2XLIA

Crystal structure of the csy4-crrna complex, monoclinic form
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
189
structure length
167
Chain Sequence
FTMDHYLDIRLRPDPEFPPAQLMSVLFGKLHQALVAQGGDRIGVSFPDLDESRSRLGERLRIHASADDLRALLARPWLEGLRDHLQFGEPAVVPHPTPYRQVSRVQAPERLRRRLMRRLDLPFVTLRSQSTGQHFRLFIRHGPLQVTAEEGGFTCYGLSKGGFVPWF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequence- and Structure-Specific RNA Processing by a Crispr Endonuclease.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase/rna
molecule keywords CSY4 ENDORIBONUCLEASE
total genus 36
structure length 167
sequence length 189
ec nomenclature
pdb deposition date 2010-07-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09618 Cas_Csy4 CRISPR-associated protein (Cas_Csy4)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.2540 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xliA01
2XLJA 4AL5A 2XLKA 4AL6A 2XLIA 4AL7A
chains in the Genus database with same CATH superfamily
5FJ4A 1QY7A 1RHMB 3F41A 1T94A 2KRRA 2Q43A 4XAKA 1NB2A 1RWOB 4RNHA 2RILA 5AJ3F 3CJTA 3K0JA 1WC1A 6FDRA 3V6DB 1T0TV 2J9CA 3MHYA 3W8GA 5JMNA 5U47A 4JI0F 2LA6A 3IRXA 3GSDA 5L1IA 4B9VA 3JTOA 4C7QA 5BYSA 2QO3A 1D09B 2YX1A 3CJRA 1BHNA 3M7VA 3MMAA 4WP8A 5K9FA 4QWCA 3LGNA 2ZH4A 9RUBA 4OX7A 4Y65A 5HN0A 2YNIA 4GVLA 3BBCA 4F26A 3VQTA 2JEGA 1HNWJ 2V50A 2OMLA 2QL5B 2R42A 3RRGA 2V4QA 2MQ8A 2PEBA 5E7OB 3OLBA 5DGAA 2FVRA 3MM8A 2FQQB 1CEZA 2MQMA 3IBCB 4LRAA 4A4JA 5T7LA 3PIPQ 2H4YB 3PHTA 3MD1A 3FCWA 2VONA 3SSSA 1FRIA 1M0SA 4UOHA 2JZ5A 2XNRA 3GIIA 1HNVA 2BKPA 2G0IA 3MM7A 2VODA 2IYGA 2XCPA 3GG0A 3HXMA 2XSJB 4IG3B 4RU9A 1RKIA 3SV4A 5B0DA 3OL7A 2AYGA 2G1HA 2M3DA 2PGCA 4U7CA 1DQ8A 3CC2S 2G4BA 1MROA 1HBUA 1R8BA 4OLOA 4RO0A 1NRKA 5HLFA 1U6ZA 3M05A 2VG5A 2IPOB 5B0GA 1GEHA 2QIFA 4DPOA 1NK5A 4IR9A 1DARA 1QLNA 4NA3A 2W9CB 4H4OB 3H20A 4JYAJ 3RBEA 4DUYJ 4J7CA 2XM3A 4DV2J 4CP5A 2I2YA 4ZVOB 4LSNA 1BXNA 1G4CA 5DQHA 1Y3KA 2XO6A 5HVFA 3UI3A 1WC6A 3FFIA 3THVA 4ETZA 4NEZA 2D9PA 5CYQB 1FDDA 3M6VA 2BQUA 4UQGA 1T8EA 4JI2J 4KGKA 3VF0B 2RB7A 2RS2A 2K1RA 2RF2B 2MHEA 3N28A 3GONA 4NX9A 4OZNA 2ZBRA 2HURA 3KLHA 3HVRA 2FJEB 2CJYB 5LXYA 3LA0A 5IOLA 4EEYA 2EK6A 3SCKE 1FFGB 2DCUB 1U25A 2DNHA 3OFFA 3KLFA 2DITA 2IC3A 4ILRA 2AEFA 1TVRB 4N41A 4LJMA 2KM8C 2VQEF 3WC2A 2HHQA 3DOMA 4TXSA 3BDEA 5B0BA 6FD1A 1T11A 3PYEA 4RNNA 2C2MB 3R27A 4OV6A 3RYLA 3R5DA 1NKBA 3IGVA 3M32A 3CCQS 4I4BA 3TZZA 2R2SA 2B56A 2KZZA 1FK9A 2L9DA 2Z4PA 1EKSA 1HPZB 2UUCF 2DXDA 2HZCA 5E3AA 4Y2MA 2CRLA 1NJZA 1N52B 4J9SA 1JMTA 1QSLA 4ENOA 1T02A 3OTCA 1KHVA 2DD8S 1OIAA 5E3PA 3TAPA 3E8OA 1S49A 1YRTA 3MM9B 3QIPA 4HEA9 2HBYB 4MK7A 2XZWA 3H5UA 3IR5B 2HG4A 4NLUA 5J1EB 5J2MB 3M6UA 3FJ2A 1TL1A 3L7UA 5THWA 2J0QD 5EWGA 1SQFA 1H2UX 2EK1A 5K8MA 2O67A 3EPIA 4DV3J 1NK9A 4V19J 3Q0AA 1HNXJ 2DRAA 3P4UB 2CQHA 1DTQB 1UETA 3PYFA 3MFIA 1W25A 1YJTA 3R5CA 3T6JA 5EHHA 4B08A 2WRMA 3UVJB 2HVIA 3M2VB 5CYMA 4YS2A 4KH0B 2KYZA 4ECTA 1U0HB 4I7FA 4R8UA 2IMWP 1HNZJ 1F5CA 2Y8WA 2QA2A 4U9RA 1HA1A 3DM2B 5BJRA 5KAKA 3ET6B 1N88A 1J5EF 2E5LJ 5C42B 2MPUA 5DG7A 2CQIA 1IKVA 3CB4A 1U0HA 1S77D 3GYXB 3W8PA 1QDUB 1KEKA 5IV4A 4IH6A 1L3UA 3OR1A 1VMBA 3AJDA 3D28A 4Q2MA 2UVUA 1D9DA 3DOKB 8RUCA 3V81B 4M95A 2YNFB 1KOOA 1SUQA 2F9JA 2IRYA 2F8EX 1J5OB 1SB6A 1S1XA 1HHQA 4JI7J 2IJRA 2HWIA 4USIA 4YUDA 5BR8J 1MSWD 1WWHA 2FGCA 3B4DA 3I4PA 2C2EA 4TU7A 1GXTA 2HS4A 2XI3A 1AZSB 2VPZB 3QGGA 4U7UK 1DY3A 3G6XA 1CS4A 2O1PA 4I2PA 5M2UA 1FXDA 3QIDA 2J9DE 2Q79A 2U1AA 1F5AA 3BO3A 3KK2A 5LMUJ 3MOJB 3ENQA 5DQIA 2HVHA 4ZOSA 3MR5A 3R7SB 3FBCA 4F36A 2FLNA 3RW6A 3CD7A 4J9QA 1K0TA 2RU3A 2KTQA 2EFVA 3DGPB 5GAGI 1HNIA 1MW7A 3Q89A 4N47A 2FHMA 9ATCB 4IRKA 1AZSA 2VG6B 2AJFE 3BYPA 1HKAA 2O01C 3MECA 3UCZP 2Z8QA 2AYBA 1UVJA 2F4VJ 2OPSA 2JFKA 2VFUA 4S0MA 5GVQA 2E5GA 2AJ4A 1VQSA 2X1GA 2ASJA 4CO3A 2HFVA 1FD8A 2OEJA 2HBZB 3KLHB 2B43A 3HHEA 3UD4P 4KFBB 4QR2A 3RB4A 2GAGC 4DCPB 2LXUA 2HHHJ 4K4SA 3ETOA 1Q7YT 1OQ6A 2F4FA 4OYBA 1NAQA 2KKHA 2JC1A 3HKWA 2FHOB 2ZVSA 3KDNA 3OD2A 5EUHA 4LFCJ 3MCOA 2DT9A 2WSFC 1ZZNA 1ULRA 4FVCA 4OIXA 5B0FA 3NWGA 1VQ5S 1H7XA 3DMJB 3UFCX 5I3UA 4RW7B 2DY9A 1IKXB 3UN5A 4F7VA 1U09A 4F0KA 3BH6B 2FDNA 2BE2B 3QLHB 3TW0A 3NMAA 1SH3A 3NP5A 4X65J 2DNGA 5KFNA 3O3LA 4P10A 4CH0S 3KFWX 4OX9F 2AQ4A 1JNRB 4WXWA 5DLGA 3H98A 2GIQA 1NKCA 1X4AA 1JQGA 3TUPA 3TJAA 3V5RA 2NXUA 3EVOA 3OXGA 5I3UB 2UV8A 2FLOA 3MAAA 2DGXA 1MWYA 1Q79A 1ZM2A 2ZKUA 4LRFA 5LJ3Y 3G8SA 3V4IB 1EETB 1CJUB 2Y0SD 2BVZA 4P52A 3KUEA 1RCXB 3J7A1 2MZJA 3U27A 3LALA 4A8XA 4ZN3A 4WXOA 4YFUA 4DV5J 1X7VA 3GPAA 2C3UA 3KJFB 3BKFA 2YWGA 3QIPB 4L74A 5J2MA 1YBUA 4URSA 3KLIA 3UN2A 3KYLA 1BGXT 1S7HA 2VL1A 3T5JA 4B9UA 4DR7J 1I94F 4OYMA 2O5DA 3J80U 2Q3PA 1L5UA 1LWXA 2XEXA 2KHCA 3NXZA 3W62A 4LF5F 4LR7A 1Q8IA 2KJVA 3PEJA 4PWWA 3IXQA 2G1DA 2KVIA 1XEZA 3SQGA 1HHTP 3ZTRA 4FYDA 3Q83A 3JTNA 2KDOA 2MJNA 3S01A 1JKHB 5B0CA 3KK2B 3ZNJ1 4UOFA 2EBGA 3I82A 3NBPB 2WONA 3T9NA 5C42A 3AODA 3I9V9 1XMQF 4ER8A 2KU7A 2I6WA 1KN6A 3B82A 2RDDA 3AD9C 2ASLA 4FBUA 2M4MA 4UUWA 4ES2A 4DR2F 5LL6d 4A8KA 4DQPA 3RR8A 2DH7A 1X4FA 5KFJA 3HF5A 5F41A 1X9MA 3A3OB 4OJ1A 4HI1A 3AD8C 4USTA 3R5GA 4CTAB 