2XLIA

Crystal structure of the csy4-crrna complex, monoclinic form
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
189
structure length
167
Chain Sequence
FTMDHYLDIRLRPDPEFPPAQLMSVLFGKLHQALVAQGGDRIGVSFPDLDESRSRLGERLRIHASADDLRALLARPWLEGLRDHLQFGEPAVVPHPTPYRQVSRVQAPERLRRRLMRRLDLPFVTLRSQSTGQHFRLFIRHGPLQVTAEEGGFTCYGLSKGGFVPWF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequence- and Structure-Specific RNA Processing by a Crispr Endonuclease.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase/rna
molecule keywords CSY4 ENDORIBONUCLEASE
total genus 36
structure length 167
sequence length 189
ec nomenclature
pdb deposition date 2010-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09618 Cas_Csy4 CRISPR-associated protein (Cas_Csy4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2540 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xliA01
4AL5A 2XLKA 2XLIA 4AL7A 2XLJA 4AL6A
chains in the Genus database with same CATH superfamily
2H3EB 3L95X 1GFWB 2KI2A 3HT0A 4I7FA 3W5XA 3KHRA 4JYAF 3SSQA 1J5EJ 3FQKA 3DU5A 5D4OA 3GILA 5SUHA 5A8RB 2XMKA 3I55S 4ED2A 3C46A 1X7VA 2GJFA 2AYMA 1VMBA 1M1KT 4DPXA 2RJZA 4OI2A 5L1JA 2B56A 2BBEA 4OJ3A 2NUUG 2QLBB 4QJVA 5ITHA 4X64F 3PIPQ 1S59A 1C0UB 4K5RA 2FZCB 2GW8A 3X1LB 2QMWA 3QMQA 3DOLB 4ZP8A 1SJ4P 1WACA 4ID8A 4ZPDA 4CM0A 3HCXA 5LMUF 2CPDA 4DR3J 1N54B 2VG6A 2GQ2A 3S8SA 3PX0A 3HK2A 1UWAA 2AJ2A 1L5UA 4RO0A 1Y0HA 1ZAXA 3C16A 1S6PA 2FLNA 2V2VA 4DSLA 3FCVA 3KWMA 1CULB 5HK4A 4JI1F 2R7UA 1UJ6A 2J9DA 4OYPA 2OPPA 1NLKL 2OEJA 2CDRB 3ISND 3OTDA 1QDUB 2EI5A 2YKOA 2JLEA 3BKFA 3MMAB 3OFGA 4HVZA 4ICLA 4RW6B 4BHQA 3OL8A 1RTZA 1NEEA 4DF8A 4FF4A 4GO7X 3GLJA 2XBPA 3H20A 5KT6A 5DM7Q 3JTPA 3M9NB 4I7FB 4DUTA 4R25A 3W2WA 1S72S 4NXNF 1FK9A 4WP9A 2XY6A 3I4PA 3H5YA 2CDQA 4J9PA 1S1WA 2LXUA 1C1BA 4QPXA 1IBMJ 4GVBA 2VBZA 1NK0A 3CPWR 5HQLA 1JLQB 4HKQA 5EWFA 4DPWA 2H5JB 1FJ7A 1P8GA 2M9KA 3FQLA 1HNXJ 1NJWA 4EMDA 4B9SA 3SSRA 2JC1A 4PWDA 2MSSA 1FA0A 5HQMA 3KJVB 1Q82T 2LMIA 3PNIA 1ZZNA 3QRQA 3CCVS 1IKYA 1TKTA 1Q5VA 1CSJA 4UW2A 3R7SB 4RNNA 1YLXA 2GFFA 2PEBA 1TKXA 4OI6A 4B3MF 4OYIA 3GP9A 4OYWA 3QRPA 5LOQA 1NK8A 3HO1A 3HSGA 3U7JA 4XPEA 3AHPA 2V50A 5K14B 4K4WA 2XYGB 3MFHA 2VA2A 2NZ4A 2J6TA 3QYYA 4CLUA 4KBIA 3CO0P 3M2UB 3C19A 4C11B 4CLZA 5IT9Y 3WX4A 5L39A 1FRMA 1OPZA 1D9FA 1V5IB 3HF5A 1FEEA 4UF4A 1SB6A 1I94F 5DO2A 1DARA 2G2OA 2F7VA 2K7KA 1FVQA 4N56A 2VD3A 3TX8A 3G6ES 2R8HA 1S6UA 1V3SA 2VBXA 5FJ4A 3CCJS 3W61A 5LXRA 1FF2A 4TN2A 2FUG9 3DMJB 4K50A 3LOUA 3MM8B 2ZJQQ 1WSRA 4WP3A 1S57A 4R0EA 2R2SA 4EYIB 4MK9A 3EVWA 2Q6BA 2M5YA 2Z2MA 3GIKA 4PUOA 1Q7YT 2HHWA 4F67A 2QT7A 2YNGA 2CQ0A 5MAOA 1YJRA 1FWKA 2AZ1A 4Z7CA 2UXCF 1VQMS 1KQFB 1RUSA 3OR1B 2ZBRA 1LWFB 1ZM4A 5LMUJ 4B3SF 2X7IA 3D54A 2BV3A 1OS5A 2VA3A 8ATCB 4KKOB 3MFIA 4G65A 1T05A 2W2NP 3DC2A 2R7XA 1AUSL 5CD4H 2G0JA 3MEGB 4UUWA 1U1KA 1T9VA 5HVGA 3IG1B 4EZ9A 3D7SB 5HQ8A 2X1GA 3S6EA 1SUQA 2FPHX 3MM7B 5ETPA 4ZPBA 4PRFA 5CAAA 1N56A 2RKIA 2FLLA 3GV7B 1X60A 3AB4B 4UOFA 4X65F 2EK6A 4ZLLA 1RQ0A 2VV5A 2CQ3A 5A8WB 3LP0A 1FT8A 1RT5B 4OZJA 4URSA 5CYMA 2EXUA 3ENWA 1WORA 3SEOA 1S9GB 5M2UA 1CQMA 4Q45A 3M2RA 3QZ8A 4DQSA 5DLFA 3IWLA 4NLVA 1PG5B 2LU1A 3DLLQ 2YNGB 4M1KA 4DUZF 3J81Y 2QL5B 2WVCA 1ZA1B 2ZC3A 2CQIA 4HHHA 5CYQB 4D3HA 4KH0B 1PILA 2CPIA 2F5GA 3ZZRA 3DXSX 1FD8A 2JEGA 2OIHA 2VQFF 1HPZB 1SPBP 2ZITA 3TO8A 2ZM6F 2RRAA 4F0MA 2R8JA 3ZZPA 2CZ9A 4IDKA 5A0YB 1VGYA 1RT3A 3A8IA 3CCTA 1A0OB 5F41A 1HL6A 3K5LA 1VQYA 1FE4A 1UMJA 2KKHA 3CXCR 3BQ0A 3M6WA 4DG1A 4A8MP 1Q0NA 2NSBA 3CIZA 4ZVHA 4K7QA 3W66A 3FMWA 3E2EA 2OLWA 2LDYA 2NXNA 2RF2A 2VC0A 3UNGC 3VTIA 3CCZA 2HVEA 4CZCA 1Y00A 1U0HB 1Q8LA 2FYXA 4Y6IA 2IVFB 3FDSA 1RJJA 3LP0B 1RTIB 2DHGA 4P73A 4DX8H 3BPSP 3CD5A 3NOCA 3T5JA 2YH0A 2PFDA 5FDLA 3DOMB 4QWDA 1R31A 3ZZ0A 3PW2A 1OO0B 2QA1A 4Y2MA 3WQPA 3EDRB 1R43A 5CZVA 4JI4F 3R5GA 2RE1A 4LF9J 4KHPF 2COLA 3TVYA 4ZPCA 1S0NA 1GQEA 1KVKA 1TL3A 2EKNA 2DGWA 4L3KA 2K3IA 3P45B 2PFFB 3QPIA 4FBUA 2G2YA 2HQCA 2J0WA 3V4IB 2J0QD 2HGLA 3HP6A 3GG1A 4G1IA 2WSFC 3TANA 1GXLA 3W2WB 2AF6A 2KYXA 4RNFA 3T1HJ 3FGVA 2UXDJ 2YVSA 1AYEA 1YJVA 2CJYB 4IRDA 3IBCB 1VOMA 4M5LA 4C11A 2E5JA 3R5DA 2E44A 1Q95G 2GHVC 3KG1A 4YB7A 2HHQA 1XERA 4I6AA 4M5IA 4N8NA 4B17A 1U26A 3CC4S 3MMCB 2RH3A 2MZSA 2XCPA 1IQZA 1XMQJ 1CJKB 1FJGJ 1VRTB 5HBMA 1PAEX 4LREA 2XCAA 1S6PB 1KBRA 5H9EK 2VG5B 4DF4A 2E9ZA 1WC3A 1S1UB 3H25A 3OSNA 4Z7YA 2FQQB 4TY9A 2D9OA 2QTWA 3RB0A 3I31A 4LFAF 2HEKA 4OX9F 1HNWF 2V9KA 5JJBA 3IA0A 1B64A 2LLZA 3MMAA 2KDOA 2XM3A 1W25A 2MHNA 3EJMA 1EX8A 2IMOA 3NWRA 3ZNJ1 1VRUA 4KT0C 5JMNA 1ZBTA 2R2TA 1NK7A 4DMZA 2C3UA 1BGXT 3IR5B 2POKA 2JFDA 2QE5A 4KGZB 4PEOA 3MR2A 3TW0A 4DFPA 2ABYA 1VQOS 4O4GB 4H4OB 2BE7D 1XNQF 1IUJA 4ETXA 1CLFA 2HK2A 4ZCIA 4RBTA 2WVEA 7FDRA 2YWWA 3BGLA 5IT4A 2MQPA 3WC2A 3MEGA 2W24A 4NX9A 3R1HA 3EGWB 3DLKA 3RBXA 5C42B 3HM9A 2IMWP 4G6VB 4RW8B 2F40A 2X51A 3LP2B 4M5NA 3G82B 1C0UA 3UWTA 4CNYA 1SV5A 3FRYA 3IWXA 4KO0B 4UUXA 1TU0B 1VQ8S 1KFSA 3OVAA 2BQRA 1EKSA 5JXSA 2CQHA 2Z4PA 3OFFA 4AL6A 1IXKA 1RWVB 2YNHA 4O3NA 3Q8QB 4WIQA 2B9WA 1TK0A 4NLUA 1BQMB 5HSPA 1QAJA 3MM8A 5KOXA 4CLSA 4AFFA 4CYUB 1O8BA 