2XLPA

Joint-functions of protein residues and nadp(h) in oxygen-activation by flavin-containing monooxygenase: asn78ser mutant
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
446
structure length
446
Chain Sequence
ATRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSSGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSAAFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLSDK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
publication title Joint functions of protein residues and NADP(H) in oxygen activation by flavin-containing monooxygenase.
pubmed doi rcsb
source organism Methylophaga aminisulfidivorans
molecule tags Oxidoreductase
total genus 160
structure length 446
sequence length 446
chains with identical sequence B, C, D
ec nomenclature ec 1.14.13.8: Flavin-containing monooxygenase.
pdb deposition date 2010-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xlpA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xlpA02
5EOWA 3RP6A 4AOXA 2YQUA 1NHSA 2WOWA 1OJCA 3NKSA 2XFQA 5CQFA 2AAQA 2R0PA 5TR3A 5KXJA 2C72A 3L1RA 1PJ7A 1YKJA 2YWLA 1YY5A 2GR0A 2DKIA 1XANA 1GXFA 2WP5A 1F8SA 5KVHA 3K30A 1OJTA 1DJNA 3AE2A 4AP1A 3AEFA 3NN6X 2BK3A 5KOWA 1IUSA 1YQ3A 2R0GA 3F8RA 1S2QA 1JRZA 2BXRA 3DGHA 3EPTA 5M0ZA 3V3NA 4EQWA 1D4CA 2GF3A 2Y6QA 4JNAA 2QA1A 2WU5A 2RABA 2A8XA 4J31A 4J57A 2C65A 3F8DA 3REDA 1JNRA 1H82A 3GMBA 2XCGA 3QVRA 3VRAA 1IUWA 1LTXR 1Z6LA 4CCRA 4IA5A 4J34A 2OLNA 1NAAA 1NHPA 2HQMA 2R45A 2WP6A 3CGCA 4K5RA 1AOGA 1QJDA 2WDRA 4U8MA 3QSEA 4Y4MA 4C77A 1GNDA 3GRTA 1CC6A 2E5VA 2C3DA 4C5OA 4H4ZA 2GMHA 3H4KA 3IF9A 4CNJA 2A87A 4K8DA 2J3NA 4DSGA 1GOSA 1NHRA 1D4EA 4HA6A 4YKGA 1GERA 2Z5XA 5JCMA 4EIPA 3NN0X 2QCUA 3UKFA 2ZZCA 3SGLA 2XVHA 4IA6A 4CRTA 3GRSA 3KA7A 3Q6JA 3EF6A 3SFDA 2YG4A 4U2LA 4Z25A 2WOVA 4YTPA 3ATQA 3VRBA 5BRTA 3LZXA 2BC1A 3AE1A 3BHFA 2JB1A 2R4EA 1K4QA 3AE5A 3NH3X 1E1MA 1K0JA 1H86A 3NYCA 3O0HA 2RGJA 3AD7B 3QFBA 4OPIA 1PBFA 5BVAA 3ICSA 2IIDA 4BV6A 2ACZA 3AYLA 2YM2A 3COXA 3NK2X 4U8PA 1LJ1A 4DGKA 3NTDA 2E4GA 3ALMA 4B68A 4EM3A 1DOCA 1GEUA 3B6DA 2EQ6A 2BACA 1FEBA 2BYBA 2C73A 4OPUA 3ZYXA 4C3YA 2R46A 4Z2UA 2YVGA 2VVLA 4USQA 3C4AA 3CNJA 4OPLA 1GPEA 4YSXA 3DMEA 1ZKQA 1CC4A 2H88A 2Q0KA 4K2XA 3CNSA 4BK2A 1GRBA 2BK4A 4LIIA 2YR6A 2NVKX 1DODA 2YR5A 4YKFA 3AEDA 2GAGB 3K7MX 4A79A 4YT0A 2FJEA 4U8LA 4ADWA 2B7SA 3ABVA 3DJGX 3QVPA 2BC0A 1KF6A 3NTAA 2XDOA 4PABA 3DK8A 3FIMB 3B3RA 2YR4A 3Q9TA 4FX9A 2R9ZA 2WESA 2X8HA 3AE3A 2YM1A 2FJDA 3DGZA 4OCGA 3RP7A 3KLJA 4Y4NA 1CJ4A 3AE8A 3PS9A 1D7YA 1FL2A 1VG0A 2WU2A 4FK1A 3BI4A 1ZMDA 2EQ8A 4J33A 2W0HA 4TM1A 3CNTA 1XPQA 4JDRA 4MJWA 2CFYA 2GEWA 1PBCA 2BS4A 2XFPA 1L9EA 2ZZBA 2V3BA 4J56A 4REKA 3II4A 3AB1A 1O95A 1D4DA 1GRHA 1PXCA 4E0VA 3CGDA 3M0OA 4B67A 2BS2A 1K0IA 5U63A 4B69A 2XYOA 2XVIA 1GALA 2C64A 1TDFA 2B9XA 3FPZA 4IVOB 4BJZA 5KVIA 3K7TA 3UOVA 1CC2A 1Y0PA 4TM3A 4H4PA 1EL8A 2GRTA 3ALLA 3CNDA 3AEEA 3AYIA 5CKUA 2GQWA 5EBKA 1PJ6A 5JCKA 2B76A 1H83A 2A89A 2VRLA 3NYEA 1LQTA 4H2QA 4NEWA 4FK1C 2GVCA 2JB2A 1EBDA 4BK3A 5BULA 4H4QA 2CDUA 3DH9A 4I59A 3IC9A 4TLZA 2Q0LA 3KKJA 2EQ9A 3CPHG 3QSSA 4UP3A 2YLRA 3SM8A 3UKLA 4H2PA 2EQ7A 3NK0X 4HB9A 4A6NB 3QFAA 2UZZA 4AT2A 1VQWA 1LPFA 1ELIA 1GV4A 3L8KA 4KX6A 4D04A 1REOA 4UDPA 1PN0A 2GV8A 3KVEA 1B8SA 1KDGA 1B4VA 1COYA 2YLSA 1TRBA 2H89A 3NK1X 1F3PA 4YWOA 2ZBWA 5GRTA 1Q9IA 3CNPA 4Y4LA 1X31B 2FBWA 2GR2A 2OALA 1PXBA 1S3EA 3OC4A 1L0VA 3S5WA 2XLUA 3GWDA 3P4SA 4JY3A 4LU6A 3ISHA 4H2NA 1ZOYA 1DNCA 1EL7A 1N4VA 1Q1RA 2QA2A 4U8NA 2C7GA 4GUVA 1E1NA 1NDAA 3AYJA 1F8WA 3CN8A 3LB8A 2VRMA 2I0ZA 3CIRA 2CVJA 2XLSA 4APNA 4EQRA 2JB3A 3AE4A 4H7UA 2C75A 2IVEA 1PS9A 4B65A 1CJ2A 1TDOA 2WETA 3DA1A 5GSNA 4A6NA 4A65A 3M13A 2YVFA 2JK6A 2R4JA 1KFYA 5LV9A 3V76A 1CHUA 2OAMA 1CF3A 2WDQA 1MO9A 2X8CA 1N1PA 2VQ7A 3NIXA 2E1MA 4CCQA 1GT8A 3AD8B 2YVJA 2V3AA 3AD9B 4NTDA 3SQPA 4C74A 4YSYA 4B66A 4P9SA 1VDCA 4BJYA 2GR3A 1MOKA 1ZP0A 4GDEA 1TDKA 1GSNA 1JEHA 1D5TA 1GRAA 2XFOA 4OPGA 3WE0A 4DSHA 1KNRA 2YG6A 4X4JA 4H4TA 1E6EA 4JNQA 1N4WA 1E7PA 3RNMA 2VOUA 2FJBA 3AECA 2OA1A 3AXBA 1ZDLA 1Y56B 3BNMA 1ZK7A 1HYUA 5J7XA 1ZY8A 3I6DA 4TLXA 3KPFA 5BUKA 3P9UA 4YTMA 2YLTA 3BNUA 2FJAA 3UCLA 3OZ2A 4H4VA 2X99A 2GQFA 4O5QA 2XFUA 1BF3A 1YQZA 5DBJA 2VVLG 2JAEA 3BI2A 1CJCA 3NHOX 1ZMCA 4PAAA 3CTYA 1OJ9A 2GAHB 2Q6UA 1JRXA 4JN9A 4Z2TA 5EB4A 1BGNA 3UKHA 2WPCA 4OPCA 4ECHA 1DOEA 3LZWA 4H4RA 3AEBA 2BCGG 3K7QX 1P2EA 5FS6A 3GYIA 1SEZA 4RG3A 1IUUA 2WDVA 3UKKA 2Y6RA 3VQRA 1DOBA 3H8LA 4TM0A 4B63A 1FEAA 1H7XA 3P1WA 3T37A 3LOVA 2C66A 5EB5A 1Y56A 4A9WA 4GDPA 4I58A 1EL9A 3FMWA 1JU2A 5JCIA 4BURA 1PDHA 1UKVG 5HYMA 1GRFA 2O9ZA 3P4PA 1GTEA 2BXSA 4U8IA 4NTCA 3UTFA 3QSMA 4H4WA 1FECA 4U2TA 1H81A 1Q1WA 5KWFA 5HHFA 3GDNA 2CULA 3DJDA 3VR8A 2C70A 5HY5A 1KSSA 1F6MA 3AE6A 1YQ4A 4ICYA 1O94A 2XVJA 3NLCA 3C4NA 2F5ZA 5JCNA 3H8IA 1PXAA 1CBOA 3ICTA 3V3OA 4JY2A 1LVLA 2YLWA 3AWIA 3EANA 4AOSA 1BWCA 2DKHA 4X9MA 3GD4A 3R9UA 4EIQA 4U8JA 1JOAA 4RG4A 1KNPA 3GYJA 3G5RA 3UKAA 3IWAA 3ALJA 1IUTA 4Z24A 5IQ4A 1TDEA 3BI5A 3CGEA 3UTEA 1GTHA 3UOYA 1NEKA 2XFNA 1M6IA 4CBQA 4ZN0A 2XLTA 1RYIA 4OPDA 4H4XA 4U8OA 2XVEA 3UP5A 3NYFA 3AEGA 1TYTA 3CPJG 3IHMA 2WPEA 4XWRA 5ER0A 4B1BA 2GR1A 3IHGA 4A99A 2WHDA 3DJJA 