1KTVA 1R0AB 4USUA 3DHWC 3WIUA 3RBDA 3EMTA 1RE1B 4PG6A 2F3JA 5ETQA 3HVAA 1DJ0A 3OTEA 3I0RB 2RDJA 2DHSA 2RUGA 4JI0J 2AYEA 1SI9A 1X4GA 1WG4A 2C3MA 2DNPA 3R2DJ 3N4WA 2R7UA 4G1QA 2VHGA 4H4KA 3TVZA 3AXKA 2JLFA 2MKJA 5ETVA 4QWBA 4LSLA 5D3GB 1XC9A 1BD6A 1ZM4A 3ZZPA 1TAUA 1AFIA 5KT7A 2VDHA 4FYVB 3TZXA 2VQFF 3FMWA 3K89A 4DR3F 3PX4A 1GMWA 1RWUA 1NDKA 4V1Ak 5F9NA 3G9CA 4KIAA 1X31C 4M5NA 4PQAA 4RW4A 2GS8A 3TOQA 4L3KA 2V34A 5B0AA 3MURP 1UA0A 2JC0A 2NXCA 3G87A 1AB8A 2AT1B 2V8DA 3GJRB 1D9AA 2HSEB 3IR6B 5HVGA 4OZLA 2E1RA 2ZM6F 3V6HA 5HP1B 4PWUA 2VC1A 3EZOA 5T14A 3VR1A 2HZVA 2OPPB 2CXEA 2NUHA 3FEXB 3HZEA 1I94J 1RWVB 4DR4J 1UAWA 1LW2A 4JV1A 2IC3B 2MGZA 2JH3A 3L9ZA 3MPUB 5CH7B 3CUNA 2DR9A 4C0HA 1N0VC 4OYOA 3WQPA 4E0DA 2HLUA 3LO3A 2IVMA 3T3FA 3G6ES 5ETRA 1S0NA 4QJVA 4WE1A 2GCFA 3NCPA 1LOUA 3JQKA 2MZRA 2FD2A 2I5JB 4PPDA 2LEBA 2ZFHA 2P6TA 2HHPA 5E3QA 4M63A 1X4HA 4JI4F 1NPRA 5AE2A 1C1CB 1GXUA 3FKBA 3SDEB 2RMLA 1IBCB 1L3TA 4HLBA 2WVFA 5J2NA 2HHHF 2RIJA 1FRHA 2V4JA 3BS9A 2W7PA 1MMNA 4YY3F 1ZA1B 3PNIA 3FVYA 1LW0B 3EZ5A 1KLMA 2JWNA 2ZUGA 5D15A 3PW5A 3UD3P 2IM0A 1N56A 1JLEA 3A1YG 4OYWA 1REGX 1S99A 5JVHQ 1T05A 1VS3A 3IC1A 4I7FB 3BEGB 3I32A 2R8HA 2GA7A 1YDLA 3DRRB 2AX0A 5FDLB 2UUTA 2FJWA 1ITPA 2E44A 4LFCF 2IBOA 3QGHA 4X65F 1M1HA 3HP6A 4M5LA 5IXUA 4E98A 2J0SD 5D4NA 4CTAA 2EVZA 4KB7A 5A2QY 3CCWA 3OFEA 5F0UA 1DZ5A 4EZ6A 2CDQA 2MYFA 4Q43A 2ZNYA 2NUUG 2KM8B 3LP0A 4L72B 2GW8A 4X4NA 3PDNA 1NLKL 2Q1LA 3G8QA 2XYGB 1WACA 1Y3JA 1ZETA 1SL2A 4X4TA 1MWQA 2IA0A 1A7GE 4CZCA 4C8MA 4DR6J 1HMVA 3ISNC 4LF4J 4B3RJ 3UR3C 1RBLA 4OJHA 3TRGA 3WC0A 2BKOA 2F7VA 5J2PA 3F44A 1RWMB 2LU2A 5LM7E 3QT8A 3OQ2A 3KTQA 3C6UB 4O4GB 2D7SA 1HIYA 2CPIA 1N5VA 5HBMA 3MTJA 1N6QB 1YJ9S 1NK6A 4FS2A 3GYGA 1HQEB 3NGRA 1JKHA 3CC7S 2AMCB 3M8WA 1VQOS 4NXMJ 2BACA 5EN1A 5CHCB 2HPUA 4DR7F 3DRPA 2EG1A 2BQRA 4EO6A 4JI5F 2B3TB 1G3OA 2BEFA 3T1AA 2Y1IA 4Z2XA 4RW8A 1QVGR 5KFSA 1SJ4P 4NA1A 2ZOMA 2MLXA 5IM0A 3ENWA 4FYYB 4MAKA 2DNLA 2UVVA 1TFWA 1GTEA 3TP2A 5D0EA 1F2HA 4J90A 4CLFA 2HW3A 1J5EJ 1Q4RA 1PG5B 1HWUA 4NPOA 4FF3A 2CJBA 1WORA 2R7OA 3CJ0A 1SKRA 2JEJA 4HACB 2QEXS 1IJFB 2CPXA 2ASDA 3MAAB 4RNFA 1IKVB 4N8OA 4QPXA 2HK2A 3RJMB 4GO7X 3BN4A 2IFXA 1CJTB 2NPFA 3TAQA 3OJUA 2CQDA 5HVHA 1MMLA 1WF1A 4MYUA 5J2QB 1TUWA 3DOLB 2J9EA 3DM2A 4RWXA 1T03B 2HBQB 1K1QA 3T6BA 2PI5A 1S76D 2PDAA 2N82B 4B9MA 1N33J 2DXFA 3J81Y 3QRRA 5JUMA 2BE7D 2VKZG 3BREA 1S72S 4DL3A 4ZHRA 3TJ8A 2WBRA 3PIOQ 4PG5A 1Q5YA 4X66F 5CZXA 1OSCA 1DURA 1NEEA 2LQ8A 3FQLA 4MKBA 5KG1A 1RT6B 2A3JA 2ZC3A 3W9HA 3I5BA 4MKAA 2GVZA 3DYAB 2B9EA 4JI6F 4DX5A 1SVDA 2HFOA 2RQ4A 2J7UA 3NGTA 3DGPA 2CQGA 4ED3A 3H8YA 5GADI 3SYZA 3DN9A 3C46A 1N5TA 1XWLA 3T1YJ 2WSEC 1IBKF 4Z37A 3MTKA 2OPSB 1S9EA 3MZIA 3OV7A 1FF2A 1HYSA 2LEAA 2WAQD 4U6PA 1PYSB 4DF4A 1VQKS 4F4XA 5L8RC 2XS5A 4LVOP 3H42A 1IR0A 1S1UA 2X3DA 4PXCA 2GMJA 2UU9F 1YTYA 2MQQA 4ILLA 3A8JA 1MN9A 2YX4A 4WFAQ 5AJ3J 2QLFB 4IRDA 2BANB 2HWTA 3RW7A 4RW4B 1TP7A 4Y2CA 2COLA 3OR2B 1JK9B 5DS7A 4ECRA 4K4VA 1FJ7A 5T41A 1ACMB 2R7RA 1TL3A 2JLEA 1X0FA 1FX2A 1RAFB 2V69A 1PBUA 2Z30B 3KG4A 2W7AA 3OW2R 2MKYA 2XLJA 2ROGA 2V68A 1YSJA 3BDPA 2FJVA 1SIZA 2O3DA 2VFTA 3CSKA 3PG9A 4U8YA 2HVEA 1DLOA 4PG8A 4R5PB 5ETNA 3VAKA 4K5SA 1HWLA 4DSLA 3C66A 3K8VA 1S6QA 4WYWA 1U1KA 4E8UA 1R0BG 4DFKA 1EARA 5KFAA 4X62F 1N36J 2HLTA 2W4DA 1ZBTA 4ECUA 2RHQB 1KFSA 5F9LA 1H7WA 1U2CA 3Q86A 3MI7X 2HAFA 1D8ZA 4KKOA 1EP4B 5C25B 1K47A 4K50A 4IOBA 1Y00A 3VAHA 1FT8A 3ZTPA 1OPZA 5A8RA 3G86A 2AEJA 2MY7A 2QX0A 2WVEA 3UVJA 4CLWA 2G0CA 5K8OA 3POTA 4NZ7A 3VVUA 1SXLA 5I42A 2YKPA 4DQIA 7AT1B 2QYGA 1X4DA 1C2PA 2DRDA 3VGSA 2ZKTA 2ZBQA 4W92B 1JXEA 3EDRB 5KT3A 4TU8A 1KVIA 3GIKA 2NREA 4OYPA 2UUWA 1TZ0A 3UDCA 1V3ZA 4JI1J 1T9TA 1Y0HA 2E5IA 2GMLA 1RA6A 4ID5B 4DDFA 4URGA 1H38A 3DGVA 5DM6Q 1F1BB 2VU5A 3K5NA 2Z0GA 2E1AA 3HCXA 2HK3A 1GMWD 4KYZA 3GIJA 3OFHA 3HJVA 1FJEB 3V2UC 1NNDA 4PYAA 4IR1A 5FDLA 5IV3A 1T7PA 5DG8A 5H1SV 5AE1A 2IY5B 4LBIA 2H1YA 1IWAA 3W66A 4NCBA 1N34J 3W1YC 4M5HA 5JVGQ 1TU0B 3PCOB 1QAYA 5KFTA 1HFEL 4C3LA 1WG5A 3QT7A 4ES1A 3P3DA 5KG2A 3KLGB 4NXNJ 1FRLA 1B7YB 1Z2ZA 3PACA 2YH1A 3OUYB 4ZPCA 3ZFVA 3C6UA 4O4GA 3HK2A 1R7IA 4PPZA 4ZP6A 1C1CA 2CNNB 4UT4A 1UWBA 3FBFA 2HHTA 2Y9HA 4EGLA 2XY5A 3CXCR 4JI7F 3AOBA 4OHXA 1WSRA 5D0HA 4HYKA 1VIOA 1AXQA 4L76A 5A6PA 3QRPA 2X3GA 3SQOP 3LF0A 4X62J 1VCTA 3V6JA 3KHHA 5KG7A 1FFWB 2JVRA 4O0IA 5CYQA 2QA4G 2P9CA 1TKZB 3N6MA 3H7HB 3GWCA 1MNEA 1EX8A 3U1NA 2B7CB 3W5YA 3EYZA 1T3NA 4DLEA 4PUOA 1EZZB 3C6TA 1ZPWX 5LSOA 4CIOA 3MR6A 2HBRB 2VJVA 2ALZA 4O3RA 2E7VA 1S6PB 1KDNA 1I1GA 4K2JA 3DRXA 2FZGB 4DV2F 1NDPA 3RAXA 1U0SA 4PZVA 2RDIA 1LKZA 3ENAA 2DO0A 2LQ9A 3UR0A 5E33A 3MMAB 4KO0A 1UVMA 4FXDA 4TLRA 4NMLA 3LWLA 2H5EA 4UQTA 1KWMA 1VLOA 3T1YF 4DCJB 2FY8A 2AD9A 4ATNA 3BSNA 5BYQA 5KTQA 4KHPF 2W4CA 1GT8A 3TR5A 2VICA 4P7TA 3GZ7A 4DJBA 3NAIA 1SKWA 1HMVB 1NXIA 2A2DA 2DIUA 5FIIA 2IRXA 2GO8A 2DHAA 3W61A 3WX8A 3RTVA 3VGUA 1HQUA 2XYPB 1RADB 3VCDA 4DS5A 1S0MA 1MN7A 2FB0A 2R7QA 4K0KJ 1QSYA 2EEYA 1HL6A 4WPAA 1SJRA 2OPRB 3PY8A 6AT1B 2ZH5A 2VBZA 3GR0A 3R5AA 2CQ3A 4PYDA 4NXMF 1UL3A 1I6JA 4DPWA 7FD1A 4USVA 1WUUA 3MEEA 2B4OA 1JXVA 4RUCA 1S0OA 1Y7PA 