3XA 3EAGA 4ZOLF 4R7ZA 4MQEA 4YV0A 5B1YA 1OLSA 1I0ZA 3LBNA 3X1ZA 2GZ1A 1G291 3PRHA 1JUDA 4RTLA 1YJCA 5FPQA 1PZEA 3EGDB 1RI1A 3OETA 3ZXXA 4B43A 4IWXA 1SG9A 2P11A 2O54A 1AJEA 1P1BA 2C8VA 4DMLA 2ZZMA 3THXB 1L7OA 3RQIA 2AJTA 2P6MA 4HN4B 3IE1A 2PQ2A 1ZD2P 4MVJP 3UT5B 1BVHA 3OFVA 3SOPA 1Y7HA 2A14A 3CRQA 2PTHA 5I4BA 2WF6A 3RWBA 4U2FA 4QM6A 2FU5C 1YS9A 2B4TO 3MCZA 5LCXA 4JQZA 2EU8A 2ZRGA 3UM9A 1CP2A 1VKNA 2JFFA 4P0TA 4G5RA 3T8YA 4CR6A 1C4KA 2ZM5A 1VKZA 2HJRA 1G6Q1 1XZNA 3GFFA 4RVCA 4TYYA 1KQ3A 2AOWA 1YZNA 2OLKA 2PFKA 3I2KA 1FNMA 3FNQA 5FBWB 3T7JA 2GPBA 4ZYXA 2PGOA 1T4MA 2QAGC 2I4IA 1TM7E 2OBBA 4HI0E 2OM6A 3CUUA 4X41A 4B2LA 3UV3A 5IKEA 3A70A 3IE2A 1V8PA 1UBEA 3IV9A 3KG2A 4EW2A 4AMZA 3CZ9A 4NBTA 4QYXA 1DMSA 1SVLA 2JH9A 3B6ZA 3K05A 4I14A 1VGVA 1VRVA 2JIZA 3RU7A 3L7DA 3RC1A 4KYUA 2X9NA 4RLHA 1XWFA 2R60A 1PFKA 5DWQA 1M67A 2Y1KA 4C0LA 2VRCD 1UZAA 3A2LA 3B9PA 3GW8A 3HYRA 2Z3VA 3Q11A 4LQDA 5DHSA 5JG7A 4M0PA 4B9EA 4E13A 2ONYA 2CVZA 2WWTA 1UC4B 3V3KA 1VLZA 3GLIB 3LH5A 1I7DA 2V6FA 1JHAA 2VP6A 2WM9B 4D8VA 4JI1B 1KY4A 2MYUA 4EPYA 2ERXA 4DC0A 5G0TA 3WHIA 2BEVB 1YNSA 1EFPB 2CVOA 3QI7A 4MARA 4WCFC 1B0ZA 2DSTA 1E0AA 2Z8YA 1KQOA 1ZIYA 2FWRA 2F90A 2G28A 2W0SA 1U0TA 3FZYA 2OQ2A 2PKQO 3GGDA 3FGOA 3KAKA 4FS3A 2WD7B 1ZU5A 4FXPA 4WD3A 3JYHA 3VV3A 3ZJ5A 1C7QA 5JRDS 3R7FA 3WMWA 1GAEO 1NMYA 1QDLB 3GFGA 3KCQA 1TT7A 3NBKA 4ML3A 1Z6GA 2VZ8A 5DBGA 4C78A 5BYBA 3OKAA 1ZO8A 2J6BA 4P7KA 3UMCA 3DEFA 3AJAA 1H6CA 2OGUA 2VK4A 1SG6A 5TPZA 3RROA 3J80A 3VTAA 1K66A 1TQ6A 2IYZA 3DD5A 3MBKA 3TW8A 1SC3A 2WU8A 3LFUA 4ZK6A 1ISHA 1J0BA 1BS9A 3M5PA 1PYOA 4Z9AA 2GA9A 1KSJA 2E82A 1YA8A 1EUQA 1A1VA 2ZIGA 4P81A 5HKKA 2XBMA 1A50B 2RJOA 2C7GA 1JG4A 1V37A 3HN7A 3LV8A 4Y6QA 5AJZA 3X1WA 1AN9A 4PGGA 3ZN2A 2CNWD 4XD7A 4IICA 3RC7A 5BXYA 3RU3A 2JATA 3CXUA 4NG5A 4XI9A 4Q1EA 1DIBA 3A0RB 2BFOA 4IEFB 3D5TA 5BNFA 4ED9A 4J1TA 2X42A 1DCKA 3JD3A 4LPKA 4Q7EA 2VPPA 2XRZA 5DLEA 1DRVA 1UPUA 4R5HA 1MABB 1HA3A 3ZDXB 2GYUA 4LCEA 3E03A 3OT1A 4ZYLA 2JIBA 3AF3A 2CVFA 2YXNA 2N0SA 3GEGA 4XJVA 3L7CA 1JXMA 3A9TA 4NFLA 4YRLA 5B2ZA 5FNVA 1NUAA 1F8UA 4Y2JA 4M22A 3OA0A 5AK0A 9MHTA 3MRXA 2NUAA 3RIYA 4U02A 2HRZA 1LTKA 5KS2A 1JAXA 3EQZA 2UUPA 3KALA 3A04A 1FFXB 5E3JA 1R8JA 3KB8A 1TVKB 4K9DA 4P32A 2IX3A 2C2XA 4WGFA 1UKEA 3IPCA 4R1UA 1JYFA 2PCJA 3H13A 4US0R 2HWWA 4DR7B 3NPMA 2Q1TA 5A04A 2HF9A 1IATA 1ZJYA 2CD7A 1RBMA 2XV1A 3BE8A 4FYPA 4UUNA 3LIIA 1JB9A 1HYQA 1M2OB 3DDZX 3Q40A 4HQLA 2PQ0A 5KKNB 1KKLA 2HO4A 3KJGA 5KBYA 1G20E 1WMBA 1A98A 3UJPA 4ERNA 3V4VB 2BCEA 3VNVA 5KVAA 5TPWB 5AKLA 3A1NA 1SWVA 4NE7A 3NHJA 2GCOA 4NBLA 3J7AC 3ROFA 4FQ7A 2FMTA 3DT9A 2CXUA 3KYDB 4DQ0A 1SEPA 3C3WA 2YY6A 5BV2P 1MX5A 4QBKA 3J81k 4R8LA 1KAGA 1LEHA 3G7SA 2G9QA 4L5IA 4UVHA 1SXJE 1Z6AA 1WLSA 4KVGA 2V7VA 2X1LA 4DV6B 1AMUA 5BSRA 3H97A 3G6KA 1P29A 4QWWA 4YWJA 1C9JA 1SVOA 3JZAA 3SXPA 5IVHA 2AC4A 2PMWB 4JU8A 3PDUA 1GM5A 4M87A 1AKRA 1SHJA 4L85A 4M0KA 1EB9A 2EF0A 2DQZA 3R3VA 5EN4A 2RGAA 2W8BA 4IIYA 2NVUA 2BE7A 1NONA 1LVUA 2PKYX 2YVQA 3QWIA 3NWJA 5REQA 2CMGA 3OESA 4IUCS 4Q6BA 2YWRA 4HADA 5BT9A 3H6GA 4N3AA 4MVYA 4H7HA 4HS9A 3H9EO 1ZY2A 3HRHA 3I2JA 4LDZA 1WLYA 4OBEA 1E6CA 5DRTA 4OH1A 3WWZA 5GTDA 4RPHA 5FX2A 5L4SA 3CINA 2E7ZA 3SP1A 5SY9A 3AERA 2O4UX 2WM8A 1U7TA 4M4SA 