1M64A 1GRGA 3DJEA 1VG9A 1ZOVA 4KPRA 2Z5YA 4LA1A 4EQXA 4EQSA 1NG3A 1L9DA 2IVDA 2NPXA 2WP9A 2YLZA 1XDIA 1RSGA 3PO7A 3VRDB 4AP3A 3ITJA 2WEUA 5J60A 4M52A 1ZX9A 2V60A 1VRQB 3F8PA 4GCMA 1S2YA 3KU9A 1GETA 5FS8A 4O5UA 4BK1A 3UOZA 3UTHA 4CNKA 4WCTA 3CPIG 1EL5A 1H7WA 1CJ3A 2B9WA 1F8RA 3NNEA 2TMDA 3GWFA 1V59A 2R0CA 2YG3A 2GH5A 2C76A 1P2HA 2PYXA 4H4UA 1XHCA 3NGCX 4U8KA 1NG4A 3G5QA 3P4QA 4Z44A 5FS7A 1IJHA 3UP4A 4C3XA 4NZHA 1E1KA 4DNAA 1LQUA 1N4UA 3LXDA 4N9XA 4Z43A 2JKCA 1FOHA 1LV0A 2YG5A 1B5QA 4K22A 2YLXA 3FG2P 1QLBA 3GSIA 1FCDA 2BCPA 1PJ5A 3ATRA 4K7ZA 4GF7A 5C3JA 3LJPA 5FS9A 2BA9A 2V6OA 2VQBA 2QAEA 4UDQA 4UDRA 2ZZ0A 4USRA 1GREA 1PBEA 3GD3A 2V61A 4EMWA 2X50A 2BABA 2YAUA 3D1CA 4Z2RA 4YSZA 4IVMB 1H84A 3M12A 2AR8A 2XLRA 4D03A 3AEAA 3QJ4A 2RGOA 1MXTA 4TM4A 3UKPA 3PVCA 3FBSA 4EM4A 1CL0A 3URHA 2BS3A 2TPRA 4H4YA 2APGA 1BKWA 4WX1A 4EMIA 4J36A 2WBAA 3UTGA 5KRQA 4YTNA 3G5SA 1QO8A 1DJQA 2PHHA 4XXGA 3UOXA 4YSHA 5FMHA 1BZLA 2V5ZA 2C67A 4EMJA 5IPYA 1K0LA 2B9YA 2BK5A 2B7RA 1GRTA 5IQ1A 5U1OA 1BGJA 1GESA 1L9CA 3UKQA 2WOIA 4CY8A 4K5SA 3BHKA 2VZ2A 2WPFA 2WS3A 4GRTA 3I3LA 1KSUA 1PHHA 3JSKA 3GMCA 5U25A 3AE7A 1PBBA 4NEVA 3C96A 4YXDA 2YG7A 1TDNA 4Z26A 2VVMA 1TYPA 2X3NA 5JCLA 3VR9A 3SFEA 4A7AA 3RP8A 1PBDA 3DK4A 4U2SA 4ZCCA 3NRNA 5KOXA 3NT6A 4GR1A 2ARDA 3DK9A 2GB0A 2XLPA 2OLOA 3P4RA 1OJDA 5L46A 3NG7X 4OPTA 4JQ9A 4RSLA 4ZCDA 2RGHA 4H2RA 1H6VA 4A5LA 4OVIA 2XVFA 3E1TA 1NHQA 1JRYA 3ICRA 3ADAB 4J2WA 3S61A 4AT0A 4B64A 3HZLA 5M10A 2Q7VA 1B37A 2JBVA 1D7LA 3KD9A 4FDCB 2X8GA 1ONFA 1S3BA 1W4XA 4H50A 1NENA 1E39A 2WQYA 3D8XA 1O5WA 3EAOA 1DXLA 1IUXA 4IV9A 4XWZA 4CY6A 3RHAA 2C3CA 2AQJA 3AE9A 1IUVA 1NPXA 1JNZA 3GDPA 1RP0A 3CGBA 3LADA 4NTEA 5C2TA 4X9NA 3ZDNA 1E1LA 5HXIA 1OJAA 4H4SA 2GMJA
chains in the Genus database with same CATH superfamily
5EOWA 3RP6A 4AOXA 2YQUA 1NHSA 2WOWA 1OJCA 3NKSA 4GAVA 2XFQA 5CQFA 2AAQA 2R0PA 5TR3A 5KXJA 2C72A 3L1RA 1PJ7A 1YKJA 2YWLA 1YY5A 2GR0A 2DKIA 1XANA 4G74A 1GXFA 2WP5A 1F8SA 5KVHA 3K30A 1OJTA 3SZCA 1DJNA 3AE2A 4AP1A 3AEFA 3NN6X 2BK3A 5KOWA 4G9KA 1IUSA 1YQ3A 2R0GA 3F8RA 1S2QA 1JRZA 2BXRA 3DGHA 3EPTA 5M0ZA 3V3NA 4EQWA 1D4CA 2GF3A 2Y6QA 4JNAA 2QA1A 2WU5A 2RABA 2A8XA 4J31A 4J57A 2C65A 3F8DA 3REDA 1JNRA 1H82A 3GMBA 2XCGA 3T2ZA 3QVRA 4G6HA 3VRAA 1IUWA 1LTXR 1Z6LA 4CCRA 4IA5A 4J34A 2OLNA 1NAAA 1NHPA 2HQMA 2R45A 2WP6A 3CGCA 4K5RA 1AOGA 1QJDA 2WDRA 4U8MA 3QSEA 4Y4MA 4C77A 3SX6A 1GNDA 3GRTA 1CC6A 2E5VA 2C3DA 4C5OA 4H4ZA 2GMHA 3H4KA 3IF9A 4CNJA 2A87A 4K8DA 2J3NA 4DSGA 1GOSA 1NHRA 1D4EA 4HA6A 4YKGA 1GERA 2Z5XA 5JCMA 4EIPA 3NN0X 2QCUA 3UKFA 2ZZCA 3SGLA 2XVHA 4IA6A 4CRTA 3GRSA 3KA7A 3Q6JA 3EF6A 3SFDA 2YG4A 4U2LA 4Z25A 2WOVA 4YTPA 3ATQA 2BRYA 3VRBA 3LZXA 2BC1A 3AE1A 3BHFA 5BRTA 2JB1A 2R4EA 1K4QA 3AE5A 3NH3X 1E1MA 1K0JA 1H86A 3NYCA 3O0HA 2RGJA 3AD7B 3QFBA 4OPIA 1PBFA 5BVAA 3ICSA 2IIDA 4BV6A 2ACZA 3AYLA 2YM2A 3COXA 3NK2X 4U8PA 1LJ1A 4DGKA 3NTDA 2E4GA 3ALMA 4B68A 4EM3A 1DOCA 1GEUA 3B6DA 2EQ6A 2BACA 1FEBA 2BYBA 2C73A 4OPUA 3ZYXA 4NNJA 2R46A 4C3YA 4Z2UA 2YVGA 2VVLA 4USQA 3C4AA 3CNJA 4OPLA 1GPEA 4YSXA 3DMEA 1ZKQA 1CC4A 2H88A 2Q0KA 4K2XA 3CNSA 4NWZA 1GRBA 4BK2A 2BK4A 4LIIA 2YR6A 2NVKX 1DODA 2YR5A 4YKFA 3AEDA 2GAGB 3K7MX 4A79A 4YT0A 2FJEA 3GYXA 2BRAA 4U8LA 4ADWA 2B7SA 3ABVA 3DJGX 3QVPA 2BC0A 1KF6A 3NTAA 2XDOA 4PABA 3DK8A 3FIMB 3B3RA 2YR4A 3Q9TA 4FX9A 2R9ZA 2WESA 2X8HA 3AE3A 2YM1A 2FJDA 3DGZA 4OCGA 3SZWA 3RP7A 3KLJA 3HYXA 4Y4NA 1CJ4A 3AE8A 3PS9A 1D7YA 1FL2A 1VG0A 2WU2A 3T0KA 4FK1A 3BI4A 1ZMDA 2EQ8A 4J33A 2W0HA 4TM1A 3CNTA 1XPQA 4JDRA 4MJWA 2CFYA 2GEWA 1PBCA 2BS4A 2XFPA 1L9EA 2ZZBA 2V3BA 4J56A 4REKA 3II4A 3AB1A 1O95A 1D4DA 1GRHA 1PXCA 4E0VA 3CGDA 3M0OA 4B67A 2BS2A 1K0IA 5U63A 4B69A 2XYOA 2XVIA 1GALA 2C64A 1TDFA 2B9XA 3FPZA 4IVOB 4BJZA 5KVIA 3K7TA 3UOVA 1CC2A 1Y0PA 4TM3A 4H4PA 1EL8A 2GRTA 3ALLA 3CNDA 3AEEA 3AYIA 5CKUA 2GQWA 5EBKA 1PJ6A 5JCKA 2B76A 1H83A 2A89A 2VRLA 3NYEA 1LQTA 4H2QA 4NEWA 4FK1C 2GVCA 2JB2A 1EBDA 4BK3A 5BULA 4H4QA 2CDUA 3DH9A 4I59A 3IC9A 4TLZA 2Q0LA 3KKJA 2EQ9A 3CPHG 3QSSA 4UP3A 2YLRA 3SM8A 3UKLA 4H2PA 2EQ7A 3NK0X 4HB9A 4A6NB 3QFAA 2UZZA 4AT2A 1VQWA 1LPFA 1ELIA 1GV4A 3L8KA 4KX6A 4D04A 1REOA 4UDPA 3SYIA 1PN0A 2GV8A 3KVEA 1B8SA 1KDGA 1B4VA 1COYA 2YLSA 1TRBA 2H89A 3NK1X 1F3PA 4YWOA 2ZBWA 5GRTA 5KNLA 1Q9IA 3CNPA 4Y4LA 2GR2A 1X31B 2FBWA 2OALA 1PXBA 1S3EA 3OC4A 1L0VA 3S5WA 2XLUA 3GWDA 3P4SA 4JY3A 5KMQA 4LU6A 3ISHA 4H2NA 1ZOYA 3T31A 1DNCA 1EL7A 1N4VA 1Q1RA 2QA2A 4U8NA 2C7GA 4GUVA 1E1NA 1NDAA 3AYJA 1F8WA 3CN8A 3LB8A 2VRMA 2I0ZA 3CIRA 2CVJA 2XLSA 4APNA 4EQRA 2JB3A 3AE4A 4H7UA 2C75A 2IVEA 1PS9A 4B65A 1CJ2A 1TDOA 2WETA 3DA1A 5GSNA 4A6NA 4A65A 3M13A 3T2YA 2YVFA 2JK6A 2R4JA 1KFYA 5LV9A 3V76A 1CHUA 2OAMA 1CF3A 2WDQA 1MO9A 2X8CA 1N1PA 2VQ7A 3NIXA 2E1MA 4CCQA 1GT8A 3AD8B 2YVJA 2V3AA 3AD9B 4NTDA 3SQPA 4C74A 4YSYA 4B66A 4P9SA 1VDCA 4BJYA 2GR3A 1MOKA 1ZP0A 4GDEA 1TDKA 1GSNA 1JEHA 1D5TA 1GRAA 2XFOA 4OPGA 3WE0A 4DSHA 1KNRA 2YG6A 4X4JA 4H4TA 1E6EA 4JNQA 1N4WA 3SZFA 1E7PA 3RNMA 2VOUA 2FJBA 3AECA 2OA1A 3AXBA 1ZDLA 1Y56B 3BNMA 1ZK7A 1HYUA 5J7XA 1ZY8A 3I6DA 4TLXA 4G6GA 3KPFA 5BUKA 3P9UA 4YTMA 2YLTA 3BNUA 2FJAA 3UCLA 3OZ2A 4H4VA 2X99A 2GQFA 4O5QA 2XFUA 1BF3A 1YQZA 5DBJA 2VVLG 2JAEA 3BI2A 1CJCA 3NHOX 1ZMCA 