2XLIA

Crystal structure of the csy4-crrna complex, monoclinic form
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
189
structure length
167
Chain Sequence
FTMDHYLDIRLRPDPEFPPAQLMSVLFGKLHQALVAQGGDRIGVSFPDLDESRSRLGERLRIHASADDLRALLARPWLEGLRDHLQFGEPAVVPHPTPYRQVSRVQAPERLRRRLMRRLDLPFVTLRSQSTGQHFRLFIRHGPLQVTAEEGGFTCYGLSKGGFVPWF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CSY4 ENDORIBONUCLEASE
publication title Sequence- and Structure-Specific RNA Processing by a Crispr Endonuclease.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase/rna
total genus 36
structure length 167
sequence length 189
ec nomenclature
pdb deposition date 2010-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09618 Cas_Csy4 CRISPR-associated protein (Cas_Csy4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2540 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xliA01
4AL5A 2XLIA 2XLJA 4AL7A 2XLKA 4AL6A
chains in the Genus database with same CATH superfamily
5B0EA 4ZVHA 3M2UA 1RHKB 2DCLA 3HSJA 4RUBA 1U0SA 2HAFA 3KUGA 2FJXA 3Q23A 4DG1B 4YB7A 2DRDA 3QLHA 2OFHX 1GMWD 2YX4A 3CXCR 1V3SA 5E3PA 2NQPA 4QW8A 4M5JA 5HMXA 3FSYA 2LA4A 4WJBA 3KK1B 2YKMA 2J0SD 5A8KA 3GIKA 2AW0A 4CLZA 4JB8B 3BBFA 2OD4A 2Z56B 2WW4A 4OYXA 4HVZA 3MGJA 5DG8A 2QL7B 1R8HA 3U02A 5CZVA 2P9EA 3IM9A 2QV6A 2VQEF 4KRWA 1FRJA 4LF4J 2ADCA 2CNLB 3HPOA 3TUZC 2H9ZA 4JI2F 2JLEA 2FC9A 2M2BA 3DGPB 5IQQA 5IWAF 1KHVA 1QAJA 2KU7A 3H90A 1CJKB 5LXRA 1NDPA 2ZJQQ 1NRKA 1S4FA 1UETA 3NGUA 2DNMA 1W26A 1HR0F 3ITHA 4TQRA 4DU8A 2OGUA 2YWHA 1GXTA 2ILYA 4QJVA 1QAXA 3RRKA 1S6PB 3EMTA 2UP1A 3QT5A 4ZKAA 3DLKA 4A8SA 1JLCB 2G13A 1IKWB 1P1LA 3LGMA 2LYVA 3EE3A 1MWQA 2Y1JA 1DTQB 2MSSA 5B0CA 4OI2A 1CJVA 4YN3B 4CTAB 3BGUA 1PJ6A 2AJ4A 1V6HA 1IR2A 1Q5VA 3BKFA 3AH6A 1R0BG 2C1EB 2DGUA 2YKNA 3IGNA 2WK4A 3DLEB 3HP6A 4AD6A 3IWLA 2RDIA 5B0GA 5LMUF 1EAYC 4ECZA 1I1GA 3MD1A 5GAEI 3DHXA 3EM1A 4IR9A 5DLFA 1GAOA 2QFJA 2EFPA 1UVKA 4Y6IA 3HT3A 4DV4F 3BPSP 2IBOA 5HVFA 3SV4A 3H5XA 3OTOF 2ALYB 3CD0A 2DH9A 3SCKE 3AXKA 2NZ4A 3M8WA 4I6WA 2QA4S 1FDNA 4RW6A 4R0EA 2NUUG 3TA1A 4NL5A 3CCLS 1L3UA 3FVYA 1N56A 3ZZRA 4GVBB 2FZKB 2BE2B 2BXJA 1IKYA 1S49A 1X4CA 3DRSA 4KKOB 4EFAC 5D15A 4ZCLA 2N3OA 1HNIA 2WBRA 2HQDA 3GIIA 2WSEC 3IRXB 1XNQJ 1FA0A 4Y34A 5LL6d 3DMJA 3FC9A 3ZXWA 1BE4A 4QU6A 2OIHA 1YLXA 4PG8A 3UFCX 1IKXA 1XWLA 1N36F 1EQMA 3RTVA 1VRTA 4JI3F 2BQ3A 3QT6A 5EGYA 5IFMA 1B64A 1X4FA 4NA3A 1CG2A 1GXLA 3V2UC 4OJGA 4CNYA 3CJ4A 4Q0BB 2HNZA 2HGMA 2ZDOA 2D7SA 2DYAA 1B7YB 1KSPA 1FJGJ 1FXDA 3K5PA 3QYYA 1Q0NA 1XMQF 4C0BA 1B3TA 2M8HA 5KOWA 4QR2A 3R2CJ 5IZHA 5DDQC 5THWA 4CLUA 4XO0A 1W2IA 4ELVA 5B0DA 1S9EB 1DTTB 1NJYA 4WYLA 2MKSA 4ZPBA 3HZEA 2HZCA 2XGPA 3NGRA 4KB7A 5J2MB 4WFNQ 1C0TA 4NWBA 4NYPA 5GAGI 3RW6A 1LV5A 4FVCA 1L3KA 2AQ4A 1UL3A 3OQ2A 2RQMA 2RDJA 2UUAF 3R6GB 3SQGA 2FYXA 2CZ9A 3MCMA 2G4BA 4F02A 3DOKB 3BN7A 2YNFA 1FWLA 3M32A 4TQSA 3BO2A 3DOMA 1NJWA 2D9OA 2JOQA 2LXFA 3EVMA 3GLJA 2RT3A 4WWSA 1U47A 5LJ3Y 5J2QA 3HK2A 2V6AA 3MOJB 3CC4S 4RX6A 2H51B 5G0RB 4DCJB 3IBCB 5HROA 1XBWA 1VJQA 5L9NA 3E01B 4I2QA 2PGCA 1RWKB 3W5ZA 2RKIB 4JI4J 3M2VA 4R8UA 3UPFA 4J9OA 3HJFA 4M5LA 3GR1A 5K8PA 2VFVA 2R2UA 1HYSA 4ANCA 2J6TA 1RLCL 2KN4A 3QIPB 4ID5A 4P74A 2RB7A 4QYZK 1W7WA 5C24B 5ETPA 2K3KA 1X5TA 3GG0A 4X62J 1J27A 1PO6A 2KZZA 1XJWB 2JEJA 2LXIA 3DU6A 3P4UB 1EP4A 2VC1A 1UA1A 1AA1B 4UY85 1IJFB 2AP6A 2PMHA 4GKJF 1T94A 2HFNA 1WC1A 4ECQA 3MEDA 2R8HA 1Q81T 4O3RA 2NSBA 2Q6CA 4F8RA 2A6MA 3QNWB 4PYDA 2CVIA 1N54B 5CHCB 1G1XA 4YB6A 1M5KC 4IDKA 1L3TA 4C3LA 4PKDB 1AXQA 2BUNA 2QIFA 1VS3A 4RWXA 2VA2A 2IRUA 1R8PA 3R8YA 1VQSA 3CCQS 1TK8A 5CH7B 1KOOA 3THPA 4CM0A 5A8RB 2GJ2A 1ZS6A 1M5OC 1WEYA 2XYGB 4OYMA 3NMAA 1O51A 1WKLA 1NU4A 3T1YF 3OHBA 3VAGA 2IM1A 4IFYB 1Z2ZA 4LQ9A 5FLXU 1RWVB 5L1KA 3TP2A 2X1FA 1K73T 2V63A 2UXBJ 3TX8A 3KJFB 2VB6A 1IUJA 2EFQA 2B9EA 1JKHB 3T1HF 4ZVGA 1RT2B 3QJJA 4X65J 2AJQA 3GTYX 5F8LA 1TL7A 1HD0A 1OY6A 2ZH5A 2UVWA 3NMRA 4F2RA 8RUCA 2IM0A 4ZVQB 4BWJA 2V4RA 1ZM9A 5KT4A 4GKKJ 2HSEB 1H72C 3M2RB 3H25A 2GW8A 2HQGA 2GIQA 2VBXA 2D3ZA 4JI8J 5IC6B 1UZHA 2P6TA 5CCLA 2C2KB 2F63A 4IFVB 2IFXA 5AE3A 4DX8H 1TK5A 2PSZA 2PD1A 5F8HA 3BO3A 1I51B 1N48A 1AFJA 5HP1A 2CDQA 3C6TA 5SUHA 3R5GA 4FBUA 5FIIA 1WTBA 1VQ5S 2J76E 4KFBA 1EJ7L 2EC0A 4XK8C 3AB4B 4LT6A 2HRUA 1RAHB 1ELOA 3DDNA 2KVIA 1T3NA 3UD3P 2EBEA 1NSQA 2VFUA 1RA6A 2FY8A 4TU8A 2E5HA 1TL3B 4LFCF 3RJMB 2HQCA 2KHCA 2E1PA 2V4QA 1TELA 1M5SA 1NKCA 2PC6A 3C8YA 2XEXA 4Y3CA 1SL2A 1QM9A 3S1TA 2AIRB 4FBTA 4N8NA 2Y3YA 2KB2A 1D9FA 3HLUA 1IBKF 3TO8A 2RD5C 5ETQA 4PG7A 3BB5A 4FF1A 1BUXA 1BWVA 4A8FA 5CQGA 4OI3A 1UVJA 5DLGA 3M9NB 3MPDA 1MU2A 4WBFA 3T6BA 5L38A 5AE2A 1S1VA 2XYHB 5DQHA 2RH3A 3D0IE 2C2ZB 2ZH6A 3JXOA 3ZZYA 2HNDB 3UN3A 1GXUA 1U8WA 4USTA 1LW2B 1LFPA 2W24A 1TFYA 1K0TA 1JJ2R 1CBKA 2BJ3A 2HVHA 5DG9A 2V5HG 4M5NA 2UXCJ 2HS4A 3VVUA 4J7CA 4ZP8A 3UDEA 1L3VA 2DJWA 2IMWP 4O0NA 4DV7F 3V4IA 4OV6A 3OTBA 4P7VA 1RTIB 1UPMB 4LR9A 1TU0B 2ILZA 4OHYA 4F4AA 2W2QP 4QIGA 2NYHA 1HBOA 5EWGA 3V6DB 1YRTA 2DR5A 2BW2A 4K0KJ 4I2PB 1IR0A 4U96A 1HARA 2CXEA 2D3O1 2CQIA 2AYMA 5SZTA 1ZPWX 4X4PA 3I56S 1RT6B 2JWNA 3NRBA 5KG5A 4LF6J 