1FYXA 3H11B 3LCMA 4UEJA 3FXAA 3UG6A 3PDCA 3K0SA 5FKJA 4F1JA 4PVDA 1JQKA 3P0IA 4E7OA 3KU1A 2A8YA 1JDJA 2O6LA 1ZCJA 2G9ZA 1J42A 5T64A 4ARSA 4NZZA 1UFKA 4CF6A 1KEVA 3VZRA 4LE0A 4ARAA 3JQ7A 2PL1A 5FTJA 5BN4A 1UC8A 2JFZA 3OHPA 1LJLA 1XL0A 5B2EA 3N58A 2A9RA 1KZ9A 3X1YA 3D3KA 4RHTA 5FTWA 1T3GA 4DUZB 2V6MA 1RPAA 4R3NA 2WHQA 1I6KA 3FLMA 3KWJA 1GCIA 1RRKA 2H6EA 2O4CA 2J0UA 4I0WB 4RTKA 2XTMA 2YBEA 1MXFA 1ZH6A 2CC2A 2ODTX 3HR7A 2IBTA 5B4VA 2NTJA 1YE8A 4M38A 3L8FA 4XOUA 1F2UB 1YBVA 2WOOA 3M4ZA 4PLZA 3D1VA 1K4MA 3ISTA 4RK6A 1CQXA 6REQA 1XX6A 1IBMB 3LRTA 3RRMA 1CEQA 1V8BA 1VKJA 2PS0A 2XVAA 3PGA1 2A0XA 1YTUA 2FW8A 3NIDB 2AOXA 1RZVA 4L4SA 5EIOA 2HMYB 1GT91 4NZOA 1KH3A 1PGNA 5JYCA 3PYMA 5JLJA 3DEHA 1PNQA 4OI1A 2IS2A 1GAJA 2QNRA 2BTQA 3H16A 1RPTA 5CXXA 3WA7A 1NXPA 2V54A 4IBOA 3ZDEA 1WCIA 1Y6GA 2G9VA 3VU1A 1C9KA 1ECCA 2QVCA 2GK3A 1O4VA 2ISQA 2VPIA 1DRWA 2RIPA 1CLUA 2ZTUA 2ZYUX 5FA8A 3VSEA 3GWGA 2ODWA 3UATA 1QO0A 3L82B 4PTZA 1WZ2A 4X60A 3QNUA 1IULA 3R3YA 4GG1A 1UFVA 2GEFA 2CDBA 2WKPA 3NVDA 3ROZA 4HNGA 3GB9A 5DX8A 1MG0A 1AT1A 1D2HA 5AVYA 1ICIA 4L27A 3TD6A 1QOQB 1A3CA 2LTAA 4MQEB 3VBCA 1OLSB 1RYBA 2NQ2C 2WABA 5TS2A 1OU0A 3BAZA 3EDRA 3VKFA 4CM9A 2VSYA 2IXFA 1VTKA 2XCQA 2I2FA 3HEAA 3EVEA 3OZDA 4N9QA 4R1MA 1G5QA 1VI5A 1U4NA 3C3YA 1SCIA 4UDOA 4C6RA 1FMFA 4JUBA 1CR6A 1Y5RA 1Z8HA 4EGCB 4EELA 2WQZA 3ZNOA 3A0UA 2GVNA 1I6WA 1NHWA 3OOWA 3PDJA 2LDBA 2EGUA 3NJ4A 5DCYA 5ED0A 4HVTA 1WSDA 3VAZA 3CLSC 5AHWA 3LRXA 3D6FA 4J1NA 2CV1A 4J0IA 2IOFA 4FMDF 2POCA 5ECGC 3VI3B 2ORVA 4IFTA 3DDNA 3ELYA 4MAAA 1TLFA 4M9XA 3K30A 3L7IA 1QE5A 4KWIA 2FW9A 5KX5A 2UYOA 2E4XA 1VE3A 2XUDA 3U19A 1VCNA 3ZHRA 3DAHA 4RH0A 1JH8A 1MOSA 2X5JO 3RW9A 5KTKA 4X61A 3MMZA 1NQ5A 2MYTA 2FPGB 4RMGA 3I4CA 4OX9Y 2FRVA 1MRNA 2QR3A 3O74A 4QNMA 2XEDA 1W52X 4U8HA 3JWJA 1BFUA 3PENA 3WLEA 3GLGE 3EY9A 1G7CA 3RU2A 1DV1A 3TOCA 2JLUA 1JRLA 3PHHA 4RLFA 4C04A 1E2NA 2C0CA 2GBCA 2YQZA 1TZ2A 2XUJA 1E18A 4E5UA 3VZSA 5LBUA 1NU8A 3RVMA 2TYSB 4Y0AA 4RANA 1GGKA 3AHGA 5DU2A 4KHZA 2XR1A 4HDQB 4BDSA 1JU9A 2O20A 4CTNA 3ZDCA 2OB1A 2PUEA 1XJ0A 2Q4OA 3FETA 1RHJA 3MTGA 2P40A 1F8XA 2BL4A 5AI5A 4KAFA 3IAXA 4FE4A 4FS8A 1QVZA 2X58A 3OECA 2PTGA 1CR4A 4JROA 4ZZ2A 2RD2A 3ANLA 3KLPX 2I3BA 3CLHA 4OFWA 2BKXA 2VAPA 1P0MA 5CH3A 4C43A 4QREA 3ECAA 4KPFC 2IHJA 1AS2A 2NO4A 3P45A 1CR0A 5HZKA 3HBNA 3PDWA 3HHEA 1BWPA 4L4RA 5H3HA 5BPHA 3BORA 2D1TA 1Q22A 1PLJA 3M9WA 1J2EA 4RETA 2HW8A 4ZQBA 3QXHA 5DZSA 2M6KA 1YFLA 2O8CA 2OBXA 3P2KA 4MP3A 4OLFA 4WJKB 2VF7A 3TW8B 1GG9A 3M1AA 5FLEX 3D1LA 3H5AA 3T12A 3FR7A 3FKQA 2IUTA 4BMPB 4D6XA 4F3TA 2NXNA 4MGHA 2DHDA 3HA7A 3U6BA 4ZTBA 3B9RA 3CWQA 2Y0BA 3K4QA 3O4GA 3NP7A 2J9XB 3EQ2A 3OCUA 3R3XA 4I4LA 4KWHA 3VC1A 4F60A 2VR1A 4CQMA 1M6NA 2QLNA 3C7DB 2L82A 1Q7TA 4X63A 3U3OA 3D8NA 4YUYA 2IEYA 1YAJA 4ZV4A 4QUIA 1NRXA 1U94A 4DSUA 4B31A 1QVAA 3LVFO 4UHEA 4DM7A 2W9XA 5JE8A 1IYZA 1NOIA 1AKWA 1H6DA 1MUUA 1Z2OX 5BV0A 1NBAA 2Q3LA 4HWTA 1BDHA 1G9SA 3DXXA 5LJIA 1XN1A 4KUGA 2I8LA 1EB8A 1CNEA 3DLAA 1LKZA 4F21A 3FOZA 3F71A 5H9VA 4M21A 2NUAB 2G09A 3CR3C 4GDFA 2VP2A 2XJ9A 2ZSDA 2ZT6A 3OZTA 3DE3X 4MV7A 3D6MA 3TEMA 1B73A 1DXHA 1HNXB 2IBMA 1B3BA 1ANKA 2FFBA 1Z7BA 5ECYA 1G7TA 3R1IA 1F0PA 5K03A 3RUPA 2EL7A 2XQGA 2CNKA 3NYRA 3X1DA 1R6XA 2MSDB 2QUIA 