4PAAA 3CTYA 1OJ9A 2GAHB 2Q6UA 1JRXA 4JN9A 4Z2TA 5EB4A 1BGNA 3UKHA 2WPCA 4OPCA 3SXIA 4ECHA 1DOEA 3LZWA 4H4RA 3AEBA 2BCGG 3K7QX 1P2EA 5FS6A 3GYIA 1SEZA 4RG3A 1IUUA 2WDVA 3UKKA 2Y6RA 3VQRA 1DOBA 3H8LA 4TM0A 4B63A 1FEAA 1H7XA 3P1WA 3T37A 3LOVA 2C66A 5EB5A 1Y56A 4A9WA 4GDPA 4I58A 1EL9A 3FMWA 1JU2A 5JCIA 4BURA 1PDHA 1UKVG 5HYMA 3T14A 1GRFA 2O9ZA 4G73A 3P4PA 1GTEA 2BXSA 4U8IA 4NTCA 3UTFA 3QSMA 4H4WA 1FECA 4U2TA 1H81A 1Q1WA 5KWFA 5HHFA 3GDNA 2CULA 3DJDA 3VR8A 2C70A 5HY5A 1KSSA 1F6MA 3AE6A 1YQ4A 4ICYA 5KMPA 1O94A 2XVJA 3NLCA 3C4NA 2F5ZA 5JCNA 3H8IA 1PXAA 1CBOA 3ICTA 3V3OA 4JY2A 1LVLA 2YLWA 3AWIA 3EANA 4AOSA 1BWCA 2DKHA 4X9MA 3GD4A 3R9UA 4EIQA 4U8JA 1JOAA 4RG4A 1KNPA 3GYJA 3G5RA 3UKAA 3IWAA 3ALJA 1IUTA 4Z24A 5IQ4A 1TDEA 3BI5A 3CGEA 3UTEA 1GTHA 3UOYA 1NEKA 2XFNA 1M6IA 4CBQA 4ZN0A 2XLTA 1RYIA 4OPDA 4H4XA 4U8OA 2XVEA 3UP5A 3NYFA 3AEGA 1TYTA 3CPJG 3IHMA 2WPEA 4XWRA 5ER0A 4B1BA 4GAPA 2GR1A 3IHGA 4A99A 2WHDA 3DJJA 1M64A 1GRGA 3DJEA 1VG9A 1ZOVA 4KPRA 2Z5YA 4LA1A 4EQXA 4EQSA 1NG3A 1L9DA 2IVDA 2NPXA 2WP9A 2YLZA 1XDIA 1RSGA 3PO7A 3SY4A 3VRDB 3ITJA 4AP3A 2WEUA 3CMMA 5J60A 4M52A 1ZX9A 2V60A 1VRQB 3F8PA 4GCMA 1S2YA 3KU9A 1GETA 5FS8A 4O5UA 4BK1A 3UOZA 3UTHA 4CNKA 4WCTA 3CPIG 1EL5A 1H7WA 1CJ3A 2B9WA 1F8RA 3NNEA 2TMDA 3GWFA 1V59A 2R0CA 2YG3A 2GH5A 2C76A 1P2HA 2PYXA 4H4UA 1XHCA 3NGCX 4U8KA 1NG4A 3G5QA 3P4QA 4Z44A 5FS7A 1IJHA 3UP4A 4C3XA 4NZHA 1E1KA 4DNAA 1LQUA 1N4UA 3LXDA 4N9XA 4Z43A 2JKCA 1FOHA 1LV0A 2YG5A 1B5QA 4K22A 2YLXA 3FG2P 1QLBA 3GSIA 1FCDA 2BCPA 1PJ5A 3ATRA 4K7ZA 4GF7A 5C3JA 3LJPA 5FS9A 2BA9A 2V6OA 2VQBA 2QAEA 4UDQA 4UDRA 2ZZ0A 4USRA 1GREA 1PBEA 2C4CA 2V61A 3GD3A 4EMWA 2X50A 2BABA 2YAUA 3D1CA 4Z2RA 5KMRA 4YSZA 4IVMB 1H84A 3M12A 2AR8A 2XLRA 4D03A 3AEAA 3QJ4A 2RGOA 1MXTA 4TM4A 3UKPA 3PVCA 3FBSA 4EM4A 1CL0A 3URHA 2BS3A 2TPRA 4H4YA 2APGA 1BKWA 4WX1A 4EMIA 4J36A 2WBAA 3UTGA 5KRQA 4YTNA 3G5SA 4II3A 1QO8A 1DJQA 2PHHA 4XXGA 3UOXA 4YSHA 5FMHA 1BZLA 2V5ZA 2C67A 4EMJA 5IPYA 1K0LA 2B9YA 2BK5A 2B7RA 1GRTA 5IQ1A 5U1OA 1BGJA 1GESA 1L9CA 3UKQA 2WOIA 4CY8A 4K5SA 3BHKA 2VZ2A 2WPFA 2WS3A 4GRTA 3I3LA 1KSUA 1PHHA 3JSKA 3GMCA 5U25A 3AE7A 1PBBA 4NEVA 3C96A 4YXDA 2YG7A 4II2A 1TDNA 4Z26A 2VVMA 3KPKA 1TYPA 2X3NA 5JCLA 3VR9A 3SFEA 4A7AA 3RP8A 1PBDA 3DK4A 4U2SA 4ZCCA 3NRNA 5KOXA 3NT6A 4GR1A 2ARDA 3DK9A 2GB0A 2XLPA 3HYWA 5KMSA 3T2KA 2OLOA 3P4RA 1OJDA 5L46A 3NG7X 4OPTA 4JQ9A 4RSLA 4ZCDA 2RGHA 4H2RA 1H6VA 4A5LA 4OVIA 2XVFA 3E1TA 1NHQA 1JRYA 3ICRA 3ADAB 4J2WA 3S61A 4AT0A 4B64A 3HZLA 5M10A 2Q7VA 1B37A 2JBVA 1D7LA 3KD9A 4FDCB 3HYVA 3SZ0A 2X8GA 1ONFA 1S3BA 1W4XA 4H50A 1NENA 1E39A 2WQYA 3D8XA 1O5WA 3EAOA 1DXLA 1IUXA 4IV9A 4XWZA 4CY6A 3RHAA 2C3CA 2AQJA 3AE9A 1IUVA 1NPXA 1JNZA 3GDPA 1RP0A 3CGBA 3LADA 4NTEA 5C2TA 4X9NA 3ZDNA 1E1LA 5HXIA 1OJAA 4H4SA 2GMJA
chains in the Genus database with same CATH topology
5EOWA 3RP6A 4AOXA 2YQUA 1NHSA 2WOWA 1OJCA 3NKSA 4GAVA 2XFQA 5CQFA 2AAQA 2R0PA 5TR3A 5KXJA 2C72A 3L1RA 1PJ7A 1YKJA 2YWLA 1YY5A 2GR0A 2DKIA 1XANA 4G74A 1GXFA 2WP5A 1F8SA 5KVHA 3K30A 1OJTA 3SZCA 1DJNA 3AE2A 4AP1A 3AEFA 3NN6X 2BK3A 5KOWA 4G9KA 1IUSA 1YQ3A 2R0GA 3F8RA 1S2QA 1JRZA 2BXRA 3DGHA 3EPTA 5M0ZA 3V3NA 4EQWA 1D4CA 2GF3A 2Y6QA 4JNAA 2QA1A 2WU5A 2RABA 2A8XA 4J31A 4J57A 2C65A 3F8DA 3REDA 1JNRA 1H82A 3GMBA 2XCGA 3T2ZA 3QVRA 4G6HA 3VRAA 1IUWA 1LTXR 1Z6LA 4CCRA 4IA5A 4J34A 2OLNA 1NAAA 1NHPA 2HQMA 2R45A 2WP6A 3CGCA 4K5RA 1AOGA 1QJDA 2WDRA 4U8MA 3QSEA 4Y4MA 4C77A 3SX6A 1GNDA 3GRTA 1CC6A 2E5VA 2C3DA 4C5OA 4H4ZA 2GMHA 3H4KA 3IF9A 4CNJA 2A87A 4K8DA 2J3NA 4DSGA 1GOSA 1NHRA 1D4EA 4HA6A 4YKGA 1GERA 2Z5XA 5JCMA 4EIPA 3NN0X 2QCUA 3UKFA 2ZZCA 3SGLA 2XVHA 4IA6A 4CRTA 3GRSA 3KA7A 3Q6JA 3EF6A 3SFDA 2YG4A 4U2LA 4Z25A 2WOVA 4YTPA 3ATQA 2BRYA 3VRBA 3LZXA 2BC1A 3AE1A 3BHFA 5BRTA 2JB1A 2R4EA 1K4QA 3AE5A 3NH3X 1E1MA 1K0JA 1H86A 3NYCA 3O0HA 2RGJA 3AD7B 3QFBA 4OPIA 1PBFA 5BVAA 3ICSA 2IIDA 4BV6A 2ACZA 3AYLA 2YM2A 3COXA 3NK2X 4U8PA 1LJ1A 4DGKA 3NTDA 2E4GA 3ALMA 4B68A 4EM3A 1DOCA 1GEUA 3B6DA 2EQ6A 2BACA 1FEBA 2BYBA 2C73A 4OPUA 3ZYXA 4NNJA 2R46A 4C3YA 4Z2UA 2YVGA 2VVLA 4USQA 3C4AA 3CNJA 4OPLA 1GPEA 4YSXA 3DMEA 1ZKQA 1CC4A 2H88A 2Q0KA 4K2XA 3CNSA 4NWZA 1GRBA 4BK2A 2BK4A 4LIIA 2YR6A 2NVKX 1DODA 2YR5A 4YKFA 3AEDA 2GAGB 3K7MX 4A79A 4YT0A 2FJEA 3GYXA 2BRAA 4U8LA 4ADWA 2B7SA 3ABVA 3DJGX 3QVPA 2BC0A 1KF6A 3NTAA 2XDOA 4PABA 3DK8A 3FIMB 3B3RA 2YR4A 3Q9TA 4FX9A 2R9ZA 2WESA 2X8HA 3AE3A 2YM1A 2FJDA 3DGZA 4OCGA 3SZWA 3RP7A 3KLJA 3HYXA 4Y4NA 1CJ4A 3AE8A 3PS9A 1D7YA 1FL2A 1VG0A 2WU2A 3T0KA 4FK1A 3BI4A 1ZMDA 2EQ8A 4J33A 2W0HA 4TM1A 3CNTA 1XPQA 4JDRA 4MJWA 2CFYA 2GEWA 1PBCA 2BS4A 2XFPA 1L9EA 2ZZBA 2V3BA 4J56A 4REKA 3II4A 3AB1A 1O95A 1D4DA 1GRHA 1PXCA 4E0VA 3CGDA 3M0OA 4B67A 2BS2A 1K0IA 5U63A 4B69A 2XYOA 2XVIA 1GALA 2C64A 1TDFA 2B9XA 3FPZA 4IVOB 4BJZA 5KVIA 3K7TA 3UOVA 1CC2A 1Y0PA 4TM3A 4H4PA 1EL8A 2GRTA 3ALLA 3CNDA 3AEEA 3AYIA 5CKUA 2GQWA 5EBKA 1PJ6A 5JCKA 2B76A 1H83A 2A89A 2VRLA 3NYEA 1LQTA 4H2QA 4NEWA 4FK1C 2GVCA 2JB2A 1EBDA 4BK3A 5BULA 4H4QA 2CDUA 3DH9A 4I59A 3IC9A 4TLZA 2Q0LA 3KKJA 2EQ9A 3CPHG 3QSSA 4UP3A 2YLRA 3SM8A 3UKLA 4H2PA 2EQ7A 3NK0X 4HB9A 4A6NB 3QFAA 2UZZA 4AT2A 1VQWA 1LPFA 1ELIA 1GV4A 3L8KA 4KX6A 4D04A 1REOA 4UDPA 3SYIA 1PN0A 2GV8A 3KVEA 