1YI2S 1HBMB 4NLQA 1F9HA 1E6YA 1Q16B 2BXJA 3R5BA 1XIQA 4CM2A 3MCMA 4X4PA 1MROB 3MPYA 3BH7B 2CQ4A 4OZ2A 5C24B 1PJ5A 4ZJQA 1CJTA 4OI3A 5KFPA 4BLGA 2J0WA 1YJWS 1EJ7L 4OI4A 1IWGA 1RZMA 4CT9A 3PJXA 3CJKB 3RZAA 4CO4A 1RHJB 2GO9A 4I2QA 3UO0A 4KGXB 4WP9A 4OZ3A 3VWSA 1IBMJ 1OJ4A 3MMJA 4HL9A 4HHJA 4OQJA 3KLEA 2B8PA 2ILZA 5KG5A 3JAMY 1FI4A 1WHYA 2RH3A 5GAGU 3DNCA 2VBYA 4PKDB 4M1KA 3PXGa 2HNDB 3CCJS 5GADU 1VQMS 2AJ2A 2YX7A 3ZZOA 2HAIA 1JIHA 3BSCA 3ENVA 1U47A 1TK8A 2AHOB 3DRSA 1JLAA 4RBUA 3JSBA 4KHRA 4PXEA 3QQCD 4JI5J 1ZPVA 4R25A 3GIMA 2HNYA 4F25A 5F8JA 4JOUA 4J9RA 3DI6B 4B02A 3D66A 3I55S 3NGSA 2MXYA 3RG6A 3M1VB 3C8YA 2UVWA 2UUAF 4M5IA 3M9OB 4A8FA 1FK9B 4C0BA 3S7RA 4DV4F 1VBYA 3M6WA 1REVA 3W7BA 2Y3YA 1C4AA 3DU5A 2J76E 3Q8VA 1IVZA 3IFEA 4QWDA 2DJWA 3CCMS 2J9DA 2FVPA 4G6VB 2M70A 1PC5A 5B7WA 2UUBF 3CW2C 1S9FA 3ZO7A 5L9NA 1VBXA 5IT9Y 4HT5A 5KFQA 3NGDA 4AL7A 3TA2A 4ELTA 2VQFJ 5KG4A 3W2WB 2BJEA 1YRXA 3OR2A 4RW9A 4TU9A 4ANDA 1S48A 2HRYA 4RPFA 5G4DA 4ECWA 4WTOB 1CSJA 3PW2A 2YKNB 4IFYA 2OTJS 4O3OA 3TAMA 3ZZRA 1VQLS 1BC6A 1TAQA 3CT9A 4RBTA 5HO4A 4QZVB 2Y1JA 3DLHA 2CNKB 2HNZB 4JI3J 2YPYA 3L7OA 1R89A 4Q0BB 3VAMA 2BYCA 2B5JB 3K5OA 4HR2A 3CCSS 4BHQA 3CDEA 2ZZMA 3I31A 4DL4A 5K20B 2FVQA 4LF6J 4QQBA 2QTWA 4FXVA 3MM5A 4IDKB 2A6OA 2WW8A 1FNMA 2C2DA 1UEVA 2ZC4A 1C0UB 3T5KA 4LF5J 5ETKA 4DX7A 1VQ8S 4ZITA 1HNVB 1G1XA 2BX6A 3GYNA 2CZ4A 3AH6A 3HKZD 2WBMA 3DXBA 2N4CA 1SBRA 3FQKA 4I1TA 2FIUA 4Y00A 1TL5A 2E9ZA 3J7AN 4CNYA 3GSIA 3FGVA 4NASA 2DISA 3HHLD 3LUYA 1EQ0A 3NEKA 1CVJA 1H3DA 2L08A 3QATA 3VVTA 3W9JA 2JEIA 4FPIA 2XSFA 2FZKB 1Q82T 5LMNF 3KUGA 3H2LA 4YEAA 2MZ1A 2YBVA 5IS2A 3M8SA 1XNQF 1JWWA 2JFDA 2WVDA 2EI5A 3HDSA 2N7YA 3PYGA 5HI7A 1NH8A 4ECQA 3POTB 2QA1A 5J1NA 5I42B 1LXJA 2VJUA 3G71S 3J7YU 3PRDA 3N6NA 2G9OA 1QJHA 1WD6A 2VG7A 4L3NA 4Q44A 1FTRA 3OHBA 2MQPA 2YNHB 4ED8A 1U45A 2HFNA 4NCGB 3KNAA 4GKKJ 3ILIA 3IBWA 3R6LB 5C24A 4DI6A 1YHQS 1QUVA 4IO1A 3M8QB 1EAYC 1RAOA 3D1HA 3MPVA 3QLHA 1FTCA 3ZC4A 3HD2A 2VPXB 1OS5A 1B3TA 2DR8A 2VZ9A 1S6PA 3M2VA 3IA0A 5CYMB 1IXKA 3CDAA 4PWDB 2PT0A 1RT7B 3BN7A 3MCNA 1N0UA 3SSQA 4RU2A 2M8DB 2A0FB 2JX2A 5KFGA 1Q5VA 4LFAF 3H90A 2LU1A 3EUNA 3TQ1A 2MKSA 1RU2A 2UV8G 2JSXA 2Y1RI 1RWWB 1RU1A 3DLLQ 2OO4A 5DZ7A 5F8LA 4PWDA 1HQUB 1GTHA 4FVMA 1RXOB 1FEEA 2IRUA 2L9NA 2W9BA 4KFBA 2IIHA 3HHLB 1PC4A 3GFYA 2EFPA 1WC5A 1WNEA 1NSQA 2BMBA 1TKTA 2DHXA 2MDAA 4I56A 1XMOF 3D67A 3RU0A 4QPTA 2LCWA 4N76A 2WONB 5EWEA 3GTYX 3Q8YA 4ZVSB 5CYJA 3CMES 4C8KA 1XBWA 2GGPB 4WZMA 1JJ4A 2XHWA 5KFCA 4ZKAA 3DI6A 4P74A 1NCLA 5BXIA 1SC1B 4H4KC 3F56A 2D74B 3LP2B 3ZNUA 5D77A 3T19A 2ZJQQ 4NZ0A 1BY9A 4DPYA 1D8YA 5LXRA 2ZH1A 1CULB 3MF5A 1OO0B 2KG0A 2DH8A 2VFVA 3BGRB 2YKQA 3Q8QB 5G0RA 1PYOB 3NCRA 1UEKA 1MMDA 2C3PA 3I0RA 4XIUA 4IUFA 4FF1A 4ZLJA 4ZVUB 1F3VA 2LFVA 2HQFA 2JHEA 4K59A 5ETTA 3N9UC 1RT2B 4OV1A 1ZA2B 4W90B 2C2KB 5T7LB 1KSPA 2E1CA 3B8HA 2H5IB 1HWIA 3GJTB 4K4WA 2B4PA 3S6EA 4WK1A 1ZOTA 5L1KA 2LDYA 4ZP7A 2ZOGA 1X4EA 4G1PA 5HQMA 3OUYA 1SC4B 1BUXA 1KS2A 1V6HA 3GFHA 1X9WA 2UUBJ 2EKYA 2ATLA 2EG2A 2G2OA 4NCGA 4LFBF 1D9FA 4O3PA 4DV0F 5H9FK 2YY3A 2IVFB 1HNXF 2ZWPA 2MTLA 1URRA 2V2VA 4EBEA 1YJNS 2XSJA 4IG3A 2VASA 3O6QA 4A47A 4H4MB 4DR3J 4DU7A 3V4MA 3R97A 3IWXA 1WC4A 4QIGA 2MGZB 3BGOP 1BWVA 1Y9OA 2CQBA 2EPIA 3B6BA 5M2RA 5EDWA 3K5MA 4BDPA 2AJ0A 1R8CA 4FNHA 1XR7A 1Q0NA 3AQPA 3FCVA 2U2FA 3NGKA 1TMJA 3Q8SB 3M9MB 1R0AA 1Q81T 1URNA 2O66A 2IBKA 1KRPA 4F8RA 3FDSA 3LPYA 4QR1A 4OZ1A 2RRAA 4J9MA 4KHPJ 1S9GB 3TEGA 3Q23A 2XY7A 2GHWA 3E3XA 2MSTA 3GCWP 3TVYA 2CKWA 5ETPA 4ZDNA 3TWZA 3W60A 5C5JA 4PXDA 1M90T 2HEKA 4Q7AA 4Y2KA 1WF0A 4ZIWA 4NWBA 4DV3F 1FFSB 1TKDA 2NSCA 4GVBB 2DH9A 4FYXB 5DJBA 2CFXA 1NK8A 4C8ZA 1B99A 4AE5A 1RHRB 2AX1A 3BGUA 2B5JA 1T9WA 2LP4A 1WDTA 1P1LA 3A8KA 4QW9A 3MXHP 3UD5A 1N36F 3W63A 2AF6A 3R7BB 2MMYA 1DQ9A 1X4BA 2OEMA 4K8RA 2N3LA 4AL5A 3ITHB 3DDIA 2W2NP 1KFDA 2CQCA 3DOMB 4PCQA 1XNRF 3MM7B 4EBDA 2QC3A 3I9ZA 1S79A 2VQEJ 3S1TA 3QO9A 2PA3A 5D4OA 5EWFA 8ATCB 4HH1A 4N77A 2ZH2A 4ICLB 1LXNA 4DUYF 4HDHA 3GP9A 2HHXA 2D3UA 2J6TA 1VLYA 2SXLA 5ETMA 2RKIB 1YBAA 4C8YA 5CCLA 2IAJA 4M5MA 4LSNB 1TV6B 4ED5A 2E1PA 1KLMB 5I3PA 2POKA 2A1BA 4B17A 1RWNB 2J8AA 3X3UA 3KK3A 3CCES 1QAXA 1HR0J 4KAIA 3LTOA 2V9WA 1VRUA 3IM9A 1PSDA 4WFXA 1AYEA 1TTHB 3DLGB 4L6V3 4DV7J 4DL5A 3V6KA 1ZAXA 1WOOA 3TJ9A 4DN9A 2FJXA 3LWMA 2OUGA 3G96A 3ILOA 2R7WA 1PBAA 2EBEA 1FWKA 4RUHA 3OL8A 3SXLA 2GVZB 3DYAA 4K4XA 4ZCMA 2NLWA 1GH8A 2RT3A 2FJDB 4MFBB 4RW6A 2DNKA 3GE9A 4BC9A 4YMEA 1HBOA 2FY1A 3ULHA 2DKOB 4K2XA 5L38A 4JYAF 3AAWB 3LGMA 2OELA 4YDXA 1X60A 1NJWA 1H2TZ 2MKCA 4ETXA 2N3OA 1PAEX 3LQVA 3NCQA 4C11A 3MM5B 2QT7A 1UEUA 3PJ9A 4IDKA 3CEDA 5D0RA 4CLZA 4NI2B 3HJFA 1UVNA 2OP5A 4HHUA 4OHZA 4J9UE 4IFVB 3U1LA 5JJBA 2DHHA 5LSRA 3WX4A 3PX0A 4LF9F 1ZAVA 3BGFA 2K06A 1MU2A 3ZZZA 2XCAA 1Y5IB 2J7WA 4L73A 4UF4A 4CH7A 4HT7A 4N5SA 3RRHA 1T03A 1TL7B 3OVBA 4CLLA 1JJHA 3IRXB 4KV8B 2K7KA 4OI2A 2ZBCA 4NI2A 2N4DA 1I51B 2GAHC 1PKUA 2VG7B 4L75A 2YKNA 1T9UA 4CDIA 2E9TA 1JLGA 5IQ6A 5DRKA 4RZRA 4CQ1A 1NM2A 4IH7A 2LQJA 4BCAA 2EFOA 2KFYA 2VB6A 1SIWB 2LDIA 3PJWA 1H2VZ 4MTPA 3CJ8A 3MM6B 4DG1B 3NY0A 5KFOA 1LK5A 1HBNA 3TAMB 1PIEA 