2OEMA 5F8GA 1EKSA 1YJUA 1VQMS 3O3LA 1Q79A 2YXLA 4QWCA 1TV6A 1Q7YT 3KNAA 1ICEB 4MAKA 1TK0A 2V8GA 1N34J 1U1PA 2E7XA 1X9MA 1X60A 1WELA 5DDRC 1REVA 2ZNZA 3MMJA 3KLHB 3RR7A 1RAAB 1BC6A 1RE1B 2AYGA 1LWFA 4OYPA 1HIYA 2W4CA 1TKTA 4O44A 3AJ1A 4B3MF 3UD4P 2BVZA 4RL1A 2OP5A 3DDKA 4ED6A 2KH9A 3HSZA 3SDEB 3FZBA 2B7CB 3N01A 2R7OA 1NPPA 3FQLA 5AXKA 2VQEJ 3D66A 4JI1J 4ZHRB 5H9EK 2M4MA 5DGBA 3HHEA 2WSFC 3CE8A 1PBUA 5IWAJ 3UI3A 1AZSB 3RUBL 2CUYA 2RRAA 1UJ4A 3I5CA 1U7LA 4KC5A 1GQEA 2HHXA 4LIWA 2VG6B 3HXMA 1RCOB 3EGVA 4OIXA 3I6PA 1CJTB 4ER8A 2VOOA 1R43A 4Q43A 5F8MA 4E8UA 1N52B 4FXWA 3LO3A 4C2MA 1UW9A 4U7CA 4X64F 3KK2A 3B4MA 3HO1A 1U0HA 4A8OA 3D1QA 3QGPA 4OHVA 2O66A 1RAFB 5K9FA 2UXDF 1QVFR 2DBBA 3HFKA 4USVA 4LFBJ 2ZZTA 3PEJA 2W2PP 4KT0C 4ERDA 3OVAA 2Z30B 2ZC4A 2IVFB 3VQTA 2G0CA 1WACA 2K2PA 4MKVA 5ETKA 4OYAA 2LQ5A 2KHDA 3E51A 2CQBA 3SSSA 1SBRA 4I67A 4KHMA 3DLGB 4ECUA 4LSLB 3MD3A 2V2KA 1KKHA 1U6BA 3MR2A 2HBYB 1X0FA 5B7WA 5KT5A 2P2CB 4ZP6A 1IQTA 1D09B 1U45A 1WI8A 1QUPA 1IXKA 1VHIA 2PI5A 4ZP9A 4F36A 3HVTB 3MEGA 1RYSA 1TVRA 2IC3B 4B3OB 4YY3F 1GMWA 1NH8A 2APOA 4H4OB 3OTOJ 3PCOB 4DL5A 3PNIA 4ZN3A 2OEJA 2GV1A 1G2EA 3KG0A 4QQBA 2FVRA 4ZLNA 3EPIA 1CS4B 1XEZA 1W2BR 3OL7A 1HQEB 1XR6A 2NSCA 3M8QB 5D4OA 3JSMB 4ZVRB 1FESA 1YRXA 2HIQA 2IYGA 3TAMB 5A6WA 3W8GA 1TL1A 1E6YA 1DZ5A 5E41A 5KFBA 4DSJA 1KFSA 2IA0A 4KO0B 4M1KA 4DV0F 2CVEA 1RWMB 2EFOA 4KQZA 4ED8A 2F3JA 2QMUB 1SJ3P 2L3MA 3MWBA 2OMOA 3D2WA 1WHVA 1F3FA 4BS2A 4HI1A 2OPPA 2R8IA 1N36J 5ETNA 2KXNB 3FUYA 3SMZA 2DCUB 1HNXJ 3NY0A 4UZCA 1UP1A 5FJ4A 1QTNB 3IAS9 4F3QA 2DNZA 2ZE2A 1HBNB 1G4CA 4HTJA 4UOCA 5C42A 4UY8T 1KDNA 4DV2J 4Z7YA 3LQVA 3A3PB 2E1CA 3OXGA 5I42A 1QY7A 4RZRA 4FXDA 2CIMA 3CJ5A 2P5VA 3L7OA 2E9RX 4WXWA 1RWOB 2KYZA 2G1DA 3CO0P 1U02A 3N28A 2AEJA 3SCIE 4X66F 2VD3A 2MZQA 1R8BA 3W2WA 5AJ3F 3W1YC 2SXLA 2VG7B 3BSAA 4ES1A 2DR7A 4NYOA 3GFXA 3IBWA 3TZZA 2Z0GA 4USUA 5KOXA 1RK8A 1JLFB 5DZ6A 4LSZB 2OPQB 4LRAA 3NNHA 4Y2KA 2CJ9A 3KXDA 2HFVA 4HTIA 2ZUGA 2MLZA 3TAQA 3MHYA 1BGXT 4NLSA 1HI1A 3IN5A 4DQPA 3V6KA 5D3GB 3AOBA 2FJWA 1UMJA 1GX5A 4DG1A 2RRNA 4OX9F 1YJ7A 3CWJA 4QZVB 1CJUB 4CO1A 4YMEA 2DEJA 1S1TA 1SL1A 3EDRB 2EPIA 2PI4A 3R5CA 3TRGA 3VAIA 1HNWF 2LDIA 4ECRA 3KNGA 2C3PA 3P96A 3N6NA 4HHJA 2ZBQA 1Q1KA 2VG5A 2MB0B 2WSCC 3LWMA 1YG0A 4IO9Q 2HYIB 1FRLA 1NO8A 1TKZA 3NOGA 2IJRA 3GJSB 3EGNA 4P52A 3CD5A 4LF8J 2XHWA 1M0SA 3K8VA 4LFAF 1PIEA 4ECTA 5I4MA 3M1VA 3MDFA 3PYGA 3PJ9A 3OD2A 1FT8A 1YBUA 4HDGA 2FVCA 3EVWA 3PW0A 4DF4A 3UVJB 4AQYF 1S57A 1UVIA 2VICA 3MOZA 4LRDA 2KI2A 2MKCA 2XY6A 4B9VA 3PO4A 1NMEB 1S6PA 2EW9A 2VQFJ 4ELTA 1WD6A 4L74A 2HHPA 2AF6A 3CF5Q 3CCSS 1XK8A 3AAWB 4U7UD 5JMNA 1DTQA 1V5IB 3FCWA 1SJFA 3POTB 4ETXA 3W65A 2VIHA 4CTAA 2IVMA 1VQKS 1NPKA 3UDLA 4DR5F 1S10A 4R0JA 1KC8T 2HVZA 5C5JA 3H2UB 1HFEL 4A8KA 2DNGA 1NK6A 5FLXY 3T1YJ 2MHEA 2I0XA 1C4CA 2B4UA 3OVSA 1TKXA 1JLEB 2J9EA 4MK8A 2RILA 1QVGR 2FPHX 2B6AB 3DRYA 1R0CB 1S5ZA 4FNIA 3OW2R 1VLOA 2YNGB 2C2MB 3QATA 3L7UA 1R27B 2ATCB 3OL8A 4G1QB 1OYDA 2R3VA 5CYMB 4ILMA 2ZOGA 4IH5A 2RSQA 4PEOA 3OFEA 1IBMJ 5KFXA 1GTHA 2H3EB 3TUPA 3Q24A 4LRCA 5KG1A 4V19X 4TNOA 1RKJA 4CI0B 4Y0FA 3QFWA 3T5KA 1HQ2A 3PRDA 1T9VA 4TLQA 3IA0A 2Y1IA 1RA7A 2U1AA 1FRKA 2JDJA 2CZVC 1T95A 4B9MA 3K2YA 4GVBA 1KLMA 2H5EA 2DHSA 2W25A 2CQ0A 4KKOA 5FDLA 3QZ7A 5E3RA 2GNKA 4ED7A 1WUUA 3DU5A 3DM2A 1O6XA 4P75A 3N79A 2HVDA 1CULB 3VTIA 4PXDA 2V8HA 1VQYA 3O6QA 3MEKA 2RAQA 4DR2J 5E2QA 1M1GA 1CEZA 4X84A 3J7YI 2AU0A 3QT8A 2B8PA 4WPAA 2HHHJ 3IMQJ 1XR5A 1Y9OA 2ZEJA 2BR0A 5HO4A 1VJWA 3KJQB 4E98A 2AWZA 3QZ8A 3PR4A 1TAQA 3PJXA 3O8WA 2HWIA 3LH2S 3Q22A 1VQ8S 2ZOMA 2J9DA 1ZH5A 1NHKL 3NWGA 2UV8A 2MKKA 2W2MP 1VIXA 2EFNA 2V2VA 4Y28C 1PBAA 2VC0A 4ZK7M 1LK5A 4MIBA 1NK0A 2UUWA 3NLCA 3R5JB 4UW2A 1S9FA 3OUYA 2GGPB 2F65A 1H2UX 4JI5F 4B3RJ 4CZCA 5KFYA 2DGXA 3MM7A 1QD1A 1JLGA 4DUZJ 5E3AA 4DWIA 2ZNYA 3MR3A 4DFPA 1X4EA 2CJYB 4OI1A 1EB0A 1HL6A 4X4RA 2GVZB 3H2LA 2HHSA 3SIPB 5J2MA 3H20A 3DYAA 3HSGA 1WC6A 3DLJA 4DR4F 4KTQA 1MMNA 3MAAA 1XERA 2HMIB 4CO3A 4C11B 3VZHA 3JYTB 3CMES 2JNJA 5GAHU 3R3TA 3CB4A 1CLFA 1FNOA 1H2VZ 3MECA 1S0MA 2PA3A 4DV7J 3MUMP 1NB2A 4DN0A 2XM3A 3IR7B 2VJUA 1S76D 2FJVA 2EK1A 2FGCA 1QE1B 2RHQB 2IRYA 3ZZTA 4CLWA 4ZPCA 2Z2LA 2N3LA 5F3TA 1UJ6A 3E01A 2RKIA 1D9DA 4HKQA 2JRSA 1ZZFA 2AD9A 3D3CJ 2OTLS 3IGVA 4NLRA 3NCPA 3MUVP 2CPYA 4DUYF 1L3SA 4ECYA 1S1XB 2QMWA 2ZWOA 4USHA 3QIPA 3PFOA 1P9QC 2AZ3A 3T9ZA 3OPKA 5C24A 1NZ8A 1FK9B 4CH1A 5CYQB 2GCFA 2V50A 4QPTA 3HZGA 1X8DA 5L9XA 2ROGA 4DU7A 1Q8IA 2PEHA 2V0NA 4Q7AA 2PFDA 3HKZD 2BKOA 3LTOA 1O5JA 4E0DA 4F0KA 1RAJA 3QWUA 4PPDA 4ZIWA 2ZZNA 1KLNA 3PHEA 3QGGA 3GYXB 2CJKA 3M8YA 5KFSA 1YJRA 2LEBA 2N4DA 2FVPA 2G2ZA 4LF1A 1F6TA 5A8RA 4NCBA 2QO3A 1AYEA 1FFWB 2PO4A 4OFZA 3V6HA 1H0HB 4YOEA 4KGXB 4LF2A 3GMGA 4PWDB 3FMWA 3QT7A 2M5YA 4XPEA 3HHLA 2Z2YB 4X64J 5IQ6A 3BQ2A 4DV1J 2DNOA 1N6QB 3JQMA 4LF4F 3LANA 4R5PA 3I0RB 1DRZA 3KLGB 2QLJB 1U48A 2FY1A 3W7BA 2MLYA 1SI9A 2B9XA 4F25A 4Z2XA 1VC0A 1GMUA 3C15B 4JI0F 1F5AA 2YKOA 1FD2A 1S79A 5HMYA 1M90T 2XWXA 1EARA 1FD8A 4LSNB 5AXMA 3IWNC 2MLXA 3G6YA 1D0EA 4IFVA 1Q8KA 3JB9k 5ETLA 4ZCIA 3NKYA 5KFUA 1CPZA 3MTKA 3T3FA 4ZP7A 1FKAF 2DNNA 