1B8SA 1KDGA 1B4VA 1COYA 2YLSA 1TRBA 2H89A 3NK1X 1F3PA 4YWOA 2ZBWA 5GRTA 5KNLA 1Q9IA 3CNPA 4Y4LA 2GR2A 1X31B 2FBWA 2OALA 1PXBA 1S3EA 3OC4A 1L0VA 3S5WA 2XLUA 3GWDA 3P4SA 4JY3A 5KMQA 4LU6A 3ISHA 4H2NA 1ZOYA 3T31A 1DNCA 1EL7A 1N4VA 1Q1RA 2QA2A 4U8NA 2C7GA 4GUVA 1E1NA 1NDAA 3AYJA 1F8WA 3CN8A 3LB8A 2VRMA 2I0ZA 3CIRA 2CVJA 2XLSA 4APNA 4EQRA 2JB3A 3AE4A 4H7UA 2C75A 2IVEA 1PS9A 4B65A 1CJ2A 1TDOA 2WETA 3DA1A 5GSNA 4A6NA 4A65A 3M13A 3T2YA 2YVFA 2JK6A 2R4JA 1KFYA 5LV9A 3V76A 1CHUA 2OAMA 1CF3A 2WDQA 1MO9A 2X8CA 1N1PA 2VQ7A 3NIXA 2E1MA 4CCQA 1GT8A 3AD8B 2YVJA 2V3AA 3AD9B 4NTDA 3SQPA 4C74A 4YSYA 4B66A 4P9SA 1VDCA 4BJYA 2GR3A 1MOKA 1ZP0A 4GDEA 1TDKA 1GSNA 1JEHA 1D5TA 1GRAA 2XFOA 4OPGA 3WE0A 4DSHA 1KNRA 2YG6A 4X4JA 4H4TA 1E6EA 4JNQA 1N4WA 3SZFA 1E7PA 3RNMA 2VOUA 2FJBA 3AECA 2OA1A 3AXBA 1ZDLA 1Y56B 3BNMA 1ZK7A 1HYUA 5J7XA 1ZY8A 3I6DA 4TLXA 4G6GA 3KPFA 5BUKA 3P9UA 4YTMA 2YLTA 3BNUA 2FJAA 3UCLA 3OZ2A 4H4VA 2X99A 2GQFA 4O5QA 2XFUA 1BF3A 1YQZA 5DBJA 2VVLG 2JAEA 3BI2A 1CJCA 3NHOX 1ZMCA 4PAAA 3CTYA 1OJ9A 2GAHB 2Q6UA 1JRXA 4JN9A 4Z2TA 5EB4A 1BGNA 3UKHA 2WPCA 4OPCA 3SXIA 4ECHA 1DOEA 3LZWA 4H4RA 3AEBA 2BCGG 3K7QX 1P2EA 5FS6A 3GYIA 1SEZA 4RG3A 1IUUA 2WDVA 3UKKA 2Y6RA 3VQRA 1DOBA 3H8LA 4TM0A 4B63A 1FEAA 1H7XA 3P1WA 3T37A 3LOVA 2C66A 5EB5A 1Y56A 4A9WA 4GDPA 4I58A 1EL9A 3FMWA 1JU2A 5JCIA 4BURA 1PDHA 1UKVG 5HYMA 3T14A 1GRFA 2O9ZA 4G73A 3P4PA 1GTEA 2BXSA 4U8IA 4NTCA 3UTFA 3QSMA 4H4WA 1FECA 4U2TA 1H81A 1Q1WA 5KWFA 5HHFA 3GDNA 2CULA 3DJDA 3VR8A 2C70A 5HY5A 1KSSA 1F6MA 3AE6A 1YQ4A 4ICYA 5KMPA 1O94A 2XVJA 3NLCA 3C4NA 2F5ZA 5JCNA 3H8IA 1PXAA 1CBOA 3ICTA 3V3OA 4JY2A 1LVLA 2YLWA 3AWIA 3EANA 4AOSA 1BWCA 2DKHA 4X9MA 3GD4A 3R9UA 4EIQA 4U8JA 1JOAA 4RG4A 1KNPA 3GYJA 3G5RA 3UKAA 3IWAA 3ALJA 1IUTA 4Z24A 5IQ4A 1TDEA 3BI5A 3CGEA 3UTEA 1GTHA 3UOYA 1NEKA 2XFNA 1M6IA 4CBQA 4ZN0A 2XLTA 1RYIA 4OPDA 4H4XA 4U8OA 2XVEA 3UP5A 3NYFA 3AEGA 1TYTA 3CPJG 3IHMA 2WPEA 4XWRA 5ER0A 4B1BA 4GAPA 2GR1A 3IHGA 4A99A 2WHDA 3DJJA 1M64A 1GRGA 3DJEA 1VG9A 1ZOVA 4KPRA 2Z5YA 4LA1A 4EQXA 4EQSA 1NG3A 1L9DA 2IVDA 2NPXA 2WP9A 2YLZA 1XDIA 1RSGA 3PO7A 3SY4A 3VRDB 3ITJA 4AP3A 2WEUA 3CMMA 5J60A 4M52A 1ZX9A 2V60A 1VRQB 3F8PA 4GCMA 1S2YA 3KU9A 1GETA 5FS8A 4O5UA 4BK1A 3UOZA 3UTHA 4CNKA 4WCTA 3CPIG 1EL5A 1H7WA 1CJ3A 2B9WA 1F8RA 3NNEA 2TMDA 3GWFA 1V59A 2R0CA 2YG3A 2GH5A 2C76A 1P2HA 2PYXA 4H4UA 1XHCA 3NGCX 4U8KA 1NG4A 3G5QA 3P4QA 4Z44A 5FS7A 1IJHA 3UP4A 4C3XA 4NZHA 1E1KA 4DNAA 1LQUA 1N4UA 3LXDA 4N9XA 4Z43A 2JKCA 1FOHA 1LV0A 2YG5A 1B5QA 4K22A 2YLXA 3FG2P 1QLBA 3GSIA 1FCDA 2BCPA 1PJ5A 3ATRA 4K7ZA 4GF7A 5C3JA 3LJPA 5FS9A 2BA9A 2V6OA 2VQBA 2QAEA 4UDQA 4UDRA 2ZZ0A 4USRA 1GREA 1PBEA 2C4CA 2V61A 3GD3A 4EMWA 2X50A 2BABA 2YAUA 3D1CA 4Z2RA 5KMRA 4YSZA 4IVMB 1H84A 3M12A 2AR8A 2XLRA 4D03A 3AEAA 3QJ4A 2RGOA 1MXTA 4TM4A 3UKPA 3PVCA 3FBSA 4EM4A 1CL0A 3URHA 2BS3A 2TPRA 4H4YA 2APGA 1BKWA 4WX1A 4EMIA 4J36A 2WBAA 3UTGA 5KRQA 4YTNA 3G5SA 4II3A 1QO8A 1DJQA 2PHHA 4XXGA 3UOXA 4YSHA 5FMHA 1BZLA 2V5ZA 2C67A 4EMJA 5IPYA 1K0LA 2B9YA 2BK5A 2B7RA 1GRTA 5IQ1A 5U1OA 1BGJA 1GESA 1L9CA 3UKQA 2WOIA 4CY8A 4K5SA 3BHKA 2VZ2A 2WPFA 2WS3A 4GRTA 3I3LA 1KSUA 1PHHA 3JSKA 3GMCA 5U25A 3AE7A 1PBBA 4NEVA 3C96A 4YXDA 2YG7A 4II2A 1TDNA 4Z26A 2VVMA 3KPKA 1TYPA 2X3NA 5JCLA 3VR9A 3SFEA 4A7AA 3RP8A 1PBDA 3DK4A 4U2SA 4ZCCA 3NRNA 5KOXA 3NT6A 4GR1A 2ARDA 3DK9A 2GB0A 2XLPA 3HYWA 5KMSA 3T2KA 2OLOA 3P4RA 1OJDA 5L46A 3NG7X 4OPTA 4JQ9A 4RSLA 4ZCDA 2RGHA 4H2RA 1H6VA 4A5LA 4OVIA 2XVFA 3E1TA 1NHQA 1JRYA 3ICRA 3ADAB 4J2WA 3S61A 4AT0A 4B64A 3HZLA 5M10A 2Q7VA 1B37A 2JBVA 1D7LA 3KD9A 4FDCB 3HYVA 3SZ0A 2X8GA 1ONFA 1S3BA 1W4XA 4H50A 1NENA 1E39A 2WQYA 3D8XA 1O5WA 3EAOA 1DXLA 1IUXA 4IV9A 4XWZA 4CY6A 3RHAA 2C3CA 2AQJA 3AE9A 1IUVA 1NPXA 1JNZA 3GDPA 1RP0A 3CGBA 3LADA 4NTEA 5C2TA 4X9NA 3ZDNA 1E1LA 5HXIA 1OJAA 4H4SA 2GMJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EOW A;  3RP6 A;  4AOX A;  2YQU A;  1NHS A;  2WOW A;  1OJC A;  3NKS A;  2XFQ A;  5CQF A;  2AAQ A;  2R0P A;  5TR3 A;  5KXJ A;  2C72 A;  3L1R A;  1PJ7 A;  1YKJ A;  2YWL A;  1YY5 A;  2GR0 A;  2DKI A;  1XAN A;  1GXF A;  2WP5 A;  1F8S A;  5KVH A;  3K30 A;  1OJT A;  1DJN A;  3AE2 A;  4AP1 A;  3AEF A;  3NN6 X;  2BK3 A;  5KOW A;  1IUS A;  1YQ3 A;  2R0G A;  3F8R A;  1S2Q A;  1JRZ A;  2BXR A;  3DGH A;  3EPT A;  5M0Z A;  3V3N A;  4EQW A;  1D4C A;  2GF3 A;  2Y6Q A;  4JNA A;  2QA1 A;  2WU5 A;  2RAB A;  2A8X A;  4J31 A;  4J57 A;  2C65 A;  3F8D A;  3RED A;  1JNR A;  1H82 A;  3GMB A;  2XCG A;  3QVR A;  3VRA A;  1IUW A;  1LTX R;  1Z6L A;  4CCR A;  4IA5 A;  4J34 A;  2OLN A;  1NAA A;  1NHP A;  2HQM A;  2R45 A;  2WP6 A;  3CGC A;  4K5R A;  1AOG A;  1QJD A;  2WDR A;  4U8M A;  3QSE A;  4Y4M A;  4C77 A;  1GND A;  3GRT A;  1CC6 A;  2E5V A;  2C3D A;  4C5O A;  4H4Z A;  2GMH A;  3H4K A;  3IF9 A;  4CNJ A;  2A87 A;  4K8D A;  2J3N A;  4DSG A;  1GOS A;  1NHR A;  1D4E A;  4HA6 A;  4YKG A;  1GER A;  2Z5X A;  5JCM A;  4EIP A;  3NN0 X;  2QCU A;  3UKF A;  2ZZC A;  3SGL A;  2XVH A;  4IA6 A;  4CRT A;  3GRS A;  3KA7 A;  3Q6J A;  3EF6 A;  3SFD A;  2YG4 A;  4U2L A;  4Z25 A;  2WOV A;  4YTP A;  3ATQ A;  3VRB A;  5BRT A;  3LZX A;  2BC1 A;  3AE1 A;  3BHF A;  2JB1 A;  2R4E A;  1K4Q A;  3AE5 