4USWA 3R9LA 3RR7A 1SH2A 1UVLA 4BS2A 2FYXA 4UY8T 2DR7A 2XS7A 4F3OA 2Z58B 3MEKA 3HT0A 4Y3CA 4QIWD 4DEZA 1EQMA 2QL9B 5KT4A 4N56A 1S1TB 4MMOA 1VYAA 4OHWA 1U1OA 2BM1A 1RGVA 1NSKL 2JVOA 4A48A 2PA8D 4H4OA 4X4SA 1SQGA 4DCOB 1CJVA 3MUVP 1Q1KA 3GILA 2FHKA 3HMJG 2AGOA 1V5IB 5A8WB 1R43A 2XMUA 2ZITA 3HD1A 3KXDA 3O1LA 5HQ8A 4ZJOA 4J9NA 4IG0B 2DHGA 4U96A 4QWEA 1VI7A 1YJRA 2CADA 2CNLB 3EGNA 4OX6A 1UFLA 2GQCA 2K2PA 1NO8A 2GQQA 1YITS 2HFSA 4LF9J 4KGVB 4DFJA 2BJ7A 3D6MB 1UW9A 3EXYA 5L9XA 2V5HG 3X1LB 4CLUA 2LECA 1VC0A 1N33F 1VQ4S 3SV3A 2CG4A 1BQMA 2X1BA 1VIXA 4O44B 4ED4A 3PFEA 5IZHA 5C2CA 3F73A 3H2UB 1FDNA 2G2ZA 2MSSA 1RI7A 4WBFA 1HHSA 1Z1ZA 2DNRA 4ZPWR 3VTIA 4GC6A 4X4QA 2OIHA 2C2NA 1RK8A 1D3WA 2BBEA 2RRNA 3GR1A 4PG7A 3GFXA 5B09A 4J9LA 1WI6A 3IBFB 3QGIA 1U49A 2DPJA 2FVSA 2HMIB 2KL8A 4PQUB 3ELHA 3Q2SC 3MMBA 3RB3A 2CA9A 3NMRA 1VJQA 2YKOA 4NA2A 4F3QA 4JI6J 3FBEA 3TZWA 4RNMA 3CD6S 2UUCJ 1WEZA 3M8QA 3CCRS 3CJ2A 3IP0A 2ROEA 3MD3A 1G2EA 5KFKA 4NEYA 2F8HA 4GVBA 4ANCA 2W9AA 3SIPB 4DF8A 3AB4B 3UWTA 4YR0A 3M2RA 2FC8A 2KT3A 5IC6B 2DBBA 2HZAA 2E1MC 3BPSP 2PC6A 4ANEA 1RWPB 4AYBD 4DX8H 1QSSA 4OZ0A 3BQ0A 1YJ7A 4LF7F 3Q8PB 3IWNC 4CWBA 1AW0A 4LIWA 3FC9A 3IAM9 2G13A 4TY8A 2I8EA 1AT1B 3FEZA 5KG0A 3MAQA 2GHVC 4WWSA 3MCSA 1DTQA 4ID5A 3TEHB 3W5XA 4ED2A 4U7UD 2AZ3A 4DSEA 2F9DA 5KG3A 4GRSA 1RJJA 1TL1B 2H51B 1DHMA 3JYTB 1CJKB 5I3QA 2ZBIA 5DETA 3CIMA 2D3O1 4DWIA 1HBOB 3NGUA 1KQKA 3ITHA 4P73A 3EGWB 4V19X 2D9OA 5CCMA 1EETA 5LSLA 2ZWOA 2CPDA 5DDPC 1XNRJ 1W2IA 1FERA 2ZDOA 3T41A 1NHVA 4DQSA 1FCAA 3D6TB 1IM6A 1RLDA 4CRJA 3M32B 1WKJA 3C15A 3K5PA 3M8ZA 3WBZA 3TANA 2NS1B 1F9FA 1FKOA 1NU4A 2PMWA 4E2FB 3CF5Q 3EVWA 2FZCB 1BQNA 2BA9A 1JLFA 2DK2A 3EVMA 1KR4A 1TL4A 1VQ6S 2HKEA 1AFJA 2AJ1A 4ZVRB 5D78A 5AXNA 1NK0A 1RT5A 4IFYB 4NLVA 3VQSA 1N4LA 1PCAA 2RNEA 2AGQA 1JLAB 3Q8UA 2NZCA 5DDOC 1Q53A 3QBCA 1RWXB 1VHFA 2KFZA 1RTJA 1V5VA 2Z2YB 3HPOA 3F0NA 4DV0J 4X4UA 1S12A 2WW4A 1PAUB 1FA0A 4RWWA 4KHMA 2KT2A 5KFXA 1RT4B 1F3FA 2EFGA 1U8SA 2DNZA 3N5FA 5KFYA 2CPJA 1TUGB 2MKKA 2XMWA 2PMHA 3GV8B 1B0TA 1SKUB 5ETOA 3KLGA 2BE2A 2WVCA 1RTIA 1KLNA 3FRZA 2IM3A 3I96A 2GX8A 2OFHX 4LQ3A 1OYEA 4I0WA 2HRTA 1U6FA 2VG6A 4LMZA 1Z2LA 1UWBB 3HVWA 2XZTB 1N5YB 4HVZA 1MU2B 1E6YB 1FE0A 4K4YA 4DR5F 1HI0P 2CJXB 3AHPA 2JEFA 1S1WB 1GFWB 2WSCC 5J1PA 1V3SA 1FWLA 4PAAA 5IT0A 3TO8A 1R8AA 5LMNJ 2RHSB 4WFZA 1T9VA 1L3SA 1VJWA 1FKPA 1WHXA 3ZTQA 2H4WB 3W2VB 1AUSL 4A46A 4YY3J 5DG9A 4DR5J 1JLCA 3SFUA 3OFGA 4FDFA 2QMUB 2KXNB 2MZSA 2B9YA 5KFRA 2JNJA 7FDRA 2IVYA 4DFPA 3DRYA 2R7VA 5HP1A 2HGLA 2V8PA 4F67A 3ILJA 3K57A 4AQYF 3NOCA 4JI8F 5GAEU 4DPUA 4Y0FA 2MZTA 4ZVHA 1B70B 3D0IE 4WK3A 4LBHA 3T1HF 5DDRC 2DEJA 1VBZA 1UW4A 4USJC 1ZTTA 2RQMA 3EJMA 1FXRA 4EYHB 2CQ1A 1XK8A 3B54A 2KG1A 2VV5A 3HLUA 2DYAA 4M5DA 4TY9A 1N5QA 1HBMA 4CLKA 5L46A 2BW2A 1CJVB 1RAAB 3DLJA 4ZVTB 5A0YB 2B8QA 2CWXA 4ZLPA 3OTDA 4PEOA 3OBIA 1AA1B 3GCXP 3GJQB 1U2FA 1B0VA 1TVRA 1SC3B 2ILYA 4EBCA 3PZPA 3RB0A 5D3GA 2DNQA 3SDEA 2KJWA 1EP4A 1ZM9A 4OHVA 5GMDA 2DGUA 2XMVA 1B0PA 1FXLA 2I5JA 3P45B 2ADBA 4AL6A 1DTTB 4ZIVA 2BW7A 1U1QA 3G4SS 3P8BB 1HD0A 2XULA 2E5HA 3FRYA 2KYXA 3AT1B 1CULA 1RBOB 1DAXA 1P9YA 4GO5X 4Y34A 2ZHBA 2ADCA 2UUAJ 4KTQA 2OH2A 1JNZB 2F4VF 3DRPB 2VH7A 3PEHA 1O51A 1QM9A 4J5OA 4LRBA 3SCIE 1NSPA 2DGWA 3E51A 3ET6A 3IGNA 2ZH7A 5GMEA 2OD6A 3PRBA 3A8IA 4CI0B 3QT5A 1KTQA 2GFFA 4FYWB 4RX6A 3D54A 3LH2S 3ZTSA 3M1VA 1OMSA 3LW5C 2AKWB 3BBFA 2YWEA 3N01A 4NLPA 2DGSA 4DV6J 3UDLA 2CIMA 2V2ZA 4IYQA 4K5RA 3KLVA 1TUVA 3RB6A 2EW9A 1CC7A 3Q24A 3DDKA 1F9EB 2JDJA 5D6GA 2E7XA 3KLEB 3BKTA 1L3VA 4FBTA 2DR6A 3OXLA 2Y1LB 4JI8J 1B7FA 2NQPA 3HX9A 1S1TA 2Z57B 3D0GE 3ZXWA 1NZ8A 2DIVA 3W2WA 4B3TJ 4B3SF 3BO4A 3BYRA 3OSNA 5KFEA 4C3MA 2IDEA 4JV5F 1VK3A 3DHXA 3O2IA 4F4WA 4KPCA 2CQPA 2K1RB 2RF2A 4NLDA 2HVDA 5KFMA 1RKJA 4AFFA 1A9NB 4ZK7M 1SV5B 2AGPA 3DOKA 4TNOA 4EI2A 4CO5A 2R9LA 2YNGA 1KQFB 3R8YA 2DB1A 4USKA 2PN6A 4LF7J 4HH0A 1RTDA 3CDUA 5IWAF 1ZH5A 1LV5A 1IBMF 1NK4A 5HMXA 3HI9A 2ZHAA 1R0CB 2FLLA 3W64A 2FVCA 5DGBA 4DL2A 3NNHA 4K4ZA 1WF2A 2ZE2A 2F1FA 2MHNA 2WVBA 3R5JB 4HACA 1RSCA 4O3NA 2PFDA 4CO2A 4QWAA 3A8EA 1RAEB 4RL1A 3T9ZA 2RQCA 2MQNA 4HTIA 2OPQB 2W2OP 4YB6A 4ZLLA 3KJVA 2F65A 1VFJA 4UZBA 3UCUP 2OLWA 2WB4A 2YKAA 3CMAS 2B9XA 1ROFA 3BSOA 3CDWA 4NLTA 4UOGA 5DZ6A 3CPWR 2Q6BA 4B3MJ 3MEGA 4I69A 1H74A 2BJ3A 4CM0A 3G6VA 1HNZF 3OVSA 5FLXU 3Q8RB 2G2YA 3BR9A 1GMUA 4FP9A 5CABA 1OQ3A 1SL0A 5HMYA 1K44A 3ZZYA 4F4ZA 1RWKB 3M4XA 2V8HA 3AD7C 1FD2A 4WIQA 4YP3A 3TUJC 1VRTB 5KFFA 3PO5A 1NHKL 2MZQA 3CJ3A 2EC2A 2VD3A 1F5BA 2ZHOA 3MPDA 2Z2ZA 4MT1A 3CCVS 2OHDA 2V8GA 2NYIA 2DXEA 1XJWB 2NPIA 3FUYA 2PFFB 1RT1A 4NLYA 1R27B 4WTYA 4KSEB 5E0OA 4P6QA 2XC9A 4IKAA 4JI2F 4J9PA 1RT4A 1I5OB 1YRUA 4Z7CA 1FHTA 3D3BJ 4OYXA 4O23A 5BR8F 1RB0A 3H0PA 5LT5A 4X4RA 3TX0A 3JYTA 2J6UA 2WHOA 4DXLA 5KFDA 2HIYA 4AQYJ 1BE4A 2W25A 2V6AA 4FXWA 1QAIA 3LP0B 3GIRA 3K17A 4RUBA 1ZAWA 5K5MA 1UKUA 3HZGA 4XTTA 1S7IA 1KVJA 2RAQA 1UPMB 1YWXA 2CZ9A 2LVWA 3AA9A 5L1JA 1WEXA 1VR6A 2XWXA 5I4MA 3DXSX 3HFVA 5HMZA 1WEYA 3I0SA 1R6VA 2JLGA 3C3LA 1SH0A 1CBKA 3CMQA 3QFHA 3KNGA 2DVIA 1Q78A 1RAGB 3W9IA 2AJQA 2BJ9A 3FFIB 1N54B 3PW7A 5F3TA 3AOCA 