4MK8A 2VOOA 1OY9A 2Q6CA 4ENOA 3KUHA 1RTDA 1R0AB 2VB6A 3GIIA 4QWBA 1MROB 4ZOSA 1JX4A 3GIMA 2HBQB 3C6TA 1HA1A 2B5JA 4LRBA 5DLGA 3G96A 3HFKA 1NHVA 3UI3A 4K4UA 1R6YA 3OLBA 3GONA 2MZQA 2OSRA 1AW0A 1VQLS 4ZVTB 2PDAA 3EVOA 5IV4A 5EHHA 3R3TA 2XULA 5HN0A 1EQ0A 2MQOA 3A3PB 1CC8A 1OY6A 4OV6A 3SXLA 1AA1B 1FVSA 3NGRA 1U7LA 3ZZUA 4OHVA 2O67A 2G1HA 2N82B 1S76D 1XWLA 5HAOA 5I3QA 1X4CA 2V5HG 5LSOA 4QYZK 4ZMMA 4OYXA 4TYBA 4EBCA 1JLGB 1VCTA 1RDRA 4F36A 3IO1A 5K8PA 3UPFA 2D1CA 4NCAA 4CTAA 2XS7A 4NLOA 2VHGA 1SCJB 2RMLA 3QT5A 4H4OA 3OHAA 3J7YU 1HNZJ 9RUBA 1JMTA 3HHLB 3NY0A 1XQIA 2CQBA 2J0XA 1VC6A 2ZOGA 1ZH5A 3B54A 3BGUA 2VPWB 1VHIA 2FY8A 4BBYA 3GV5B 3IAS9 2V34A 5KFZA 1RT4A 2VASA 2QV6A 1ZTTA 4K8RA 2RU3A 2AX0A 4RWXA 1RWPB 1YJWS 2QX0A 2MZ1A 4MIBA 4CLLA 2G1DA 3DRPA 1DRZA 5L46A 2GCFA 3FRZA 2ZBIA 3NG8A 1REVA 5K20B 1K9MT 2UUAF 1EETA 4V19X 5I42B 4PWWA 2MKSA 5C25A 2L41A 1H2TZ 1QM9A 1U24A 3EPGA 3FSIA 2VQEF 3VWSA 4NWBA 1NSQA 4I64A 2AV5A 1NK9A 1Y3JA 2YPZA 2B9XA 1N5VA 4FPRA 2E5LJ 2PT0A 3DM2B 3D66A 4QQBA 2MKHA 2R2RA 1NM2A 5A2QU 5CYQA 3BEGB 2KZZA 4J9NA 2XMMA 3O44A 3GU0A 1RACB 1I1GA 2LFVA 3PEJA 1KTQA 3OFEA 2HZAA 2JVOA 1RCOB 2GZOA 1YBAA 4JI0F 4EFAC 2F4VJ 2P9CA 1APSA 1YG0A 3R7NB 3CMAS 3OQ2A 2C3MA 3H8YA 2ZE2A 1QSSA 1WG5A 1O51A 2F8EX 3DRXA 5GAEI 5I4MA 4QU6A 2K06A 4HR2A 4DLGA 1KKHA 2LYVA 5IC4B 5LM7E 1L3TA 3CD7A 3HJVA 1LWEA 1KHVA 2F8MA 5HMXA 3IRXA 3KK1A 4DSJA 4W92B 1KD1T 3UQSA 4LF4J 1G3OA 2HNZB 1WF2A 3PFEA 4KE5A 2JX2A 4DOZA 3POTA 4QZVB 1RT7B 3CDWA 2E1AA 1UP1A 2YKMA 3BGOP 3M05A 4K4TA 1RAOA 1BQMA 2KJWA 1VBYA 1N6QA 3GR0A 1JLBB 1JNZB 1NHKL 1URRA 1X8DA 2CVIA 2EBEA 2WVBA 5AT1B 2EFVA 1X4DA 2BA9A 4Y3CA 2O66A 4EUVA 1NDPA 5GAHI 2QA4S 1WHVA 5A2QY 4USMA 3OL6A 3BSOA 4EO8A 3T9ZA 2GVDB 1X4BA 5A76A 3IS9A 5KFPA 4FXVA 1SJQA 5B0GA 1MWQA 2FHMA 1S79A 2HRTA 2WB1D 3EWGA 3WC0A 1JK9B 3PV8A 3I6PA 4OZ1A 3LAKA 3CJRA 1EQMA 3BZQA 3D3BJ 3CJ4A 3KTQA 3CJ2A 1WKKA 1WC6A 3RRGA 1UVJA 1TUVA 3SQOP 4NCBA 1U1LA 3MR3A 3KG0A 3JYTA 1HNXF 2ZZNA 2ZE2B 2CQ1A 4B9NA 2W2MP 3MEDA 1YRUA 2JSXA 3A3OB 4K0KJ 4E8UA 3NS7B 3KLGA 3PDNA 2CNNB 4ELVA 3VZIA 3AOCA 2ZM6J 1HLWA 3KLEA 4LBHA 3TEHB 2QL7B 2YKAA 5E33A 3N6LA 1U1QA 2UUBJ 3I32A 4NRUA 3QGHA 2AEJA 1DAXA 1H74A 2J6SA 1FWLA 3UVJA 3ZXWA 2AGQA 2Y1RI 3NCRA 1TL4A 2DKOB 5LJ5Y 1EJ7L 4A8OA 1N36J 3T6JA 4K4YA 1NJXA 1O0PA 1KEKA 2LQ8A 4D3GA 2Z2ZA 4CO1A 1LWCA 1AXQA 3RRKA 3UD3P 1JWWA 1HARA 1RT4B 4YB5A 3T6BA 2V4QA 3ONQA 2ZVIA 1AZSB 1N0UA 4ZJQA 1XEZA 3HSZA 3LPYA 2WRMA 3OTCA 5HATA 2QJ3A 2IM1A 3LWLA 3P96A 4DFKA 1WEZA 3CO9A 2XS5A 3FSXA 4LQ9A 4JV2A 2M88A 3TQ1A 2VQFJ 1G4CA 4DS4A 3HHNB 4B3RJ 2HVDA 3B4DA 2A6OA 4LQ3A 2HHVA 3CVKA 3QJPA 3O6QA 1MNEA 4USHA 1BWEA 2O1PA 3UN2A 4WU2A 3OW2R 2FTRA 5E3CA 4CYUA 2XZTB 1EB0A 4K2JA 2QLFB 4PXEA 4C0BA 4PQUA 1HYSA 4X84A 2M8HA 1FTCA 3LUYA 3HHEA 1SIWB 2Y8WA 3Q8RB 5KG4A 4R5PB 4DL2A 1U45A 2VH7A 2DD8S 3W5YA 2HQFA 2YKNB 1KSPA 3GCWP 4WP8A 3NGDA 4C0OC 4LF7F 4HT5A 1S0VA 1Q1KA 2FLOA 2ZH6A 2C28A 3PYGA 1T9XA 3D0IE 3IFEA 3SCKE 2L3MA 1P1LA 4FVCA 2RD5C 2XMTA 2DGUA 2AEFA 3TI0A 4LRFA 3Q23A 2V4JB 5GMKa 4EEYA 1RBLA 2ACYA 1S10A 2YX4A 2KVQE 2D3ZA 2VFTA 3HVAA 2M2BA 4KV8B 4F26A 2ZOFA 3AQPA 3TAMB 4O0IA 2C3YA 2HK3A 1LK7A 2LA4A 3ITHB 1GMWA 2YWEA 3QGGA 5MLCV 1M5OC 3TQEA 2GQQA 5C2CA 2K1RB 1GTHA 4O3PA 4IO1A 2VFRA 3FFIA 2W25A 1P9YA 2NR0A 1JLAB 4RZRA 4TY8B 3U27A 2W9AA 2HPUA 3C15A 4WKYA 3E51A 4ANEA 1UFLA 2HS0A 3HFVA 4WXOA 2U1AA 3JTOA 1JNRB 3J80U 3D5MA 1NPRA 5J2QA 2FHKA 1WI8A 4PABA 2C2EA 1RTHB 4QIEA 4JI3J 3GFXA 3CJ5A 4F25A 1IBKF 2RT3A 2ZD1B 2AJ4A 1HQUA 2Z2YB 4TVAB 1VC0A 5ETSA 5KG5A 1RT1B 1RAEB 3QNWB 5IM0B 2WB4A 3RAQA 1VC5A 3QJLA 2KFZA 1UA1A 2DRAA 3V6DA 4DR6F 1RWUA 1NB7A 3CE8A 5HMWA 2PN6A 3C8YA 4M63A 4P52A 1N48A 2DGVA 1NRKA 2UUTA 3TOQA 2YQ3A 3M6XA 4IH7A 1X5TA 2RDDA 4WBFA 5CCLA 2HNYA 3FK4A 2R42A 1XBWA 3TZXA 1XTZA 2DH8A 4ZP6A 3J7AN 2YWKA 1SJ3P 4FDFA 4KGKA 1WSVA 5EN1A 2V2QA 3DGPB 2GC8A 3DOMA 2CNKB 1LOUA 1NZAA 4M5MA 3ZZYA 4YP3A 1HHTP 1VLOA 3PW0A 2K2PA 1DLOA 2CJ9A 4YHHJ 5F3ZA 2CPHA 1K0TA 2BE2B 3L4BC 4HHUA 1WKLA 3KNGA 4FPIA 4AXJA 4DV2J 1ZPVA 2C1EB 2EK1A 4LBIA 5J2NA 4B3RF 2IY5B 2W01A 4ZPWR 2XB2D 2J8SA 3CWJA 1C4CA 1VQPS 2F65A 2HIYA 3HX9A 1F1BB 2RQKA 1ELOA 3DLGA 4J9QA 3MMCA 3C2PA 2G4BA 2D9PA 2XSJB 3KHLA 1HBUA 2D69A 2E1RA 2G2ZA 4KGMA 2CXEA 5KG1A 3V6DB 2XLJA 4GKJF 1H73A 4IR1A 5B0DA 2MSTA 1SIZA 1KQSR 3NOGA 4NYPA 5HJYA 3F44A 3L09A 2YTCA 3C14B 3M8PA 5HL7Q 3A8KA 2HNYB 4WFNQ 5LJ3Y 3M2RB 4P75A 2L9DA 3RW6A 3M8RA 1VIOA 5GMDA 1SKSA 2RU9A 3CIMA 4DR7J 3UVJB 3PX6A 3DFEA 4MKYA 3P49B 2M3DA 1S1XB 2K3KA 2WZ1A 2ZWPA 3QJJA 1YKWA 1T9TA 2ZBCA 3MR7A 5GMEA 1N32J 2HBRB 3I5AA 1AT1B 1KOHA 1HBMB 1KOOA 2V8DA 3T1AA 4A46A 1TTHB 5IM0A 4WCEQ 2UVRA 4B3TJ 1H6KX 1SJFA 1LWCB 1H0HB 1HKAA 3I4HX 4IDKB 4NYOA 4V1Ak 5A0YA 2BM1A 4Z37A 3EE3A 4H4KA 4Q2LA 4ER8A 3KOAA 1KHWA 2P2CB 4DJBA 3DXBA 1VBKA 5AE3A 4ZITA 4G1QA 3M30B 4LSNB 2HNDA 3ZTQA 3CC2S 2XMAA 1UWBA 3DYAB 4LVNP 3VAIA 3SYZA 2RQ4A 4I67A 1U0HA 3JAMY 2LCWA 5GAHU 4USWA 5KFUA 1U2RA 4B9VA 1I3OB 3KJVA 3FFIB 3L7OA 4BCAA 4IRKA 2RILA 4C0HA 5KFJA 1FRKA 4U6PA 4RNHA 1QVGR 1UVKA 2F4VF 4W4MA 3BJYA 2I8EA 2LA6A 2PA3A 4RW4B 2DRBA 2AGPA 2KO1A 2AZ3A 4KGVB 3VF0B 2X1BA 3NL0A 4P2XA 