2QA4G 5HATA 5HVGA 2DNYA 1RT4A 4O4GB 3TQEA 1LW0B 3N5FA 1X7VA 4WE1A 5J1EB 2HZVA 3QSIA 1XMBA 1MROA 3Q8UA 1VQOS 4FF4A 2R7VA 3I5BA 3SV3A 5AXNA 5IC4B 2R7QA 1U24A 4JI6J 2XS5A 1MW7A 1C1CB 3GPAA 3B4DA 4WKRA 2XULA 5T7LB 2DY1A 2FUG9 2XZWA 1P6TA 3JQJA 2LA6A 1S6OA 2C2NA 3BS9A 3VGVA 2MSTA 1HHTP 1X4GA 3ZTPA 3TUJC 4ZDNA 4C3KA 1MN7A 2Z4PA 3CJKB 1S1UA 5L46A 2W7PA 2P9CA 3TVKA 1JJHA 1HQUB 2C3UA 2AEMA 2YQ0A 4P2SA 4DV0J 4RNFA 3GJQB 3MM6B 3M05A 2F5GA 1KHWA 1HA1A 4RNHA 1RTJA 2ASYA 1WEZA 2YNIB 4C6AA 4P7TA 1IN0A 4JYAJ 4WXOA 4DX5A 1RHUB 4QR0A 3F41A 3C2PA 4X4NA 4ED3A 3VV2B 1FFSB 2CJQA 3MCNA 2AX0A 3OL6A 3RB4A 2W01A 1SC1B 1CSJA 4DDFA 5KFDA 1S9GA 4GC6A 3FGVA 4YDXA 2V9WA 2IA6A 4MTPA 2OPSB 5KFGA 2GQQA 2LQ9A 4YUDA 1NUEA 4QWAA 3UN5A 2QA2A 1FO1A 2CPDA 5LXYA 2CNOB 4YS2A 3KK3A 2EVZA 1N5QA 1VQ7S 3JTOA 4I64A 3OTDA 3TVZA 3FFIB 4RW7B 3NNCA 1RU2A 2GQCA 2ZBCA 4IH6A 3FK4A 2MEWA 4B9TA 4ECWA 4I7FB 1TMJA 3DLLQ 2KG0A 3V6DA 3MM5B 1FJEB 4I2PA 4NA2A 1Q8LA 3Q86A 2HRYA 2RJZA 5U47A 3R5AA 3EZ5A 4WFYA 3A8JA 1OPZA 2VU5A 1FJGF 1RT6A 1XQIA 4J9VA 1C1BA 5DDOC 2H54B 4UF4A 2EG2A 2H48B 3OXFA 2MGZB 5M2UA 4NXNJ 1R89A 4YR0A 1A7GE 2CWKA 5F8IA 1RADB 2WVCA 5HBMB 3QGHA 1VRQC 1RP5A 4NLWA 1HBMB 1FKPB 3UW1A 5DO2A 1RHMB 2BANB 3DRPB 3LAKA 4DSFA 4CH7A 2AJ1A 2Q3PA 4I4BA 2YBVA 1ZAVA 1NCLA 3BR8A 4AL6A 3CJ2A 3LP0B 1SXLA 3AY0A 1SIWB 3SDEA 2R7TA 4FKYA 2H4WB 2IAJA 2PEBA 1FKOB 4ZHRA 4JV5J 4K50A 1Z1ZA 4I0WA 3QGIA 2Y1LB 1Q95G 2EEYA 4P9SA 4JBCA 1TR0A 4LFAJ 4QWEA 5F0WA 3VAHA 1AZSA 3RBEA 1BMQB 1CC8A 2BJ7A 1EKRA 1B99A 4B17A 2QLWA 1YBAA 1NK7A 4DFKA 3A3OB 5KFOA 1CJTA 2QA1A 3QAUA 2OSQA 1QLNA 3J81Y 1WEXA 3EGZA 3ILJA 2O3DA 3OR2B 3DGVA 5LSLA 1WHWA 4JI4F 3DDIA 2YNHB 3NS5A 4IRDA 2ZJPQ 1KR4A 4CQ1A 4K2JA 2HBRB 2QYCA 3PKYA 3SZ2A 3G8SA 5KFCA 3L7PA 1T03A 4ZVEA 4EO6A 4NLTA 1S12A 2HK2A 1R6YA 4IG0A 3O5TB 2OEKA 4HL9A 2V34A 2R4FA 4UOGA 2R2RA 2DEIA 3FBCA 4DL4A 2MZRA 2OPRA 3VZIA 3X1LB 2WAQD 1Z4UA 2FB0A 4FN5A 3TNVA 4CLFA 1MWZA 3HM9A 3CIMA 3HVWA 4OX6A 5H1SV 3ICLA 3TW0A 2P9GA 1M5PC 3VQSA 5KFPA 1HWJA 4DI6A 3DC2A 2G9OA 4IUFA 2JEGA 1F2HA 3QPIA 3HVTA 2IC3A 2K3IA 4B3OA 2HVIA 4FZVA 4YEAA 2I5JB 1S1WB 4KBIA 3V81A 2DNRA 1X9SA 3A8KA 3D1OA 1E6VB 3FBBA 2RU3A 1Y3KA 3TI0A 2K1RA 2W9CB 3M8QA 1FTCA 3JSMA 3ETMA 1S0NA 4FYXB 2NXUA 1U09A 2D74B 1D3WA 3RU0A 4H4KA 4WZMA 1RWPB 7FDRA 3QSYB 3KMSA 3EZOA 4X65F 2KRRA 2Y0BB 1D8ZA 3B78A 1I3OB 1TMMA 3THVA 4IR1A 1LFWA 5HN0A 1S7HA 3JTNA 2FVQA 2GC8A 3WHIA 3C46A 1HBUB 2HWHA 2BV3A 2F8MA 2CJXB 4JI8F 5IM0A 3BGFA 4XIUA 4DSLA 1IBLF 2PFFB 3N6MA 2FTRA 3ENAA 3D28A 2UVUA 2J8AA 2J7KA 3M7VA 3SSQA 2FLOA 1QSYA 4RKUC 1GTEA 1HBNA 3J7A1 4C0OC 4AUKA 1QUVA 1AB8A 3KYLA 3N6LA 3P5TL 3W62A 2NLWA 4CDIA 2F4VF 2YKMB 2MZJA 5JUMA 1JLQA 4DLEA 2DRBA 2VG7A 4TYAA 2AYEA 1HMVB 4KHPJ 5HK4A 3OFHA 2VF3A 1X4DA 3EXCX 4L3KA 2JL9A 2GJFA 4J90A 4M5GA 4EBCA 3M4XA 4DR4J 3IR5B 4NZ6A 4KV8B 4YR2A 2ZM6F 5G4DA 1S6UA 2J9DE 2ZJRQ 2LDYA 1SIZA 4CLLA 3R7SB 1LWXA 3RZAA 2V4JA 4OI4A 4WTYA 1LXNA 1WC5A 3M6UA 5E33A 4BBYA 2CA9A 2LU1A 1HPZB 2VZ9A 2OO4A 5LOQA 3GIRA 4JP8A 4M94A 3KLFB 1PSDA 5KG7A 4K2XA 1CJUA 2RQCA 4MKAA 3TANA 1X4AA 2VHGA 1H7XA 1UCNA 3C66A 4C3MA 2GHVC 4X4SA 1SL0A 2XI2A 2D1CA 4K8RA 1HI8A 2FHJA 5K8NA 2XZDB 4PUOB 1CJVB 2F40A 4FF2A 4QCLA 2IM3A 4NLOA 4FPRA 4A47A 4O3PA 1DQ9A 3BV8A 2QLXA 1QSSA 1YRUA 1ITPA 4DQQA 1YK9A 4MT1A 3K17A 4ZVUB 3EICA 4OLOA 3ISNC 3NCRA 4IH7A 4W98A 3E3XA 4IKAA 2RMLA 4Q8EA 4CIOA 4K0KF 3KUEA 2XO6A 5B09A 1WNEA 1OWXA 1GT8A 5HI7A 3KLEA 4L75A 4DS4A 3T5JA 3TEHB 3ZO7A 2DHXA 5K14A 2DGWA 1FJ7A 3DNCA 2XNQA 2GAGC 4RW6B 3OL9A 3POTA 3FCHA 2QLBB 1X4BA 3RRHA 1N34F 2V8VA 5GMKa 4U6PA 2HVEA 5F41A 4DL3A 4UUWA 1APSA 5M2PA 1WOSA 1WG5A 2BQRA 1IKYB 2Q6BA 1YJNS 1T9UA 2HGNA 1VRUB 2EXUA 1HNIB 2E9ZA 1RAIB 3I32A 4C8NA 2Z2ZA 3NS7B 1U1QA 1JLEA 1AUDA 4KE5A 2B6AA 3GB0A 5KT7A 2YNGA 4OYBA 3DMJB 3VAKA 4ZVPB 5BYQA 3CUNA 2J0QD 2H5IB 4JI1F 1PG5B 2AT1B 4Q44A 3V6JA 2DH8A 3EVOA 1BQMA 4ZCMA 1SQGA 1CQNA 2CJBA 2KFYA 2KO1A 4JI0J 1IKXB 2DIVA 3D3BJ 3D54A 2YH0A 1VRTB 1FWPA 3PIPQ 4DR3F 2BJ8A 3CJ0A 2KT3A 2VV5A 5GADU 4EUVA 3D67A 4X4VA 3CCJS 3IR6B 2HNZB 3SEOA 3PXGa 3GR0A 2C2RA 1ZAXA 4DOZA 4PCQA 2ACYA 1WF2A 2W7AA 1HWLA 2XMUA 3PJWA 2OAUA 4GRSA 2DD8S 4LFBF 1FRHA 1DQAA 3CDBA 3QWPA 5IT0A 1RHRB 2WONA 1JLAB 3G86A 4DLGA 1NPRA 5KT6A 1KTVA 2YKAA 5HVHA 3G6XA 1ZA1B 3IP0A 1YTYA 4O3NA 1R0AB 4PG4A 1GNKA 3VAMA 1LQ9A 4IG3A 3V4MA 1AFIA 2ZVIA 3QIDA 3SQGB 4U8YA 3KHLA 2HS3A 2VKZG 2YNFB 4JUZA 3M32B 2JC1A 5B0FA 2XBPA 2UV8G 2GGPA 1S6QA 1U8SA 4WP9A 1DBDA 3DOMB 2E1MC 4J9MA 1KD1T 3WC2A 3NXZA 2WOMA 2XMTA 1ZPVA 1AUSL 3U1LA 2YWFA 1EQ0A 2CNNB 4CYUB 3SXLA 5E3CA 5HQ8A 3W60A 2OLWA 5CD4A 2ZOFA 1OQ3A 3CDEA 3ZFVA 5HROB 3HHLC 4K5SA 1MLAA 2A2CA 4PQUB 2GVZA 2LVWA 3M2VB 4CLSA 1MSWD 3CCVS 3BM7A 2ZUAA 4R8UB 2V8DA 1DY3A 4J9KA 2ZD1B 2VPZB 3IM8A 1TL5A 2BM0A 1Q82T 3CD7A 3M8SA 3QJPA 4QYZJ 5CZXA 1X5PA 3D6MB 4I68A 3JYTA 1NK8A 4OZ3A 2DT9A 3RYLA 4LRBA 3KLIB 4X4UA 3I87A 4EEYA 1EP4B 4QIWD 4N76A 4NXMF 2IPOB 3NG8A 1U1KA 2XG8A 3WIUA 2CG4A 3KTQA 5MAOA 3PTWA 5HAOA 2R2TA 4F4YA 2BRKA 4NRUA 4NCAA 5KFIA 2DNQA 1HNXF 2FLNA 2PT0A 2PMWA 1G7CB 2C42A 4EYHB 3H5UA 5KFHA 1VBKA 4DV2F 3M8RA 4P10A 5KFNA 3RRGA 2HGLA 3C16B 3GP9A 3CT9A 3S6EA 