4EWTA 2OSRA 4WFNQ 3MEDB 2XO7A 4WZQA 2XG8A 2P5VA 4GMKA 4JB8B 2IJNA 2PE8A 5DDQC 5HAOA 2R4FA 4X4VA 1LK7A 2AIRB 2V9KA 3BSAA 3M30A 4NYPA 4CLYA 5D8HB 4TVAB 3M8PB 2CAJA 4F0HA 1JLEB 1Y5NB 1T05B 4R8UB 3E2EA 2HIQA 1SPBP 5GAHU 4DV7F 4F50A 4GC7A 1FNXH 1FKAF 2G0JA 1TR0A 1JJCB 1PJ6A 3AJ2A 2YVSA 3M2UB 1U02A 4QIFA 2ZNZA 4NRTA 3JSMB 1KD1T 1U8WA 4FNIA 2LA4A 4DN0A 2QMXA 3M6XA 3IWLA 4C11B 4ECZA 1NJIT 2Q66A 4X4OA 1PGZA 2I9SA 1VDHA 2XI2A 4YQWA 4ZPBA 4CNZA 3QNWB 5KFWA 3GV7B 1FO1A 1C0UA 1VC5A 1VQYA 4YR3A 1RYSA 1D0EA 1SUQB 4KE5A 5KOXA 1JLQA 3JSMA 4DMZA 4LFAJ 4ED7A 4IO9Q 2DGQA 4M94A 3DLEB 2KXFA 3BBBA 1S1WA 2BDPA 3GQCA 4WYLA 4WFYA 2W4PA 3MPWA 3MMCA 3GFZA 3H59A 3RAQA 1TQLA 2WOMB 4DSIA 5HROA 2NSBA 1WOPA 5F8MA 4MKYA 4IQMA 1IKXA 1M5VC 3DOLA 3VGVA 2NXJA 1IJEB 4WJBA 1YX2A 4BBYA 1NZAA 3SEOA 1VRQC 2MQLA 2XNQA 4ZPTR 4Y6IA 2W8KA 1EIYB 2KB2A 5AE3A 2CJQA 2ACYA 5RUBA 1XTZA 1AUDA 5HL7Q 4B9TA 4F2RA 1VOMA 4NLWA 2E9RX 4GKJJ 1LQ9A 3A12A 1IKYB 3OR1B 4N8NA 5F0WA 4ICLA 1F2GA 4R5PA 3SFGA 1IQTA 3C16A 4ZVQB 3OL6A 3QO9B 4W98A 5K14A 2Z2LA 1RAHB 4ZPVR 2L3MA 2P6SA 5F3ZA 2MKIA 2UXBJ 1DQAA 2DEIA 2VKRA 1XR5A 3MM9A 5HANA 1JXLA 1Y10A 2OD4A 1APSA 3T5LA 2M52A 4FKXA 1Y5LB 4RBVA 1RT1B 2KI2A 2VG5B 3DRRA 3PR5B 3H25A 2DNOA 4AD6A 1FX4A 4ZP8A 5EX3A 5CQGA 1IR2A 1N5SA 2FJAB 5A6WA 1HYSB 1SL1A 4B3SJ 2DNNA 3A3PB 2LKZA 4D3HA 3IG1A 1S4FA 1G7CB 3PW0A 1IBLF 1QE1A 3ISND 2J8SA 3FMBA 4PG4A 3M9NB 5J2NB 5KFUA 5IT9U 3KLFB 4ZP9A 1N34F 5K8NA 4XPEA 1RABB 4X64J 1RUSA 1VHIA 4I68A 1HW8A 4P2XA 4I6AA 1RT3B 5KFLA 3EM1A 1FJGF 4OYIA 4TN2A 1YVFA 2YQ3A 4NLGA 5KT5A 2EXUA 3JQJA 3BJYA 4ZPAA 1FESA 1IM4A 2M0GB 1Q86T 3DLBA 4CLTA 4B9SA 1NPKA 2C42A 4IH5A 3GU0A 4IG0A 4XPCA 1S97A 2D1CA 2X51A 4J91A 1N8RT 1K0VA 4J9OA 1BLUA 1LWCA 3CWJA 1TFYA 2PD1A 2LMIA 3AFGA 3MR7A 2DGOA 4H54A 3UCGA 1TV6A 3QSIA 4NE9C 1RDRA 4K7QA 5AT1B 1OY8A 2D3OR 1H6KX 4B3OB 3L3CA 2IYIA 3CIZA 1A6LA 2DNYA 3L7PA 2VUGA 1UWAA 1B4SA 4QW8A 4BWMA 2UXBF 5IFMA 1VRTA 3UNGC 2XMMA 2DPIA 3FSYA 3B78A 2HMIA 1FWPA 4DLGA 1Q8LA 4NCAA 4MK8A 1RQ0A 1RAIB 2RJZA 3OT9A 4DBQA 4F3MA 5A76A 4DV6F 2B6AB 5EGYA 2RE1A 2NCKL 5SUHA 2ZBPA 3BQ2A 2HHWA 4A8WA 1NHUA 3EZUA 4JP8A 2FHJA 2HGMA 3J7Z5 4OI6A 3HHLC 3PTWA 2M2BA 1H72C 1BMQB 5LOQA 4AXJA 3MR3A 4UY85 4QYZJ 2GJ2A 2AZ1A 2J7KA 4OI1A 3UN3A 4ECYA 2XYHB 3W3SA 4HKQA 2M88A 3G2XA 1QVFR 3QAUA 1KC8T 1QAJA 2ZUAA 2YH0A 2B4UA 2BJDA 3S8SA 4XO0A 1FNOA 2YNIB 1M5HA 1V9OA 4ZVGA 1BWEA 2QLBB 2JRSA 1UJ6A 1GAOA 4YB5A 3J81U 4DR6F 2R7XA 4P9SA 3ZZUA 3H4DA 1U7LA 2K7JA 2QRRA 2OAUA 3MAHA 4UOCA 1U6BA 1P1TA 2ZD1B 1H98A 3CVKA 3GB0A 4J9KA 5JXSA 1QTNB 1T9YA 4LSZB 2HNZA 3BKUA 3ADAC 3BO2A 4RW6B 4Q0BA 3AQOA 3NG8A 1XERA 4OZJA 1FJCA 5F8GA 2DCLA 5IWAJ 1SJFA 4PUOB 3HVTA 3QZ7A 1IN0A 4JBCA 3H4BA 2IDLA 2W1BA 3MM6A 4KR0B 2M7SA 4MKVA 1JLBB 5E41A 4DV1J 3PVXA 4XDCA 3CE8A 1IUJA 1TKXA 2OJ3A 1OWXA 1GQEA 5FLXY 1NH7A 1WKKA 3C16B 4HDGA 3FK4A 5GAHI 3I5AA 1G6BA 3HFKA 3TNVA 4X66J 1H0HB 1ICEB 1LFWA 2V4JB 4OLPA 4QOTA 3G6YA 2UXDJ 1VGYA 4G3IA 4FF2A 1TL3B 2NXNA 1TL7A 3HFZB 2JJ4D 3DLKB 5A8KA 1HNIB 4KY3A 4A8QA 1KHWA 4C2MA 1FE4A 1TK0A 1HWJA 3THPA 1RISA 3MUMP 1S1VB 2BQ3A 1SKSA 3C2PA 3D5MA 2GIFA 1YZ7A 3MDFA 2OSQA 2GZOA 3NS7B 3JTPA 4ZLNA 4IRCA 1ZS6A 1FEHA 4I6YA 4AT1B 2HWHA 3MMCB 3R1HA 4URQU 1IKWA 5DLFA 1MG7A 5B08A 3UW1A 2RD5C 1H73A 1S59A 2XHCA 3CJ5A 1CJKA 4UW2A 3PRVA 1O5JA 3TX8A 4U95A 3MR2A 3K58A 4P2MA 4TQRA 5ADZA 3Q22A 2NR0A 4K4UA 2D3ZA 3DCAA 3RUBL 5KT2A 2DR5A 3T5HA 1WTBA 3KHLA 2VF3A 3CJSA 4OX9J 4Y2AA 2X1FA 1RACB 2E29A 1EHWA 1FRXA 4PR6A 1IKWB 2PO4A 3C19A 2W2PP 3R3TA 4O3QA 4C97A 2HQGA 4ECXA 1VQ9S 2F8MA 3QFWA 3D6HB 1LEOA 4Z7YA 4P2FA 1C0TA 3QWPA 4LF8F 3OXFA 2B9WA 5A8WA 4B3TF 3M2UA 4DR4F 3OSPA 2VPWB 2W2MP 1NKEA 3MEEB 4MIWA 4Q5VA 2XGQA 4RNOA 2ZH8A 2AEMA 2BJ8A 2BZ2A 3M8RA 1A0OB 2YWFA 2VFRA 2XWYA 2YKMA 4KQZA 5CXTA 2QSFA 3HHLA 3P5TL 3CO9A 2H65B 4KC5A 2QSWA 2OTLS 3BPDA 4LF2A 5ETLA 4O3SA 3EGZA 4F04B 3HSJA 3N5BA 3N79A 2HRUA 4IFVA 5H9EJ 1DRZA 3I6PA 4NL5A 4YB1P 3QZ8A 3H5XA 1RTJB 2GIRA 2CVIA 3LPEA 2V67A 3FBBA 4J37A 2P9EA 3RRKA 4LVNP 3U02A 5IM0B 5BYRA 4DQRA 3BGRA 1KBRA 3D0HE 3CJ4A 2V2KA 2UXDF 4ZA1A 4LF6F 2HS3A 4DL7A 4C9DA 4QCLA 4RJVA 3KG0A 3KG1A 3J7ZT 3OTOJ 3H40A 3D1OA 1RT7A 2OPPA 2B4VA 2HFZA 5ITHA 3C14B 3QMQA 5A0YA 2D69A 4QBUA 4CYUB 3V81A 4MFBA 2CJ9A 4TKTA 1GXLA 5IQQA 3NNAA 5DM7Q 3W5ZA 2DTJA 2OFGX 1N32F 1XR6A 2JOQA 3NBPA 3PKMA 1PJ7A 2CQ2A 3I87A 4I6WA 3QPIA 1FRMA 3RAMA 2I38A 2HVZA 1RLCL 2RRBA 3UQSA 3VZHA 2GVDA 1VK8A 1NJYA 2BE9B 5HBMB 4A8MP 4M5KA 2A6MA 3HSZA 1N6QA 1U26A 2L9WA 5F8NA 2C3YA 1UZDA 5C7PA 3D9BA 3QJLA 3PR4A 2KFNA 1FVSA 2HHSA 1WOSA 2F63A 2MY8A 4LREA 4RKUC 2W9BB 3QJPA 1M5SA 2Q6CA 3MOZA 4OJGA 3VAGA 1FDAA 5AXMA 2HS0A 5C2GA 2ROPA 3VHQA 4EMDA 4C98A 5CAAA 3H5SA 2B6AA 1JLCB 2EFQA 1MWZA 2K8GA 2LXIA 2OPQA 2DGVA 4KH1B 4CLPA 4ITSA 3TZYA 5GMKa 2ZM6J 3K59A 2KHDA 4FS1A 2WCXA 1UVKA 3PV8A 1S4EA 1PYTA 1WDDA 4A8OA 2QA4S 2HHVA 3CGIA 2HQCA 3J80Y 2ABYA 2GJIA 4DOZA 4ILMA 1YJUA 4P75A 3KJVB 3PW4A 3CD0A 2AW0A 4OZ5A 5KFHA 3NNCA 4C4WA 2W9CA 4DSFA 1UVIA 3BF4A 5C25A 4I64A 4FPRA 2VIHA 2CYYA 1K1SA 2LYVA 1T3OA 1V3RA 4PQUA 4DUTA 3IO1A 4TLQA 3IS9B 8AT1B 1E6VA 4WKRA 3I5CA 2NXEA 1Q8KA 1S5ZA 4ECSA 1VQ7S 3HSGA 3NAHA 