1MWYA 1MMLA 2DGSA 4CO3A 1RYSA 2Y9HA 1H2VZ 1UVMA 4X4NA 1U1OA 2RVJA 2IAJB 1JXLA 5IS2A 4L72B 2CNOB 4NPOA 3PO5A 5LSLA 4BC7A 2XTJP 1HNVB 2QZ8A 3DLHA 1JKHB 4YB1P 4RW8A 2KG0A 1URNA 4OHZA 3DHWC 3WBZA 3M2UA 3DKDA 1FDNA 3QIDA 2AHOB 3GFYA 4GO5X 3RG6A 3AFGA 4URGA 4ANCA 1OPIA 5L38A 4L3NA 2OD6A 1GX5A 2NPFA 2GMLA 2MLYA 2WW8A 1FNMA 3Q86A 2BVZA 2BW2A 2MHEA 5AXNA 4J9VA 3FC9A 5FDLB 5DETA 4PXDA 2HVIA 2FHJD 4ELTA 3R6GB 3G8TA 2P8IA 4LUBA 4DV1J 1X9SA 1A9NB 1CVJA 4C7QA 2V0NA 2FHJA 2KTQA 1HHQA 3GJRB 1SVDA 2XZDB 4L74A 4QIVA 5GVQA 5THWA 1P6TA 3W8PA 4F7VA 1Q79A 2FVCA 4C97A 4U7CA 2LQ9A 3NGTA 4HACA 2XC9A 1RB0A 2IAJA 3VGSA 2ADCA 5K9FA 4DQIA 2DNOA 3H59A 4F04B 4WIIA 1CJTB 3M2VB 2E7VA 2E5IA 3CCSS 2PI5A 1V9OA 4IOCQ 3MUVP 4P10A 2LP4A 2JC0A 2OPQB 4DV3F 4QIFA 3N79A 2F4FA 3IR6B 3FZBA 2V8GA 2BANB 3R2DJ 2FVSA 1NJZA 3M8WA 3V6KA 2GMJA 2P9EA 4YDXA 3D9BA 4QWAA 2WCXA 4DR6J 3G2XA 3LGHA 4R8UB 2AWZA 2HG4A 4WU3A 1N32F 2HIQA 1D09B 4ZVGA 2N4CA 2PMHA 4R0JA 2D3UA 3B4MA 4U8VA 1YDLA 3DHXA 4CO0A 1IKXB 1UZDA 5F8LA 1G7CB 3KUEA 3BO3A 4B3SJ 5AJ3J 4L76A 5F8IA 2XSFA 3FNNA 2BOAA 4XTTA 2DH7A 4Y2CA 2C2DA 1Y4ZB 1Y10A 5LL6d 4LF9F 1IVZA 3H5SA 3GFHA 4I6WA 1DY3A 3PYEA 1VS3A 3BGFA 5E5NA 4OZNA 2EEYA 3CCUS 2ASJA 4X4VA 2EKYA 5JVGQ 4G3IA 3KLIB 4DS5A 4UOHA 2DPIA 3EGVA 1RADB 3ZTSA 2J0SD 5B0FA 1DJ0A 2NYIA 1X4HA 1S1WB 2XG8A 3OJUA 2VFVA 2UUCJ 3HD2A 2YX7A 4KKOA 4WFZA 4X66J 2JEIA 4CH7A 2LQBA 4DV0F 3A3NB 2DRDA 1MWZA 4P7VA 2ALZA 2V9WA 1AZSA 2EFOA 4M5JA 2M7SA 3JS9A 3H4BA 2ZZMA 4BWMA 2W2PP 2KHDA 1PGZA 1F9EB 1H2UX 4ES1A 2VFSA 1KS2A 3IXQA 2WBRA 4DR4F 2DY1A 4ZJLA 1FRHA 2GNKA 4OYAA 4K2XA 1H7WA 1RT7A 2JLFA 3JQKA 2DNMA 5HLFA 4TQSA 4IG3A 3EVMA 2DEIA 4UZCA 1YX2A 4OYBA 4W98A 2C2MB 1TVRB 2ZH5A 4DBQA 2QFJA 2DBBA 3EZUA 1JLAA 2H54B 5E3AA 4ETZA 3BB5A 4P6QA 1UEKA 3AY0A 1MLAA 1TP7A 2H51B 2QLXA 2ZHAA 3M1VB 5F0WA 4QR2A 1YJNS 4J9OA 4AUKA 4B08A 4JI5F 4JI6J 4LF6J 3JXOA 1UJ4A 2CG4A 1FJEB 3MOJB 1SKRA 1UVNA 5I3UB 2B5JB 2BZ2A 2HFVA 3PKYA 5HI7A 4CDIA 2XZWA 4JI7F 4OYMA 4ZCLA 4NCGB 5IV3A 3W63A 4ZVEA 1RI7A 2ILZA 3PVXA 5E3QA 1UETA 4CO5A 2A18A 1LKZA 1ZM9A 3EUNA 4JB8B 3TJ9A 1NCLA 4A8XA 2VL1A 2C3OA 3DRPB 1N5SA 4FYYB 4O4RA 3QGPA 4K4ZA 3PR4A 1WJ9A 3ULHA 3AAWB 2RUSA 1IKWA 3DU6A 4FYXB 3GR1A 1SXLA 2FGCA 5T7LB 1LV5A 4ILMA 5J2MB 3VGVA 3O8WA 3MI7X 4MKVA 3SCLE 2ZHBA 1J2VA 2JWNA 2XLIA 1O5JA 2AYEA 1VQ5S 4GMKA 1NK6A 1F0XA 3EXCX 3D0HE 3OR2A 3OPKA 1S6OA 3RW7A 2V8VA 4LVOP 5KT4A 4GKKF 3HLUA 1LW2B 1R0BG 1UFKA 2MJNA 5A8RA 3RB4A 4IUFA 3AD7C 2KN4A 5E3PA 3KLHA 2KT3A 1XC9A 1WG4A 1VQ6S 3Q83A 4O3OA 5M2RA 1FJGF 3AD9C 3N01A 1FKPA 1I6JA 2DISA 1VI7A 1VBZA 1LXNA 3AH6A 3AXKA 4RJVA 4ILRA 1RABB 2A2CA 3MUMP 2E1CA 3UO0A 3TUZC 4N5SA 1S0MA 3V81B 3PJWA 4DL7A 3MD1A 3JTNA 4NCGA 4OLOA 5KFFA 1IM6A 2BEFA 2MYFA 2CQDA 2IRUA 2MY7A 2NXCA 3AA9A 5D4NA 5D78A 1U2FA 4A4JA 2B4OA 1YJUA 3SV3A 2X1FA 1SV5B 3GTYX 4Q0BA 1TVRA 1FD2A 1WHXA 2LECA 2FVPA 4X4QA 3IMQJ 3QATA 2R7VA 2QL9B 4ERDA 3ZC4A 3KLFB 1PJ6A 2BQ3A 1T7PA 5H9FK 5KFBA 1QE1A 2XYPB 2KM8B 4LF1A 1TKXB 2PD1A 4OYZA 1U4BA 3MEKA 1SH3A 2IDLA 2KYZA 4NI2B 4PG4A 3HPOA 3QO9B 4FKYA 4YEAA 3G71S 1BC6A 4XO0A 2ZVSA 3W8GA 4QWCA 4EBDA 1PAUB 3ILIA 2R7SA 4NXMF 2MQQA 5I3UA 2Q43A 2ZJPQ 2MQMA 3OXLA 2GX8A 4DR4J 1D1UA 4LFBJ 2BJ9A 2EFGA 3CF5Q 2MGZB 2FB0A 5D4PA 3LTOA 4CIOA 3EZ5A 4LF4F 3P5BP 2AP6A 3D6MB 4KPCA 4GKJJ 1V3ZA 2DO0A 3V4IA 1ZOTA 4IQXA 4X64J 2QEXS 1RP5A 2DTJA 3ILLA 3F73A 2IA0A 2QN6B 4OX7A 1UFWA 2RF2B 1KRPA 1ACMB 3W2VA 2W8LA 4JI2F 5ADZA 2LEPA 3W64A 4LSNA 3VVTA 4NOHA 4FF1A 2NQPA 1S99A 3I82A 4JI8F 4E2FB 3KHGA 1XR7A 4I69A 4Y0FA 3KDNA 4LFCJ 4ED5A 1PKUA 3QAUA 2EFPA 4JI5J 2BJDA 4CQ1A 4LMZA 2I6WA 1Q5YA 3SMZA 2CZVC 2SXLA 2ATCB 4IG0A 2VFUA 3QLHA 4MIWA 2PA8D 4DCPB 4ZLJA 1BE4A 3UW1A 2CQ2A 4RUCA 4PCQA 2OGUA 1EP4B 3PW4A 2BOPA 3NXZA 3FEYB 1K47A 2YKPA 3NAHA 4NLGA 3MPVA 4C4WA 5KT3A 1ITPA 1CPZA 5DGBA 2NSCA 4NI2A 5ETRA 1MROA 2IM3A 2MQLA 4CLFA 2VG7B 4HT7A 3OUYB 4K0KF 4OI0A 4Y65A 4OLPA 4OHWA 1HD1A 2D7SA 2KXFA 4ECQA 2HHXA 1NPPA 3MPDA 3NCPA 4OI1A 2DGTA 4IFVA 4P71A 5M2PA 4NYZA 1CJUB 4DCOB 2XGQA 1YIJS 3Q2TC 1AFJA 1UL3A 3HZEA 3KG4A 2AJFE 4OJ1A 4YN3B 5BJRA 1S6QB 3PHEA 2CFXA 2HGNA 3PX4A 2ZWOA 3BH7B 3THPA 5KFDA 2WVDA 2R9LA 2I5JB 4GC6A 4NA1A 2V63A 1DQAA 1HBOB 1QTNB 4B3TF 4WF9Q 3UE2A 1QSYA 1HR0J 4FP9A 2HBYB 4NA3A 1E6VA 3AXMA 1NNDA 2CPZA 2KB2A 3BR9A 4I56A 4IG3B 4M5HA 5G0RB 2OH2A 3RR7A 3E01A 1IQTA 3M9MB 2FLPA 5D0EA 2Z30B 1HNWJ 2IYIA 1DLOB 5DZ6A 1FESA 2A3JA 2Y3YA 5C5JA 2ZOMA 5IZHA 4LR9A 3HMJG 2VDHA 2CKWA 2ZD1A 4ED4A 5T14A 1U47A 4A8WA 1MMNA 2HFZA 1ROFA 1JLEB 2AMCB 2HURA 3IAM9 4ZJOA 1RWWB 3T1HF 1NB2A 5DG7A 3NBPB 1U8SA 2IIHA 2OELA 3W62A 3DLKB 5C42A 3JSMA 1DQ8A 2FC9A 1YQHA 5BXIA 3CC7S 4C8KA 3VAKA 1RT6A 1YJTA 1X31C 4DDFA 1NSPA 2J7UA 4EI2A 2K8GA 3DCAA 1QY7A 2DHAA 4ID5A 3BQ2A 2JRSA 1ZYQA 2RHSB 2FJXA 6FD1A 4DR1F 3M9OB 2R8KA 3OL9A 3LANA 1BMQB 3ILOA 3K8WA 3LH2S 4PPDA 2HHHF 2DNZA 1B7YB 2W9CB 4DLEA 2AW0A 4LFAJ 3CNQP 2RDJA 4OX9J 1R8AA 1TV6A 2RRNA 3UN3A 4CNZA 3QRRA 5F8NA 5EUHA 1X4GA 4ZN3A 2UXCJ 3V5RA 1ZAWA 3I5CA 3CULA 1U8WA 3IP0A 3MM5A 1N88A 2R7OA 2Z2LA 4ES3A 4JV5F 1WC4A 2VPXB 3W5ZA 4F50A 3HT3A 4DPYA 5CCMA 1HQ2A 1XR6A 4LRDA 4QW8A 3SV4A 3DOKA 1VRQC 2YNIA 1CJTA 