4LW8A 4O5AA 1MQ9A 4YEDA 3GA0A 1Y0BA 3HBJA 2J3LA 2HF8A 1UMBB 3TRFA 5KVVA 5FFNA 3K9FC 3BFVA 5KSPA 1L4GA 4QVGA 3T99A 3W8NA 1NOJA 4DIBA 1VLJA 2VL7A 3ADCA 5MGNA 2J9ZB 3KHSA 2ST1A 5G3ZA 3AEUA 5HJ7A 2ZUTA 4G37A 3VZPA 4IEEA 3IPXA 5HQTA 3BXHA 4A4DA 3BUSA 3PC3A 3ND8A 2GCOB 4LGYA 4Y9RA 5E0OA 3RVBA 1J8DA 3PQ7A 5FADA 5CBKA 1EGQA 2SKCA 3GVIA 5JSHA 5L7YA 3VU8A 2D13A 2SICE 2YTZA 4MQFA 2C5BA 4QZVA 2NYRA 1UBLS 5D6NA 4PIMA 3L79A 4TT8A 3B2QA 4X62B 4DJAA 4ALKA 5JOQA 3ZKAA 4CCSA 3FIUA 2P4HX 2RH9B 2V97A 4ZZ1A 1Q7CA 3MCAA 5FUVA 3OE1A 1QBKC 5KOJA 2Z6QA 1U28C 4HQFA 2F1JA 5LUBA 4V02A 1RKUA 2ZB4A 3HPQA 4NJMB 4IFIA 1U7HA 1H8HA 4QDKA 3C45A 1FVOA 2MINB 2IF0A 4OFZA 2B92A 4IZIA 1H2BA 2OO7A 3FVTA 2W8BB 4HNSA 2DUJA 3MYRA 2Q4DA 4XCXA 4RM2A 4YTEA 5JVDF 5JEEA 4G0QA 1EI9A 4D99A 1G4HA 5B5SA 3PWSA 2Y92A 1XNHA 4LRWA 2IV3A 2IUSA 3HQ4O 2VJAA 3G0DA 1Y8ZA 2QUBA 1UBCA 5F12A 5EE9A 1K7EB 1SY7A 2GD1O 3E05A 5IBRA 5KOIA 5FNVF 3QI2A 2IK8A 3RC3A 3TLXA 5T8KA 5EMLA 4Z4FA 4HT3B 1W49A 3N2EA 4G5FA 3OM0A 2D1FA 1I30A 4OB8A 4TOIA 3LG2A 5ER6A 1KY5A 5JYDA 1Z08A 4JA2A 1PIWA 1Z0FA 1OOEA 4P08A 1PFGA 1ZA1A 3IHTA 3IOBA 1X7WA 3MJHA 3PS9A 2KM1A 5AKZA 4C7JA 1A9XA 1PK9A 3PL5A 3GARA 3PCRB 2OHGA 4CU5A 3DNPA 1UMCA 2A0FA 3GHHA 2MSKA 3HSKA 3MC1A 3R0XA 4RY0A 1AKNA 3JQ7B 5IBQA 2GN9A 4TVKA 5AK3A 3STUA 1EPUA 1RYEA 2NZ2A 3DAFA 4LJ5A 4UBNA 1KJQA 1BD3A 4G5SA 1HDEA 3WDKA 4DANA 1B26A 3VPBA 4D4HA 3TR0A 4OA5A 1U9IA 4LVCA 2EQ5A 4ARIA 3VR6A 4MW6A 1PCXA 2PKXA 1ZVKA 3G1TA 4V0SA 2RGYA 2J0UB 3HG7A 3O83A 4NRDA 3EWAA 1ONBA 5FBVB 4RXTA 3PRJA 4W7HA 3GDFA 3LFTA 4FHGA 4KZKA 2QN7A 3O3OB 5SYAA 4ZWNA 5A05A 1JAZA 1EH5A 1YRWA 2VHWA 5AM1A 2JCYA 1OBFO 1W4RA 1RWQA 3OZCA 1YQGA 4MYRA 5KNCA 5DOZA 2PXHA 3IP7A 1KZYC 4LVOA 3PQ6A 4RU1A 1UPCA 1KBQA 5FHQA 3V2IA 4LOJA 3HU1A 3B7WA 4ZOQI 3PC2A 2JFYA 4B35A 2XCLA 4IJQA 3H5IA 3IUNA 4NDAA 4UD6A 4EUNA 2JGRA 4JAVC 3F3YA 1MHTA 4AO7A 4X45A 1MQAA 5FJJA 1LI7A 1WCIB 4KPGA 1PL7A 3HWX1 4KVZA 1MFPA 1IRIA 5DYYA 5B7QA 1M6HA 4I2VA 3WGJA 3H3XA 4CGZA 1SHLA 1UP4A 4HWRA 1Y7TA 4TUYA 1JPUA 3C97A 3GL9A 3I58A 4YJDA 3SYLA 3TDMA 1W0CA 6PFKA 4GZ5A 2QTHA 4L7VA 2YWEA 2FPPA 3F6SA 1M1NB 1IY0A 1E1LA 1F38A 3OLVA 3QG1A 5CCEA 1S96A 7MDHA 5JXHA 1ISJA 1E2HA 2PA0A 4LJ7A 1P2TA 1I24A 3ONNA 4EUSA 1HWYA 2UUOA 2EBWA 5LZ9A 2B8WA 2B3DA 5K05A 3PLAE 1IDOA 1RM4A 4HUJA 4RIEA 3K92A 1QIEA 1D2RA 3C3CA 2I2AA 4FJ2A 3SNHA 5ILQA 5FD8A 2O7NA 3LDUA 2IYTA 3WL5A 1YOVA 4HD8A 3QKRA 2XVMA 5IKXA 1KWKA 2UXDB 3JX9A 4R9RA 4V0MA 2F43B 3SEFA 2ZROA 2RHHA 4FTWA 1N6OA 3OE5A 3GJ0A 1HMYA 2WHPA 3FTDA 1CUJA 3HCDA 1S2MA 5CA0A 3S28A 1XEWY 3UUFA 3HB1A 1Z83A 2C4MA 3WK7A 4BNGA 3PXUA 4WINA 2ASEA 3OU7A 5KX5B 3WTCA 1UJNA 3HKBA 3KYBA 4BUCA 2IDKA 3NG1A 3QTTA 2OHFA 3OPVA 4EJFA 5L8VA 1I7PA 2Q5OA 4L07A 4BFLA 4H7FA 4ER6A 4YGYA 1NXWA 1ORWA 3VO2A 5A02A 1AY0A 3U4AA 4PSVA 4C5BA 1XR3A 1YR7A 2GWHA 3HDVA 4MDEA 1YIAA 1TMKA 1SN7A 1R8QA 1SRQA 3BOSA 3PXXA 2IL1A 2XSZA 3VJMA 3FHLA 3ZWOA 4RDXA 2ET6A 5ES3A 1E1RD 5CHEA 2XBUA 3M8KA 4PSCA 221PA 4PZ0A 4ZZIA 4D3FA 1E1NA 2AN9A 4LCBA 3GFVA 3QU7A 5BQXA 2E4VA 4IKPA 1NXOA 4GD3Q 1RM5A 2B99A 3RUHA 4DDKA 1PWXA 5KNBD 2X0RA 2JZOA 1PJTA 3Q0EA 1Y5NA 1XNGA 1GKIA 1T3ZA 4QUGA 2JDIA 4UAUA 5FBRB 1VSBA 4F92B 3RSGA 4RF3A 2PRZA 1IE3A 2ZWOA 1JHRA 1E2PA 4DCTA 2QENA 3G2OA 3P0EA 5H82A 