A;  3NH3 X;  1E1M A;  1K0J A;  1H86 A;  3NYC A;  3O0H A;  2RGJ A;  3AD7 B;  3QFB A;  4OPI A;  1PBF A;  5BVA A;  3ICS A;  2IID A;  4BV6 A;  2ACZ A;  3AYL A;  2YM2 A;  3COX A;  3NK2 X;  4U8P A;  1LJ1 A;  4DGK A;  3NTD A;  2E4G A;  3ALM A;  4B68 A;  4EM3 A;  1DOC A;  1GEU A;  3B6D A;  2EQ6 A;  2BAC A;  1FEB A;  2BYB A;  2C73 A;  4OPU A;  3ZYX A;  4C3Y A;  2R46 A;  4Z2U A;  2YVG A;  2VVL A;  4USQ A;  3C4A A;  3CNJ A;  4OPL A;  1GPE A;  4YSX A;  3DME A;  1ZKQ A;  1CC4 A;  2H88 A;  2Q0K A;  4K2X A;  3CNS A;  4BK2 A;  1GRB A;  2BK4 A;  4LII A;  2YR6 A;  2NVK X;  1DOD A;  2YR5 A;  4YKF A;  3AED A;  2GAG B;  3K7M X;  4A79 A;  4YT0 A;  2FJE A;  4U8L A;  4ADW A;  2B7S A;  3ABV A;  3DJG X;  3QVP A;  2BC0 A;  1KF6 A;  3NTA A;  2XDO A;  4PAB A;  3DK8 A;  3FIM B;  3B3R A;  2YR4 A;  3Q9T A;  4FX9 A;  2R9Z A;  2WES A;  2X8H A;  3AE3 A;  2YM1 A;  2FJD A;  3DGZ A;  4OCG A;  3RP7 A;  3KLJ A;  4Y4N A;  1CJ4 A;  3AE8 A;  3PS9 A;  1D7Y A;  1FL2 A;  1VG0 A;  2WU2 A;  4FK1 A;  3BI4 A;  1ZMD A;  2EQ8 A;  4J33 A;  2W0H A;  4TM1 A;  3CNT A;  1XPQ A;  4JDR A;  4MJW A;  2CFY A;  2GEW A;  1PBC A;  2BS4 A;  2XFP A;  1L9E A;  2ZZB A;  2V3B A;  4J56 A;  4REK A;  3II4 A;  3AB1 A;  1O95 A;  1D4D A;  1GRH A;  1PXC A;  4E0V A;  3CGD A;  3M0O A;  4B67 A;  2BS2 A;  1K0I A;  5U63 A;  4B69 A;  2XYO A;  2XVI A;  1GAL A;  2C64 A;  1TDF A;  2B9X A;  3FPZ A;  4IVO B;  4BJZ A;  5KVI A;  3K7T A;  3UOV A;  1CC2 A;  1Y0P A;  4TM3 A;  4H4P A;  1EL8 A;  2GRT A;  3ALL A;  3CND A;  3AEE A;  3AYI A;  5CKU A;  2GQW A;  5EBK A;  1PJ6 A;  5JCK A;  2B76 A;  1H83 A;  2A89 A;  2VRL A;  3NYE A;  1LQT A;  4H2Q A;  4NEW A;  4FK1 C;  2GVC A;  2JB2 A;  1EBD A;  4BK3 A;  5BUL A;  4H4Q A;  2CDU A;  3DH9 A;  4I59 A;  3IC9 A;  4TLZ A;  2Q0L A;  3KKJ A;  2EQ9 A;  3CPH G;  3QSS A;  4UP3 A;  2YLR A;  3SM8 A;  3UKL A;  4H2P A;  2EQ7 A;  3NK0 X;  4HB9 A;  4A6N B;  3QFA A;  2UZZ A;  4AT2 A;  1VQW A;  1LPF A;  1ELI A;  1GV4 A;  3L8K A;  4KX6 A;  4D04 A;  1REO A;  4UDP A;  1PN0 A;  2GV8 A;  3KVE A;  1B8S A;  1KDG A;  1B4V A;  1COY A;  2YLS A;  1TRB A;  2H89 A;  3NK1 X;  1F3P A;  4YWO A;  2ZBW A;  5GRT A;  1Q9I A;  3CNP A;  4Y4L A;  1X31 B;  2FBW A;  2GR2 A;  2OAL A;  1PXB A;  1S3E A;  3OC4 A;  1L0V A;  3S5W A;  2XLU A;  3GWD A;  3P4S A;  4JY3 A;  4LU6 A;  3ISH A;  4H2N A;  1ZOY A;  1DNC A;  1EL7 A;  1N4V A;  1Q1R A;  2QA2 A;  4U8N A;  2C7G A;  4GUV A;  1E1N A;  1NDA A;  3AYJ A;  1F8W A;  3CN8 A;  3LB8 A;  2VRM A;  2I0Z A;  3CIR A;  2CVJ A;  2XLS A;  4APN A;  4EQR A;  2JB3 A;  3AE4 A;  4H7U A;  2C75 A;  2IVE A;  1PS9 A;  4B65 A;  1CJ2 A;  1TDO A;  2WET A;  3DA1 A;  5GSN A;  4A6N A;  4A65 A;  3M13 A;  2YVF A;  2JK6 A;  2R4J A;  1KFY A;  5LV9 A;  3V76 A;  1CHU A;  2OAM A;  1CF3 A;  2WDQ A;  1MO9 A;  2X8C A;  1N1P A;  2VQ7 A;  3NIX A;  2E1M A;  4CCQ A;  1GT8 A;  3AD8 B;  2YVJ A;  2V3A A;  3AD9 B;  4NTD A;  3SQP A;  4C74 A;  4YSY A;  4B66 A;  4P9S A;  1VDC A;  4BJY A;  2GR3 A;  1MOK A;  1ZP0 A;  4GDE A;  1TDK A;  1GSN A;  1JEH A;  1D5T A;  1GRA A;  2XFO A;  4OPG A;  3WE0 A;  4DSH A;  1KNR A;  2YG6 A;  4X4J A;  4H4T A;  1E6E A;  4JNQ A;  1N4W A;  1E7P A;  3RNM A;  2VOU A;  2FJB A;  3AEC A;  2OA1 A;  3AXB A;  1ZDL A;  1Y56 B;  3BNM A;  1ZK7 A;  1HYU A;  5J7X A;  1ZY8 A;  3I6D A;  4TLX A;  3KPF A;  5BUK A;  3P9U A;  4YTM A;  2YLT A;  3BNU A;  2FJA A;  3UCL A;  3OZ2 A;  4H4V A;  2X99 A;  2GQF A;  4O5Q A;  2XFU A;  1BF3 A;  1YQZ A;  5DBJ A;  2VVL G;  2JAE A;  3BI2 A;  1CJC A;  3NHO X;  1ZMC A;  4PAA A;  3CTY A;  1OJ9 A;  2GAH B;  2Q6U A;  1JRX A;  4JN9 A;  4Z2T A;  5EB4 A;  1BGN A;  3UKH A;  2WPC A;  4OPC A;  4ECH A;  1DOE A;  3LZW A;  4H4R A;  3AEB A;  2BCG G;  3K7Q X;  1P2E A;  5FS6 A;  3GYI A;  1SEZ A;  4RG3 A;  1IUU A;  2WDV A;  3UKK A;  2Y6R A;  3VQR A;  1DOB A;  3H8L A;  4TM0 A;  4B63 A;  1FEA A;  1H7X A;  3P1W A;  3T37 A;  3LOV A;  2C66 A;  5EB5 A;  1Y56 A;  4A9W A;  4GDP A;  4I58 A;  1EL9 A;  3FMW A;  1JU2 A;  5JCI A;  4BUR A;  1PDH A;  1UKV G;  5HYM A;  1GRF A;  2O9Z A;  3P4P A;  1GTE A;  2BXS A;  4U8I A;  4NTC A;  3UTF A;  3QSM A;  4H4W A;  1FEC A;  4U2T A;  1H81 A;  1Q1W A;  5KWF A;  5HHF A;  3GDN A;  2CUL A;  3DJD A;  3VR8 A;  2C70 A;  5HY5 A;  1KSS A;  1F6M A;  3AE6 A;  1YQ4 A;  4ICY A;  1O94 A;  2XVJ A;  3NLC A;  3C4N A;  2F5Z A;  5JCN A;  3H8I A;  1PXA A;  1CBO A;  3ICT A;  3V3O A;  4JY2 A;  1LVL A;  2YLW A;  3AWI A;  3EAN A;  4AOS A;  1BWC A;  2DKH A;  4X9M A;  3GD4 A;  3R9U A;  4EIQ A;  4U8J A;  1JOA A;  4RG4 A;  1KNP A;  3GYJ A;  3G5R A;  3UKA A;  3IWA A;  3ALJ A;  1IUT A;  4Z24 A;  5IQ4 A;  1TDE A;  3BI5 A;  3CGE A;  3UTE A;  1GTH A;  3UOY A;  1NEK A;  2XFN A;  1M6I A;  4CBQ A;  4ZN0 A;  2XLT A;  1RYI A;  4OPD A;  4H4X A;  4U8O A;  2XVE A;  3UP5 A;  3NYF A;  3AEG A;  1TYT A;  3CPJ G;  3IHM A;  2WPE A;  4XWR A;  5ER0 A;  4B1B A;  2GR1 A;  3IHG A;  4A99 A;  2WHD A;  3DJJ A;  1M64 A;  1GRG A;  3DJE A;  1VG9 A;  1ZOV A;  4KPR A;  2Z5Y A;  4LA1 A;  4EQX A;  4EQS A;  1NG3 A;  1L9D A;  2IVD A;  2NPX A;  2WP9 A;  2YLZ A;  1XDI A;  1RSG A;  3PO7 A;  3VRD B;  4AP3 A;  3ITJ A;  2WEU A;  5J60 A;  4M52 A;  1ZX9 A;  2V60 A;  