3BH6B 1EHWA 1Y5IB 3H42A 3M2VA 3N28A 3KLVA 2R8IA 1DURA 1SI9A 3M30A 4NLYA 2E5GA 2ZZTA 4RUHA 5J2PB 1U1PA 2V8HA 1RHJB 3R27A 4RW9A 3F0NA 4B3OA 1ZZFA 4J9MA 2CADA 3AJ1A 2BX6A 1GK8A 1HHSA 4QIGA 2EFQA 3A1YG 3NWGA 1N52B 5F8HA 4IRCA 1D0EA 3FBCA 3IM8A 3C6UA 3R1LA 4OFZA 4DV2F 4TXSA 3J7A1 2HHUA 3H5UA 2JHEA 2JOQA 2IM2A 3MMBA 5HROB 3C15B 2VJUA 3R6LB 3H2UB 4OJHA 1JLCB 5A6WA 3MXHP 4ZS6A 4PXCA 4CLWA 2BKOA 2J76E 5C7PA 2BDPA 2MXYA 3J81j 4O4GA 1RTHA 2H65B 1W2BR 1N8RT 4RR5A 4M5DA 3ZZZA 1EZZB 1KLMB 3PJ9A 4UY8T 1UKUA 1T05B 2L48A 1M5SA 2KU7A 2OJ3A 1AUDA 4RBVA 5EWEA 2ALYB 3QSIA 4I2PB 5LXYA 2CJKA 2B6AA 1RK8A 2KVIA 3DLGB 3W9IA 4C8YA 1FERA 1UEVA 1N33F 2M8DB 5H1SV 3ET6B 3V6JA 1YRXA 1Z2ZA 2YKQA 2MZRA 4WYWA 4IQMA 2E7WA 2QA4G 2YNFA 3C66A 1C0TB 3BN4A 4OX8A 2OHDA 3AT1B 5HBMB 1QLNA 4XDCA 2KT2A 1CULA 2QSFA 5FLXU 4DR2J 2HMIB 3BV8A 3DDIA 3ZTOA 4RUBA 2GJ2A 2W7OA 1GNKA 4F4WA 4ELUA 2OPSB 1UA0A 1CEZA 2OEMA 1T3OA 4KIAA 4JV0A 3DGPA 3V6HA 1LQ9A 1U49A 2CNLB 4Y00A 2QLJB 4M5GA 4RU9A 1CC7A 1NUEA 2RDIA 5DJBA 1UJ5A 5ETKA 3DLJA 4KRWA 4J37A 2MLZA 4UY85 2C2OB 1NSAA 1RXOB 2ZH1A 4F4YA 2R7TA 4GC7A 2P5VA 1RWNB 3CD0A 1E6YA 5A8KB 1M5HA 2C42A 2ADBA 4F2RA 5BYRA 4JV1A 2XMJA 3G87A 2J5AA 4PZVA 5G4DA 3U1NA 2DITA 4HTIA 1D8YA 3MTKA 3DGVA 2WSCC 2HFUA 1A7GE 2ZUGA 2DHSA 4KYZA 4QR0A 4BWJA 2H4YB 3HHDA 1LWEB 4TLQA 3ZNUA 3LWMA 1L3VA 1QTMA 4X4UA 3ET6A 3MCMA 3VCDA 3ILJA 5E41A 1TMMA 3LAMA 4JI7J 4ZIWA 5GAGU 1XNRJ 5ETNA 4YR3A 1VQSA 4I4BA 3U1MA 5A8WA 4DL6A 1BD6A 5G0RA 1VQ7S 4DV7F 1TL7A 3NEKA 4ECYA 3MAAA 3MCNA 3P5TL 3BKTA 2WW4A 3CCQS 4CCHA 4WPAA 2UUWA 2UXBF 2P6TA 4PQUB 3QO9A 1OYEA 1YJ7A 4DV4F 1TELA 4CP5A 3PRDA 1R8PA 1HBMA 2XS2A 1F5AA 1P1TA 1QD1A 2UVWA 3TUPA 4USIA 4MJKA 3QWPA 1UCNA 3QAEA 2AJ0A 3UFCX 4DQRA 4DV0J 5C24B 1IJFB 3TA1A 2MDAA 3G6VA 3MM6A 4ECUA 2H5EA 3LPEA 5KFKA 3Q0AA 4ZN1A 5DQGA 2BKNA 4U9RA 1F9HA 2HZCA 2CJQA 1HNZF 4ALZA 5KTQA 3FUYA 1BHNA 4LF7J 2MLXA 4H4MB 2GIRA 2OMLA 1HFEL 1SJ1A 4N8OA 1CJKA 1GMVA 3MM7A 1UVLA 3CDEA 3MWBA 3CJKA 1DHMA 1NO8A 3UDCA 2R8GA 3TZWA 4CI0B 2QSWA 1QE1B 3KJFB 1HQEB 2IJNA 5KG3A 4EU0A 1RT5A 1U6ZA 5IXUA 4WXWA 2OTLS 1TKZB 4URQU 4ZPAA 5ETLA 3TUJC 3MEEB 1PC4A 3UDVA 4CO2A 1EP4A 2DXEA 4ECSA 3ZTPA 2BE9B 4JI2J 2L9NA 3GIRA 2VF3A 4E0DA 1Y7PA 1KN6A 5CXTA 2BE2A 3CJ3A 2RQCA 5DQHA 1M0SA 2O5DA 4ICLB 4RPFA 4TKTA 4Q43A 4LFCF 4EO6A 2BM0A 2ACMA 3FMBA 1DTQB 1DBDA 4J9UE 4WE1A 1T02A 1TL5A 4CH1A 1DQ9A 2PEHA 4GVBB 2CQPA 5D77A 3DN9A 4ECTA 1CJUA 4ED1A 1YHQS 4IFVB 3L9ZA 3QWUA 5IQQA 2E29A 4C9DA 3W2VB 2DR9A 2R2UA 1HBUB 3FEZA 5ETTA 3BS9A 1V6HA 2GS8A 3C6UB 4NLDA 1GEHA 2B7CB 2I5JA 2WONA 4LBPA 2EC2A 1S9GA 2DNQA 4P2SA 4A48A 5EGYA 5KFIA 5KT2A 2AEMA 3T5LA 2HAFA 4JBCA 2FD2A 3TEGA 2LEBA 3NGUA 1NAQA 5KFVA 3ZTRA 3VAJA 2DHXA 4QR1A 2BQUA 1U48A 4IYQA 1RWOB 2ZKUA 2KM8C 5F8JA 1LK5A 2KG1A 3ENAA 1BXNA 4C8OA 1YJ9S 4ITSA 4ZLPA 1N36F 1C4AA 3SQGB 4C3MA 3EDQB 4ZVUB 5DRKA 3EYZA 1OSCA 3CJSA 2DJWA 4A8SA 3P6YC 5I3PA 2CVEA 5T41A 3SFUA 2NXJA 1Z2LA 3I0SB 3NGKA 4HI1A 2X3GA 5K8NA 2OFGX 3OXFA 1IBLJ 3TA2A 5D8HB 3FCWA 3I9ZA 1BLUA 1Q16B 5K5MA 1JXVA 1TZ0A 2ZBPA 3HFZB 4WTYA 5T7LA 5H9FJ 2BR0A 4DWIA 4MK7A 1YGYA 2MZTA 1KVJA 5FD1A 2HMIA 3HKWA 3VAHA 1RHQB 2HNZA 3ITHA 5JVHQ 3T5KA 1Q78A 1X4AA 4DL3A 1AROP 2WONB 4O44B 5E2QA 4N77A 3PXGa 2RRBA 1JLBA 2UV8A 2LKZA 4PAAA 3GG0A 3MTJA 2GMHA 3S01A 2C2RA 3KUGA 5J2QB 5DZ7A 1S77D 2HWIA 2V67A 2KHCA 4NA2A 1D3WA 4X62J 1HR0F 1X0FA 2BACA 4P2MA 3HHLA 2IDEA 1TMJA 2DB1A 2H9ZA 1KTVA 5BR8F 1A6LA 3HD1A 2GGPA 5HANA 2AYBA 3M32B 2YWHA 4A8KA 2BABA 4DV3J 1C1BB 2XI2A 1JKHA 1YI2S 1S49A 4CT8A 1RHKB 2DNKA 2V2ZA 4CWBA 5EDWA 2ZJRQ 3JYTB 4USKA 4YMEA 1KONA 2P6SA 3T5HA 2GO9A 4DV5J 1RHUB 4ZP9A 3TYTA 1LWXA 1NKBA 2VG6B 3PACA 1Q81T 6FDRA 4JV5J 3AODA 4PWUA 4NZ0A 3CJKB 2CPXA 4BS2A 4OZLA 2XEXA 2BRLA 2CWKA 4FYVB 4C6AA 3DLEB 2ROEA 2IYGA 1WI6A 1BQNB 2OPPB 4KQZA 3VGTA 1WKJA 1YWXA 3N5BA 3I56S 2D74B 4ZPTR 3M1VA 4CLYA 4IG0B 2ZH4A 1Q7LB 2GIFA 2DCUB 2V4RA 3TUIC 2ASLA 1U6BA 3MHYA 4ATNA 5DDRC 1SL1A 5DGAA 5DM6Q 5HJXA 3D68A 4RU2A 4U7UK 4DUYF 1WC0A 1B70B 3ETMA 1S9EB 5KFMA 2WBMA 4GVLA 1RU2A 1RWXB 2FDNA 3KK3A 9ATCB 1T8EA 3DLBA 1KLMA 4OZ2A 2UU9J 3QQCD 8RUCA 4PG6A 1HBNB 4H4KC 4OV1A 4C8LA 3DRRB 4FBTA 1Y5NB 3D0GE 2Q1LA 3BO4A 2DH9A 3R5CA 1EAYC 1FFGB 2ZDOA 4ED3A 1FXLA 3ENVA 3W60A 4ECZA 2PE8A 2Y1JA 4ZHRA 3PKMA 2HW3A 4J91A 1UPPA 2DYAA 2KH9A 3M8YA 5I42A 5B09A 5FIIA 1U02A 2XGPA 3X3UA 2J6UA 1MSWD 5CYJA 3BSNA 3DLEA 3S1TA 5EWGA 4NASA 4UT4A 2OKQA 3G6YA 4ECVA 1RYRA 2IRXA 4V19J 3TVKA 2EW9A 1S9FA 3IWNC 3M8PB 3MPUB 2PIIA 1JLGA 2XWXA 4H54A 3BREA 1G2EA 1LW2A 1RLCL 3BPDA 5ETMA 3TNVA 3UCZP 3W3SA 1WOPA 1XNRF 2A1BA 1NJIT 1MG7A 1B0VA 2QIFA 1DTTB 4PYAA 1FWPA 2GA7A 3A4TA 4NL5A 4OZ3A 1VHFA 3GQCA 2DT9A 4WE1B 2Y8YA 2DNHA 3L7PA 4KGXB 1RLDA 3HVWA 5D0GA 1E6YB 4YS2A 4IR9A 1IKVB 3N6MA 3I0SA 5GAGI 3DRSB 2J9EA 3J7YI 5KFTA 2DNGA 3V81A 2ZEJA 4OJGA 2RS2A 1RKJA 1HNVA 3CUNA 4OMFG 4WFYA 5L1KA 3PJXA 5KG2A 2Q66A 1KQGB 3D6HB 1RSCA 4G1QB 2XO7A 3VAGA 1E6VB 5KAKA 1S97A 3PR5B 2RKIB 5AXKA 1NSKL 1NKEA 4DQQA 2I2YA 3U1LA 2XHWA 4Q0BB 1F60B 2B0GA 2J8AA 3PYDA 3J7Z5 1T03A 2LQJA 3TJAA 3UDLA 2W9BB 1SC3B 2WSEC 3S7RA 3NMAA 5D15A 2HQDA 4FZVA 3KK2A 2JL9A 1RAFB 4DL0C 4OI3A 2FY1A 