4Y6SA 3WX0A 1PW5A 2AMJA 2AQIA 1DSSG 5DULA 4CEIA 4MUYA 2J3DA 1NUQA 4JASB 4G0YA 4Q7KA 4RV4A 5AKGA 4XB2A 3IEUA 1RXUA 4MEBA 3VGJA 1YXMA 3T9DA 2FVXA 1E9RA 1VL1A 2IE0A 4MV3A 3FDXA 4RPKA 2D1YA 3ZC3A 3NDBB 4PZAA 5DF1A 3KAQA 1G9XA 2WTUA 1XO1A 5THXA 2O8CB 2JLZA 2FZEA 4JITA 3W4KA 4WQMA 1YZGA 1OI2A 3ND6A 4G0MA 1A8SA 3RBZA 1O8CA 2QMZA 4OAQA 3OZUA 3FI0A 1FFHA 1QYXA 4Y1RB 1OTYA 3IEMA 1UC5B 4G67A 4PNHA 4C4SA 4EF4A 4OHFA 5EUMA 5K5EA 2VEDA 4RHFA 2N1BA 5CA1F 2QRKA 4YC7A 3H1EA 5JAOA 3D1JA 1LXCA 1CP3A 3G2QA 1KMQA 2O2EA 1W0KA 3LT1A 2FFHA 4RWZA 5HJ5A 4QOIA 1GGEA 3NTXA 4UHJA 3C5WP 4C2UA 3QWFA 4YCCA 4TTPA 2O9JA 3JVIA 1JLLB 2WT4A 1GV1A 4KMRA 2PWAA 3GVCA 3H5TA 2DFVA 3OHMA 2X0FA 5IJXA 1MVLA 4MUKA 1Z68A 3RS8A 3SJBA 2WMYA 3TBKA 3TLAA 3WNZA 2DE0X 3BTOA 1F14A 2ECQA 2HQBA 4X95A 1E99A 4YT5A 5CNJA 1RXWA 4R68A 4IDHA 4YDRA 1JI3A 5C31A 2ZUFA 1G66A 2CJFA 5KYGA 1DBQA 4CMBA 1U31A 2WAYA 1NE2A 2OXEA 2VSQA 4IG4A 4PCUA 4IVRA 1UJBA 4B6SA 4E31A 1JJBA 2IW1A 4I1YA 5F5NA 3PYLA 1IBCA 2P8JA 2WW8A 2C92A 1Q95A 4B84A 5K4GA 3STHA 5LJLA 2DWCA 1HFWA 2QT1A 3JD0A 3QVJA 3CVOA 4XLTA 1WPRA 1ZBDA 2X6RA 4HNQA 3KNZA 2P68A 2XUHA 5DTJA 2QX6A 3LUJA 3UHPA 1BKDR 4MROA 3PEWA 4BNFA 5JWOA 2OUIA 4KYVA 1E3MA 1U90A 2H4FA 4NCHA 4AZTA 5CDSA 2BKUA 2MSWA 3LUHA 3KSDO 5L95A 3LX8A 3FCUB 4MQFB 4MYSA 3GJQA 1Z0SA 4A36A 4UEQA 3OM8A 3G6WA 3PNYA 3G3EA 3C70A 5KOJB 4XYGA 3TSYA 3UV7A 3AHEA 4GAEA 4RABA 4PQRA 2QLTA 3D4NA 4DV2B 4J6EA 3H65A 3SOZA 4JJGA 5D7BA 5K0FA 3M6FA 5MN6A 4NOKA 1O6GA 2A0KA 1NBIA 5B4UA 2CMFA 2A3RA 3NCTA 4O4JA 5AQEA 2BSXA 3O7MA 5K3CA 3VR5H 4MP8A 4J0GA 1NW5A 1TYDE 3F90A 3AJEA 1LF0A 1GEGA 2AYZA 3G5TA 3P97A 4IDGA 4UAGA 4W1PA 1BE6A 1WM1A 4O0MA 2WG1A 2JZCA 1QYDA 2ZYDA 3L2OB 3R0VA 1ESNA 3JQGA 5H8WA 1B3RA 2CMKA 3OMWA 1E5QA 4UFPA 2F1KA 3OC6A 3PNOA 1RSZA 3F47A 4ZAWA 3Q5GA 5KKAA 1UXGA 1SUFA 1XKTA 1ADGA 1ZDMA 1RU3A 4RDCA 2VXBA 3QPVA 3Q88A 2WVHA 3T0IA 4QGHA 1A9PA 4P7BA 4WK0B 2XAUA 3SJZA 3RAEC 2I91A 1R0LA 4JMPA 2PSSA 1W93A 2JLVA 5G53C 1P1CA 3WAJA 1TF5A 3WJ7A 5T67A 4BVEA 3P9KA 1FPQA 1X7WB 2OGSA 1ZIDA 1Z6YA 3HS3A 4HTAA 4OV6B 3AF6A 2B98A 3L0PA 1A9XB 1YHNA 2YZ7A 4H1UA 4PYKA 2QT9A 1O97C 3RJMA 3BK2A 1ND5A 3GFTA 1XU9A 3W5IA 4H2DA 1UMCB 2GS9A 1O94A 2Z8ZA 1BSVA 3DVLA 4UHKA 4WFJA 3GGJA 2TMYA 1X7GA 5IAKA 4DRXA 5BV1A 1K3FA 3S70A 1HM5A 4P6VF 4BRSA 4YB8A 4CF4A 1U5AA 2D1RA 1T2CA 1TJPB 3KV3O 1MJGM 1DKUA 3L5KA 3NM4A 3EXIB 4BNHA 3GJ4A 1ICEA 2EAUA 2FJPA 4N8EA 5F9FA 3UMJA 1M3SA 2PL9A 3TD2A 3CMMA 3DMPA 3QY9A 4WSOA 4AZVA 4J07A 5ALLA 3OFKA 4UTRA 1EWYA 2XIJA 3BHNA 4MV1A 3WDSA 5JIBA 4X6LA 1BEEA 2OGTA 3B51X 5C35A 3KV1A 5E4TA 4FOLA 1PJBA 4ISCA 5JCPA 3FFXA 4AO8A 4F1WA 4RZ2A 5KU1A 3ZV5A 1BVYF 2P6UA 4KQGA 4KL8S 5JWRA 3ZHZA 2GFQA 1EVYA 2WU3A 3NXKA 3WP1B 3NV9A 3P2JA 3ILXA 1I3CA 1P3DA 1HFJA 2GYYA 3EVZA 1P75A 1L5QA 1RMYA 3NMUF 5FI5A 4BLOA 5JDCC 2ICAA 4O59O 4IIDA 3A6FA 2K4MA 3G0OA 2XZOA 4M46A 1V1MA 5TGDA 4D02A 2I03A 2YMQA 3WLOA 3DYVA 1PBNA 2GLTA 3T3OA 1NVKA 2EZTA 3UUWA 2YVKA 2FG7C 2QWXA 3R5FA 3UAVA 3VOTA 4XQ0A 3LP5A 5EAIA 3WRWA 4JYBA 2EFDB 3MELA 4B74A 2BW0A 3JQBC 3SYNA 2J0EA 2FPPB 1W25A 2E37A 2PLNA 1LS1A 3KRTA 5D5HA 1C9MA 1PZXA 1XA3A 1K4KA 4G5OA 3RGWS 4TVSA 3TH5A 4JEHA 2AFHA 3U4MA 1OH5A 1IJEA 4GP7A 1QFMA 3KFLA 4Y9TA 5IAOA 3AGQA 1XLTC 3SR0A 3AVUA 3U16A 