1YGYA 1HARA 4OMFG 3O8WA 5HATA 1RTZA 1RHQB 3MGJA 1M5OC 2GHPA 4QYZK 2CVEA 4DV4J 2YNGB 3K7RA 4NRUA 3A4TA 5E2QA 2IA6A 4W4MA 4KRWA 5B0EA 3W2VA 2MKHA 4LRDA 4LT6A 4QIEA 1Y11A 2RS8A 3BV8A 2RUSA 1OSDA 3NWRA 3HM9A 1NK7A 1YZ6A 2V94A 2Y0BB 4DR2J 4NXNF 1GK8A 2E66A 2ZOFA 1X8DA 3EX7B 5L39A 2R2UA 4F2SA 1VBKA 3HO1A 1RTHB 1RBAA 3MECB 4JV0A 1HW9A 2PI4A 3GMGA 1ELOA 4ZS6A 1LFPA 2AP6A 2LXFA 3IR7B 4C48A 3CULA 1QE1B 2LLZA 2YQ0A 1RTIB 5AXKA 5DQGA 2ZDPA 3HHDA 4CO1A 2DGTA 4KKOB 2W01A 4WIIA 2N7CA 5KT6A 2EWHA 4AUKA 3HT3A 2RSQA 2R8JA 3V6DA 4ZMMA 3JAMU 4DV5F 4BC7A 4AXIA 3BGLA 4EYIB 4KT0C 1M1KT 1KKHA 3SCJE 5H9FJ 3D2WA 1RYRA 4F4YA 4UZCA 4OYAA 4DPXA 4ECVA 4ALZA 1SC6A 3ONQA 2DNMA 4WFBQ 2J0XA 1KP6A 3JSRA 4JI3F 2CZVC 1YKWA 1QD1A 1TKZA 2CNOB 2V4RA 2Z56B 3KKFA 1UFKA 4QIVA 1J5OA 3K2YA 2XBPA 2V0NA 2KO1A 2RQKA 2MQOA 3SI8A 2FHJD 2ZD1A 1UZHA 3MM8B 3NS5A 2FUG9 4MYTA 5KFVA 2A2CA 3IRWP 2ASYA 2E5LF 3G82B 2X1AA 1DFDA 3IM8A 1NPPA 4ED0A 4C0OC 4IQXA 3GJSB 1OY6A 3TUIC 5MAOA 2CJKA 3CTRA 2R3VA 4G65A 3P6YC 1NDCA 4I67A 1WSVA 4HTJA 4OFZA 4JI1F 3PX6A 2KVQE 5HJYA 1HQ2A 1NDLA 3EWGA 5KG6A 2GGPA 3GLJA 4PXBA 3KJNB 4TYBA 4M5DB 4Q8FA 2QL7B 1C0TB 1YJVA 2C3OA 3L09A 4P2SA 3A3NB 4ZJLA 5J1EA 4A8YA 1M5KC 3NRBA 1Q7LB 1K9MT 3NLCA 4KGZB 4ZCKA 1ZZFA 1C1BB 2V2QA 3AOAA 3QAEA 5KFZA 4LRCA 4MIAA 2QZ8A 3L95X 3VV2B 5A2QU 1OY9A 4F4KA 3TARA 4OL8A 5HSPA 1WTFA 4JUZA 5GAEI 3B4MA 2OI2A 5CD4A 1T95A 2ZH6A 2FPHX 4N7TA 2BANA 1FKPB 1LWFA 2M9KA 2YQ1A 1WG1A 2M8HA 2AWZA 2QE5A 3EGVA 3AA8A 4X64F 3BQ1A 1HNWF 4B9LA 4ZHRB 1IR1A 3TQEA 2JL9A 2Z2MA 3O44A 3KHGA 5H9EK 1JB0C 1GMVA 3JS9A 3I4HX 2CQ0A 1UTAA 4WU2A 4OYZA 1E6VB 1U4BA 1NB7A 1SQEA 2CUYA 3P5BP 4DHVA 3LP2A 2UXCJ 3BR8A 2ATCB 2HQIA 3U1MA 2K3IA 1MLAA 1X4CA 2VPYB 3FZ2A 1C4CA 4G1IA 2MLZA 1EB0A 3NS6A 1KVKA 4ZVFA 3SCLE 3VZIA 1YK9A 4TYAA 3EDQB 2RVJA 4ED6A 3AJ1A 3LP1B 4RR5A 1UCNA 4R0JA 1RHUB 3VAIA 3D1QA 4WKYA 2E5JA 2GMHA 1R8HA 3KWMA 3I0SB 1VQNS 4FN5A 3D68A 1PO6A 1RT2A 2F40A 4YN3B 2C2ZB 3J7YI 3KUHA 4O44A 2BKNA 1NSAA 4FZVA 4BWJA 2PSZA 2YNFA 3QYYA 3TUZC 1R8PA 5D4LA 1JLGB 2ZZTA 3K8WA 3U7JA 4HHHA 3KMSA 3G8TA 3TI0A 2CPEA 2KXHA 2VC0A 2VFSA 1X5OA 1VQPS 4KV8A 3CC4S 3Q2TC 2R7SA 2BRLA 3RBZA 3VALA 4M5JA 4NLRA 2HYIB 1O6XA 2VOOA 2ZE2B 2PEHA 1OPIA 3DLGA 4TQSA 1JJ2R 3VAJA 4F4AA 1CS4B 3FSXA 1F6TA 4I2PB 4O0NA 4ZCLA 3C6TB 4KO0B 1FDBA 4RUAA 3WIVA 2YNHA 3SSRA 1S57A 2X7IA 1CJUA 2H48B 3CJQA 3EE3A 2H54B 3N0VA 4ID8A 5HK4A 3I56S 3KK1B 2UXCF 2WK4A 5M2PA 3V4IA 2IM2A 3EXCX 2C1EB 5CA5A 2XMAA 2BR0A 4TY8B 2QN6B 3SZ2A 2KRBA 3D4JA 3PO4A 2XY6A 4LFBJ 2ZVIA 4NYZA 3TA1A 4Y2IA 3THTA 4YHHJ 2KT5A 1UMJA 2F5GA 3OJSA 1HR0F 3H2VE 3BZQA 1WI8A 4LR9A 3IN5A 2C2RA 3IMQJ 1XN9A 3FZBA 3LOUA 1VC6A 1HPZA 3LGHA 2WB1D 1WELA 4RW7A 5E5NA 5E3CA 3KOAA 1VRUB 3OL9A 2KN4A 2BOAA 1NMEB 1UJ4A 4X2BA 2HQDA 1CPZA 3L4BC 2RKIA 1XMQJ 3CCLS 2V63A 1GX5A 1I3OB 3HHNB 4OHYA 1NBEB 3OTOF 2YPZA 4GKJF 3KK3B 1J27A 4HI2A 1U48A 4CH1A 3OHAA 2BM0A 2HFUA 2LEPA 3C14A 2VA2A 3NL0A 1W26A 3CCUS 4M8LA 2AV5A 1U1MA 1S6UA 3LAMA 3PFOA 2XQCA 1QTMA 4PABA 5HJXA 2XGPA 3R2CJ 2NZ4A 3LP1A 4QU6A 1Z4UA 1RT5B 3MMBB 4F0MA 1RA7A 4EK2A 4F02A 4JI4J 3PHEA 3FCHA 3UDEA 3ZZTA 4DPTA 2KZMA 3KMQA 2L41A 1GX6A 1P9QC 1BQXA 2XZDB 1YLXA 4WF9Q 4RW9B 2QMWA 5HMWA 2IM1A 3IAS9 2ACMA 1B64A 2VA3A 2CPHA 5LJ5Y 3BM7A 1SJ3P 2APOA 2V8VA 3M30B 2HGNA 1RCOB 4P72A 2QFJA 2OMOA 3IG1B 2PMZD 2R8IA 4K4TA 1LWFB 4ZVPB 1X9SA 2GVDB 2HNYB 3MEDA 4EFAC 2UZAA 2CWKA 4Q45A 2FJBB 2B7BB 4KGMA 4DR1F 4JV5J 4U67Q 4YR2A 2QLWA 2OGUA 4OX8A 5CD4H 4KPYA 4B3RF 5KFIA 4Q8EA 1LWEB 4YHHF 3UNYA 1Q95G 3G82A 3KJQB 1X0PA 2XMKA 1F0XA 4P71A 5FD1A 3O5TB 1FRJA 1UP1A 4NYOA 4OJ3A 3UE2A 4LF4F 1HI8A 1QUPA 1X5PA 4G1QB 4KBIA 4YB7A 4Q2LA 2QG9B 4CO0A 5F8IA 5K14B 4DL6A 1S0VA 4LSLB 5D4PA 4ZN1A 3RGIA 4DUZJ 2YXLA 1HBNB 3M2RB 2FC9A 5D0GA 1S6OA 5IC4B 4ELVA 2IJFA 2XLKA 3A13A 4ERDA 5L1LA 1U2RA 1Q8BA 2AYMA 3CDBA 2GNKA 3R7NB 2I1RA 4YOEA 1IQZA 1HD1A 2WOMA 1JLFB 1AROP 2GQ2A 4FKYA 4ZCIA 1UA1A 3ILLA 1OYDA 4LBPA 1YQHA 1CC8A 4CLSA 2DY1A 4EUVA 3CJKA 1U1LA 5SZTA 1LW0A 2A18A 3DLEA 3LAKA 3RBXA 1XQIA 2I0XA 2GC8A 1FRKA 2WZ1A 2CG8A 1P8GA 4ELUA 3K5LA 1CLFA 1WHWA 5HROB 4DFMA 1X5SA 2GV1A 2R7TA 1WHVA 2W24A 1XNQJ 3PM9A 2OPRA 4X84A 3SBMA 3T1HJ 1F60B 1HBUB 4DL0C 2MB0B 1ZTWA 3DRSB 4DR1J 2H3EB 2P2CB 5G0RB 2C22A 4ES3A 3EICA 4UTGA 4WE1B 3KHRA 1RT3A 1ZYQA 4WCEQ 4DX6A 1LW2B 4MIBA 4B3OA 3WDOA 3NKYA 4JV2A 4YDDB 2XB2D 4GKKF 2CJAA 1DBDA 2YTCA 3OPKA 2GJFA 2CPYA 2YWWA 4DU8A 2W8LA 2AU0A 2R8KA 1N5YA 4C8OA 3QWUA 1TK5A 2QLXA 2ZEJA 1UPPA 2ZH9A 3JXOA 3E01A 3WHIA 2ZH3A 5EX0A 1FKOB 1U1RA 1CG2A 4DV1F 3JB9k 3JQMA 2KH9A 4B3MF 1ZM3A 3HHKA 2W7OA 3D6FB 4QR0A 3FNNA 1KNZA 3FEYB 4CYUA 3AY0A 1XMOJ 4MJKA 3QJJA 4USMA 3ETMA 2DO4A 3D3CJ 3UDVA 1IBKJ 4DUZF 2M5YA 1NUEA 2E7WA 3KLIB 3QT6A 3CO0P 1S6QB 1RHKB 2EKNA 1WJ9A 2A10A 1R6YA 1TELA 2QFIA 3CCZA 4RW8B 3SMZA 3N6LA 4C3KA 1JLBA 2LQBA 1RAJA 2B0GA 4U8VA 4B9NA 1TKXB 3HSDA 3ZTOA 1K73T 4WP3A 1N32J 2XMJA 4EU0A 4C8NA 2BV3A 5DO2A 5AXLA 3LANA 1REVB 3WZ0A 3EPGA 3ZZ0A 4R0EA 1M5PC 2YKMB 2ERRA 1NJXA 1M1GA 3QRQA 1UJ5A 2C28A 1YBTA 5HLFB 4DSKA 2R8GA 1R3NA 3MFHA 3C15B 2QV6A 1D1UA 4ZPDA 1CQMA 3ISZA 2WTFA 1BQNB 1HWKA 5KFBA 1R31A 4QU7A 1HQEA 1RP5A 2L48A 