1RA7A 3MAAB 3NRBA 1K44A 1VRUB 5AXMA 2D3O1 3MAQA 2EFNA 3IM9A 2B3TB 4YY3F 2VC1A 2M0GB 2WTFA 1FO1A 2K7JA 2ZDPA 3K57A 1SKUB 2LDIA 1JLFA 3OR1A 3VVUA 4LF5J 3JSMB 4RX6A 3SZ2A 4DR7F 3JSRA 1R8CA 1N4LA 4FS2A 1FRLA 3CTRA 4ZVFA 3OV7A 1C1CB 3ZZTA 4XIUA 4F4ZA 4AT1B 4PXBA 1MU2A 1NDCA 2B7BB 2BRKA 5KT7A 5IWAF 4DR5J 3ISZA 2E5HA 2OUGA 3HI9A 5J1EA 1UPMB 2MY8A 5B0EA 3Q24A 3H4DA 2J9CA 2HAIA 2LQ5A 3BDEA 2BXJA 3Q22A 2VKZG 4DL5A 2V94A 4FF2A 1FE0A 4TU7A 4O23A 2X1AA 4JI6F 2ROPA 1EETB 4RNMA 5B0BA 4LF8J 4F4XA 4QCLA 1NZ8A 2N3LA 3MECA 3NKYA 4B9UA 2W8KA 3MR5A 3IRXB 3KK1B 3EPIA 3TVZA 1OSDA 2DNLA 4TY8A 1B0PA 1FDDA 4P72A 2CQGA 4I1TA 2I0XA 3TWZA 3JSBA 2BUNA 2KXNB 3PZPA 1X5SA 4O3RA 2IBKA 3SDEA 4KY3A 3D2WA 2W1BA 5CQGA 5CABA 3AB2B 2DNYA 3NCQA 3N5FA 3G6XA 1PYOB 3A12A 1YITS 4F02A 3AOAA 4KHMA 2C2NA 2DK2A 2MKYA 1YZ7A 3BYRA 5EX3A 4RKUC 4PKDB 4J9SA 2C22A 1WWHA 3OXGA 1IWAA 3MM6B 3DYAA 2DIVA 4UQGA 4J9LA 1L3SA 2AD9A 2UUAJ 1YBTA 2AQ4A 3M6UA 2VU5A 3BN7A 2DNRA 2UVVA 1H38A 2ZC4A 1CQNA 4OHXA 4ZHRB 4HEA9 2BJ1A 3KHHA 4MKBA 1VRTA 3SI8A 1HNIB 1SQGA 3Q89A 3OLAA 1RISA 3FKBA 3LA0A 2W9CA 3C14A 4DHVA 3OVSA 1NDLA 3T3FA 3D1HA 3HHKA 4RW4A 3UR3C 5CHCB 1G1XA 2VQEJ 3PW7A 2EG1A 2Y1IA 4LSLB 4NLTA 1I51B 3K2YA 4K4XA 2JEFA 1L3UA 3UCUP 3R7BB 1WF0A 1FI4A 4IFYB 3CW2C 4CLKA 4CTAB 3LGMA 2VOPA 4LIWA 2H5IB 4KAIA 3GJQB 3KLHB 2ZH8A 3PO4A 3OFHA 1KQKA 2QFIA 3NBPA 2MGZA 1VDHA 1TR0A 4DSEA 3FZ2A 1OMSA 2GIQA 4KC5A 2CQCA 4MTPA 5K8OA 3SSSA 4DG1B 5SZTA 2CPFA 3D28A 1C0TA 2NS1B 4RUAA 1JJ2R 1IBMF 2XSJA 2ZH9A 3BQ1A 4ECWA 2PSZA 1XR5A 3UNYA 3D6TB 1SH2A 2DIUA 3FBBA 3CMQA 4ANDA 2G13A 5KFGA 3I0RA 1T94A 2Z58B 1N34J 2QC3A 2MKIA 2VG5A 4DX5A 1FCAA 3BM7A 4EYHB 3CCWA 4LFBF 3KMQA 1S7HA 1Q8BA 4KHPJ 3FBFA 3KK2B 4WYLA 1HI1A 2IJRA 3MCOA 3MPWA 4BLGA 1ZETA 1NJYA 2OP5A 4A47A 1TUGB 1XMBA 1ZTWA 1RU1A 1MW7A 4NMLA 2APOA 3MM9A 5F0UA 5KFRA 1QAYA 2KJVA 4NLQA 3T1YF 3EGZA 2HRYA 5D0HA 3MDFA 1GTEA 2QO3A 4Y2KA 4RNOA 1SQFA 3OTBA 4B02A 7AT1B 1VK3A 2XY5A 2VG7A 3BYPA 3NP5A 4ZVQB 5LMNJ 1Q86T 1M90T 1JLQA 2I9SA 1LW0B 2HS3A 2B6AB 2DY9A 3DRSA 1FTRA 1MMDA 1QUVA 2YWGA 3CJQA 2V8PA 5U47A 3RJMB 4BDPA 2MMYA 4ZVPB 1PYSB 2YH1A 5KFLA 3JB9k 1S6QA 1WEYA 3M8ZA 3LP2A 3MAHA 2YPYA 4DU8A 2CJXB 4ZP7A 3FBEA 5LT5A 5CA5A 2GAGC 2ZH3A 2ZFHA 1ZS6A 4MH8A 1X4EA 4RW7B 2CPEA 2I38A 3O2IA 1J5EF 1T03B 1RAJA 2YNHB 2OO4A 1RTIA 3GZ7A 1R3NA 1N6QB 4P2FA 1G6BA 1PJ7A 2K1RA 1QAXA 4ZCMA 1PC5A 3RGIA 5K8MA 4FXDA 3VAMA 4N47A 1JLCA 2OD4A 3KKFA 2N7YA 4IFYA 4OYOA 3TZZA 1VBXA 1VQ9S 4GKKJ 1RWKB 2B9EA 2KRRA 2VPZB 4DPUA 4MIAA 3SIPB 4K5SA 1C2PA 4HYKA 3MF5A 1NMEB 1S4FA 3T19A 3LGNA 3DNCA 4DSIA 4F3OA 3QFWA 2RQMA 2XI3A 4DV5F 3WIVA 1Q8KA 4P74A 4CH0S 4DI6A 5H9EJ 4X4SA 1SL2A 1R6VA 2W2QP 4E98A 1M5KC 2EG2A 1YZ6A 2Z8QA 2BKPA 1H98A 1B7FA 1GAOA 3A13A 4KV8A 4DFJA 2QRRA 3I96A 3VGUA 4F3QA 2D41A 4H4MA 4DN9A 2FZKB 5HMYA 5KT5A 1N5QA 1N33J 4WZMA 2IBOA 2V4JA 2NLWA 2GQCA 1UW9A 1N0VC 3O1LA 3QBCA 2A2DA 2C2KB 5HP1A 5BR8J 2DXDA 1UEUA 4RLEA 1FXRA 2JEJA 4F8RA 4X66F 2PO4A 4ZVRB 2IC3B 3GJTB 1QJHA 3HSDA 3VV2B 2HYIB 3WZ0A 1TV6B 4DCJB 2NUHA 1GXTA 4ZKAA 4K4SA 3Q8VA 4JOUA 5BYQA 2DVIA 3LO3A 4EZ6A 1WC5A 2HQ3A 3TP2A 4QYZJ 2M4MA 1UW4A 4OQJA 2OAUA 3KXDA 4YDDB 1TQLA 3CJ0A 3ISNC 3H98A 1VFJA 4QU7A 4I6YA 4OIXA 1NK5A 2LEAA 1C1CA 1L3KA 1FKOA 3CDUA 3HZGA 5KFQA 2YNIB 5AXLA 1FX4A 3GE9A 3DOKB 1UTAA 4TLRA 1R8HA 3D1OA 1S1TB 2OMOA 2E66A 1IBLF 1UAWA 1IKVA 4DEZA 5HO4A 1LFWA 2HVZA 3C3LA 5IT0A 3OHBA 3G86A 1T9UA 2DGOA 1S0OA 1J5OA 4QWEA 4Z2XA 2FVRA 5GAEU 1R89A 2UU9F 1VJQA 2QLWA 5F3TA 1RHMB 4TNOA 4CT9A 4X65J 2HVHA 2CJBA 2YBVA 1FFSB 2W9BA 2AJ1A 4OZ0A 3W1YC 4CRJA 5RUBA 1QAIA 3BF4A 4WTOB 3BR8A 4TYAA 1PBUA 4ZPVR 1B0TA 4KTQA 1MN9A 2CJAA 2JJ4D 2ATLA 2Y0SD 3ZZOA 2FJVA 3IS9B 1HMVB 1IR2A 2Q79A 2HHHJ 1FXDA 3W9HA 4FF3A 4JP8A 1JLFB 3M8SA 1RT3B 1I94J 3GB0A 5CH7B 1FDBA 4ZCKA 2PGCA 4FXWA 3M6VA 4DFMA 4USUA 2AU0A 1U1MA 2HHSA 3J80Y 1HPZA 3K5OA 3W9JA 2W7PA 3CJ8A 3M4XA 1RAGB 2EBGA 4TU8A 3DRYA 3M8QA 1MU2B 2HFOA 5L9NA 4LSZB 3GYGA 3TAMA 3HDSA 4GRSA 1RWMB 2ZNYA 4QBUA 4PPZA 1EARA 3JQMA 3GSDA 1ZM2A 2R7QA 2WVFA 4I2QB 3VZHA 3CCRS 4PYDA 1SKWA 1VQKS 4F4KA 1AFIA 3BGRA 3LQVA 2W4CA 1H72C 3HSJA 3QT7A 4FKXA 3GV8B 5HLFB 2GVZB 1S1VB 3IGVA 1J5OB 5KFXA 3OR2B 3B78A 2OPRB 4AL5A 1SC1B 1FHTA 4LSLA 2AIRB 3DI6B 5L1IA 3A8EA 3BBCA 4FVMA 4DV6F 4JI4J 1VJWA 2E5LF 3HJFA 4R5PA 1PIEA 3B82A 3CCES 2DEJA 1FDAA 2A6MA 2HLUA 1HWUA 2HQGA 2JVRA 2UXBJ 2OFHX 5F8GA 5DDOC 4LRAA 1FRIA 3AA8A 2CZ4A 5K14A 1GH8A 3OD2A 4MYTA 1FKPB 4DL4A 3MPYA 2FC8A 4NRTA 1ZAVA 3T9NA 3BSCA 1IBCB 3KK3B 2NPIA 2XMVA 4NLXA 4S0MA 1UZHA 1WF1A 4X4RA 1S4EA 2FHOB 2Y0BB 1U25A 3NS6A 2NCKL 1OJ4A 3IBFB 3K5PA 2JH3A 4DR1J 3DRRA 2NZCA 4NXMJ 5BYSA 3M8QB 3RYLA 1HWKA 1REVB 3MEDB 4CLPA 1BWVA 1TAQA 2MQ8A 2F8HA 3AOBA 4ZK7M 1GX6A 3K0JA 1BQNA 3V4MA 1VLYA 3QGIA 3DMJA 5LSRA 1IKXA 3GCXP 3C16B 2ZKTA 2MKKA 4PG7A 1QSLA 3D3CJ 2JZ5A 5C25B 3EZOA 2QGFB 2XYHB 1M1HA 3DDNA 3E8OA 4UOGA 1FRXA 3FVYA 2I1RA 1W26A 1PBAA 3MM5B 3Q8SB 2B4VA 1U2CA 1J27A 5E3RA 4DR2F 2KL8A 1NDKA 3DM2A 2V2KA 1WOSA 5J2NB 1WDTA 3BSAA 4K4VA 2YKNA 2BJ3A 1CBKA 3IC1A 3KYLA 3THVA 2GGPB 4NLWA 3IBWA 3EXYA 3M32A 3GYNA 3WX8A 2ERRA 2Z56B 4J7CA 1PJ5A 3CGIA 3I9V9 5C24A 1Q53A 1YK9A 