1E6LA 3OJOA 3QPUA 3UTDA 1D1SA 1N9KA 5BSMA 4BU0A 4YT2A 3V7FA 4RL6A 3SX2A 5GJBA 4HWOA 1HFKA 1DHRA 3K53A 1ZJZA 2P5TB 1AZLA 3BWCA 5AM0A 2V9PA 1RJDA 2BF7A 1N9GB 3QKRB 2Y68A 1E9VA 5IF9A 1X19A 2OYRA 3VMFA 4H4EA 1MP0A 1DKOA 4RDIA 2WQ7A 4HYEA 1A04A 3EZ7A 3Q6MA 2WNIA 2ACWA 2WHPB 4JJFA 1FRNA 2IF2A 1Q5PA 4RVGA 3OFNA 5AQ1A 2AX3A 3MBOA 1FUIA 3ZG6A 4YPVA 2O2DA 5E6RA 3N8KA 2GK7A 2X2PA 4C7OA 1Q7EA 1DUVG 3SYTA 5IAEA 3HKBB 2KMLA 4LISA 1I10A 1CQZA 2R6R1 3LZCA 2W6OA 4V38A 5IXJA 2O8EB 4H27A 4Q21A 5KHOC 4TMTA 2XYQA 2ZKLA 4EYEA 1CZNA 1QAMA 4RMHA 4OKSA 3OX1A 3ZCPA 1TQ2A 3OEHD 2ZUWA 1XEXA 3MZ0A 3BWBA 1UKYA 5IDYA 4US1R 1CULC 3VKUA 1Q50A 3IAM6 3PE3A 4GNKA 5A5GA 4CI0B 5FWYA 5LQRA 4BO8A 2OMEA 2XQKA 3Q7QA 2C84A 5JJKA 3ZVNA 3L7BA 1PUJA 4KQ2A 3DV0A 5EIAA 2GEUA 1A8QA 2PMFA 1J0XO 2V45A 3MRTA 5TB5A 4F7DA 1WZUA 3H3JA 1ZK1A 3CUYA 2J3EA 3RG2A 4XX1A 3NC4A 4TUYF 1NZJA 1ZMRA 2W8ZA 1J8QA 3DEIA 4MB6A 1YIOA 5CRIA 4KYTA 2ZE8A 4O25A 1MT0A 3HLTA 1ILEA 4FYMA 5T57A 5JR3A 1HZZC 5E38A 1N6PA 4P80A 2C4TA 3W3AH 5BSVA 5FORA 2NVOA 4GGMX 1DG3A 4CEIB 4YLEA 3QGMA 1FK8A 1V3QE 3MB8A 3W1WA 5M29A 1G98A 1Y8RB 2Q0HA 3T3PB 4MKXA 4WE3A 1ZLYA 2CEKA 3B3FA 1B8OA 2II6A 4PFKA 1P9RA 2RBEA 2XNSA 4UATA 3C8HA 3QEMA 1EZ4A 3FNEA 1YQTA 4PHGA 4H6WA 5FF9A 3SHOA 4GYJA 4PINA 3SHVA 2C42A 4FDTA 4KNYA 3E3MA 2JH8A 4G36A 3S2FA 4B8WA 3F7OA 4UE6A 5DLDA 4Y30A 1TYCA 4KR2A 2GCIA 3LLUA 2XOXA 5BSTA 4EF5A 5DHAA 4Z8XA 4N0QA 2H11A 1CB7A 1E2LA 3GU3A 4JYCA 4NAVA 5I9SA 1PZNA 3DLCA 4BPRA 4ND2A 3ZK9A 2YWGA 5CA0F 2ODPA 4GM0A 4ENPA 4ZDWA 5LQDA 1GDHA 4QPNA 1ZCFA 1LDNA 2YWXA 1Z4MA 4H4CA 4P8RA 4EYKA 1ZAYA 1HE1C 1CUYA 1U9CA 5LP6F 4AJLA 3IBFA 3E9ZA 3DMGA 2NT3A 4MS1A 5FYQA 1DQSA 1YOBA 2A9OA 3HCRA 4KG7A 4KXXA 2H3EA 3HY4A 2H1LA 4IH9A 4WOBA 2RHJA 5ALPA 1QDUA 1ZINA 4RF5A 1ZSYA 5SZHB 2C78A 4XR4A 4N3CA 5LZ7A 2ID7A 1SZCA 2DJIA 1XQ1A 2V0CA 4UOEA 2XT0A 2GM3A 4LZLA 5LQCA 1NSYA 2D8MA 2FFQA 2X9LA 4MLPA 1ZUIA 1DAFA 3CEMA 4L5AA 4QJBA 3HB0A 1UK7A 2MSNA 4X54A 2WTEA 2BI4A 2FEOA 5EJMA 2ID9A 3NBYC 1LBHA 3WYDA 1E3EA 1XLVA 2VOEA 1TFRA 2CXTA 2B69A 1WPXA 3OPNA 4HBZA 4OQYA 1Y9AA 4KGVA 3AY6A 3HUDA 1RYMA 2CLHB 4YRFA 1XEWX 2Y9MB 2JCBA 4AX4A 4CU2A 1BROA 3UH1A 1OAKA 2C97A 1JLRA 3JXEA 2IT1A 2QP4A 4AMBA 1CZKA 4KPYA 1OZHA 1J2TA 1MPXA 1IEVA 1XQ9A 1Z4PX 4WN9A 3RKRA 1RAGA 1QG4A 2FEWB 1RDFA 2OMKA 1RIFA 5K20A 1XNQB 4ZREA 2GETA 5FWXB 5HRAA 1CIPA 3KQYA 3RO7A 4KUHA 1VMEA 1IG0A 5CNIA 4C87A 1JG2A 5DYTA 2WLTA 1TCVA 2GHIA 4QODA 5ALNA 4E09A 5HS6A 2L0XA 3K09A 2G9RA 4LJYA 4RZSA 1GSHA 3UFBA 4OQDA 4RQTA 4XIFA 1EBBA 1KOFA 1UIRA 3KKZA 3KXLA 4JJ7A 4MAMA 4D6YA 1Z82A 5BYKA 2GLXA 1OH8A 1Q1AA 4LRUA 4PNPA 2C4KA 1UAGA 2HMAA 2VI5A 3RIHA 3TNFA 4UVIA 3COPA 3OY2A 4O4JB 5I7WA 3GZNA 4PC6A 2Q0XA 3L1KA 5F7XA 2FA9A 1VB5A 1DP4A 3MTEA 4LDPA 3ONEA 1RXVA 1PEDA 2E1PA 4HSEA 5FULA 2BE9A 1HORA 3T7EA 3UWOA 3E22A 3BMXA 3MCVA 5LMNB 5JS8A 3A6LA 2HMVA 2QP3A 4K0KB 5T4BA 3I9JA 4HYQA 3W7BA 3NAZA 1Y6ZA 4PYRA 3CVWA 4JYAB 1O6BA 2GCPA 1HEIA 4OQPA 4BLUA 4X1IA 2ZR0A 2XF2A 3DBHA 4MVJF 4AYWA 1L5YA 3AYZB 1VLLA 3TTUA 5A4JA 1P0PA 3PFIA 4W5RA 1K5HA 4KAXA 2WHEA 4BN5A 4WUTA 1LBTA 1A72A 3V32A 2QBYA 2PJDA 3EXEA 4X00A 1YDFA 5AYVA 2QJWA 4QPCA 4RXMA 3B1WA 3D6HA 2LR0A 3RAJA 4L02A 2ZG6A 3RHTA 3K2IA 3LY8A 3KZKA 4MGEA 3TO5A 3THWA 3LPDA 1QLHA 