3DFEA 4NLOA 2XMTA 4MK9A 1X5TA 2ZZNA 1U24A 3DU6A 4Y28C 4ZVEA 5F8HA 3MUTP 2DRBA 4D3GA 3FSIA 2MEWA 4EO8A 5IT4A 1JLQB 2BABA 3AB2B 1N48A 2EFNA 4O4RA 4USHA 2BOPA 1C1BA 4WU3A 1HI1A 5E3RA 5LMUF 4RLEA 4FF4A 1S10A 5MLCV 3PYDA 2BUNA 1RT6A 3BB5A 3QGPA 1WKLA 4LUBA 4LR8A 4DS4A 3VGTA 2LQ5A 1W7WA 2FGOA 1U1NA 3QSYB 1IBLJ 2UP1A 2Y8YA 3DC2A 3MEGB 2CPFA 1YIJS 4LIRA 4UUXA 4KJIA 3KK1A 3US5A 2VBXA 1VISA 3PKYA 2UU9J 1IKYA 1SJQA 2HQ3A 3TYTA 3IS9A 1FVQA 1SCJB 1O8BA 4C6AA 3DLKA 3W65A 5A8KB 2IAJB 3MWBA 4NOHA 3KDOA 1YG0A 4IOCQ 2FLPA 1CQNA 5K8PA 2P9GA 3DMJA 3M8YA 2QLJB 4NLSA 5J2QA 2NYHA 3OLAA 2XTJP 3UPFA 1U1PA 2IMOA 1W2BR 4DSJA 2H5JB 4XDDA 2K3KA 1LWCB 1HLWA 3OTBA 1J2VA 4CT8A 1RTDB 3OVAA 4K0KF 2B51A 2ALYB 3CD5A 4OI0A 4DZ6A 4NMXA 3AXMA 1L3KA 3HVTB 1K8AT 1SV5A 3P96A 2QGFB 1KQGB 2J6SA 1UFWA 4EZ9A 4PRFA 1WC0A 1KQSR 3CCTA 2VBWA 2FTRA 3TVKA 1P6TA 4LF8J 4XK8C 4C8LA 5KOWA 3DDNA 3H5YA 1TMMA 1LWEA 2CDRB 2XS2A 1XMBA 1Y4ZB 1PILA 4I2QB 5CZVA 2YWKA 4DQQA 1GNKA 2MLYA 1WC3A 1LNQA 2OKQA 3R6GB 1BQMB 2EC0A 4LQ9A 4MH8A 3TA0A 3GV5B 4DZDA 4A8SA 4NZ6A 2YWHA 3R1LA 2QJ3A 4CCHA 2HHUA 2RU9A 1S1VA 1O0PA 2P8IA 3SQGB 2CPZA 4J9VA 5A8RB 2XLIA 1EKRA 1S9EB 1P27B 1FJGJ 2ZJPQ 3E01B 4QYRA 4ED1A 1S9GA 4NLXA 2VOPA 2J5AA 2VDIA 2W2QP 5J2PB 3M8PA 2BRKA 2H9ZA 1S1UB 3NOGA 1JX4A 2R2TA 3VAFA 2MJUA 1DTTA 2HNDA 1SJ1A 4LF1A 5HQLA 2D41A 2IHR1 2QYCA 3GG1A 3HULA 1TKTB 3DKDA 3D7SB 3ICLA 2R2RA 1S1XB 1RTHA 2BJ1A 2UVRA 2C2OB 1DLOB 1KOHA 2OEKA 2PIIA 3CNQP 4P7VA 5ETSA 1T9XA 4H4MA 3P49B 4DG1A 3J81j 3JSYA 4M5GA 2ZJRQ 4IOAQ 1KONA
chains in the Genus database with same CATH topology
5FJ4A 1QY7A 3F41A 1T94A 2KRRA 2Q43A 4XAKA 4RNHA 2RILA 5AJ3F 3K0JA 6FDRA 3V6DB 2J9CA 3MHYA 5U47A 4JI0F 2LA6A 3IRXA 3GSDA 5L1IA 4B9VA 3JTOA 4C7QA 5BYSA 2QO3A 2YX1A 2E1CA 3MMAA 4QWCA 5K9FA 3LGNA 2ZH4A 4OX7A 4Y65A 5HN0A 2YNIA 4F26A 3VQTA 2JEGA 2OMLA 3RRGA 2V4QA 5E7OB 3OLBA 5DGAA 2FVRA 3MM8A 1CEZA 2MQMA 4A4JA 5T7LA 3PIPQ 3MD1A 2VONA 3SSSA 1FRIA 1M0SA 2JZ5A 2XNRA 3GIIA 1HNVA 3MM7A 2VODA 2IYGA 2XCPA 3GG0A 3HXMA 2XSJB 4IG3B 4RU9A 1RKIA 3SV4A 5B0DA 3OL7A 2AYGA 2PGCA 2M3DA 4U7CA 2G4BA 1DQ8A 1MROA 1HBUA 1R8BA 4OLOA 1NRKA 5HLFA 1U6ZA 3M05A 2VG5A 5B0GA 1NK5A 2QIFA 4IR9A 1DARA 1QLNA 4NA3A 2W9CB 4H4OB 3H20A 3RBEA 2I2YA 4LSNA 5DQHA 1Y3KA 3UI3A 3FFIA 3THVA 4ETZA 2D9PA 5CYQB 1FDDA 3M6VA 2BQUA 4UQGA 1T8EA 4KGKA 3VF0B 2RB7A 2RS2A 2K1RA 2RF2B 2MHEA 3N28A 4NX9A 4OZNA 3KLHA 3HVRA 4EEYA 2FJEB 5LXYA 2EK6A 3SCKE 2DCUB 1U25A 2DNHA 3OFFA 3KLFA 2DITA 2IC3A 4ILRA 1TVRB 4N41A 4LJMA 2KM8C 2VQEF 3WC2A 2HHQA 3DOMA 4TXSA 3BDEA 5B0BA 6FD1A 4RNNA 3R27A 3RYLA 3R5DA 1NKBA 3IGVA 3M32A 3CCQS 4I4BA 2R2SA 2B56A 2KZZA 1FK9A 2L9DA 2Z4PA 1HPZB 2UUCF 2HZCA 5E3AA 4Y2MA 2CRLA 1NJZA 1N52B 4J9SA 1JMTA 1QSLA 1T02A 3OTCA 1KHVA 2DD8S 1OIAA 5E3PA 3TAPA 3E8OA 1S49A 1YRTA 3MM9B 3QIPA 4HEA9 4MK7A 5J2MB 2XZWA 3H5UA 3IR5B 2HG4A 4NLUA 5J1EB 4DUYF 3M6UA 3FJ2A 1TL1A 2J0QD 5THWA 3NNHA 5EWGA 3EPIA 1H2UX 2EK1A 5K8MA 2O67A 1NK9A 4V19J 2DRAA 3Q0AA 2CQHA 1DTQB 1UETA 3MFIA 1W25A 1YJTA 3R5CA 3T6JA 5EHHA 4B08A 2WRMA 2HVIA 3M2VB 5CYMA 2KYZA 4ECTA 4I7FA 4R8UA 2IMWP 1F5CA 2QA2A 4U9RA 1HA1A 3DM2B 5BJRA 5KAKA 1J5EF 1N88A 5C42B 2MPUA 5DG7A 2CQIA 1IKVA 3CB4A 1S77D 3GYXB 1KEKA 4IH6A 1L3UA 3OR1A 1VMBA 3D28A 4Q2MA 2UVUA 1D9DA 3DOKB 3V81B 4M95A 2YNFB 1KOOA 1SUQA 2F9JA 2IRYA 2F8EX 1J5OB 1SB6A 1S1XA 1MSWD 2HWIA 4USIA 4YUDA 1WWHA 2FGCA 3B4DA 3I4PA 2C2EA 4TU7A 1GXTA 2HS4A 2XI3A 2VPZB 3QGGA 4U7UK 3G6XA 4DQRA 2O1PA 4I2PA 3BO3A 5M2UA 1FXDA 3QIDA 2J9DE 2Q79A 2U1AA 1F5AA 3MOJB 3KK2A 2HVHA 3ENQA 5DQIA 4ZOSA 3MR5A 3RW6A 2FLNA 3CD7A 4J9QA 1K0TA 2RU3A 2KTQA 2EFVA 5GAGI 1HNIA 1MW7A 4N47A 2FHMA 4IRKA 2VG6B 2AJFE 3UCZP 2O01C 3MECA 2AYBA 2Z8QA 1UVJA 2OPSA 2JFKA 2VFUA 5GVQA 2E5GA 2AJ4A 1VQSA 2X1GA 2ASJA 4CO3A 1FD8A 3KLHB 2B43A 3HHEA 3UD4P 4KFBB 4QR2A 3RB4A 2LXUA 4K4SA 3ETOA 1Q7YT 1OQ6A 1NAQA 2KKHA 2JC1A 3HKWA 2FHOB 2ZVSA 5EUHA 2DT9A 2WSFC 1ZZNA 1ULRA 4FVCA 4OIXA 5B0FA 3NWGA 1VQ5S 1H7XA 3DMJB 3UFCX 5I3UA 4RW7B 1IKXB 1U09A 2FDNA 2BE2B 3QLHB 3TW0A 3NMAA 1SH3A 3NP5A 2DNGA 5KFNA 3O3LA 4CH0S 3KFWX 4OX9F 2AQ4A 1JNRB 4WXWA 5DLGA 3H98A 2GIQA 1NKCA 1X4AA 3V5RA 2NXUA 3OXGA 5I3UB 4GKKF 2UV8A 2FLOA 3G8SA 2DGXA 1MWYA 1Q79A 1ZM2A 2ZKUA 5LJ3Y 3V4IB 1EETB 2Y0SD 2BVZA 3J7A1 2MZJA 3U27A 3LALA 4A8XA 4WXOA 4YFUA 4NXMF 1X7VA 3QIPB 2C3UA 5J2MA 2PI4A 2YWGA 4URSA 3KLIA 3KYLA 3T5JA 1BGXT 1S7HA 2VL1A 4B9UA 1I94F 2O5DA 1L5UA 2Q3PA 2XEXA 2KHCA 4LF5F 1Q8IA 2KJVA 3PEJA 3IXQA 2G1DA 2KVIA 1XEZA 3SQGA 1HHTP 4FYDA 3JTNA 2KDOA 2MJNA 3S01A 1JKHB 5B0CA 3KK2B 2EBGA 3I82A 3NBPB 2WONA 3T9NA 5C42A 3I9V9 1XMQF 2KU7A 1KN6A 3B82A 4FBUA 2ASLA 2M4MA 4UUWA 4ES2A 4DR2F 5LL6d 4A8KA 4DQPA 3RR8A 2DH7A 1X4FA 5KFJA 3HF5A 5F41A 1X9MA 4OJ1A 4HI1A 4CTAB 1R0AB 1KTVA 3DHWC 3RBDA 4PG6A 2F3JA 2RDJA 3HVAA 1DJ0A 3OTEA 3I0RB 2DHSA 2RUGA 2AYEA 1SI9A 1X4GA 1WG4A 2C3MA 2DNPA 2R7UA 3N4WA 4G1QA 4H4KA 3TVZA 2JLFA 2MKJA 4QWBA 5D3GB 4LSLA 1XC9A 1BD6A 1ZM4A 3ZZPA 5KT7A 2VQFF 3FMWA 4DR3F 3PX4A 1RWUA 5F9NA 3G9CA 4KIAA 4PQAA 4RW4A 3TOQA 1UA0A 5B0AA 3MURP 2JC0A 2V8DA 3IR6B 1D9AA 2ZM6F 3V6HA 4OZLA 2E1RA 5HP1B 4PWUA 2VC1A 5T14A 3VR1A 2OPPB 2NUHA 3FEXB 3HZEA 1UAWA 1LW2A 