4DPTA 3AJ2A 2F9DA 2DXFA 4K59A 4U67Q 4ILLA 2QA2A 5DDQC 2PMWA 3GPAA 3PFOA 2VONA 4LRCA 3EM1A 5HMZA 1TK8A 2HQIA 1X9MA 2YY3A 2CQ4A 4AQYF 1X5OA 4O44A 4NZ7A 1T0TV 2HFNA 4MKAA 2FIUA 4YFUA 4Y28C 3B8HA 2H48B 3NNCA 5KFWA 1T3NA 3PIOQ 3VALA 3PYFA 3GFZA 3ZFVA 4HH0A 1VISA 5KFNA 4J90A 2RHQB 5L1LA 4RWWA 4WZQA 4M95A 3CB4A 2YWFA 4DR3F 1JQGA 1F5CA 1HMVA 2CA9A 2NYHA 3EGNA 3HVTB 4AXIA 3N0VA 4FS1A 4RBUA 4X2BA 1ZM3A 1D9AA 4QPTA 4DN0A 1HWJA 2BMBA 4Q5VA 4YQWA 4WKRA 3RAXA 1RZMA 2FJAB 3C6TB 4A8YA 4UOCA 4XK8C 2VPYB 2JDJA 1U0SA 2Z0GA 2R7WA 4NLPA 1K0VA 3NNAA 1IWGA 4MMOA 3NGSA 2ASYA 2N7CA 1HI0P 2D3OR 4C98A 3PTWA 4JI8J 2FJEB 1EIYB 4YR0A 3GIJA 2JLGA 2GHPA 4PQAA 1YBUA 2L08A 2RAQA 4F3MA 4ED0A 3O3LA 2MZJA 3AJDA 4F0HA 1PYTA 2RB7A 2O3DA 2YNFB 4ES2A 8AT1B 3K7RA 2N3OA 4WFAQ 1V5VA 2W7AA 2IC3A 4PG5A 4Y34A 3UCGA 2M52A 4IOBA 1SJRA 2XHCA 1SL0A 4HTJA 5CZXA 1K1SA 1SC6A 3K58A 3VQSA 4A8FA 1SQEA 1R0AA 2KT5A 4DQPA 4DUZJ 1U1NA 5KFEA 1JJHA 3FCHA 3D4JA 3TAPA 5B7WA 1XMQF 3F56A 4O0NA 5D0RA 3SFGA 4U95A 1V3RA 4CLTA 1IR0A 1TL1A 1JLEA 5KFCA 1HD0A 1RE1B 4L73A 4MFBA 1AB8A 1GT8A 4QYRA 4NLSA 1WEXA 2RSQA 4UTGA 5J1NA 2MTLA 1FFWB 2RUGA 4A8QA 2HLTA 2ZUAA 5KG6A 2DR8A 3AQOA 3D6FB 1DTQA 1KVIA 2YQ1A 2F1FA 1KNZA 2DNPA 1D9DA 3H7HB 3VHQA 1YTYA 5HP1B 2HHPA 4TU9A 1JB0C 3LP1A 4Q44A 3G82A 4C8ZA 4HI2A 4LF2A 2FZGB 4CO4A 1CS4B 2WK4A 3IR7B 3MD3A 4CM2A 1OY8A 1B4SA 1DFDA 4Y2AA 1XNQJ 1OWXA 2GHWA 4LF5F 1M1GA 2BJ8A 3FSYA 1X4FA 2ROGA 3KFWX 4J5OA 5LMNF 2VODA 1S1UA 2HFSA 5C2GA 4ZLNA 1FRJA 1K8AT 3LF0A 2MPUA 4DU7A 5D4LA 5DG8A 2CRLA 3DI6A 1UVIA 4XPCA 2OPRA 1CJVB 3GJSB 1W2IA 1WHWA 3I87A 4MT1A 4WWSA 5KOWA 2OI2A 2BJEA 3SCJE 5DQIA 5GADI 2ZH2A 3HHLC 3MCSA 1HQEA 1LFPA 3VR1A 2IVYA 4PR6A 4IH6A 4WFXA 4O3QA 2LXFA 3UD5A 1T9WA 4BC9A 3RB3A 5L9XA 1H7XA 1O6XA 3HHLD 2V68A 3R5AA 3QFHA 4DV1F 1FKOB 4FYWB 4RW9B 4B3OB 2ZBQA 2BANA 3CT9A 4KHRA 2VICA 2HZVA 3PY8A 1BQXA 3H90A 4LR7A 2NREA 1RBAA 2XO6A 4Q8FA 4OHYA 2OPQA 1K1QA 1F5BA 3ADAC 2WHOA 2MKJA 3K8VA 4YY3J 2IFXA 5DG9A 5DDPC 4I68A 1HW8A 4KR0B 2ILYA 2VIHA 2GAHC 1RTJB 2IHR1 2KXHA 2ZNZA 4JYAJ 3CSKA 1RAAB 2CYYA 2NXEA 4J9RA 3ELHA 1DZ5A 3OVBA 1S1VA 1HI8A 2XQCA 1NXIA 1R27B 2DCLA 2F3JA 3H2LA 4NZ6A 4KB7A 1Y3KA 2DNNA 2W2OP 2WOMA 3D67A 4JUZA 3RU0A 4DV4J 1Y5LB 1TL3B 1PSDA 2YXLA 1KP6A 2V69A 3KDOA 1RTDB 1NHUA 1CJVA 2HWHA 4M5DB 3SDEB 3ENQA 1Q4RA 3N9UC 3QIPA 4NEYA 1R8BA 3OTOJ 2IM0A 2R4FA 3MM9B 3I5BA 2B9YA 1HWIA 2GVDA 1VQNS 1HQUB 3MURP 4B9TA 3P8BB 2H1YA 1FNOA 1YVFA 3R5BA 5B0CA 5F8MA 4WFBQ 3R2CJ 1FKAF 4IH5A 5HVHA 1R0CB 1S1TA 4MAKA 1CS4A 5FLXY 4DR5F 4Y2IA 5IWAJ 3CD6S 3PG9A 4X62F 3G9CA 1UWBB 3MZIA 3NAIA 4L75A 4C8MA 3RBEA 2EPIA 4NEZA 1NU4A 2QG9B 2VKRA 1B99A 3JSYA 3F41A 3Q8YA 3R9LA 1HBOA 3MUTP 2VJVA 1WOOA 2CIMA 2XMWA 1F3VA 4HDHA 1SUQB 3VQTA 4I2QA 4EBEA 1TK5A 1IJEB 1M5VC 1KC8T 2M70A 3PCOB 2E1PA 4WJBA 2OPSA 1JXEA 1SBRA 1ULRA 1LNQA 3H2VE 1YSJA 3Q8UA 1TUWA 1N5TA 4HL9A 2RNEA 4RW7A 2IPOB 2VBWA 3MMBB 3O5TB 3PHTA 4FNHA 1P27B 1WHYA 3K5NA 1S1XA 4DX6A 1R7IA 3N4WA 3RUBL 4ED6A 2WOMB 2ZHOA 3HVTA 5ETVA 5A8KA 2JNJA 2N4DA 1S5ZA 4N41A 1F3FA 1LW0A 2J9DE 5KFOA 2BYCA 2IRYA 4LIRA 1GXUA 1RAIB 1RT2A 2IJFA 2LU2A 3RR8A 1HW9A 4Q8EA 2XNRA 1B3TA 4MYUA 5KFAA 4C2MA 4IOAQ 1Q8IA 3THTA 5J2PA 2MQNA 5KFHA 1ZPWX 4IKAA 4O3SA 2UZAA 1NBEB 2FJDB 1PCAA 3NLCA 3R97A 3TJ8A 5B0AA 3H40A 1RAHB 2B51A 2HWTA 1HNIA 2V6AA 4KH1B 1KLNA 4NXNJ 4W90B 1CG2A 2P9GA 3CDAA 4X4OA 2Q3PA 1Y9OA 2KFYA 4NLRA 3NMRA 1TL7B 2CPJA 2XMUA 2QMUB 2E1MC 1IN0A 3K17A 1NH8A 3MGJA 4DSFA 3Q2SC 3WIUA 4HH1A 3K59A 3J81U 2DGXA 5CD4A 1Z1ZA 1FX2A 5KFYA 3G8SA 2MEWA 4J9KA 5CYMB 2DPJA 4RW6A 4ZIVA 1WC1A 2RS8A 2MB0B 2AX1A 2WAQD 2Z57B 5E7OB 3JAMU 1X5PA 2A0FB 2GV1A 5IOLA 2OTJS 2J7WA 2VBYA 2XNQA 1SC4B 3JQJA 2B8QA 1WG1A 4P9SA 2MKCA 3BBBA 4FN5A 1S9EA 2CPYA 4M8LA 4XAKA 4U8YA 4C8NA 3RBZA 1JJ4A 1VK8A 5D6GA 1IR1A 1VR6A 2LXIA 2U2FA 3H0PA 1H3DA 2C2ZB 1LEOA 1T95A 4KPYA 1QVFR 2KFNA 4ZDNA 3B6BA 3RZAA 3LP1B 4I0WA 4R8UA 5AE1A 1TAUA 3OBIA 1WTFA 4UZBA 2HNDB 2CWXA 3BDPA 4OI4A 4EWTA 4USVA 3I0RB 2XLKA 1RTJA 5ETQA 5EX0A 1NK4A 2XWYA 3PRVA 1WUUA 1IKYB 1TKTB 3BBFA 2DHHA 4AYBD 4UQTA 4DV7J 4OL8A 4LR8A 3UDEA 4PUOB 1ZA2B 3BKUA 3L7UA 1P9QC 1U1RA 1VIXA 2CG8A 2GJIA 2R7RA 1F6TA 4EK2A 1XMOJ 1YRTA 2B4PA 3ICLA 1KFDA 4FYDA 1EKRA 1LWFA 4AE5A 3KLIA 3GYXB 1F2HA 3RB6A 3QT8A 1Z4UA 4L6V3 3HVRA 3H5XA 2EVZA 3AD8C 5IT9U 1RT6B 3TARA 2IA6A 4N7TA 2ZH7A 1FK9B 2KRBA 4LF8F 2E9TA 2EWHA 1DTTA 3CJTA 3R5JB 4AQYJ 2FVQA 4USJC 4M5KA 1NPKA 1S7IA 1SH0A 3FJ2A 2B4UA 1RT1A 2FGOA 1HWLA 3OL7A 2BW7A 3UN5A 1GMWD 3BGRB 2NXUA 3SCIE 1MN7A 4DZDA 4YR2A 1WTBA 3G8QA 1WNEA 3J7ZT 2DR6A 3EX7B 1OIAA 2C3PA 3GMGA 4KO0A 4WK3A 1T11A 4X4TA 4F2SA 3MECB 2Y1LB 5JUMA 1I5OB 3G4SS 4KFBB 2AT1B 2G0IA 4DV6J 2AJQA 2PC6A 3Q8PB 3IGNA 1S48A 2HSEB 2O01C 4PG8A 4QIWD 2PMZD 3TAQA 2RIJA 2X3DA 1KDNA 2QYCA 4QW9A 1N5YB 4OZ5A 2KZMA 1REGX 4X4PA 1KWMA 4HACB 2GO8A 3QIPB 4MFBB 3US5A 4Q2MA 3EMTA 3NS5A 2H4WB 4EGLA 7FD1A 4ECRA 2UUCF 4RL1A 1RT2B 3OTOF 4KJIA 1W7WA 3CDBA 3HULA 3PRBA 1RCXB 3MR6A 3OUYA 3IG1A 2HGMA 1NKCA 3OT9A 2G9OA 2E7XA 4ZVOB 2B43A 3T41A 4ED8A 1IM4A 4I2PA 3DOLA 1ICEB 1Y11A 3M7VA 4HHJA 4YB6A 3W7BA 3UR0A 2UVUA 4N76A 3NNHA 3K89A 5IC6B 3KJNB 5F9NA 4PWDB 4ZVSB 