2PBRA 4AS1A 1GPUA 1PWYE 2FZ4A 3EEYA 1NN1A 4MX8A 4B40A 3FOFC 3CLUC 1YDEA 4E4YA 3I9FA 1VXRA 3DCJA 4D9CA 1V26A 3E9MA 2RKOA 2X41A 3HJUA 5DGHA 3EE6A 4LY9A 4QGSA 2QYHA 3AHJA 4PZEA 1QAOA 3BEDA 3GCWA 4PRZA 3UHJA 3TIIA 4HQOA 3DDWA 4R69A 4AMYA 1MA0A 1P17A 3CH6A 2PV0A 3E35A 4FK8A 1P2BA 4DSZA 2IYUA 3CJTA 4RK4A 1O0CA 5JPIA 1CUXA 3G7NA 1V7PC 4O4LF 1MT3A 1YB7A 2J9YB 3O26A 3O4IA 4MQBA 5M5BA 1CB0A 2I7XA 2OXFA 3FWPA 4ZHQF 3ZU3A 1CF2O 3TLYA 3N7TA 4MQUA 5JJLA 3WE7A 1CRLA 2P62A 4UKDA 3QRWA 3PGXA 2W2QA 4KR7A 1R66A 2KPOA 4FZ3A 4LZNA 3R9XB 2FP4A 1G8HA 4AIRA 3EXG1 1RQPA 1Z37A 1UDBA 1H0RA 2AFHB 1EAMA 2VCHA 3AZOA 3QBJA 4NMLA 3UJBA 2VKTA 3WYEA 1D09A 1Z5ZA 4OQFA 2M6SA 4HDSB 1R12A 3G8CA 1N8KA 1UOQA 4BBAA 1FLVA 1SXIA 2QXUA 1VYHA 2VHQA 2NZUG 3OIFA 5D6OA 1X1RA 1EFDN 1YRBA 2H8GA 2BAGA 3A28A 4LXUA 1U8UA 4FX2A 3WL8A 3IMFA 2I7TA 2NYUA 4YUAA 1NF8A 5L9AA 821PA 3KDAA 4ZEWA 2QE7D 2EX1A 2H7XA 4EFLA 2DOKA 2M9MA 2REBA 2YINC 1KO1A 1OY1A 2PPLA 1VFNA 3ENNA 3BRQA 3MIZA 4HUQA 4LHYA 3S6JA 1V3UA 4QTUB 5BMVF 3UWMA 3FCOA 3L0IB 4F4UA 3S3TA 1K9VF 3LXRA 3EVNA 1DELA 1RC8A 3FGPA 1OXUA 4Y9DA 2VK1A 4BMOB 3C3AA 3BSWA 2O1XA 3DDSA 4JP1A 3FMIA 5E6RB 4E03A 1M0SA 2D06A 2PO7A 4PU0A 3S68A 4IHJA 4C7OB 2BC9A 3EG9B 4RKQA 3TXYA 2WFLA 4L4UA 1L8QA 3LZDA 5NULA 4EKGA 5IVKA 3O2JA 3NT2A 2HU2A 5KWJA 3A1CA 4D9BA 2Y1DA 4OG2A 4U7GA 1MX9A 2RHLA 4IDBA 2GPAA 3HCPA 2PX8A 4BFWA 1NMXA 3HP4A 4IVNA 1N7HA 2I6GA 4V0ME 2XCSB 1IOWA 1XEXB 1Q20A 2R48A 3GLKA 4NHEA 3MG9A 3ORSA 1O9BA 4R40A 5F5LA 4ON9A 4KE8A 4Q1DA 1VGQA 4WBNF 1LW7A 2M1XA 4OHBA 3RJ9A 1FSFA 2PM8A 1WUKS 4YXWA 4E88A 4R1PA 3KSAC 2HLDA 3MOGA 4TKZA 4C2BA 3TE6A 4JMLA 5H0IA 2VPWA 2B4QA 3IP3A 4MIEA 1WHTA 1R18A 1TUBA 2F59A 4R51A 1G41A 1SOUA 2IP2A 3M1YA 5DW3A 4HGRA 4WESB 1EX6A 5JNLA 1NXSA 1T3SA 3QUSA 4H3HB 3UVEA 2P67A 2QHXA 5BP7A 5IT4A 1YGPA 2D5BA 1FIUA 3HLKA 4MUGA 3IUBA 2VQ6A 4N9WA 1Q0SA 1PS0A 1TA4A 1VE9A 4NCIA 3TQSA 4AWXA 4FZRA 3EGCA 1NVXQ 3T3DA 1UBUS 1AKYA 3G1UA 2Q2VA 4MPTA 3L92A 5EERA 3WBBA 1PR2A 3EULA 4QBTA 1MNQA 2UYQA 5CLQA 2CHEA 5BQ3A 2DCMA 2WJ6A 5DASA 1XSEA 5MFZA 4OI4A 3EVAA 1FFSA 1RAHA 1NI4B 2IHVA 4MGZR 4G5GA 1VIYA 3RHSA 1VHTA 3AJ8A 3WTBA 4EARA 5JCJD 4W5NA 1PTJA 3RAGA 4JLPA 2OV2A 2DU8A 3DLPX 4JR0A 3E7FA 4EY8A 2FWPA 3QIAA 4UTNA 2NWQA 5FNZA 5KREA 2IZ1A 3A1SA 1MDFA 4IO0A 2Z2YA 4RQBA 5JC1A 3I2IA 4IY1A 1VMAA 2JGMA 4P2GA 1FFBA 2HA5A 8LDHA 1G8AA 2MT9A 4P83A 3I1YA 3A1TA 2FWNA 4UOZA 1ABBA 2OO5C 1IXKA 3NRBA 1RP7A 4UFOA 5ERYA 1JBQA 1GL6A 2V6IA 4Z7NB 1D5WA 1P19A 4CL8A 1E96A 2C5LA 4HAUA 3O2QB 2BGNA 4OHZA 1QFXA 2UV8A 3R7BA 3R0QA 4MS1B 3AZPA 4LFBB 2GAIA 5AKKA 5JZSA 3G8DA 4Q1FA 1NQXA 3M33A 5EVCA 3SFTA 5ETJA 4JI8B 1JT2A 4L3OA 4UNIA 1J2UA 1MZVA 1DFHA 621PA 1KJNA 4KEAA 1CY6A 1Z2PX 1UEJA 1IQPA 2GAAA 2D5IA 5TJHA 1D5CA 1JSXA 2CLIB 3DL0A 4MUEA 4LVNA 3LCJA 3EAQA 5T4EA 3M2TA 4YUVA 3G0HA 2AKAB 1HZJA 1A7UA 1C0EA 1G8SA 3EVTA 5EIBD 1B76A 5J1SB 2GXAA 1H3EA 5TS3A 2RHDA 2VWPA 4KX3A 1QCDA 1E6EA 3IIMA 1BOOA 2YJ6A 3EZ6A 4QGBA 4FHEA 3X2EA 1MX3A 2EDAA 3LA6A 3QA9A 3X1JA 4BNMA 4G8JA 1GPWB 4Z8YA 1L1RA 1XMQB 1LJ8A 2VTKA 4HXYA 1VA4A 2IIQA 1M10A 3KSMA 4CEHB 2AR0A 1NAHA 1USGA 3ITEA 1NU6A 4QYTA 2W6JD 5C5IA 1H6BA 3MERA 4MVJE 3B8HA 4OAOA 4R9NA 2JJ1A 3A6JA 3NHWA 1GTMA 1JI0A 1WS6A 2L69A 4W9NC 4HNTA 1G5PA 1KTIA 