1VRQ B;  3F8P A;  4GCM A;  1S2Y A;  3KU9 A;  1GET A;  5FS8 A;  4O5U A;  4BK1 A;  3UOZ A;  3UTH A;  4CNK A;  4WCT A;  3CPI G;  1EL5 A;  1H7W A;  1CJ3 A;  2B9W A;  1F8R A;  3NNE A;  2TMD A;  3GWF A;  1V59 A;  2R0C A;  2YG3 A;  2GH5 A;  2C76 A;  1P2H A;  2PYX A;  4H4U A;  1XHC A;  3NGC X;  4U8K A;  1NG4 A;  3G5Q A;  3P4Q A;  4Z44 A;  5FS7 A;  1IJH A;  3UP4 A;  4C3X A;  4NZH A;  1E1K A;  4DNA A;  1LQU A;  1N4U A;  3LXD A;  4N9X A;  4Z43 A;  2JKC A;  1FOH A;  1LV0 A;  2YG5 A;  1B5Q A;  4K22 A;  2YLX A;  3FG2 P;  1QLB A;  3GSI A;  1FCD A;  2BCP A;  1PJ5 A;  3ATR A;  4K7Z A;  4GF7 A;  5C3J A;  3LJP A;  5FS9 A;  2BA9 A;  2V6O A;  2VQB A;  2QAE A;  4UDQ A;  4UDR A;  2ZZ0 A;  4USR A;  1GRE A;  1PBE A;  3GD3 A;  2V61 A;  4EMW A;  2X50 A;  2BAB A;  2YAU A;  3D1C A;  4Z2R A;  4YSZ A;  4IVM B;  1H84 A;  3M12 A;  2AR8 A;  2XLR A;  4D03 A;  3AEA A;  3QJ4 A;  2RGO A;  1MXT A;  4TM4 A;  3UKP A;  3PVC A;  3FBS A;  4EM4 A;  1CL0 A;  3URH A;  2BS3 A;  2TPR A;  4H4Y A;  2APG A;  1BKW A;  4WX1 A;  4EMI A;  4J36 A;  2WBA A;  3UTG A;  5KRQ A;  4YTN A;  3G5S A;  1QO8 A;  1DJQ A;  2PHH A;  4XXG A;  3UOX A;  4YSH A;  5FMH A;  1BZL A;  2V5Z A;  2C67 A;  4EMJ A;  5IPY A;  1K0L A;  2B9Y A;  2BK5 A;  2B7R A;  1GRT A;  5IQ1 A;  5U1O A;  1BGJ A;  1GES A;  1L9C A;  3UKQ A;  2WOI A;  4CY8 A;  4K5S A;  3BHK A;  2VZ2 A;  2WPF A;  2WS3 A;  4GRT A;  3I3L A;  1KSU A;  1PHH A;  3JSK A;  3GMC A;  5U25 A;  3AE7 A;  1PBB A;  4NEV A;  3C96 A;  4YXD A;  2YG7 A;  1TDN A;  4Z26 A;  2VVM A;  1TYP A;  2X3N A;  5JCL A;  3VR9 A;  3SFE A;  4A7A A;  3RP8 A;  1PBD A;  3DK4 A;  4U2S A;  4ZCC A;  3NRN A;  5KOX A;  3NT6 A;  4GR1 A;  2ARD A;  3DK9 A;  2GB0 A;  2XLP A;  2OLO A;  3P4R A;  1OJD A;  5L46 A;  3NG7 X;  4OPT A;  4JQ9 A;  4RSL A;  4ZCD A;  2RGH A;  4H2R A;  1H6V A;  4A5L A;  4OVI A;  2XVF A;  3E1T A;  1NHQ A;  1JRY A;  3ICR A;  3ADA B;  4J2W A;  3S61 A;  4AT0 A;  4B64 A;  3HZL A;  5M10 A;  2Q7V A;  1B37 A;  2JBV A;  1D7L A;  3KD9 A;  4FDC B;  2X8G A;  1ONF A;  1S3B A;  1W4X A;  4H50 A;  1NEN A;  1E39 A;  2WQY A;  3D8X A;  1O5W A;  3EAO A;  1DXL A;  1IUX A;  4IV9 A;  4XWZ A;  4CY6 A;  3RHA A;  2C3C A;  2AQJ A;  3AE9 A;  1IUV A;  1NPX A;  1JNZ A;  3GDP A;  1RP0 A;  3CGB A;  3LAD A;  4NTE A;  5C2T A;  4X9N A;  3ZDN A;  1E1L A;  5HXI A;  1OJA A;  4H4S A;  2GMJ A; 
#chains in the Genus database with same CATH topology
 5EOW A;  3RP6 A;  4AOX A;  2YQU A;  1NHS A;  2WOW A;  1OJC A;  3NKS A;  4GAV A;  2XFQ A;  5CQF A;  2AAQ A;  2R0P A;  5TR3 A;  5KXJ A;  2C72 A;  3L1R A;  1PJ7 A;  1YKJ A;  2YWL A;  1YY5 A;  2GR0 A;  2DKI A;  1XAN A;  4G74 A;  1GXF A;  2WP5 A;  1F8S A;  5KVH A;  3K30 A;  1OJT A;  3SZC A;  1DJN A;  3AE2 A;  4AP1 A;  3AEF A;  3NN6 X;  2BK3 A;  5KOW A;  4G9K A;  1IUS A;  1YQ3 A;  2R0G A;  3F8R A;  1S2Q A;  1JRZ A;  2BXR A;  3DGH A;  3EPT A;  5M0Z A;  3V3N A;  4EQW A;  1D4C A;  2GF3 A;  2Y6Q A;  4JNA A;  2QA1 A;  2WU5 A;  2RAB A;  2A8X A;  4J31 A;  4J57 A;  2C65 A;  3F8D A;  3RED A;  1JNR A;  1H82 A;  3GMB A;  2XCG A;  3T2Z A;  3QVR A;  4G6H A;  3VRA A;  1IUW A;  1LTX R;  1Z6L A;  4CCR A;  4IA5 A;  4J34 A;  2OLN A;  1NAA A;  1NHP A;  2HQM A;  2R45 A;  2WP6 A;  3CGC A;  4K5R A;  1AOG A;  1QJD A;  2WDR A;  4U8M A;  3QSE A;  4Y4M A;  4C77 A;  3SX6 A;  1GND A;  3GRT A;  1CC6 A;  2E5V A;  2C3D A;  4C5O A;  4H4Z A;  2GMH A;  3H4K A;  3IF9 A;  4CNJ A;  2A87 A;  4K8D A;  2J3N A;  4DSG A;  1GOS A;  1NHR A;  1D4E A;  4HA6 A;  4YKG A;  1GER A;  2Z5X A;  5JCM A;  4EIP A;  3NN0 X;  2QCU A;  3UKF A;  2ZZC A;  3SGL A;  2XVH A;  4IA6 A;  4CRT A;  3GRS A;  3KA7 A;  3Q6J A;  3EF6 A;  3SFD A;  2YG4 A;  4U2L A;  4Z25 A;  2WOV A;  4YTP A;  3ATQ A;  2BRY A;  3VRB A;  3LZX A;  2BC1 A;  3AE1 A;  3BHF A;  5BRT A;  2JB1 A;  2R4E A;  1K4Q A;  3AE5 A;  3NH3 X;  1E1M A;  1K0J A;  1H86 A;  3NYC A;  3O0H A;  2RGJ A;  3AD7 B;  3QFB A;  4OPI A;  1PBF A;  5BVA A;  3ICS A;  2IID A;  4BV6 A;  2ACZ A;  3AYL A;  2YM2 A;  3COX A;  3NK2 X;  4U8P A;  1LJ1 A;  4DGK A;  3NTD A;  2E4G A;  3ALM A;  4B68 A;  4EM3 A;  1DOC A;  1GEU A;  3B6D A;  2EQ6 A;  2BAC A;  1FEB A;  2BYB A;  2C73 A;  4OPU A;  3ZYX A;  4NNJ A;  2R46 A;  4C3Y A;  4Z2U A;  2YVG A;  2VVL A;  4USQ A;  3C4A A;  3CNJ A;  4OPL A;  1GPE A;  4YSX A;  3DME A;  1ZKQ A;  1CC4 A;  2H88 A;  2Q0K A;  4K2X A;  3CNS A;  4NWZ A;  1GRB A;  4BK2 A;  2BK4 A;  4LII A;  2YR6 A;  2NVK X;  1DOD A;  2YR5 A;  4YKF A;  3AED A;  2GAG B;  3K7M X;  4A79 A;  4YT0 A;  2FJE A;  3GYX A;  2BRA A;  4U8L A;  4ADW A;  2B7S A;  3ABV A;  3DJG X;  3QVP A;  2BC0 A;  1KF6 A;  3NTA A;  2XDO A;  4PAB A;  3DK8 A;  3FIM B;  3B3R A;  2YR4 A;  3Q9T A;  4FX9 A;  2R9Z A;  2WES A;  2X8H A;  3AE3 A;  2YM1 A;  2FJD A;  3DGZ A;  4OCG A;  3SZW A;  3RP7 A;  3KLJ A;  3HYX A;  4Y4N A;  1CJ4 A;  3AE8 A;  3PS9 A;  1D7Y A;  1FL2 A;  1VG0 A;  2WU2 A;  3T0K A;  4FK1 A;  3BI4 A;  1ZMD A;  2EQ8 A;  4J33 A;  2W0H A;  4TM1 A;  3CNT A;  1XPQ A;  4JDR A;  4MJW A;  2CFY A;  2GEW A;  1PBC A;  2BS4 A;  2XFP A;  1L9E A;  2ZZB A;  2V3B A;  4J56 A;  4REK A;  3II4 A;  3AB1 A;  1O95 A;  1D4D A;  1GRH A;  1PXC A;  4E0V A;  3CGD A;  3M0O A;  4B67 A;  