4JV1A 2IC3B 2MGZA 2JH3A 5CH7B 3CUNA 2DR9A 4C0HA 1N0VC 4E0DA 2HLUA 3LO3A 2IVMA 3T3FA 3G6ES 1S0NA 4QJVA 4WE1A 2GCFA 3NCPA 1LOUA 2MZRA 2FD2A 2I5JB 4PPDA 2LEBA 2ZFHA 2P6TA 2HHPA 5E3QA 4M63A 1X4HA 4JI4F 5AE2A 1C1CB 1GXUA 1AFIA 3SDEB 2RMLA 2HHHF 1L3TA 4HLBA 5J2NA 2RIJA 1FRHA 2V4JA 3BS9A 2W7PA 1MMNA 4YY3F 3PNIA 3FVYA 1LW0B 3EZ5A 1KLMA 2JWNA 2ZUGA 3PW5A 3UD3P 2IM0A 1N56A 1JLEA 3A1YG 5JVHQ 1S99A 1T05A 1VS3A 3IC1A 4I7FB 3BEGB 3I32A 2R8HA 2GA7A 3DRRB 2AX0A 5FDLB 2UUTA 2FJWA 2E44A 4LFCF 2IBOA 3QGHA 4X65F 3HP6A 5IXUA 4E98A 2J0SD 5D4NA 4CTAA 2EVZA 4KB7A 5A2QY 3CCWA 3OFEA 5F0UA 1DZ5A 4EZ6A 2CDQA 2MYFA 4Q43A 2ZNYA 2NUUG 2KM8B 3LP0A 4L72B 2GW8A 4X4NA 3PDNA 2Q1LA 3G8QA 1WACA 1Y3JA 1ZETA 1SL2A 4X4TA 2IA0A 1A7GE 4CZCA 4C8MA 1HMVA 3ISNC 3UR3C 3TRGA 4OJHA 3WC0A 5J2PA 2F7VA 3F44A 2LU2A 3KTQA 3OQ2A 3C6UB 4O4GB 2D7SA 2CPIA 1N5VA 5HBMA 3MTJA 1N6QB 1YJ9S 1NK6A 4FS2A 1HQEB 1JKHA 3CC7S 1VQOS 2BACA 5CHCB 2HPUA 4DR7F 3DRPA 2EG1A 2BQRA 4EO6A 4JI5F 2B3TB 1G3OA 3T1AA 2Y1IA 1QVGR 4Z2XA 4RW8A 5KFSA 1SJ4P 4NA1A 2ZOMA 5IM0A 3ENWA 4MAKA 2DNLA 2UVVA 1TFWA 1GTEA 3TP2A 2HW3A 1Q4RA 4NPOA 1HWUA 4FF3A 2CJBA 2R7OA 1SKRA 3CJ0A 2JEJA 2QEXS 1IJFB 2CPXA 2ASDA 4RNFA 1IKVB 4N8OA 4QPXA 2FVSA 4GO7X 3BN4A 2IFXA 2NPFA 3TAQA 3OJUA 2CQDA 1MMLA 1WF1A 4MYUA 5J2QB 3DOLB 2J9EA 3DM2A 4RWXA 1T03B 1K1QA 3T6BA 2PI5A 1S76D 2PDAA 2N82B 4B9MA 3J81Y 5JUMA 2VKZG 3BREA 1S72S 4DL3A 4ZHRA 2WBRA 3PIOQ 4PG5A 4X66F 5CZXA 1OSCA 1DURA 1NEEA 3FQLA 4MKBA 5KG1A 3C3LA 1RT6B 2A3JA 2ZC3A 3I5BA 4MKAA 3DYAB 4JI6F 2HFOA 2RQ4A 4ED3A 2J7UA 3DGPA 2CQGA 3H8YA 5GADI 3DN9A 1N5TA 1XWLA 2WSEC 1IBKF 4Z37A 3MTKA 2OPSB 1S9EA 3MZIA 3OV7A 1FF2A 1HYSA 2LEAA 2WAQD 4U6PA 1VQKS 4DF4A 2XS5A 4F4XA 5L8RC 4LVOP 1IR0A 1S1UA 4PXCA 2GMJA 2UU9F 1YTYA 2MQQA 4ILLA 2YX4A 4WFAQ 4IRDA 2BANB 2HWTA 3RW7A 4RW4B 1TP7A 4Y2CA 2COLA 3OR2B 1JK9B 5DS7A 4ECRA 4K4VA 1FJ7A 5T41A 2R7RA 1TL3A 2JLEA 1X0FA 3KG4A 2W7AA 3OW2R 2XLJA 2ROGA 3BDPA 1YSJA 2FJVA 1SIZA 2O3DA 2VFTA 3CSKA 3VAKA 4PG8A 1DLOA 4R5PB 4DSLA 4K5SA 1HWLA 3C66A 3K8VA 1S6QA 4WYWA 1U1KA 4E8UA 4DFKA 5KFAA 4X62F 2HLTA 2W4DA 1ZBTA 4ECUA 1KFSA 5F9LA 1H7WA 3MI7X 1D8ZA 4KKOA 1EP4B 5C25B 4IOBA 1Y00A 3VAHA 1FT8A 1OPZA 5A8RA 3G86A 2MY7A 2G0CA 5K8OA 3POTA 4NZ7A 5I42A 1SXLA 2YKPA 4DQIA 1X4DA 1C2PA 2ZKTA 4W92B 1JXEA 5KT3A 4TU8A 1KVIA 3GIKA 2NREA 2UUWA 1TZ0A 3UDCA 1V3ZA 1Y0HA 2E5IA 2GMLA 1RA6A 4ID5B 4DDFA 4URGA 1H38A 5DM6Q 3K5NA 2Z0GA 2E1AA 3GIJA 3OFHA 1FJEB 3V2UC 1NNDA 4IR1A 5FDLA 1T7PA 5DG8A 5H1SV 5AE1A 4NCBA 5JVGQ 1QAYA 5KFTA 1HFEL 4C3LA 1WG5A 4ES1A 3P3DA 5KG2A 3KLGB 1FRLA 1Z2ZA 3PACA 2YH1A 3OUYB 4ZPCA 3ZFVA 3C6UA 4O4GA 3HK2A 1R7IA 4PPZA 4ZP6A 1C1CA 1UWBA 2HHTA 4EGLA 2XY5A 3CXCR 4JI7F 4HYKA 4OHXA 1VIOA 1AXQA 5A6PA 2X3GA 3LF0A 3V6JA 3KHHA 5KG7A 2JVRA 4O0IA 2QA4G 5CYQA 2P9CA 1TKZB 3N6MA 3GWCA 1MNEA 3U1NA 2B7CB 1T3NA 3EYZA 4DLEA 4PUOA 3C6TA 1ZPWX 5LSOA 4CIOA 3MR6A 2ALZA 4O3RA 1S6PB 1I1GA 3DRXA 4DV2F 2RDIA 1LKZA 2DO0A 2LQ9A 3UR0A 5E33A 3MMAB 4KO0A 1UVMA 4FXDA 4TLRA 4NMLA 3LWLA 2H5EA 4UQTA 3T1YF 2AD9A 4ATNA 3BSNA 5BYQA 5KTQA 4KHPF 2W4CA 1GT8A 3TR5A 4P7TA 3GZ7A 4DJBA 3NAIA 1SKWA 1HMVB 2A2DA 2DIUA 5FIIA 2IRXA 2GO8A 2DHAA 3RTVA 1HQUA 3VCDA 4DS5A 1S0MA 2FB0A 2R7QA 1QSYA 1HL6A 1SJRA 2OPRB 3PY8A 2ZH5A 2VBZA 3GR0A 3R5AA 2CQ3A 1UL3A 1I6JA 7FD1A 3MEEA 2B4OA 1S0OA 4RUCA 1Y7PA 1YI2S 1HBMB 4NLQA 1E6YA 1Q16B 2BXJA 3R5BA 4X4PA 1MROB 3MPYA 2CQ4A 5C24B 5KFPA 4OI3A 2J0WA 1YJWS 4OI4A 4CT9A 3PJXA 3CJKB 3RZAA 4CO4A 2GO9A 4I2QA 3VWSA 4HHJA 3MMJA 4HL9A 4OQJA 3KLEA 2ILZA 5KG5A 3JAMY 1WHYA 2RH3A 5GAGU 3DNCA 2VBYA 4PKDB 4M1KA 3PXGa 2HNDB 3CCJS 5GADU 1VQMS 2YX7A 3ZZOA 2HAIA 1JIHA 3BSCA 3ENVA 1U47A 1TK8A 3DRSA 1JLAA 4RBUA 3JSBA 4KHRA 4PXEA 1ZPVA 4R25A 3GIMA 2HNYA 4F25A 5F8JA 4JOUA 4J9RA 3DI6B 4B02A 3I55S 2MXYA 3M1VB 3C8YA 2UVWA 2UUAF 4A8FA 3M9OB 1FK9B 4C0BA 3S7RA 4DV4F 1VBYA 3M6WA 1REVA 3W7BA 1C4AA 3DU5A 2J76E 3IFEA 4QWDA 2DJWA 3CCMS 2J9DA 2FVPA 4G6VB 2M70A 1PC5A 5B7WA 2UUBF 1S9FA 5L9NA 1VBXA 5IT9Y 4HT5A 5KFQA 3NGDA 4AL7A 3TA2A 4ELTA 5KG4A 3W2WB 2BJEA 1YRXA 3OR2A 4RW9A 4TU9A 1S48A 2HRYA 5G4DA 4ECWA 1CSJA 3PW2A 2YKNB 4IFYA 2OTJS 4O3OA 3TAMA 3ZZRA 1VQLS 1BC6A 1TAQA 3CT9A 4RBTA 5HO4A 4QZVB 2Y1JA 3DLHA 2HNZB 3L7OA 1R89A 4Q0BB 3VAMA 2BYCA 2B5JB 3K5OA 3CCSS 4BHQA 3CDEA 3I31A 4DL4A 2FVQA 4QQBA 4FXVA 3MM5A 4IDKB 2C2DA 2WW8A 1FNMA 1UEVA 2ZC4A 1C0UB 3T5KA 1G1XA 1VQ8S 1HNVB 3GYNA 2CZ4A 3AH6A 3HKZD 2WBMA 3DXBA 2N4CA 1SBRA 3FQKA 4I1TA 2FIUA 4Y00A 1TL5A 2E9ZA 4CNYA 3FGVA 2DISA 3HHLD 3LUYA 1CVJA 1H3DA 2L08A 2JEIA 2XSFA 1Q82T 1XNQF 5LMNF 3H2LA 4YEAA 2MZ1A 3M8SA 5IS2A 1JWWA 2JFDA 2EI5A 3HDSA 2N7YA 5HI7A 1NH8A 4ECQA 3POTB 2QA1A 5J1NA 5I42B 1LXJA 3G71S 3J7YU 3PRDA 3N6NA 2G9OA 1QJHA 1WD6A 2VG7A 4L3NA 4Q44A 1FTRA 3OHBA 2MQPA 2YNHB 4ED8A 1U45A 2HFNA 4NCGB 3KNAA 3IBWA 5C24A 1YHQS 1QUVA 4IO1A 3M8QB 3ZC4A 3D1HA 3MPVA 3QLHA 1FTCA 2VPXB 1OS5A 2DR8A 2VZ9A 1S6PA 3M2VA 3IA0A 5CYMB 1IXKA 3CDAA 4PWDB 2PT0A 1RT7B 3BN7A 4RU2A 1N0UA 3SSQA 2M8DB 2JX2A 5KFGA 4LFAF 2LU1A 3EUNA 3TQ1A 2MKSA 2UV8G 2JSXA 2Y1RI 3DLLQ 2OO4A 5F8LA 4PWDA 1HQUB 1GTHA 4FVMA 1FEEA 2IRUA 2L9NA 2W9BA 4KFBA 3HHLB 1PC4A 3GFYA 2EFPA 1WNEA 2DHXA 1TKTA 2MDAA