2W4IA 4MHTA 3TG8A 2OFXA 3ILVA 1OCEA 2GCEA 2RGRA 2J31A 4X6XA 2HWXA 1YH3A 1LLCA 1PLLA 2AEFA 2WYWA 3DDHA 1SO8A 2QV7A 4I5FA 3SR4A 3FTCA 3ZE8A 4Q82A 5JSUA 5LDHA 3VU9A 2ERYA 4EHJA 5JXIA 4B48A 5BW5A 4L2IA 3ZE6A 5JZBA 3DXYA 1HE2A 4ZAYA 1DCTA 3HABA 3QHQA 1R0ZA 1RR6A 4P9NA 4G0XA 4QX6A 2V8BA 2JFOA 5IABA 3AL0C 4HEA6 2F6RA 4PR3A 2NZVG 3WKCA 5AUNB 3GN1A 1A2KC 3ETDA 2IY9A 3O2NA 2CD9A 4S1TA 2FEAA 1YJBA 4V3BA 2XDQA 3SKVA 2Q5CA 3D2AA 2CHGA 1XAJA 1XFDA 4GOKA 4G09A 2VUHB 2DQKA 2XWSA 4BNDA 3EGXB 4M49A 4UNRA 1MH1A 2QU7A 3A58B 1EFUA 1M7GA 1VYUA 4FDLA 4KVFA 3VYUB 3E22B 3UK7A 2FZCA 2NNLD 2DFNA 4UREA 1JVSA 3EBLA 2ETVA 4I3HA 3A1UA 4DGSA 2B36A 5CB4A 3W5DA 1SHTX 4Q16A 3ABZA 4CHTA 2ATXA 3F3KA 5DNAA 4MV5A 5J4LA 1BHQ1 1EFAA 2GH1A 1W36D 1Q0QA 2G72A 3D8UA 3M81A 1OV6A 4A8JA 4EG8A 5ITWA 4X1IB 3DBHB 4JI4B 3RODA 4BP3A 4JSYA 3FUXA 3AILA 4BO0A 1L5HB 2UYCA 1OT5A 4YMGA 4NP6A 4YI3A 1X0VA 4OJKA 1C0PA 4ENUA 4FFVA 1V4NA 2IEBA 2OB2A 3DR3A 4PZPA 4Q4AA 2DPGA 3DZBA 3TDKA 1WO8A 2Y1EA 3ZOKA 1A2BA 4QEDA 2QBYB 2A4MA 2WSSD 4UBMA 3N2GA 1NA5A 3WGNA 1JJIA 1H1LA 3CVVA 1V6SA 2OV4A 1KVTA 1O57A 4Z9BA 3KM0A 5AM4A 3RAPR 3W9UA 1MENA 3DF9A 1DRUA 4Y2GA 1NHGA 2ZBPA 5LOVB 1A9YA 4OFXA 1CUDA 4G41A 4MJXA 3AH8A 1QSGA 4U2GA 2XYGA 3THWB 1SBCA 1GKYA 1DO0A 3G5UA 1YV9A 1OLUA 1RM3A 2X1VA 1ZI8A 1ZG3A 2IZ0A 4I9HA 3TNYA 4DV0B 3Q7SA 4EVIA 2H29A 4QRDA 3ZQUA 5I7VA 3B13B 4RJTA 2ZJ0A 2J4FA 2DMRA 3IQFA 4KXVA 1DNPA 1DTEA 4OM7A 2B2CA 1NBMA 3TQFA 5J47A 4AJ1A 2JFBA 3P5SA 4RAOA 3HUEA 3PQ4A 1W87A 4XSVA 1SK8A 1IAQA 1RWKA 1ZRSA 2C2BA 4XWOA 1XHFA 4YAOA 4PZ9A 4CM8A 1QF9A 1UK9A 3CT4A 3FYUB 1KDRA 3JYLA 5FPSA 2QLFA 3C4QA 2I4RA 4EBFA 3EZXA 4RELA 4I9FA 4R2WA 1BDBA 3JQ6A 4LK3A 3ANXA 3SBOA 4U1RA 2D0IA 3FZNA 4NULA 5ARCA 1TMOA 1C9NA 1JU4A 3RS5A 1GNLA 1VCOA 1DINA 4BO2A 1Z5OA 1RYDA 4RPLA 3V2UA 3C4JA 1G5FA 3WLIA 4ZEMA 1KGSA 4NE9A 1XJ5A 3F2VA 2QSUA 4J0JA 2EF1A 1Z75A 4L9RA 2CNDA 5IZCC 2MDTA 3CNOA 5BV7A 1GZVA 4WMLA 2IGTA 2BFBA 4R8MA 4PY2A 3FMGA 1K5PA 3VVBA 4IIHA 1OE0A 4BC0A 4D56A 1WUTA 5KTSA 2K7FA 1QWSA 1B14A 2RGXA 5IH7A 1IZZA 2GZAA 1KH2A 2YASA 3HVKA 2YUTA 1LFAA 1N6KA 3EXHA 4MJ3A 4KRYA 4OQXA 2ECPA 4YXFA 4EQZA 2H52A 2NUBA 4NU8X 5AVSA 3I8SA 1JBKA 4J9VA 3D0OA 2G6BA 4XTRA 3TRDA 3A4MA 4FI3F 4JB8A 1QCZA 2JLAA 4HUQB 1PRYA 1NJGA 4URWR 3MRSA 5HIKA 1OJ7A 2OR3A 3HL4A 1W1UA 1Z06A 3FW1A 4MS3A 3T4XA 2X7HA 3G82C 4YMUA 5AVUA 1IHDA 1K7XB 1T5IA 1NTOA 1V9CA 1HDOA 2G08A 5CYGA 3GEPA 4AJPA 4E4RA 1EP2B 2WFLB 4CDRA 5C2JB 1XKXA 3IP1A 2BFMA 5CFPA 3I1JA 3L77A 3T06B 3KLNA 4IKEA 1VPDA 3DL2A 4EMUA 2HDOA 2NVBA 1RAEA 4POAA 3OPMA 1YJ8A 1MRZA 2WWIA 4RMJA 5JMTA 3G2JA 1O95D 2BJWA 3MJCA 3ZD7A 3ZXUB 4QBIA 4XVUA 1RLUA 4DWVA 3TGPA 1ECGA 2FFAA 2FRXA 4JBHA 3KETA 3DJFA 3BXFA 4IJWA 3HR4A 3S1AB 2A5YB 5SYNA 4CW7A 1I94B 3CJRA 1N3LA 4J91A 1WHTB 4RD4A 1TUBB 5EWMA 2Y05A 4YJ2B 2Z2IA 3P9XA 2JAPA 1WXWA 1EVJA 2PU5A 3I4LA 1NULA 1DT3A 2XUPA 3MK31 4HL6A 2ZI7A 1THGA 1OHHD 4L8VA 4BGUA 4F3NA 1SQ6A 3FZQA 1P18A 3FDJA 3IAM1 3HNRA 1ZGCA 4IIJA 4L16A 1K7SN 4RPJA 1YKSA 4MR7B 4ARZA 1D8AA 5CITA 2IYFA 1N5IA 5IJ9A 5HUJA 2WT8A 1GPBA 1T13A 5D86A 2ZTVA 1EDOA 1US8A 4E21A 2J7PD 4AUMA 5C1DA 1OREA 4BV2A 1NN5A 4WBSA 3VPXA 2K2WA 1NXQA 3TPFA 3HDQA 6ABPA 4WECA 3JAMA 3CF4A 3W0LB 4ZU3A 1FB5A 4XWKA 4R2LA 3ZHYA 2IA5A 3BB4A 