2BS2 A;  1K0I A;  5U63 A;  4B69 A;  2XYO A;  2XVI A;  1GAL A;  2C64 A;  1TDF A;  2B9X A;  3FPZ A;  4IVO B;  4BJZ A;  5KVI A;  3K7T A;  3UOV A;  1CC2 A;  1Y0P A;  4TM3 A;  4H4P A;  1EL8 A;  2GRT A;  3ALL A;  3CND A;  3AEE A;  3AYI A;  5CKU A;  2GQW A;  5EBK A;  1PJ6 A;  5JCK A;  2B76 A;  1H83 A;  2A89 A;  2VRL A;  3NYE A;  1LQT A;  4H2Q A;  4NEW A;  4FK1 C;  2GVC A;  2JB2 A;  1EBD A;  4BK3 A;  5BUL A;  4H4Q A;  2CDU A;  3DH9 A;  4I59 A;  3IC9 A;  4TLZ A;  2Q0L A;  3KKJ A;  2EQ9 A;  3CPH G;  3QSS A;  4UP3 A;  2YLR A;  3SM8 A;  3UKL A;  4H2P A;  2EQ7 A;  3NK0 X;  4HB9 A;  4A6N B;  3QFA A;  2UZZ A;  4AT2 A;  1VQW A;  1LPF A;  1ELI A;  1GV4 A;  3L8K A;  4KX6 A;  4D04 A;  1REO A;  4UDP A;  3SYI A;  1PN0 A;  2GV8 A;  3KVE A;  1B8S A;  1KDG A;  1B4V A;  1COY A;  2YLS A;  1TRB A;  2H89 A;  3NK1 X;  1F3P A;  4YWO A;  2ZBW A;  5GRT A;  5KNL A;  1Q9I A;  3CNP A;  4Y4L A;  2GR2 A;  1X31 B;  2FBW A;  2OAL A;  1PXB A;  1S3E A;  3OC4 A;  1L0V A;  3S5W A;  2XLU A;  3GWD A;  3P4S A;  4JY3 A;  5KMQ A;  4LU6 A;  3ISH A;  4H2N A;  1ZOY A;  3T31 A;  1DNC A;  1EL7 A;  1N4V A;  1Q1R A;  2QA2 A;  4U8N A;  2C7G A;  4GUV A;  1E1N A;  1NDA A;  3AYJ A;  1F8W A;  3CN8 A;  3LB8 A;  2VRM A;  2I0Z A;  3CIR A;  2CVJ A;  2XLS A;  4APN A;  4EQR A;  2JB3 A;  3AE4 A;  4H7U A;  2C75 A;  2IVE A;  1PS9 A;  4B65 A;  1CJ2 A;  1TDO A;  2WET A;  3DA1 A;  5GSN A;  4A6N A;  4A65 A;  3M13 A;  3T2Y A;  2YVF A;  2JK6 A;  2R4J A;  1KFY A;  5LV9 A;  3V76 A;  1CHU A;  2OAM A;  1CF3 A;  2WDQ A;  1MO9 A;  2X8C A;  1N1P A;  2VQ7 A;  3NIX A;  2E1M A;  4CCQ A;  1GT8 A;  3AD8 B;  2YVJ A;  2V3A A;  3AD9 B;  4NTD A;  3SQP A;  4C74 A;  4YSY A;  4B66 A;  4P9S A;  1VDC A;  4BJY A;  2GR3 A;  1MOK A;  1ZP0 A;  4GDE A;  1TDK A;  1GSN A;  1JEH A;  1D5T A;  1GRA A;  2XFO A;  4OPG A;  3WE0 A;  4DSH A;  1KNR A;  2YG6 A;  4X4J A;  4H4T A;  1E6E A;  4JNQ A;  1N4W A;  3SZF A;  1E7P A;  3RNM A;  2VOU A;  2FJB A;  3AEC A;  2OA1 A;  3AXB A;  1ZDL A;  1Y56 B;  3BNM A;  1ZK7 A;  1HYU A;  5J7X A;  1ZY8 A;  3I6D A;  4TLX A;  4G6G A;  3KPF A;  5BUK A;  3P9U A;  4YTM A;  2YLT A;  3BNU A;  2FJA A;  3UCL A;  3OZ2 A;  4H4V A;  2X99 A;  2GQF A;  4O5Q A;  2XFU A;  1BF3 A;  1YQZ A;  5DBJ A;  2VVL G;  2JAE A;  3BI2 A;  1CJC A;  3NHO X;  1ZMC A;  4PAA A;  3CTY A;  1OJ9 A;  2GAH B;  2Q6U A;  1JRX A;  4JN9 A;  4Z2T A;  5EB4 A;  1BGN A;  3UKH A;  2WPC A;  4OPC A;  3SXI A;  4ECH A;  1DOE A;  3LZW A;  4H4R A;  3AEB A;  2BCG G;  3K7Q X;  1P2E A;  5FS6 A;  3GYI A;  1SEZ A;  4RG3 A;  1IUU A;  2WDV A;  3UKK A;  2Y6R A;  3VQR A;  1DOB A;  3H8L A;  4TM0 A;  4B63 A;  1FEA A;  1H7X A;  3P1W A;  3T37 A;  3LOV A;  2C66 A;  5EB5 A;  1Y56 A;  4A9W A;  4GDP A;  4I58 A;  1EL9 A;  3FMW A;  1JU2 A;  5JCI A;  4BUR A;  1PDH A;  1UKV G;  5HYM A;  3T14 A;  1GRF A;  2O9Z A;  4G73 A;  3P4P A;  1GTE A;  2BXS A;  4U8I A;  4NTC A;  3UTF A;  3QSM A;  4H4W A;  1FEC A;  4U2T A;  1H81 A;  1Q1W A;  5KWF A;  5HHF A;  3GDN A;  2CUL A;  3DJD A;  3VR8 A;  2C70 A;  5HY5 A;  1KSS A;  1F6M A;  3AE6 A;  1YQ4 A;  4ICY A;  5KMP A;  1O94 A;  2XVJ A;  3NLC A;  3C4N A;  2F5Z A;  5JCN A;  3H8I A;  1PXA A;  1CBO A;  3ICT A;  3V3O A;  4JY2 A;  1LVL A;  2YLW A;  3AWI A;  3EAN A;  4AOS A;  1BWC A;  2DKH A;  4X9M A;  3GD4 A;  3R9U A;  4EIQ A;  4U8J A;  1JOA A;  4RG4 A;  1KNP A;  3GYJ A;  3G5R A;  3UKA A;  3IWA A;  3ALJ A;  1IUT A;  4Z24 A;  5IQ4 A;  1TDE A;  3BI5 A;  3CGE A;  3UTE A;  1GTH A;  3UOY A;  1NEK A;  2XFN A;  1M6I A;  4CBQ A;  4ZN0 A;  2XLT A;  1RYI A;  4OPD A;  4H4X A;  4U8O A;  2XVE A;  3UP5 A;  3NYF A;  3AEG A;  1TYT A;  3CPJ G;  3IHM A;  2WPE A;  4XWR A;  5ER0 A;  4B1B A;  4GAP A;  2GR1 A;  3IHG A;  4A99 A;  2WHD A;  3DJJ A;  1M64 A;  1GRG A;  3DJE A;  1VG9 A;  1ZOV A;  4KPR A;  2Z5Y A;  4LA1 A;  4EQX A;  4EQS A;  1NG3 A;  1L9D A;  2IVD A;  2NPX A;  2WP9 A;  2YLZ A;  1XDI A;  1RSG A;  3PO7 A;  3SY4 A;  3VRD B;  3ITJ A;  4AP3 A;  2WEU A;  3CMM A;  5J60 A;  4M52 A;  1ZX9 A;  2V60 A;  1VRQ B;  3F8P A;  4GCM A;  1S2Y A;  3KU9 A;  1GET A;  5FS8 A;  4O5U A;  4BK1 A;  3UOZ A;  3UTH A;  4CNK A;  4WCT A;  3CPI G;  1EL5 A;  1H7W A;  1CJ3 A;  2B9W A;  1F8R A;  3NNE A;  2TMD A;  3GWF A;  1V59 A;  2R0C A;  2YG3 A;  2GH5 A;  2C76 A;  1P2H A;  2PYX A;  4H4U A;  1XHC A;  3NGC X;  4U8K A;  1NG4 A;  3G5Q A;  3P4Q A;  4Z44 A;  5FS7 A;  1IJH A;  3UP4 A;  4C3X A;  4NZH A;  1E1K A;  4DNA A;  1LQU A;  1N4U A;  3LXD A;  4N9X A;  4Z43 A;  2JKC A;  1FOH A;  1LV0 A;  2YG5 A;  1B5Q A;  4K22 A;  2YLX A;  3FG2 P;  1QLB A;  3GSI A;  1FCD A;  2BCP A;  1PJ5 A;  3ATR A;  4K7Z A;  4GF7 A;  5C3J A;  3LJP A;  5FS9 A;  2BA9 A;  2V6O A;  2VQB A;  2QAE A;  4UDQ A;  4UDR A;  2ZZ0 A;  4USR A;  1GRE A;  1PBE A;  2C4C A;  2V61 A;  3GD3 A;  4EMW A;  2X50 A;  2BAB A;  2YAU A;  3D1C A;  4Z2R A;  5KMR A;  4YSZ A;  4IVM B;  1H84 A;  3M12 A;  2AR8 A;  2XLR A;  4D03 A;  3AEA A;  3QJ4 A;  2RGO A;  1MXT A;  4TM4 A;  3UKP A;  3PVC A;  3FBS A;  4EM4 A;  1CL0 A;  3URH A;  2BS3 A;  2TPR A;  4H4Y A;  2APG A;  1BKW A;  4WX1 A;  4EMI A;  4J36 A;  2WBA A;  3UTG A;  5KRQ A;  4YTN A;  3G5S A;  4II3 A;  1QO8 A;  1DJQ A;  2PHH A;  4XXG