3GWCA 1QUPA 5DS7A 4ZA1A 3LW5C 1HIYA 3E3XA 5GADU 1RHRB 1JJCB 2B8PA 2OSQA 3QLHB 1BUXA 3HKZD 4DPOA 3QSYB 4JI0J 4JI3F 1TFYA 3D1QA 2AYGA 2UUBF 3VAFA 5J1PA 3V2UC 2F63A 5A6PA 5D3GB 4B3MJ 3PW5A 2YKMB 4C48A 2PI4A 4TQRA 1HYSB 2FJWA 5HROA 1LXJA 3E01B 2YQ0A 1VYAA 3MEEA 3RBDA 1TFWA 1TKZA 1XK8A 3TR5A 3K5MA 4C3LA 4XDDA 1GMUA 5ETOA 2HHTA 3CMES 2DR7A 2IVMA 3TZYA 1OYDA 2G0CA 3IN5A 1M5PC 1F9FA 2OEKA 3FEXB 3OSPA 4U96A 4U7UD 1WD6A 4M94A 3CEDA 1N34F 2FJBB 4JI1J 2VZ9A 4YUDA 4HDGA 3LALA 5J1EB 2CAJA 2AGOA 1HBNA 5IFMA 5IQ6A 2XY7A 3PM9A 1U09A 3A8JA 1JIHA 1XN9A 1S12A 2CUYA 3MOZA 3CCMS 4IO9Q 1OQ6A 3WHIA 1XMOF 1BY9A 3P4UB 3HXMA 4DUYJ 4FNIA 1IKWB 1D8ZA 1IBKJ 3KNAA 1NH7A 2AKWB 4USTA 2BJ7A 1FJCA 2UXDF 3T1YJ 2EC0A 4OX6A 3TX0A 3RAMA 4AD6A 1WELA 4Q7AA 3QT6A 1U6FA 3KLFA 3BO2A 3TRGA 2F9JA 4WK1A 2ASDA 4B9LA 3KLEB 2LVWA 2R3VA 4DX7A 2HBZB 1N5YA 3OJSA 1K73T 2W4PA 2UV8G 4NE9C 5L8RC 1WDDA 2VUGA 3OTEA 3MMJA 3SQGA 3TA0A 4F0KA 3RTVA 4DZ6A 3CCLS 2HKEA 2HS4A 3N6NA 4P7TA 2J7KA 4C3KA 3KJQB 5B08A 1VQ4S 3W65A 3ETOA 3GSIA 1XJWB 1RBOB 5E0OA 1X9WA 3RRHA 4ECXA 4NMXA 2A10A 2HRUA 3P3DA 2QYGA 4ID5B 4QOTA 3SBMA 3R8YA 5KG0A 4F4AA 2MJUA 4DSKA 3KMSA 4ED7A 5HVFA 1FNXH 3WDOA 4YHHF 4KSEB 1F2GA 2YX1A 4DXLA 4B9MA 5KFSA 4G1PA 5KG7A 2DGQA 2QMXA 3PEHA 4LF6F 2DO4A 2JFKA 4YOEA 2GVZA 5D3GA 3DDKA 1T9YA 2W4DA 2L9WA 3L3CA 3KLGB 1PO6A 2DR5A 4LT6A 2VDIA 5AE2A 5J2MA 3IRWP 1OQ3A 2UP1A 1RKIA 4KFBA 5AJ3F 3UD4P 3QZ7A 1RGVA 1TKDA 1X0PA 1FEHA 2E9RX 4HLBA 1KR4A 3POTB 5F9LA 1XIQA 1RA6A 1TL1B 3U02A 3EICA 4AL7A 3ZO7A 4LJMA 6AT1B
chains in the Genus database with same CATH topology
3L95X 2KI2A 4I7FA 3KHRA 4JYAF 3SSQA 3FQKA 3DU5A 5D4OA 3GILA 5SUHA 5A8RB 2XMKA 3I55S 4ED2A 3C46A 1X7VA 2AYMA 1VMBA 1M1KT 2RJZA 4OI2A 5L1JA 2B56A 2BBEA 4OJ3A 2NUUG 4QJVA 4X64F 5ITHA 3PIPQ 1C0UB 4K5RA 2GW8A 3X1LB 2QMWA 3QMQA 3DOLB 4ZP8A 1SJ4P 1WACA 4ID8A 4ZPDA 5LMUF 2CPDA 1N54B 2VG6A 2GQ2A 3S8SA 3PX0A 3HK2A 1Y0HA 1ZAXA 1S6PA 2FLNA 4DSLA 3KWMA 4JI1F 2R7UA 1UJ6A 2J9DA 2OPPA 3ISND 3OTDA 4HVZA 2EI5A 2YKOA 2JLEA 3MMAB 4RW6B 3OFGA 4ICLA 3OL8A 4BHQA 1NEEA 4DF8A 4FF4A 4GO7X 2XBPA 3H20A 5KT6A 5DM7Q 3JTPA 3M9NB 4I7FB 4NXNF 4R25A 3W2WA 1S72S 1FK9A 2XY6A 3I4PA 3H5YA 2CDQA 4J9PA 1S1WA 2LXUA 1C1BA 4QPXA 2VBZA 1NK0A 3CPWR 4HKQA 1JLQB 5EWFA 1FJ7A 1P8GA 2M9KA 3FQLA 4B9SA 3SSRA 2JC1A 4PWDA 2MSSA 1FA0A 3KJVB 1Q82T 2LMIA 3PNIA 1ZZNA 3CCVS 1IKYA 1TKTA 1CSJA 4UW2A 2GFFA 1TKXA 4OI6A 4B3MF 3HO1A 1NK8A 3U7JA 4XPEA 3AHPA 5K14B 4K4WA 3MFHA 2VA2A 2NZ4A 2J6TA 3QYYA 4KBIA 3M2UB 4C11B 5IT9Y 3WX4A 5L39A 1FRMA 1OPZA 1D9FA 3HF5A 1FEEA 1SB6A 1I94F 5DO2A 1DARA 2F7VA 2K7KA 1FVQA 2VD3A 3TX8A 3G6ES 2R8HA 1S6UA 1V3SA 2VBXA 5FJ4A 3CCJS 5LXRA 1FF2A 4TN2A 2FUG9 3DMJB 4K50A 3LOUA 3MM8B 2ZJQQ 4R0EA 2R2SA 4EYIB 4PUOA 4MK9A 4WF9Q 2Q6BA 2M5YA 2Z2MA 3GIKA 1Q7YT 2HHWA 4F67A 2QT7A 2YNGA 2CQ0A 5MAOA 1YJRA 2UXCF 1VQMS 1KQFB 3OR1B 1LWFB 1ZM4A 4B3SF 3D54A 2BV3A 1OS5A 2VA3A 4KKOB 3MFIA 1T05A 3DC2A 2R7XA 5CD4H 3MEGB 4UUWA 1U1KA 3IG1B 4EZ9A 5HQ8A 2X1GA 3S6EA 1SUQA 2FPHX 3MM7B 4PRFA 4ZPBA 1N56A 2RKIA 2FLLA 3GV7B 3AB4B 4X65F 2EK6A 1RQ0A 2VV5A 2CQ3A 5A8WB 3LP0A 1FT8A 1RT5B 4OZJA 4URSA 5CYMA 3ENWA 3QZ8A 5M2UA 3SEOA 1S9GB 4Q45A 1CQMA 3M2RA 5DLFA 4DQSA 3DLLQ 3IWLA 4NLVA 2LU1A 2YNGB 4M1KA 4DUZF 3J81Y 2ZC3A 5CYQB 2CQIA 4D3HA 1PILA 2CPIA 3ZZRA 2JEGA 3DXSX 1FD8A 2OIHA 2VQFF 1HPZB 2ZM6F 2ZITA 3TO8A 2RRAA 2R8JA 3ZZPA 4IDKA 5A0YB 1VGYA 1RT3A 3CCTA 5F41A 3K5LA 3BQ0A 1HL6A 3T5KA 1VQYA 1FE4A 1UMJA 2KKHA 3CXCR 3M6WA 4DG1A 4A8MP 2NSBA 3CIZA 4ZVHA 3FMWA 3E2EA 2OLWA 2LDYA 2RF2A 2VC0A 3UNGC 3VTIA 3CCZA 4CZCA 1Y00A 1Q8LA 2IVFB 4Y6IA 3FDSA 1RJJA 3LP0B 1RTIB 2DHGA 4DX8H 1S0VA 3T5JA 3CD5A 2YH0A 5FDLA 4QWDA 1R31A 3ZZ0A 3PW2A 1OO0B 2QA1A 4Y2MA 4JI4F 4KHPF 1R43A 5CZVA 2RE1A 2COLA 3TVYA 4ZPCA 1S0NA 1GQEA 1TL3A 2DGWA 2K3IA 2PFFB 3QPIA 4FBUA 2J0WA 3V4IB 2J0QD 2HGLA 3HP6A 3GG1A 4G1IA 2WSFC 3TANA 1GXLA 3W2WB 2AF6A 2KYXA 4RNFA 3FGVA 2YVSA 1YJVA 4IRDA 1VOMA 4C11A 2E5JA 3R5DA 2E44A 2GHVC 4YB7A 3KG1A 2HHQA 1XERA 4I6AA 4N8NA 3CC4S 4B17A 1U26A 3MMCB 2RH3A 2MZSA 2XCPA 1IQZA 1VRTB 5HBMA 2XCAA 1S6PB 2VG5B 4DF4A 2E9ZA 1S1UB 3H25A 3OSNA 4TY9A 2D9OA 3RB0A 3I31A 4LFAF 4OX9F 1HNWF 2V9KA 5JJBA 3IA0A 2LLZA 3MMAA 2KDOA 3GIMA 1W25A 2MHNA 2R2TA 2IMOA 1L5UA 4DR7F 1VRUA 4KT0C 1ZBTA 1NK7A 4DMZA 2C3UA 1BGXT 3IR5B 2POKA 2JFDA 2QE5A 3MR2A 4DFPA 3TW0A 2ABYA 1VQOS 4O4GB 4H4OB 1XNQF 1IUJA 4ETXA 1CLFA 4ZCIA 4RBTA 7FDRA 3BGLA 5IT4A 2MQPA 3WC2A 3MEGA 2W24A 4NX9A 3R1HA 3EGWB 3DLKA 5C42B 3HM9A 2IMWP 4G6VB 4RW8B 2F40A 2X51A 3LP2B 3UWTA 1C0UA 4CNYA 1SV5A 3FRYA 3IWXA 4KO0B 4UUXA 1VQ8S 1KFSA 3OVAA 2BQRA 5JXSA 2CQHA 2Z4PA 3OFFA 4AL6A 1IXKA 2YNHA 4O3NA 3Q8QB 2B9WA 1TK0A 4NLUA 1BQMB 1QAJA 3MM8A 5KOXA 4AFFA 1O8BA 4MK8A 2VOOA 2Q6CA 1RTDA 1R0AB 2VB6A 3GIIA 4QWBA 1MROB 4ZOSA 1JX4A 3C6TA 1HA1A 2B5JA 5DLGA 3G96A 3HFKA 1NHVA 3UI3A 4K4UA 1R6YA 3OLBA 2MZQA 2OSRA 1AW0A 1VQLS 2PDAA 5EHHA 3R3TA 2XULA 5HN0A 2MQOA 1CC8A 3SXLA 1FVSA 1U7LA 3ZZUA 4OHVA 2O67A 2N82B 1S76D 1XWLA 5I3QA 1X4CA 2V5HG 5LSOA 4ZMMA 4EBCA 4TYBA 1JLGB 1RDRA 3IO1A 5K8PA 3UPFA 2D1CA 4NCAA 4CTAA 2XS7A 4NLOA 2RMLA 4H4OA 3OHAA 3J7YU 1JMTA 3HHLB 2CQBA 2J0XA 1VC6A 1ZH5A 2ZOGA 