3EZFA 2VDWA 4LC0A 3SJUA 3KD2A 3N39C 4E1BA 1TJ4A 1RXEA 2FSUA 4A0FA 1GDDA 1QZUA 3RHZA 2NADA 4MUXA 1Q0UA 2W58A 3IDOA 3PHCA 1JTEA 2R8PA 2X8AA 4GFDA 2P9QA 3IBCA 1GQFA 1RRFA 4AJ9A 4OXXA 1GGNA 1UPAA 1YHZA 4JB2A 4Q7JB 1OZFA 3QKSB 1KJIA 2HX1A 1H3FA 1T0IA 5AXAA 5H16A 1E98A 4CE6A 3HI4A 4GSYA 2C31A 2G4VA 4N03A 4IHJF 3S7TA 4YRBA 4B3SB 1Z18A 5JU6A 4DMCA 3W78A 2PRJA 3WGOA 2J67A 2FW1A 3R44A 2QLJA 2BFPA 4WEQA 1JIIA 1WSBA 2FKNA 3AB8A 3PNMA 3WLTA 1I2MA 1I1OA 3FYTA 4HLDA 1YUBA 3LX5A 4LAFA 2FCAA 2VPXA 4Z1MA 3GPIA 4AWAA 4Z4EA 2ERCA 1P9LA 1UT6A 2EFHB 2YFHA 4UBKA 1Z6XA 4XE5A 3B3GA 2PUAA 1QHIA 3RUEA 2C5HA 1RACA 4GXNA 3CNLA 1SZJG 2WA1A 4D9KA 4ZTUB 2DPXA 5H3CA 3P26A 2ZJZA 5DLQC 3TLMA 3V80A 1T2FA 4EKEA 4RK7A 4RH3A 5B58T 3L3BA 2CFIA 4AY4A 3DD1A 2XVZA 1UAYA 1K5DA 2WUFA 3BFKA 2AN3A 1D9XA 2FSVA 2HWUA 3MT0A 1AC5A 4CR7A 2DXIA 4O2BF 3NQ41 3CEHA 1ENZA 1ULAA 1V6AA 2I6TA 2Q7DA 2Z08A 1R4NB 2Z8YM 2QD2A 3LA8A 3U3MA 5ADUS 1GILA 4ARUA 3RSCA 1ESEA 3A3KA 5CNKA 1VMDA 1S3GA 1QE3A 2V7XA 2B4KA 1TZKA 3KT3A 3W6UA 2CB0A 2JCXA 1MC8A 2D7JA 5C5DA 3DC2A 1FP1D 2OCPA 5KSZA 2H9AA 2ZBDA 4QJ4A 1BS2A 4EG4A 3ADDA 3WIEA 3VNRA 3CZ4A 4DGQA 2OOSA 4JXZA 2B4RO 1DQPA 3TX6A 3Q6NA 4EK9A 1P8JA 1RHMA 1QH8A 1TLLA 2I66A 1WKCA 1CUVA 2AL7A 2ROQA 2VYFA 3TINA 1PJ8A 1R16A 3VU9B 1KVQA 1TO1E 5LZ5A 1MG5A 1KYIA 3A1WA 3BICA 3GV0A 1SIWA 1KOGA 4DLAA 4BKRA 5A7GA 3MTBA 4CXMA 2I71A 4KE6A 1MEJA 1IUOA 1S8NA 1JNXX 3LVQE 4JC0A 3VNSA 4A2QA 1LQ2A 4U7HA 4ENTA 4O63O 1AHHA 2NZJA 1BTOA 2ZRKA 3NALA 3GCXA 1VPVA 4GQBA 5LLTA 2XDQB 4M99A 4AG6A 4QICA 4K05A 2QAGA 3UV6A 3VAYA 3M3HA 3HNOA 4BNDB 4GX1A 2MU1A 5CR9A 1IHOA 5FWNA 1XVLA 2I55A 2G9UA 1F0KA 4J6FA 4TTVA 3HDTA 3IV6A 3QJ5A 3ZV6A 4YAEA 3DTVA 3QFRA 1V8DA 2VXYA 2WVJA 1XJQA 4ZVLA 2P1RA 5IXYA 1A5ZA 2IHYA 3W4JA 1M1ZA 3RIEA 4A8JB 4UM5A 1QHHA 2P27A 3OJEA 1FTSA 3OZAA 4AIIA 4C4AA 1F6BA 1U9ZA 1UXHA 5J2TA 2AX4A 3BE5A 3ZBTA 3QXSA 4BQPA 2DH5A 5EJ6A 1DAPA 2BGGA 3GC6A 1GGHA 2X8WA 1PD1A 4PC7A 2HIHA 5L3SA 4Q4AB 2P9EA 4HQ0A 1E5LA 4F4IA 2AQHA 2WYHA 3CYFA 3N59A 1G0OA 3D4BA 3N2GB 3QM1A 4GPEA 3CN7A 2R0QC 1H1LB 3TPZA 3FPFA 5AIBA 2J6HA 3DL7A 4WCFA 1TKRA 4ZJPA 2I33A 2V6JA 3EASA 4Y7CA 3I62A 1CRPA 3RG8A 2PSHA 1C9YA 3DYIA 1W88A 4TTSA 3AR9A 3PQ8A 1PT6A 5I8WA 4RA9A 5EQJB 1MZPA 2HWKA 1OLUB 2VCEA 2A9FA 3ZUPA 1KR2A 4CNQA 2MMCA 1U2GC 2W6ID 1BN7A 3DHWC 1EX7A 1HSZA 3ZWVA 5ALGA 5CG2A 3F8TA 1MOPA 4CF5A 2BSQA 1PT5A 4CIYA 4NMXB 1P1HA 1TC2A 5AI9A 2JFVA 3DBIA 4IX1A 5KYVA 1DCFA 2XB4A 1S89A 3PXCX 3PBKA 4EVSA 3VJKA 2WQ6A 3E1GA 5LYYA 5ALQA 2P1DA 4CM8B 3Q1KA 5HR5A 1T26A 4PO1A 4N39A 3GLSA 3C5EA 1TCBA 2R8BA 3BD7A 3LTEA 4BNYA 4YJ3B 1N2BA 3KJFA 1WSAA 5TF0A 1OH7A 2C5SA 3SDZA 2M6LA 3A1EA 2IJGX 5JVDB 3L18A 4WKPA 4TWBA 5JJBA 2GBLA 2PQMA 3GI1A 1J5EB 3A6DA 1E4YA 2PD4A 3BPSA 2YWBA 3AW9A 4I46A 4TXLA 4BFCA 4HDAA 1X0XA 1XAHA 2P9GA 3MUNA 5CB4F 2UUCB 3DC7A 2R00A 4M9QA 2W2NA 3LF1A 2C2WA 4LNUA 1XHLA 1KXJA 3B89A 3RVOA 3M3DA 4KXLA 1BH6A 2AG5A 3B1YA 3QFSA 3WMXA 2I2WA 2XDWA 3A1VA 1T9KA 2QM8A 3IV7A 3H5VA 4ARCA 4PS1A 5EHQA 3W90A 1NTRA 3HZZA 3OE7D 2Z5GA 1U0OC 4KTTE 1HNWB 4WWHA 1DCMA 4C6TA 3GJXC 3NXSA 1ULHA 3IUYA 4G9BA 5IC5A 4DLKA 3KOOA 4V1CA 3OQNA 1P72A 3AHDA 4EY3A 3E84A 1Y9EA 4I36A 4OU4A 4BLPA 1KPIA 3ASZA 4M60A 1I3NA 1S8FA 1SKYE 3UHFA 1CDOA 4AX8A 4ZVPA