1KN6A 3JSRA 1VHFA 2IHR1 3B82A 3I4PA 2QX0A 1LNQA 3GYNA 3CJQA 2WCXA 2MKHA 2W1BA 1ZBTA 1FK9A 1PYOB 2UUBF 3VGSA 3RW7A 1RT3A 3H40A 1KQGB 2BA9A 3TYTA 2ZWPA 2OH2A 4C9DA 5ADZA 4MIWA 2FHMA 5EN1A 3LALA 4A46A 1U1MA 3KOAA 1VOMA 2B7BB 3CNQP 4W90B 3FEXB 4JV0A 5GAEU 3EXYA 4CRJA 5D4LA 3CCRS 1LWEA 4PABA 3UNGC 4JI7J 3ZZUA 2LECA 3BBCA 3G82A 5DM7Q 1JWWA 1PJ5A 5IV4A 2YWWA 1VMBA 2GIFA 4DQIA 3GZ7A 1WORA 3RBDA 2BX6A 1TUGB 5F0UA 3CC2S 2DPIA 3J80Y 3OT9A 2W9BA 5E5NA 5DETA 1X9WA 2V2QA 4USIA 4OX8A 4MIAA 3NL0A 4YB1P 1SC4B 1ULRA 1J5EF 2DNHA 3BYRA 2RF2A 1RWUA 4RW4A 4U8VA 3VR1A 4LF8F 1BWEA 3GQCA 4B3TF 2EG1A 4Y2CA 2ADBA 3C15A 2IDLA 1Z2LA 2IRXA 3ILIA 2DIUA 1NLKL 2QL9B 3N0VA 4M5IA 4NE9C 2R9LA 5LT5A 3CJSA 4LSNA 2B43A 4M5DA 2DH7A 1HWUA 4MKBA 3JTPA 2MZTA 3GV5B 5HL7Q 2KTQA 4H54A 5C2CA 4IYQA 2NREA 4OZNA 2VQFF 1WG1A 5DZ7A 1V3RA 2HLUA 2E1RA 3CDUA 3G8TA 1FVSA 3PYEA 1PAEX 4O4GA 5KFQA 4ETZA 1UFWA 1LW0A 3PZPA 3TARA 3W64A 2I38A 1HNVA 4LUBA 3TZYA 5J1EA 4DV6F 2CPHA 1MU2B 3DOLB 4QIVA 3G2XA 3TOQA 1SH2A 1S1VB 5L39A 3TA0A 2C3MA 1VC6A 2IJFA 3TWZA 1XIQA 3ILOA 2HWTA 1UVMA 5E0OA 1D1UA 2HNYB 1IWAA 1N0VC 1NBEB 7FD1A 4LF9F 2J0WA 5KFZA 5HANA 4L72B 3MPVA 2QYGA 1FE0A 5A0YB 1LXJA 3EX7B 1KWMA 2V68A 4F4XA 4DXLA 2KYXA 4RBTA 5GAGU 3HULA 1U6FA 3OXLA 3X3UA 4QU7A 1UWAA 4IRKA 3V4IB 2XO7A 1TKDA 2YQ1A 1IBMF 5D0GA 4CO4A 5I3UA 2CRLA 2BBEA 2DNKA 2VA3A 2E1AA 1ROFA 4EYIB 3PW7A 4OZ2A 4FKXA 5L1LA 2ZC3A 1IBLJ 1PAUB 4J9NA 1NHUA 4B08A 2DXFA 3ZZ0A 3R5DA 4ICLB 5KT2A 4J9PA 5GMEA 4DSIA 3Q8QB 4DSKA 4JOUA 4DPWA 2ZH1A 2HRTA 2OPSA 1YJ9S 4Y2IA 1ZETA 3P6YC 2V8PA 1DQ8A 2PMZD 3BGRA 1GMVA 3ZZPA 4DR2F 2BQUA 1XN9A 5JXSA 1OS5A 2J7UA 1H73A 1RJJA 2XZTB 2V94A 2HHHF 3FFIA 2R2SA 2F4VJ 4J9QA 4RW7A 5KFJA 4GO5X 4DFJA 2EC2A 1RLDA 3C14B 1VQPS 2E5LF 2RS2A 5IT4A 4HT7A 3FBEA 4B02A 3I55S 5H9EJ 3MM5A 6FD1A 2F1FA 4A4JA 5MLCV 4F0HA 5H9FK 2VPWB 1J2VA 1F5CA 3W9HA 1NK4A 3IC1A 2ZM6J 3Q2TC 4QIEA 2XMJA 5C25B 2COLA 1JMTA 2R7SA 3LF0A 4NI2B 4F26A 4B3RF 1YJTA 2MGZA 2CWXA 2EKNA 4ZVFA 2NXEA 3GWCA 2DB1A 1V3ZA 4DR7F 4DUZF 4ZJQA 1Y3JA 4OYWA 3IXQA 4LVOP 1T7PA 4OYOA 5HBMA 5J2NB 3UD5A 1H3DA 4OMFG 4A8XA 1HBMA 2FHKA 4PPZA 2UUCJ 4KIAA 2X1AA 5KG0A 2BANA 3ADAC 1SPBP 4DMZA 3KK2B 1CQMA 1U0HB 3OJUA 3G6VA 3FCVA 4ZPTR 2PA8D 2A0FB 4OI0A 4KGKA 9RUBA 4CO5A 3LP0A 1FRXA 1R3NA 1RABB 3EGWB 5ETMA 1YGYA 1RGVA 3PR5B 1DARA 2JVOA 1FKOA 1FE4A 2AKWB 2WW8A 2DXEA 1OY9A 4P73A 2FGOA 4RPFA 3ET6B 1ZM3A 2QT7A 2PDAA 2MKJA 4J9LA 2KL8A 3K8WA 2I1RA 1GH8A 2BDPA 2XC9A 2VBWA 2LMIA 1MMDA 1JLBB 3DLHA 4LR7A 4P72A 3SQOP 1NSAA 3MM9A 2PIIA 1U1LA 3P3DA 4CM2A 1T9XA 3LPEA 3MEGB 2EFVA 1TVRB 2A10A 1YSJA 2W4DA 3MR5A 2RVJA 3QO9A 1SJ1A 1X31C 4NYZA 4WK1A 1PYTA 4FF3A 1IR1A 3A1YG 3UDVA 2ASJA 2HHVA 1F9EB 2NUHA 3TJ8A 4PG6A 4DR1F 5A8WA 2UZAA 3O2IA 4TY8A 1V5VA 2P6SA 4DPUA 2M3DA 2X1BA 2Z2MA 1RWWB 2LU2A 3IS9A 3DXSX 4ZN1A 4NRTA 4OZ5A 3GFZA 1HNZJ 5ETRA 4DL6A 5J2PA 3GFYA 1ZOTA 1WKKA 3SBMA 2RRBA 4ID8A 3CJTA 5BJRA 4X2BA 4RNMA 1GEHA 1TL1B 2J6SA 1WG4A 2HS0A 1N4LA 1FI4A 4UT4A 5EUHA 4A8YA 3UCZP 1FHTA 2JVRA 2ZVSA 3LW5C 2DVIA 1X4HA 2MQLA 5DG7A 4UQGA 4TXSA 2G0IA 2Z57B 1S77D 1NB7A 3R2DJ 4Y65A 1WOOA 5A2QY 2I5JA 1S1WA 2LP4A 2JHEA 4C98A 4IQMA 3CCUS 1C2PA 1RTDA 4QOTA 2MY8A 4B9UA 4DR3J 1YKWA 2B4PA 3VAFA 3PDNA 4DV5J 5KFEA 3QRQA 3KWMA 2MQQA 5RUBA 2EKYA 3NBPB 2W9CA 2VBZA 5LSOA 3KHHA 5C42B 3WX8A 4PWWA 3LP1B 1N5VA 5I42B 3OR1B 2XNRA 4DV1F 4M5HA 1UEVA 4J9SA 4LMZA 5KG2A 2BKPA 2GIRA 3THTA 4C8OA 4K4YA 1KS2A 3NAIA 1WHXA 3H4BA 3W61A 1UTAA 1H7WA 2WVEA 1FCAA 5K5MA 4OYZA 3W2WB 2DITA 5EX0A 4PAAA 5C2GA 4J9UE 3MTJA 1IVZA 4UQTA 1VBZA 4R25A 2RDDA 5KFFA 2EK6A 5JJBA 3K57A 4UOFA 5J1NA 3TJ9A 4FYDA 4EBEA 1SCJB 1NJZA 3WBZA 2G0JA 3M30B 4L73A 2Q1LA 2J0XA 4G1IA 4ED0A 2DTJA 3OTEA 3FRZA 4KAIA 4FYYB 3DRRA 4QIFA 5ETTA 4KSEB 8AT1B 4C7QA 3ENWA 3L9ZA 1YI2S 1RB0A 1SJRA 2AZ1A 1B0PA 1RTHB 1S1TB 1HKAA 3MFIA 2MDAA 3BO4A 4C4WA 2MZ1A 1UW4A 1WDDA 1UWBA 4O4RA 4CO2A 4JI6F 3RGIA 1KQKA 1HMVA 2A6OA 2VG5B 4K7QA 1RWNB 2PE8A 4XTTA 4ZPAA 1LKZA 1SKSA 1TKZB 4TU9A 4OI6A 3PO5A 1TUWA 4KV8A 4ECSA 4AXIA 1JNRB 4NCGA 3UR3C 1ZZNA 3M1VB 2GMLA 2AGPA 2CZ4A 1BY9A 4ZVOB 2NPFA 2IMOA 2OHDA 1B0VA 2AMCB 1HPZA 2BEFA 3T5HA 3B54A 1B0TA 3FBFA 4N8OA 1VQ4S 3KLFA 3PACA 1F60B 4JYAF 4NXMJ 4RW9B 4QWDA 2WZ1A 4N77A 3M6VA 3MM8B 2L9NA 3ETOA 1V9OA 1TZ0A 3GJRB 2Y1RI 4GO7X 3D68A 3HX9A 3CDWA 1OPIA 4RO0A 3CEDA 1NDKA 2KG1A 2ZBIA 2NCKL 4ZPVR 4MFBA 2B5JA 1U2FA 4KPYA 3R5BA 1EETA 4PUOA 4MK7A 3R97A 4URGA 3RAMA 3BJYA 3I0SA 2VPYB 5BR8F 3LPYA 3SYZA 1U25A 4OHWA 2GVDA 3BQ1A 1U4BA 4BWMA 3FSXA 4K5RA 1RT7B 5L1IA 3CMQA 2QN6B 4ZITA 1N32F 1M1HA 2OKQA 4EU0A 2WBMA 2CPIA 1TKXB 2XMMA 2UUBJ 5D4PA 2KM8C 3I4HX 3I82A 4NPOA 1KBRA 3MMAA 3D9BA 5CCMA 2FC8A 3QMQA 4NLGA 4Z37A 3H59A 1C4AA 4DZ6A 4DR6F 1RCXB 2XSJB 2HHQA 3W9IA 3D5MA 1I94J 1UEKA 1YQHA 4OQJA 4NXNF 2ZHOA 2CADA 2CFXA 2V67A 2JFKA 3HMJG 2P8IA 4G3IA 2ZHAA 5KFMA 1A9NB 1AROP 3R7BB 2FJDB 4F4ZA 2BOAA 1KLMB 3A4TA 4MYUA 1FTRA 4EO8A 3HHDA 5KG6A 4TLRA 2B51A 2D69A 2DNPA 5FDLB 3KK1A 1VRUA 1KVKA 3RG6A 2N7CA 4MJKA 3DM2B 1XNRJ 2R8GA 1OSDA 2ERRA 2GMJA 2VDIA 4HHUA 2X7IA 5DDPC 4CLYA 2R7RA 1RT5B 1J5EJ 4XDCA 1NAQA 3BYPA 3UO0A 3NNAA 4LF7J 3NCQA 3PRBA 1BD6A 4JV5F 2CG8A 