3BGUA 2VPWB 4BBYA 3GV5B 3IAS9 5KFZA 1RT4A 2VASA 2QV6A 1ZTTA 2RU3A 2AX0A 4RWXA 1YJWS 2MZ1A 4MIBA 2G1DA 3DRPA 1DRZA 2GCFA 3FRZA 2ZBIA 3NG8A 1REVA 1K9MT 2UUAF 1EETA 4V19X 5I42B 2MKSA 5C25A 2L41A 1H2TZ 1QM9A 1U24A 3EPGA 3FSIA 2VQEF 3VWSA 4NWBA 4I64A 2AV5A 1NK9A 1Y3JA 2B9XA 1N5VA 4FPRA 2PT0A 3DM2B 4QQBA 2R2RA 2MKHA 2KZZA 1K0TA 5CYQA 3BEGB 4J9NA 2XMMA 3O44A 1I1GA 3PEJA 1KTQA 3OFEA 2JVOA 1YBAA 4JI0F 4EFAC 2P9CA 1YG0A 3CMAS 3OQ2A 2C3MA 3H8YA 2ZE2A 1QSSA 1WG5A 1O51A 2F8EX 3DRXA 5GAEI 5I4MA 4QU6A 4DLGA 2LYVA 1L3TA 3CD7A 1LWEA 1KHVA 2F8MA 5HMXA 3IRXA 3KK1A 4DSJA 4W92B 1KD1T 3UQSA 1G3OA 2HNZB 1WF2A 3PFEA 4KE5A 2JX2A 4DOZA 3POTA 4QZVB 1RT7B 3CDWA 2E1AA 1UP1A 2YKMA 3M05A 4F3MA 4K4TA 2KJWA 1BQMA 1VBYA 1N6QA 3GR0A 1JLBB 1JNZB 1URRA 1X8DA 2CVIA 2EBEA 2EFVA 3ZZYA 4N56A 1X4DA 2BA9A 4Y3CA 2O66A 4EUVA 5GAHI 2QA4S 3BSOA 1WHVA 5A2QY 3OL6A 1NJWA 1K8AT 4EO8A 3T9ZA 1X4BA 5KFPA 3IS9A 4FXVA 1SJQA 5B0GA 2FHMA 1S79A 2WB1D 3WC0A 1JK9B 3PV8A 3I6PA 4OZ1A 3LAKA 3KTQA 3BZQA 3CJ4A 3CJ2A 3RRGA 1UVJA 1TUVA 4NCBA 1U1LA 3MR3A 3KG0A 3JYTA 1HNXF 2ZZNA 2ZE2B 2CQ1A 4B9NA 3MEDA 1YRUA 2JSXA 4E8UA 3KLGA 3PDNA 4ELVA 3VZIA 3KLEA 2YKAA 5E33A 3N6LA 1U1QA 3I32A 4NRUA 3QGHA 1DAXA 2J6SA 2AGQA 2Y1RI 3NCRA 1TL4A 5LJ5Y 4A8OA 3T6JA 4K4YA 1NJXA 1O0PA 1KEKA 4D3GA 4CO1A 1LWCA 1AXQA 3RRKA 3UD3P 1JWWA 1HARA 1RT4B 4YB5A 3T6BA 2V4QA 3ONQA 1N0UA 1XEZA 3LPYA 2WRMA 3OTCA 2IM1A 3LWLA 3P96A 4DFKA 1WEZA 3CO9A 2XS5A 3FSXA 4LQ9A 4JV2A 2M88A 3TQ1A 4DS4A 3B4DA 4LQ3A 1BWEA 2HHVA 3CVKA 3QJPA 3O6QA 1MNEA 4USHA 2O1PA 4WU2A 3OW2R 2FTRA 5E3CA 1HYSA 4PXEA 4C0BA 4PQUA 4X84A 2M8HA 1FTCA 3LUYA 3HHEA 1SIWB 3Q8RB 5KG4A 4R5PB 4DL2A 1U45A 2VH7A 2DD8S 2YKNB 1KSPA 3NGDA 4LF7F 4HT5A 1Q1KA 2FLOA 2ZH6A 2C28A 3IFEA 3D0IE 3SCKE 2L3MA 1P1LA 4FVCA 2RD5C 2XMTA 2DGUA 3Q23A 2V4JB 5GMKa 4EEYA 2ACYA 1S10A 2YX4A 2D3ZA 2VFTA 3HVAA 2M2BA 4KV8B 4F26A 2ZOFA 3AQPA 3TAMB 4O0IA 2C3YA 3ITHB 1LK7A 2LA4A 3QGGA 5MLCV 2YWEA 1M5OC 2GQQA 2K1RB 1GTHA 4O3PA 4IO1A 2VFRA 3FFIA 2W25A 2NR0A 1JLAB 4RZRA 4TY8B 3U27A 2W9AA 2HPUA 4WKYA 3E51A 1UFLA 2HS0A 4WXOA 2U1AA 3JTOA 1JNRB 3D5MA 5J2QA 2FHKA 1WI8A 2C2EA 1RTHB 4QIEA 3GFXA 3CJ5A 4F25A 1IBKF 2RT3A 2ZD1B 2AJ4A 1HQUA 1VC0A 5KG5A 1RT1B 5IM0B 2WB4A 3RAQA 1VC5A 2KFZA 1UA1A 2DRAA 3V6DA 4DR6F 1RWUA 1NB7A 3CE8A 5HMWA 2PN6A 3C8YA 4M63A 1N48A 2DGVA 1NRKA 2UUTA 3TOQA 2YQ3A 3M6XA 4IH7A 1X5TA 5CCLA 2HNYA 1XBWA 1XTZA 2DH8A 4ZP6A 2YWKA 1SJ3P 4KGKA 5EN1A 2GC8A 3DOMA 1HHTP 1LOUA 1NZAA 4YP3A 3PW0A 1DLOA 2CJ9A 2K2PA 5F3ZA 2CPHA 2BE2B 3KNGA 4AXJA 5J2NA 1ZPVA 2EK1A 4B3RF 4ZPWR 2XB2D 3CWJA 1VQPS 1C4CA 3HX9A 1ELOA 3DLGA 4J9QA 3MMCA 3C2PA 2G4BA 2D9PA 2XSJB 3KHLA 1HBUA 2E1RA 4KGMA 5KG1A 3V6DB 2XLJA 4GKJF 4IR1A 5B0DA 2MSTA 1SIZA 1KQSR 4NYPA 3F44A 3L09A 2YTCA 3M8PA 5HL7Q 2HNYB 4WFNQ 5LJ3Y 3M2RB 3RW6A 2L9DA 3M8RA 1VIOA 1SKSA 2RU9A 3CIMA 3PX6A 3DFEA 4MKYA 3P49B 2M3DA 1S1XB 2K3KA 3QJJA 2ZBCA 3I5AA 1KOHA 1KOOA 1HBMB 2UVRA 2V8DA 3T1AA 4A46A 5IM0A 4WCEQ 1H6KX 1SJFA 1H0HB 1LWCB 3I4HX 4IDKB 4NYOA 5A0YA 2BM1A 4Z37A 4H4KA 4Q2LA 3KOAA 1KHWA 4DJBA 3DXBA 5AE3A 4G1QA 3M30B 4LSNB 2HNDA 3CC2S 1UWBA 3DYAB 4LVNP 3VAIA 3SYZA 2RQ4A 4I67A 3JAMY 2LCWA 5GAHU 5KFUA 1U2RA 4B9VA 3KJVA 3FFIB 3L7OA 4BCAA 4IRKA 2RILA 4C0HA 5KFJA 1FRKA 4U6PA 4RNHA 1QVGR 1UVKA 2F4VF 3BJYA 2I8EA 2LA6A 2PA3A 4RW4B 2DRBA 2AGPA 2KO1A 3VF0B 2X1BA 3NL0A 1MWYA 1MMLA 2DGSA 1RYSA 1H2VZ 1UVMA 4X4NA 1U1OA 2RVJA 2IAJB 1JXLA 5IS2A 4L72B 4NPOA 3PO5A 5LSLA 4BC7A 1HNVB 2QZ8A 3DLHA 1JKHB 4YB1P 4RW8A 2KG0A 1URNA 4OHZA 3DHWC 3WBZA 3M2UA 1FDNA 3QIDA 3GFYA 4GO5X 4URGA 1OPIA 5L38A 4L3NA 2OD6A 1GX5A 2NPFA 2GMLA 2WW8A 1FNMA 2BVZA 2BW2A 2MHEA 5AXNA 5FDLB 5DETA 4PXDA 2HVIA 2FHJD 4ELTA 3G8TA 1X9SA 4LUBA 1A9NB 1CVJA 4C7QA 2V0NA 2FHJA 2KTQA 5GVQA 4QIVA 5THWA 1P6TA 1Q79A 2FVCA 4C97A 4U7CA 2LQ9A 2XC9A 2IAJA 2ADCA 5K9FA 4DQIA 2DNOA 3H59A 4WIIA 3M2VB 2PI5A 3CCSS 2E5IA 1V9OA 4IOCQ 3MUVP 2JC0A 2OPQB 4DV3F 4QIFA 3N79A 3IR6B 3FZBA 2V8GA 2BANB 2FVSA 1NJZA 3V6KA 2GMJA 2P9EA 4YDXA 4QWAA 2WCXA 4R8UB 2AWZA 2HG4A 4WU3A 1N32F 2HIQA 4ZVGA 2N4CA 2PMHA 4R0JA 2D3UA 3B4MA 4CO0A 5DDOC 3DHXA 3BO3A 1IKXB 5HP1B 5F8LA 1G7CB 5F8IA 2XSFA 3FNNA 2DH7A 4Y2CA 2C2DA 1Y4ZB 5LL6d 4LF9F 3H5SA 3GFHA 4I6WA 5E5NA 2ASJA 1VS3A 3BGFA 3CCUS 4OZNA 4ILLA 4X4VA 2EKYA 5JVGQ 4G3IA 3KLIB 2DPIA 5B0FA 1DJ0A 2NYIA 1X4HA 1S1WB 2XG8A 3OJUA 2VFVA 2YX7A 4KKOA 4WFZA 2JEIA 4CH7A 2LQBA 4DV0F 2ALZA 1MWZA 4P7VA 2V9WA 2EFOA 2M7SA 3H4BA 2ZZMA 4BWMA 2KHDA 1PGZA 1H2UX 4ES1A 2VFSA 1KS2A 3IXQA 2WBRA 4DR4F 1FRHA 2GNKA 4K2XA 1H7WA 1RT7A 2JLFA 2DNMA 5HLFA 4TQSA 4IG3A 2ZH5A 1TVRB 4DBQA 2QFJA 2DBBA 3EZUA 1JLAA 5E3AA 4ETZA 3BB5A 4P6QA 3AY0A 2ZHAA 1TP7A 2QLXA 3M1VB 5F0WA 4QR2A 1YJNS 4J9OA 4AUKA 4B08A 4JI5F 1UJ4A 2CG4A 1FJEB 3MOJB 1SKRA 1UVNA 5I3UB 2B5JB 2BZ2A 3PKYA 5HI7A 2XZWA 4JI7F 4ZCLA 4NCGB 4ZVEA 1RI7A 2ILZA 3PVXA 5E3QA 1UETA 4CO5A 2A18A 1LKZA 1ZM9A 3EUNA 4A8XA 2VL1A 2C3OA 3DRPB 1N5SA 4O4RA 4K4ZA 3QGPA 3PR4A 3ULHA 3AAWB 3DU6A 1IKWA 3GR1A 1SXLA 2FGCA 5T7LB 1LV5A 4ILMA 5J2MB 3O8WA 3MI7X 3SCLE 2ZHBA 1J2VA 2JWNA 2XLIA 1O5JA 2AYEA 1VQ5S 4GMKA 1NK6A 1F0XA 3EXCX 3D0HE 3OR2A 3OPKA 1S6OA 3RW7A 2V8VA 4LVOP 5KT4A 4GKKF 3HLUA 1LW2B