1XMOJ 2ZZMA 1LWCB 4LVNP 3BQ0A 4HACB 4B3TJ 3DGPA 2MZSA 2GA7A 3F0NA 3RBXA 4QR1A 3FRYA 2L9WA 2HW3A 4NLUA 1P27B 2YY3A 2Z8QA 3DXBA 3GFHA 3WIVA 2XMWA 1CJKA 1WF0A 4HH1A 1SB6A 2E29A 5DRKA 5B08A 4WIIA 4X4QA 3S8SA 3OSNA 4EWTA 3CW2C 1VDHA 5DQIA 1YX2A 2DHGA 3BKUA 2AYBA 1H6KX 3IFEA 3N9UC 3OUYB 3J81U 4DJBA 5ETOA 4QYRA 4Y00A 5B0BA 1K1SA 5IS2A 4IO1A 4RR5A 2BE9B 1S48A 3MM7B 1JLGB 3P49B 1JLCA 3DI6B 4XPCA 1IKWA 2HFSA 2BABA 1HW9A 3R1LA 1K47A 4RW8B 3ZZZA 4LF5F 2Y9HA 4DV6J 1C0UB 4EK2A 5DGAA 1JLAA 2V9KA 2J9CA 3DYAB 3GIJA 4KH0B 2JH3A 3RB6A 1URNA 3MAAB 3VAJA 2BE7D 2BKNA 1R0AA 2ZKUA 4MH8A 3RBZA 3DLEA 4LF9J 4KGZB 5HSPA 3C19A 2KKHA 3MECB 2CDRB 1NK5A 1PC5A 4ZPDA 3KHGA 5AXLA 1R31A 3W2VB 1O8BA 3LGHA 4TYBA 2HHTA 1G3OA 1YZ7A 4B3SF 2HLTA 2CQ3A 4ECXA 3J7Z5 2NXNA 3FDSA 2AV5A 3KMQA 5CABA 5EWEA 3HCXA 2M7SA 4CYUA 2B56A 5AT1B 1NH7A 4CO0A 4OLPA 2VFRA 3A8EA 1RAOA 1X0PA 2C3YA 3HDSA 3Q83A 1VI7A 1ZYQA 3KUHA 3RAQA 1O0PA 3UN2A 4PQUA 2MQ8A 4K4SA 4Q45A 1FXRA 2BE2A 1H38A 1R7IA 3H98A 1KQFB 2ZD1A 2UU9J 4F04B 3DHWC 3IRXA 4ELUA 1WWHA 4PWUA 4EZ6A 2CPEA 3KLIA 4Q8FA 3I9V9 1IM6A 5IV3A 3TA2A 1MG7A 4ED1A 2H5JB 2J5AA 3BR9A 3D6HB 3NS6A 4FPIA 2JLGA 4OV1A 1JJ4A 2OELA 1SKRA 3PY8A 2LQJA 3TJAA 2ZH7A 2E5LJ 2CPZA 4AXJA 3DFEA 4J91A 3RAXA 4BHQA 2DK2A 1Y7PA 4FS2A 2HQFA 4CP5A 3VCDA 3BEGB 5J1PA 3ISND 1S99A 3AA8A 3L09A 3MUTP 4WF9Q 4URQU 4Q0BA 5HLFB 4F4KA 4NEZA 1RTZA 2N4CA 4DS5A 3KFWX 2DO4A 3C16A 4LIRA 1Q78A 2E5JA 4OYIA 3ZNUA 4DR7J 2YKQA 1N5YB 2F9JA 5E7OB 1FVQA 2WTFA 4FS1A 3LWLA 5ITHA 2AX1A 1S9EA 1DTTA 1SJQA 4F3OA 2KZMA 5FD1A 1TL4A 4ZS6A 4KHPF 3HHLB 2W4PA 1R8CA 3TAPA 3H7HB 2CPJA 3ELHA 4K4WA 4V19J 3ZTRA 1VGYA 4R5PB 4N56A 2XB2D 1OY8A 1GX6A 3BSCA 1UFLA 1JQGA 2J7WA 4K4XA 2MYFA 5LMNJ 4F7VA 2WB1D 3TQ1A 2FZGB 2GO9A 3IG1B 3CULA 1N88A 3DOKA 2QGFB 4DL0C 2ZH3A 3JAMY 3MMCB 1P9YA 4L3NA 2L41A 3PRVA 2CYYA 4J37A 1BLUA 3MMBB 2M0GB 1VFJA 3GCXP 3KJVB 1J5OB 4ZPWR 2YWEA 2KJWA 3A3NB 2BM1A 3M6XA 4GC7A 1YVFA 1M5HA 1RT4B 2MY7A 5G0RA 2F9DA 4B9NA 4ED4A 1QJHA 3AFGA 1U1OA 4NOHA 5KTQA 2CAJA 4WE1B 1RHQB 5KFLA 3N5BA 1MROB 2XY7A 3ZTQA 4DPTA 4DR1J 2QL5B 3LP2B 1S0VA 1I6JA 1RT1B 1T8EA 3UE2A 6FDRA 1KQSR 2XS2A 1VYAA 5D6GA 4HLBA 2Q43A 2LFVA 3TVYA 3J7YU 2W8LA 1KTQA 5LJ5Y 2ASDA 4RUAA 2YTCA 2HIYA 2GAHC 2OFGX 3H2VE 3OVBA 2EWHA 3ISZA 5DS7A 2R7XA 4WP3A 4MMOA 4NA1A 1S1UB 1TFWA 3MEEB 4ANEA 4EZ9A 2XLIA 2MMYA 2UVVA 3WX4A 2I2YA 4OHZA 1SKUB 3H5YA 1N33J 3MR7A 1RTJB 2O67A 4YR3A 4ES2A 4N7TA 4ED2A 3AQOA 4O0IA 1NKEA 1JNZB 2ZBRA 1KP6A 3AJ2A 3DOLA 4EI2A 3ULHA 1SVDA 5HJYA 3SCLE 1BQNB 4UZBA 4M5MA 1QTMA 1ACMB 4CWBA 1ZM4A 4XDDA 4E2FB 2HNYA 4BLGA 4IFYA 5LM7E 1S9GB 1ZTWA 5EWFA 1VIOA 3DCAA 2K8GA 3S7RA 1PKUA 2VH7A 5A0YA 4K4VA 1PYSB 2FVSA 5HMWA 3OHAA 3HHLD 2O5DA 3KK3B 3D7SB 5D0RA 1PCAA 1NSPA 2GZOA 1JKHA 2ZH9A 1EIYB 1RT2A 2F7VA 3MURP 1JXEA 1JIHA 2BOPA 1F9HA 1F5BA 1NM2A 4HI2A 1P8GA 4W92B 4LR8A 4K4TA 1KOHA 1N8RT 1KVJA 3M2RA 2IYIA 2HHUA 3U27A 2E66A 2IM2A 1Q16B 4O3QA 2KT2A 3MI7X 1SUQB 2XY5A 4WKYA 1C1BB 3JSYA 1K0VA 2XGQA 4DV3F 4KPCA 3Q89A 1Y11A 3G4SS 4ICLA 3F56A 3RR8A 3PW4A 3M8PB 4KGMA 2DKOB 2M88A 2X51A 1CVJA 1T05B 4EBDA 3PX0A 1MMLA 5CA5A 3ZZOA 4PXBA 4BC7A 4P2FA 3H42A 1VR6A 2KFZA 1BQXA 2D9PA 4DPXA 2E5GA 3C14A 2YQ3A 1NDLA 1UA0A 1KONA 1T0TV 2QC3A 3A8IA 1TL3A 1TP7A 3W8PA 1RBOB 4YHHF 2R8KA 2RUSA 2G2OA 3UCGA 2IAJB 4MK9A 3EDQB 4ILRA 2HG4A 2ABYA 4JI2J 1XTZA 3C6UB 4P71A 5C25A 2XSFA 2OSRA 3WQPA 4RUCA 4NI2A 1WKJA 4HH0A 3CCES 4WFXA 4HHHA 2QEXS 4KJIA 1R8AA 4USJC 4ZLJA 1RUSA 3EWGA 4AE5A 5J2NA 1HR0J 2VL1A 3P8BB 4DF8A 3HF5A 3T19A 2XWYA 2CQDA 2YPYA 4EGLA 4ZOSA 4DCPB 2H4YB 2VONA 1IBCB 1KFDA 2L08A 4USWA 1FJCA 3QFHA 3G8QA 2HNDA 1EZZB 1LW2A 2XI3A 1D8YA 3WZ0A 1T03B 3PG9A 5D0EA 5T41A 4IG0B 3DN9A 2QRRA 2MQPA 5BR8J 4TY9A 2DGOA 2CKWA 3K59A 2AJFE 2BW7A 1Y0HA 4MYTA 2W8KA 3UR0A 2OPRB 2RHSB 1RTIA 1SV5B 3HD2A 3CJRA 3ET6A 5F3ZA 3K5OA 2QLFB 1N32J 3F73A 4O23A 4DPYA 1NEEA 5CYJA 4F4WA 1IKVB 2F8HA 2NS1B 2RS8A 1RHJB 5LMUJ 2YH1A 4RUHA 1EX8A 1M1KT 1JLBA 4TVAB 4I56A 5K8OA 2LKZA 2AJ2A 1FXLA 1YHQS 4BCAA 4DV4J 4USKA 3VWSA 4FP9A 4DR6J 2AGOA 3U7JA 1YBTA 2Y8YA 3V81B 4G65A 3H8YA 3CDAA 1U1RA 2ALZA 3VGUA 3WDOA 3OJSA 3BH7B 3VALA 2K1RB 2BYCA 2LCWA 2YKPA 3D6FB 3G96A 2HURA 2HFOA 3BPDA 3J7ZT 3KLHA 1SQEA 3U1NA 1T9WA 1JXVA 1UKUA 4IRCA 5IT9U 2BJEA 4FNHA 2FIUA 4QBUA 2IVYA 2ZBPA 4ZCKA 1JK9B 4WTOB 3T41A 3Q0AA 1YWXA 3PW5A 2DISA 2W7OA 3N4WA 5L1JA 3CCTA 4FXVA 3I5AA 2H1YA 2AGQA 1IJEB 4NLXA 2XCPA 4TU7A 4JI7F 1VK3A 4Q5VA 3PHTA 5IM0B 1HWIA 2D3OR 4JI3J 3HVRA 2W2OP 4IOAQ 2VG6A 4HR2A 1U26A 2JLFA 2GQ2A 2GJIA 3NBPA 1VQ6S 1DURA 3J80U 1SC6A 4UTGA 4AYBD 1DJ0A 3LP1A 2HFUA 2R7WA 1T02A 1WTFA 4OJ3A 3PFEA 3OR1A 2D3UA 2ZH2A 2LEAA 1XMQJ 5GVQA 1HI0P 2CQ1A 1DLOB 2XLJA 5K20B 1H98A 2X3DA 3GIMA 4LQ3A 1OQ6A 4LJMA 4LF5J 1UZDA 1JLQB 3A13A 1VISA 2G2YA 2BJ9A 2VUGA 1ZM2A 4B9SA 6AT1B 2EFGA 2ZFHA 1FERA 3SFGA 3GG1A 1FDDA 4F3MA 1DHMA 2RQKA 3JQKA 3DLGA 4WU2A 4LSLA 2C3OA 2DGTA 4K59A 3AOCA 3PEHA 3K58A 3M30A 3VVTA 5F9LA 3BGOP 4I6AA 3OSPA 3IBFB 1W25A 3HD1A 1MWYA 2UUAJ 4IQXA 5BXIA 1SH0A 2V4JB 1QDUB 3V5RA 4P2XA 1NDCA 2LLZA 3NOCA 5KFKA 4N5SA 3AQPA 4H4MB 2WRMA 3ENVA 4CLPA 4M63A 1N5SA 3NGSA 4ZA1A 3A12A 1DFDA 2KJVA 4B3SJ 4H4OA 1RTHA 3MAQA 2KT5A 4HEA9 4DQSA 3BH6B 3NGKA 2Q66A 4B9LA 2EBGA 1F0XA 1RU1A 2HBQB 4V1Ak 1CS4A 3BDEA 4NMXA 2NPIA 1HQEA 1TQLA 4NEYA 1QAYA 3AD8C 3D6TB 3BZQA 2QJ3A 2CQPA 3TAMA 3VF0B 2QSWA 4DL7A 4ITSA 3Q8RB 3H5SA 4P6QA 5KFVA 5KG3A 3VHQA 2BRLA 4KO0A 2KVQE 1Y00A 2NZCA 2A3JA 2VFSA 2C28A 1N0UA 3PYDA 4RW9A 4O3OA 4GKJJ 3KLEB 3MM8A 3T6JA 5CXTA 3E8OA 4OZ0A 1HHSA 2POKA 1WF1A 5K14B 3DKDA 3J81j 5DM6Q 2BJ1A 4CT9A 4YQWA 2KRBA 1UEUA 1U6ZA 3M2UB 2NR0A 1IWGA 2IY5B 3WC0A 3CO9A 3I31A 4C8LA 4ALZA 2MPUA 5KAKA 3QLHB 3R6LB 2DRAA 4BDPA 1YDLA 4DQRA 1FNMA 1WC0A 1H74A 1RT7A 3H0PA 3FSIA 3GU0A 2C2DA 4DHVA 5A8KB 1ZA2B 2YX7A 4I6YA 5D8HB 2B0GA 5BYSA 2HKEA 5GAHI 4NZ7A 1JLFA 1FDBA 1FRIA 3T1HJ 2OPQA 3HHKA 3O1LA 1VCTA 2DXDA 1BQMB 3QJLA 4GVLA 3MPWA 2XSJA 2OMLA 3I96A 2VFTA 2Q79A 2LQBA 4NLQA 5KT3A 1UVLA 2OD6A 4OZJA 1M5VC 1WJ9A 4ZLPA 1GK8A 5D3GA 2A18A 4CLTA 2GHPA 3IO1A 2AJ0A 2C2EA 3ITHB 2JX2A 3LA0A 2OUGA 5CAAA 2PN6A 3AJDA 2UUCF 1XR7A 5A76A 1RISA 4DCOB 4YP3A 5AE1A 4N41A 2CNKB 3RB0A 3TEGA 3DLKB 2I9SA 1T9TA 2CJAA 1S59A 2FHJD 1PJ7A 2BMBA 1RT5A 1VQ9S 1BXNA 1Q4RA 2WONB 1K9MT 2HQ3A 3PX6A 3KDOA 2E7VA 3HSDA 1LWCA 3PYFA 3G87A 3ILLA 4HACA 2VODA 3W9JA 1HHQA 2NYIA 2YKNB 2EI5A 3W5XA 4NLPA 3NWRA 3OLBA 4PR6A 4DL2A 4IG3B 5IXUA 1H2TZ 1G6BA 4LFCJ 3CJ8A 3D0HE 1NKBA 1HW8A 1Q7LB 5B0AA 5E3QA 3UVJA 4DFMA 2CQHA 3MCSA 4QPXA 2KM8B 3ENQA 3K7RA 2G1HA 2VDHA 2RIJA 3KG4A 1FRMA 1S6QB 1RXOB 4ZJLA 4J9RA 3HT0A 2WOMB 1IBKJ 2HHWA 1LOUA 2HBZB 1FFGB 3HJVA 8ATCB 3DI6A 5D78A 2RE1A 4RW8A 1C0UA 1FWKA 3T5LA 3I9ZA 2M70A 2DR6A 2YWGA 2Z58B 5D77A 2DO0A 1HNZF 2OI2A 4AL7A 3BF4A 2NXJA 4YB5A 4QWBA 1RSCA 3PIOQ 2WVDA 5M2RA 1OJ4A 1UJ5A 3DRSB 3IWXA 1WC3A 2ACMA 3CCMS 2E7WA 3UDCA 3OTCA 3D1HA 2HZAA 2ZDPA 3FEZA 2E5IA 3ZNJ1 1WHYA 1YZ6A 4DX6A 2YPZA 1LK7A 3GJTB 1HWKA 3FMBA 3GSIA 3W2VA 1RAEB 4G1QA 3VGTA 3PX4A 3FKBA 5CYMA 2XMVA 4K4ZA 3PM9A 3LGNA 5A2QU 4F67A 4Q2MA 4C48A 2NXCA 4ATNA 4DV5F 4Y2MA 9ATCB 4K4UA 5KFRA 3SCJE 1B7FA 1RQ0A 4FYVB 5JVHQ 4M8LA 1RZMA 3UNYA 2N7YA 2L48A 2HPUA 3E2EA 4U67Q 4AT1B 4LREA 3KHRA 2OJ3A 3GV8B 3L3CA 4DV3J 2XHCA 2IDEA 1Q53A 4FYWB 5KFWA 3MCOA 3MAHA 4OL8A 2DHAA 1CULA 2MQMA 3MZIA 2JEIA 3EPGA 3AODA 5I3PA 1FF2A 3R7NB 2BJDA 1RT3B 1VBXA 3ONQA 1I5OB 2ZH8A 1C0TB 1NZAA 2VJVA 4ECVA 1R6VA 4LBHA 3J7AN 2LEPA 4B3MJ 4CCHA 4WFZA 4WP8A 4HDHA 4XAKA 1KEKA 3EZUA 2XQCA 5KFAA 2IIHA 4OX7A 1B4SA 2FDNA 1LEOA 3L4BC 3QBCA 4YHHJ 4OJ1A 2KFNA 2WVFA 3FEYB 5L8RC 5ETSA 5HLFA 1A0OB 1LWEB 1DAXA 2FLLA 2L9DA 1VK8A 5HQMA 3G71S 3G82B 3H4DA 2CQGA 2B9WA 2VOPA 2BZ2A 3US5A 1ZTTA 1OYEA 3DLBA 2E9TA 1FEEA 4CLKA 4MKYA 1N5YA 5J2QB 3L95X 1NK9A 4PRFA 2W9BB 2RNEA 2CPFA 3NGTA 4OJHA 4NMLA 2XS7A 4WCEQ 4I2QB 1RYRA 2ZITA 2WB4A 2RU9A 1F3VA 1RACB 3MF5A 3GONA 2RF2B 4C8ZA 4RW4B 2UXDJ 4RWWA 2B4VA 5GMDA 5EDWA 1U1NA 2HMIA 1D9AA 4C11A 1HYSB 4G6VB 4DPOA 4ID5B 3IG1A 4OZLA 4A48A 1TUVA 2VKRA 4M5DB 4ILLA 2CPXA 3MMCA 3JSBA 3BSNA 1BHNA 3BKTA 1UVNA 2GS8A 5HJXA 3T1AA 3MMBA 4JV1A 3KJVA 1QE1A 3MEDB 1J5OA 3EYZA 5EX3A 3K5LA 3BN4A 3GILA 4ZLLA 1B70B 2FZCB 3CJ3A 1HNVB 3ZC4A 4IDKB 2QTWA 3HFZB 4USMA 2B8QA 4L76A 4YY3J 4ES3A 1P1TA 4RNOA 3TZWA 1VC5A 2DGVA 3BSOA 4CH0S 4UUXA 2HEKA 4I69A 1SC3B 2X1GA 3LP2A 1S1XA 4LBPA 4WU3A 2JEFA 4RU2A 1RT1A 2DNLA 3BBBA 4ZMMA 4X4OA 5CYQA 1VQNS 4HYKA 3KDNA 2M8DB 2AEFA 4KY3A 2JC0A 3K0JA 5IT9Y 2R8JA 3ZTSA 1F9FA 3R1HA 3MEEA 3FJ2A 2YWKA 3ZTOA 4RNNA 4LRFA 1TL7B 4TN2A 1S97A 1NJXA 1I94F 5I3UB 3M9OB 2QMXA 1K1QA 3K5MA 4Q2LA 2N82B 1UAWA 2GFFA 2LXUA 3D4JA 2CQ4A 1WOPA 2VBYA 4HT5A 2DR9A 5DJBA 3OBIA 1FDAA 4RJVA 1WSRA 1BQNA 2HFZA 5T14A 1Y5IB 1Y5NB 2FHOB 1YJWS 3S01A 2U2FA 5HP1B 4Z7CA 4JV2A 4N47A 1XNRF 4PWDA 3C6TB 1XNQF 1U2RA 1K8AT 4C8YA 4NX9A 4KHRA 2XYPB 4NLVA 2BACA 4KFBB 3BGRB 4BC9A 1EHWA 1N6QA 4LF7F 4URSA 1CC7A 3U1MA 2FQQB 3I0RA 1XMOF 3KLGA 3GE9A 3R9LA 4RBUA 2CQ2A 1NNDA 4X66J 3PVXA 1FX4A 3AA9A 1KRPA 3T9NA 4C97A 5AJ3J 3GV7B 3Q8SB 5H9FJ 3PW2A 2GMHA 4PZVA 1RDRA 5ETVA 2R42A 4DUTA 3NGDA 3O44A 4D3GA 2XCAA 2V69A 4DBQA 4U9RA 1SUQA 2MXYA 2MKIA 2JFDA 1KVIA 1FNXH 2I8EA 2MJNA 3AT1B 3QAEA 1RBLA 4P2MA 5HMZA 1MN9A 3BDPA 3FNNA 3G9CA 3M8PA 1QSLA 1WSVA 3P45B 4ED5A 2K7JA 4DZDA 1T05A 4OX9J 3OV7A 1JX4A 2AHOB 2ATLA 1Q5YA 3FZ2A 3F44A 3HVAA 4AFFA 1HNWJ 2ZKTA 1Y10A 4KGVB 1S0OA 1HD1A 3KLVA 1C1CA 3CIZA 2KDOA 4KYZA 2JZ5A 5T7LA 4L6V3 1OO0B 1SH3A 4GMKA 5CD4H 3SFUA 3JS9A 4X4TA 3C6UA 1YJVA 1IQZA 1VLYA 2UVRA 4U95A 2A2DA 3CJKA 2CQCA 2KXFA 1GFWB 2M9KA 1N5TA 1RAGB 1RBAA 1HQUA 1T3OA 3MM6A 3W5YA 1NXIA 1HBOB 2F8EX 2IBKA 2YNIA 4AQYJ 3W66A 3MM9B 2I6WA 3OFGA 3GCWP 2QFIA 3EJMA 2A1BA 2LQ8A 2DHHA 3QO9B 1X5SA 4WFAQ 2UU9F 3IRWP 2C22A 2X3GA 5A8WB 3B6BA 5A6PA 4TY8B 3MPYA 3NEKA 1TV6B 3QRPA 5LSRA 4ENOA 4WZQA 2K7KA 3IS9B 2HK3A 3M8ZA 1T11A 4X62F 4A8QA 1AW0A 1REVB 1TTHB 5J2PB 5C7PA 4DR5J 1UFKA 3CD6S 1YITS 1SV5A 1LWFB 5I3QA 3BREA 5K8MA 4QW9A 2ZH4A 2B9YA 1TKTB 4O44B 1XC9A 3Q8PB 4PYAA 1IM4A 1IKVA 4C8MA 5F8NA 4OZ1A 3MFHA 3AOAA 4I7FA 5BYRA 2Y0SD 4O3SA 4RBVA 2YVSA 3AHPA 3TZXA 4DN9A 2ZHBA 1JJCB 2GHWA 2MHNA 4IOCQ 3CC7S 2JJ4D 3GYGA 1SQFA 2DR8A 2FLPA 4NLYA 1X5OA 1L5UA 3C3LA 1RTDB 4W4MA 3W63A 1HLWA 2B4OA 4LBIA 2WVBA 2FJEB 3PV8A 1U2CA 3KJNB 4AL5A 2GX8A 4WFBQ 3TUIC 2UUTA 2J6UA 1AT1B 5F9NA 2W9AA 2FD2A 1FKPA 2UXBF 3EUNA 3BGLA 1S72S 4NZ0A 4H4KC 3DRPA 1FEHA 3CMAS 2KXHA 3M6WA 3NAHA 3Q8VA 1S7IA 1RWXB 4RU9A 4DSEA 1MNEA 2DPJA 2ROEA 3AXMA 4UOHA 5LMNF 3CCZA 3P5BP 2WHOA 1A6LA 4EMDA 4RLEA 4WK3A 4WYWA 3PKMA 3AD7C 2DY9A 4GKKF 3CTRA 2DGSA 3CGIA 3LAMA 3B8HA 1Q86T 3MPUB 2DGQA 1NSKL 3KG1A 2MTLA 1OSCA 5F8JA 4PQAA 3JAMU 3CSKA 3NP5A 4A8MP 3OFFA 1T9YA 4ZVTB 2IJNA 4ZJOA 2J8SA 3M9MB 2HQIA 2R7UA 3R27A 4M95A 4C0HA 3KKFA 3DRRB 2W2NP 4NLDA 3AB2B 3OR2A 2MQNA 1NJIT 4JI5J 1WC4A 1WDTA 2JSXA 4I1TA 2GO8A 2YNHA 3GSDA 1PILA 4CNZA 3K89A 4DEZA 2O01C 1DLOA 2VPXB 4IOBA 2QE5A 4G1PA 2V2ZA 1REGX 2QG9B 3AD9C 3MXHP 4KH1B 2MJUA 2RUGA 4WIQA 2E44A 3UWTA 1UWBB 2D41A 5EHHA 2XTJP 1SKWA 2YX1A 2FJAB 2Y8WA 5D4NA 3HHNB 3LUYA 4M5KA 4A8WA 2QZ8A 4OHXA 3D0GE 3TX0A 2XMKA 3W3SA 3CVKA 1OIAA 3IAM9 7AT1B 3TR5A 4NCGB 4KR0B 1E6YB 3UQSA 3Q8YA 3MR6A 4F0MA 4F50A 4ZIVA 1TAUA 4Y2AA 3LOUA 3SI8A 5DQGA 3G6ES 2VASA 2XMAA 3SSRA 2O1PA 1N33F 4H4MA 4ANDA 4PXCA 4PG5A 1RI7A 5GADI 1K44A 3QQCD 3HI9A 4YDDB 1SJ4P 2C2OB 4U7UK 5HQLA 1KNZA 2MKYA 1F1BB 1UPPA 1Q8BA 2H65B 2OPPB 5IOLA 3Q2SC 1U49A 3HFVA 1E6VA 1PC4A 4C8KA 3UCUP 3K5NA 2M52A 1JXLA 2B3TB 4MFBB 1OMSA 3CCWA 2B5JB 2ZE2B 2FJBB 2HAIA 1PGZA 5D0HA 4YFUA 1EETB 1S4EA 2UXCF 4D3HA 2ROPA 3I0SB 4DUYJ 1VQLS 5KG4A 2F4FA 2GVDB 2OTJS 5JVGQ 4FDFA 3HKWA 1YIJS 3QRRA 4NASA 1F2GA 2XLKA 1JB0C 1FX2A 1QAIA 3DRXA 4J5OA 5KFTA 4CT8A 3RB3A 1RKIA 3MMAB 1HBUA 3FQKA 2RQ4A 4FVMA 2ASLA 1Y4ZB 1VBYA 3CPWR 1WI6A 4F2SA 4S0MA 2K06A 1Y5LB 4ZVSB 1NHVA 4TKTA 1URRA 4DX7A 4PXEA 4LF6F 2QSFA 3OLAA 2MQOA 1ZAWA
chains in the Genus database with same CATH topology
1S9FA 5B0EA 3OUYA 3G8TA 2GGPB 1FVSA 4ZVHA 3M2UA 4FP9A 1H2UX 3VWSA 4O4GA 5KFQA 2DCLA 4JI5F 4ETZA 1UFWA 1LW0A 3PZPA 4CZCA 5KFYA 3U7JA 3TARA 2AGOA 2I38A 2DGXA 1HNVA 4LUBA 3MM7A 5J1EA 2FJXA 1JLGA 4DV6F 3V81B 3H8YA 3Q23A 4DG1B 2CPHA 3CDAA 1MU2B 1U1RA 3DOLB 4QIVA 4YB7A 5E3AA 2ALZA 3QLHA 4DWIA 2OFHX 3TOQA 3WDOA 2ZNYA 1SH2A 2YX4A 3MR3A 3CXCR 3OJSA 1V3SA 4DFPA 1S1VB 5E3PA 1X4EA 2NQPA 5L39A 4QW8A 3TA0A 2C3MA 3VALA 1VC6A 2K1RB 2BYCA 2IJFA 2LCWA 2YKPA 5HMXA 3FSYA 2LA4A 4OI1A 4WJBA 3KK1B 3G96A 2YKMA 2J0SD 5A8KA 1HL6A 3GIKA 2HWTA 4X4RA 1UVMA 2HFOA 2AW0A 5E0OA 1D1UA 3H2LA 2HNYB 3J7ZT 3KLHA 1SQEA 2HHSA 5J2MA 1N0VC 3H20A 3U1NA 3DYAA 2OD4A 1UKUA 3DLJA 7FD1A 4IRCA 4LF9F 2J0WA 5KFZA 4L72B 2BJEA 3MPVA 4DR4F 4KTQA 1MMNA 1FE0A 5A0YB 1XERA 4FNHA 1LXJA 4HVZA 2FIUA 3MGJA 3EX7B 4CO3A 2HMIB 5DG8A 4F4XA 4C11B 1R8HA 2KYXA 4RBTA 3U02A 5CZVA 2P9EA 3VZHA 5GAGU 4QBUA 2QV6A 2VQEF 4KRWA 1U6FA 2IVYA 3OXLA 4ZCKA 1FRJA 2ADCA 3X3UA 3JYTB 4QU7A 3HPOA 3CMES 1JK9B 3TUZC 5GAHU 4IRKA 3R3TA 3CB4A 3V4IB 1CLFA 1FNOA 3Q0AA 2XO7A 2H9ZA 1YWXA 4JI2F 1H2VZ 3PW5A 2DISA 3MECA 2W7OA 1TKDA 2JLEA 3N4WA 5L1JA 3CCTA 2FC9A 2M2BA 5IQQA 1S0MA 4FXVA 5IWAF 1KHVA 3I5AA 1IBMF 2AGQA 1QAJA 1IJEB 2PA3A 2KU7A 4NLXA 4CO4A 2XCPA 3MUMP 5LXRA 5I3UA 4TU7A 4JI7F 2ZJQQ 1VK3A 4DN0A 4Q5VA 1NRKA 1S4FA 1UETA 5IM0B 3IR7B 1S76D 2FJVA 2DNMA 2EK1A 2CRLA 2FGCA 1HWIA 1HR0F 2D3OR 1QE1B 3ITHA 4TQRA 3HVRA 2BBEA 2IRYA 3ZZTA 2DNKA 2VA3A 4IOAQ 2E1AA 1ROFA 2VG6A 2YWHA 1GXTA 2ILYA 4EYIB 4ZPCA 2Z2LA 2N3LA 4QJVA 3PW7A 5F3TA 5L1LA 2ZC3A 1U26A 2JLFA 1QAXA 3RRKA 2GQ2A 2GJIA 3NBPA 4J9NA 1VQ6S 1UJ6A 1NHUA 1S6PB 4B08A 1DURA 1SC6A 3E01A 3ZZ0A 3R5DA 2RKIA 4AYBD 1D9DA 4HKQA 4ICLB 2JRSA 5KT2A 1ZZFA 2UP1A 4J9PA 4ZKAA 2AD9A 3DLKA 1DJ0A 3LP1A 4DSIA 2OTLS 4A8SA 3IGVA 4NLRA 3Q8QB 4DSKA 1JLCB 3NCPA 2G13A 4JOUA 1IKWB 1P1LA 3LGMA 2R7WA 1T02A 1WTFA 4OJ3A 3PFEA 2LYVA 3OR1A 2ZH1A 2D3UA 2CPYA 2LEAA 3MUVP 2ZH2A 4DUYF 2Y1JA 1L3SA 1DTQB 5GVQA 4ECYA 2MSSA 1HI0P 2CQ1A 2OPSA 1YJ9S 5B0CA 4Y2IA 1DLOB 4OI2A 1S1XB 2XLJA 2QMWA 1ZETA 3P6YC 1DQ8A 2PMZD 1KFSA 1H98A 3BGRA 3GIMA 3ZZPA 4USHA 3QIPA 4CTAB 3PFOA 4LQ3A 1OQ6A 4DR2F 4LJMA 2BQUA 1XN9A 3BGUA 5JXSA 2AJ4A 1JLQB 1OS5A 1P9QC 2J7UA 3T9ZA 1RJJA 3OPKA 5C24A 1V6HA 2V94A 2HHHF 3FFIA 2R2SA 4J9QA 4RW7A 2VUGA 1FK9B 5KFJA 4GO5X 4DFJA 4CH1A 3AH6A 5CYQB 1ZM2A 2GCFA 4B9SA 1VQPS 2EFGA 2DGUA 1FERA 2ZFHA 4QPTA 3SFGA 3GG1A 1FDDA 2YKNA 3HZGA 3IGNA 4F3MA 2E5LF 2WK4A 1X8DA 3DLEB 3HP6A 2RS2A 5IT4A 3IWLA 1DHMA 2RQKA 4HT7A 5L9XA 2RDIA 2ROGA 5B0GA 4B02A 3I55S 1Q8IA 3DLGA 5LMUF 4WU2A 4LSLA 2C3OA 2PEHA 2V0NA 2DGTA 3MM5A 4K59A 5H9EJ 6FD1A 4Q7AA 4ECZA 2F1FA 1I1GA 3HKZD 4A4JA 5MLCV 3PEHA 3K58A 3M30A 1O5JA 3MD1A 5GAEI 5F9LA 3DHXA 4IR9A 4I6AA 5DLFA 3OSPA 2VPWB 4E0DA 1GAOA 1W25A 2QFJA 1MWYA 2EFPA 1J2VA 4IQXA 1F5CA 1RAJA 1SH0A 2V4JB 1UVKA 4Y6IA 3HT3A 4DV4F 3V5RA 3QWUA 4PPDA 3V6JA 2IBOA 1NK4A 3IC1A 3Q2TC 2LLZA 4QIEA 2ZZNA 5KFKA 4N5SA 2XMJA 3SV4A 3AQPA 5C25B 3H5XA 4H4MB 2COLA 1JMTA 1KLNA 2WRMA 3ENVA 3OTOF 3PHEA 2R7SA 3CD0A 2DH9A 3LF0A 3QGGA 4F26A 4B3RF 1YJTA 3SCKE 3GYXB 2CJKA 2MGZA 4M63A 4ZVFA 3GWCA 1N5SA 2DB1A 2NZ4A 1V3ZA 4ZA1A 1DFDA 4DR7F 2KJVA 4DUZF 4I6WA 2QA4S 1FDNA 4RW6A 4H4OA 1Y3JA 4R0EA 5KFSA 1RTHA 1YJRA 3IXQA 3MAQA 2KT5A 4LVOP 2LEBA 2N4DA 4HEA9 2NUUG 4DQSA 2FVPA 1T7PA 5HBMA 3NGKA 5J2NB 3TA1A 4NL5A 3CCLS 2Q66A 1H3DA 1L3UA 5A8RA 4B9LA 4OMFG 3FVYA 4A8XA 1HBMA 2EBGA 2FHKA 4PPZA 1N56A 4NCBA 1F0XA 3ZZRA 4KIAA 2X1AA 2QO3A 5KG0A 2PO4A 4OFZA 2BE2B 3V6HA 2BANA 2BXJA 1H0HB 4DMZA 3KK2B 1IKYA 1CQMA 4YOEA 1S49A 3OJUA 3GMGA 4PWDB 3G6VA 1X4CA 3BDEA 4ZPTR 3DRSA 4KKOB 3FMWA 2PA8D 1HQEA 2NPIA 4OI0A 4EFAC 4KGKA 1TQLA 2M5YA 4XPEA 4ZCLA 4CO5A 3HHLA 2N3OA 1QAYA 1HNIA 2WBRA 3LP0A 3BZQA 5IQ6A 3BQ2A 3GIIA 1FRXA 2WSEC 1R3NA 3IRXB 2DNOA 2CQPA 1N6QB 3EGWB 4LF4F 3TAMA 3LANA 3VF0B 4R5PA 2QSWA 3I0RB 1DRZA 1FA0A 1YGYA 1RGVA 3KLGB 4DL7A 1U48A 3PR5B 1DARA 4ITSA 3Q8RB 2FY1A 3W7BA 1SI9A 2JVOA 1FKOA 2B9XA 4Y34A 5LL6d 3DMJA 4F25A 3H5SA 4P6QA 4Z2XA 1FE4A 5KFVA 5KG3A 1VC0A 2WW8A 4JI0F 4QU6A 1F5AA 2YKOA 1FD2A 1S79A 5HMYA 2FGOA 2BRLA 4KO0A 1M90T 2XWXA 1Y00A 1ZM3A 2A3JA 2QT7A 2PDAA 2OIHA 2VFSA 2MKJA 4PG8A 4J9LA 1FD8A 3K8WA 4LSNB 5AXMA 3IWNC 2I1RA 1IKXA 3UFCX 1XWLA 2C28A 1N36F 1GH8A 2BDPA 1N0UA 3RTVA 3G6YA 1VRTA 2XC9A 4JI3F 4RW9A 1D0EA 4O3OA 2BQ3A 5EGYA 5IFMA 4IFVA 3JB9k 2VBWA 1B64A 1X4FA 4NA3A 1CG2A 2LMIA 1GXLA 1MMDA 3V2UC 4ZCIA 3KLEB 3MM8A 3T6JA 3NKYA 5CXTA 1JLBB 3DLHA 3E8OA 4OZ0A 5KFUA 1CPZA 1HHSA 3MM9A 2POKA 2PIIA 4OJGA 4CNYA 1U1LA 3CJ4A 1WF1A 3MTKA 3P3DA 3T3FA 5K14B 4ZP7A 1FKAF 4Q0BB 2DNNA 3MEGB 5DM6Q 2HNZA 2EFVA 2QA4G 2HGMA 1TVRB 2ZDOA 2D7SA 1KSPA 2A10A 2W4DA 1YSJA 1FXDA 4CT9A 3MR5A 2RVJA 3K5PA 4YQWA 3QO9A 1SJ1A 2DNYA 2KRBA 4NYZA 1RT4A 3QYYA 1UEUA 1U6ZA 3M2UB 4WK1A 4O4GB 2NR0A 1LW0B 4FF3A 3WC0A 3N5FA 3A1YG 1XMQF 4C0BA 2ASJA 1X7VA 2HHVA 2NUHA 4WE1A 4PG6A 4DR1F 5J1EB 3CO9A 3I31A 2M8HA 5KOWA 5A8WA 4QR2A 2UZAA 5IZHA 4C8LA 3O2IA 5DDQC 4TY8A 2P6SA 4ALZA 1XMBA 2MPUA 5KAKA 3QLHB 1MROA 5THWA 2M3DA 2X1BA 1VQOS 2Z2MA 4XO0A 2DRAA 1W2IA 4ELVA 5B0DA 4BDPA 4DQRA 4FF4A 1FNMA 1S9EB 2LU2A 1DTTB 1NJYA 2R7VA 1RT7A 3I5BA 3IS9A 3SV3A 4WYLA 2MKSA 4ZPBA 5AXNA 3DXSX 3FSIA 4NRTA 4OZ5A 2C2DA 4DHVA 2R7QA 3GFZA 3HZEA 2HZCA 5A8KB 4DL6A 5J2PA 1U24A 1ZOTA 3GFYA 2RRBA 2XGPA 2XS5A 4ID8A 2YX7A 1MW7A 1C1CB 4I6YA 4KB7A 5J2MB 4WFNQ 1C0TA 4NWBA 4NYPA 5BJRA 4X2BA 5GAGI 4RNMA 3RW6A 3B4DA 5D8HB 4WKRA 2XULA 2B0GA 5T7LB 5BYSA 1LV5A 4FVCA 2XZWA 2FUG9 1P6TA 1TL1B 5GAHI 2J6SA 1L3KA 4NZ7A 1WG4A 2HS0A 1N4LA 2AQ4A 1JLFA 2LA6A 1S6OA 1UL3A 2RQMA 3OQ2A 2RDJA 3BS9A 5EUHA 2MSTA 4A8YA 1HHTP 1FDBA 3UCZP 1FRIA 1FHTA 1X4GA 2OPQA 3HHKA 2JVRA 2UUAF 3O1LA 2ZVSA 3TUJC 4ZDNA 3LW5C 1BQMB 4C3KA 3SQGA 2DVIA 2Z4PA 3QJLA 3CJKB 3MPWA 1S1UA 2XSJA 2OMLA 2G4BA 3I96A 2VFTA 2Q79A 1X4HA 2W7PA 4F02A 2MQLA 3DOKB 2LQBA 4NLQA 2P9CA 3BN7A 3TVKA 5KT3A 2YNFA 5DG7A 3M32A 4TQSA 1JJHA 4UQGA 1HQUB 2C3UA 3BO2A 1UVLA 4TXSA 2OD6A 4OZJA 1M5VC 4P2SA 4RNFA 1S77D 1NB7A 3MM6B 3DOMA 3M05A 1KHWA 1HA1A 4Y65A 4RNHA 5A2QY 1RTJA 1NJWA 2I5JA 1S1WA 2D9OA 2ASYA 1WEZA 2JHEA 2JOQA 2YNIB 4P7TA 4C98A 1IN0A 2A18A 4IQMA 4ZLPA 5D3GA 3CCUS 2LXFA 2GHPA 3IO1A 2AJ0A 2RT3A 1C2PA 1RTDA 4QOTA 2MY8A 4B9UA 4WXOA 2C2EA 1U47A 3ITHB 5LJ3Y 2B4PA 2JX2A 4QR0A 3VAFA 5J2QA 3HK2A 3F41A 3PDNA 3C2PA 2PN6A 4X4NA 5KFEA 3MOJB 4ED3A 3CC4S 4RX6A 2UUCF 3KWMA 2MQQA 1XR7A 5G0RB 1RISA 2EKYA 3NBPB 4YP3A 2W9CA 5HROA 2CJQA 2VBZA 5AE1A 1XBWA 4N41A 5LSOA 3KHHA 5L9NA 3E01B 4I2QA 3RB0A 2PGCA 5C42B 2RKIB 2AX0A 3OL6A 3M2VA 3RB4A 3DLKB 3LP1B 1N5VA 2I9SA 1CSJA 4DDFA 5I42B 4R8UA 2CJAA 5KFDA 3UPFA 4J9OA 3HJFA 1S9GA 4GC6A 3GR1A 3OR1B 2XNRA 4DV1F 3FGVA 4YDXA 2V9WA 5K8PA 2IA6A 1UEVA 4J9SA 4LMZA 4MTPA 5KG2A 2FHJD 2GIRA 2OPSB 2VFVA 5KFGA 2GQQA 3THTA 4C8OA 2R2UA 2LQ9A 4K4YA 4YUDA 1KS2A 4QWAA 1HYSA 1RT5A 3NAIA 1VQ9S 1WHXA 2QA2A 1Q4RA 1FO1A 2WONB 2CPDA 5LXYA 3H4BA 3KK3A 1K9MT 2J6TA 2EVZA 2HQ3A 3PX6A 1N5QA 1H7WA 2KN4A 3QIPB 1FCAA 4ID5A 3JTOA 5K5MA 1VQ7S 4I64A 1LWCA 3W2WB 2RB7A 2DITA 5EX0A 3OTDA 3TVZA 5C24B 3MTJA 2VODA 2K3KA 1X5TA 3GG0A 2KZZA 4UQTA 1PO6A 3FFIB 1VBZA 4RW7B 3NNCA 4R25A 2JEJA 2GQCA 2ZBCA 4IH6A 5KFFA 2EK6A 2LXIA 3DU6A 2NYIA 2YKNB 1EP4A 2VC1A 2EI5A 1UA1A 4B9TA 4NLPA 5JJBA 4ECWA 4UY85 3OLBA 3K57A 4PR6A 4DL2A 4I7FB 1IJFB 4IG3B 2AP6A 2PMHA 5IXUA 1H2TZ 1G6BA 4GKJF 3DLLQ 5J1NA 2KG0A 3V6DA 3MM5B 3D0HE 1NKBA 4FYDA 1T94A 1HW8A 1Q7LB 2HFNA 5B0AA 4EBEA 1FJEB 5E3QA 1NJZA 4DFMA 4I2PA 4NA2A 1Q8LA 3M30B 3MEDA 3WBZA 4ECQA 2CQHA 2HRYA 3MCSA 4QPXA 2KM8B 3ENQA 3K7RA 2Q1LA 2R8HA 2RJZA 2J0XA 1Q81T 5U47A 3R5AA 2RIJA 3EZ5A 4O3RA 2NSBA 3KG4A 2Q6CA 4G1IA 4WFYA 4F8RA 1FRMA 4ED0A 1S6QB 1OPZA 4J9RA 1FJGF 1RT6A 2CVIA 1N54B 2DTJA 3FRZA 3OTEA 5CHCB 4KAIA 1G1XA 4YB6A 1C1BA 1M5KC 3DRRA 2WOMB 5DDOC 4IDKA 4QIFA 2EG2A 2HHWA 1L3TA 1LOUA 4C3LA 4KSEB 3OXFA 4C7QA 4PKDB 2MGZB 1AXQA 5M2UA 2BUNA 3DI6A 2QIFA 1VS3A 3ENWA 1R89A 4RWXA 1YI2S 2VA2A 4YR0A 5D78A 1SJRA 1A7GE 2IRUA 1B0PA 1RTHB 1R8PA 2RE1A 4RW8A 1VQSA 3CCQS 5F8IA 1TK8A 1S1TB 3MFIA 1C0UA 5HBMB 3T5LA 3I9ZA 2M70A 2YWGA 3QGHA 5CH7B 1KOOA 1RP5A 3THPA 2MDAA 5A8RB 5D77A 4NLWA 3BO4A 2GJ2A 2DO0A 1HBMB 2MZ1A 4C4WA 1UW4A 1FKPB 3UW1A 1UWBA 1WEYA 4O4RA 1M5OC 4CO2A 3NMAA 1O51A 5DO2A 1HNZF 1NU4A 4JI6F 4AL7A 2BANB 3BF4A 3OHBA 3VAGA 2IM1A 1KQKA 4IFYB 3DRPB 3LAKA 4DSFA 4CH7A 1HMVA 1Z2ZA 2AJ1A 2Q3PA 4LQ9A 4YB5A 4QWBA 5L1KA 3PIOQ 3TP2A 2VG5B 4I4BA 5M2RA 2X1FA 1UJ5A 3DRSB 3IWXA 1K73T 2PE8A 3CCMS 2E7WA 1ZAVA 3UDCA 3BR8A 4AL6A 3TX8A 3CJ2A 3LP0B 3OTCA 4ZPAA 1LKZA 3D1HA 1SKSA 1SXLA 2VB6A 3AY0A 1TKZB 4TU9A 1IUJA 2EFQA 4OI6A 3PO5A 2ZDPA 3FEZA 1JKHB 1SIWB 2E5IA 4KV8A 3SDEA 4ECSA 3T1HF 4ZVGA 2R7TA 1RT2B 1WHYA 4AXIA 1JNRB 4NCGA 3QJJA 2AJQA 2IAJA 5F8LA 1LK7A 3UR3C 1ZZNA