A;  3UOX A;  4YSH A;  5FMH A;  1BZL A;  2V5Z A;  2C67 A;  4EMJ A;  5IPY A;  1K0L A;  2B9Y A;  2BK5 A;  2B7R A;  1GRT A;  5IQ1 A;  5U1O A;  1BGJ A;  1GES A;  1L9C A;  3UKQ A;  2WOI A;  4CY8 A;  4K5S A;  3BHK A;  2VZ2 A;  2WPF A;  2WS3 A;  4GRT A;  3I3L A;  1KSU A;  1PHH A;  3JSK A;  3GMC A;  5U25 A;  3AE7 A;  1PBB A;  4NEV A;  3C96 A;  4YXD A;  2YG7 A;  4II2 A;  1TDN A;  4Z26 A;  2VVM A;  3KPK A;  1TYP A;  2X3N A;  5JCL A;  3VR9 A;  3SFE A;  4A7A A;  3RP8 A;  1PBD A;  3DK4 A;  4U2S A;  4ZCC A;  3NRN A;  5KOX A;  3NT6 A;  4GR1 A;  2ARD A;  3DK9 A;  2GB0 A;  2XLP A;  3HYW A;  5KMS A;  3T2K A;  2OLO A;  3P4R A;  1OJD A;  5L46 A;  3NG7 X;  4OPT A;  4JQ9 A;  4RSL A;  4ZCD A;  2RGH A;  4H2R A;  1H6V A;  4A5L A;  4OVI A;  2XVF A;  3E1T A;  1NHQ A;  1JRY A;  3ICR A;  3ADA B;  4J2W A;  3S61 A;  4AT0 A;  4B64 A;  3HZL A;  5M10 A;  2Q7V A;  1B37 A;  2JBV A;  1D7L A;  3KD9 A;  4FDC B;  3HYV A;  3SZ0 A;  2X8G A;  1ONF A;  1S3B A;  1W4X A;  4H50 A;  1NEN A;  1E39 A;  2WQY A;  3D8X A;  1O5W A;  3EAO A;  1DXL A;  1IUX A;  4IV9 A;  4XWZ A;  4CY6 A;  3RHA A;  2C3C A;  2AQJ A;  3AE9 A;  1IUV A;  1NPX A;  1JNZ A;  3GDP A;  1RP0 A;  3CGB A;  3LAD A;  4NTE A;  5C2T A;  4X9N A;  3ZDN A;  1E1L A;  5HXI A;  1OJA A;  4H4S A;  2GMJ A; 
#chains in the Genus database with same CATH homology
 5EOW A;  3RP6 A;  4AOX A;  2YQU A;  1NHS A;  2WOW A;  1OJC A;  3NKS A;  4GAV A;  2XFQ A;  5CQF A;  2AAQ A;  2R0P A;  5TR3 A;  5KXJ A;  2C72 A;  3L1R A;  1PJ7 A;  1YKJ A;  2YWL A;  1YY5 A;  2GR0 A;  2DKI A;  1XAN A;  4G74 A;  1GXF A;  2WP5 A;  1F8S A;  5KVH A;  3K30 A;  1OJT A;  3SZC A;  1DJN A;  3AE2 A;  4AP1 A;  3AEF A;  3NN6 X;  2BK3 A;  5KOW A;  4G9K A;  1IUS A;  1YQ3 A;  2R0G A;  3F8R A;  1S2Q A;  1JRZ A;  2BXR A;  3DGH A;  3EPT A;  5M0Z A;  3V3N A;  4EQW A;  1D4C A;  2GF3 A;  2Y6Q A;  4JNA A;  2QA1 A;  2WU5 A;  2RAB A;  2A8X A;  4J31 A;  4J57 A;  2C65 A;  3F8D A;  3RED A;  1JNR A;  1H82 A;  3GMB A;  2XCG A;  3T2Z A;  3QVR A;  4G6H A;  3VRA A;  1IUW A;  1LTX R;  1Z6L A;  4CCR A;  4IA5 A;  4J34 A;  2OLN A;  1NAA A;  1NHP A;  2HQM A;  2R45 A;  2WP6 A;  3CGC A;  4K5R A;  1AOG A;  1QJD A;  2WDR A;  4U8M A;  3QSE A;  4Y4M A;  4C77 A;  3SX6 A;  1GND A;  3GRT A;  1CC6 A;  2E5V A;  2C3D A;  4C5O A;  4H4Z A;  2GMH A;  3H4K A;  3IF9 A;  4CNJ A;  2A87 A;  4K8D A;  2J3N A;  4DSG A;  1GOS A;  1NHR A;  1D4E A;  4HA6 A;  4YKG A;  1GER A;  2Z5X A;  5JCM A;  4EIP A;  3NN0 X;  2QCU A;  3UKF A;  2ZZC A;  3SGL A;  2XVH A;  4IA6 A;  4CRT A;  3GRS A;  3KA7 A;  3Q6J A;  3EF6 A;  3SFD A;  2YG4 A;  4U2L A;  4Z25 A;  2WOV A;  4YTP A;  3ATQ A;  2BRY A;  3VRB A;  3LZX A;  2BC1 A;  3AE1 A;  3BHF A;  5BRT A;  2JB1 A;  2R4E A;  1K4Q A;  3AE5 A;  3NH3 X;  1E1M A;  1K0J A;  1H86 A;  3NYC A;  3O0H A;  2RGJ A;  3AD7 B;  3QFB A;  4OPI A;  1PBF A;  5BVA A;  3ICS A;  2IID A;  4BV6 A;  2ACZ A;  3AYL A;  2YM2 A;  3COX A;  3NK2 X;  4U8P A;  1LJ1 A;  4DGK A;  3NTD A;  2E4G A;  3ALM A;  4B68 A;  4EM3 A;  1DOC A;  1GEU A;  3B6D A;  2EQ6 A;  2BAC A;  1FEB A;  2BYB A;  2C73 A;  4OPU A;  3ZYX A;  4NNJ A;  2R46 A;  4C3Y A;  4Z2U A;  2YVG A;  2VVL A;  4USQ A;  3C4A A;  3CNJ A;  4OPL A;  1GPE A;  4YSX A;  3DME A;  1ZKQ A;  1CC4 A;  2H88 A;  2Q0K A;  4K2X A;  3CNS A;  4NWZ A;  1GRB A;  4BK2 A;  2BK4 A;  4LII A;  2YR6 A;  2NVK X;  1DOD A;  2YR5 A;  4YKF A;  3AED A;  2GAG B;  3K7M X;  4A79 A;  4YT0 A;  2FJE A;  3GYX A;  2BRA A;  4U8L A;  4ADW A;  2B7S A;  3ABV A;  3DJG X;  3QVP A;  2BC0 A;  1KF6 A;  3NTA A;  2XDO A;  4PAB A;  3DK8 A;  3FIM B;  3B3R A;  2YR4 A;  3Q9T A;  4FX9 A;  2R9Z A;  2WES A;  2X8H A;  3AE3 A;  2YM1 A;  2FJD A;  3DGZ A;  4OCG A;  3SZW A;  3RP7 A;  3KLJ A;  3HYX A;  4Y4N A;  1CJ4 A;  3AE8 A;  3PS9 A;  1D7Y A;  1FL2 A;  1VG0 A;  2WU2 A;  3T0K A;  4FK1 A;  3BI4 A;  1ZMD A;  2EQ8 A;  4J33 A;  2W0H A;  4TM1 A;  3CNT A;  1XPQ A;  4JDR A;  4MJW A;  2CFY A;  2GEW A;  1PBC A;  2BS4 A;  2XFP A;  1L9E A;  2ZZB A;  2V3B A;  4J56 A;  4REK A;  3II4 A;  3AB1 A;  1O95 A;  1D4D A;  1GRH A;  1PXC A;  4E0V A;  3CGD A;  3M0O A;  4B67 A;  2BS2 A;  1K0I A;  5U63 A;  4B69 A;  2XYO A;  2XVI A;  1GAL A;  2C64 A;  1TDF A;  2B9X A;  3FPZ A;  4IVO B;  4BJZ A;  5KVI A;  3K7T A;  3UOV A;  1CC2 A;  1Y0P A;  4TM3 A;  4H4P A;  1EL8 A;  2GRT A;  3ALL A;  3CND A;  3AEE A;  3AYI A;  5CKU A;  2GQW A;  5EBK A;  1PJ6 A;  5JCK A;  2B76 A;  1H83 A;  2A89 A;  2VRL A;  3NYE A;  1LQT A;  4H2Q A;  4NEW A;  4FK1 C;  2GVC A;  2JB2 A;  1EBD A;  4BK3 A;  5BUL A;  4H4Q A;  2CDU A;  3DH9 A;  4I59 A;  3IC9 A;  4TLZ A;  2Q0L A;  3KKJ A;  2EQ9 A;  3CPH G;  3QSS A;  4UP3 A;  2YLR A;  3SM8 A;  3UKL A;  4H2P A;  2EQ7 A;  3NK0 X;  4HB9 A;  4A6N B;  3QFA A;  2UZZ A;  4AT2 A;  1VQW A;  1LPF A;  1ELI A;  1GV4 A;  3L8K A;  4KX6 A;  4D04 A;  1REO A;  4UDP A;  3SYI A;  1PN0 A;  2GV8 A;  3KVE A;  1B8S A;  1KDG A;  1B4V A;  1COY A;  2YLS A;  1TRB A;  2H89 A;  3NK1 X;  1F3P A;  4YWO A;  2ZBW A;  5GRT A;  5KNL A;  1Q9I A;  3CNP A;  4Y4L A;  2GR2 A;  1X31 B;  2FBW A;  2OAL A;  1PXB A;  1S3E A;  3OC4 A;  1L0V A;  3S5W A;  2XLU A;  3GWD A;  3P4S A;  4JY3 A;  5KMQ A;  4LU6 A;  3ISH A;  4H2N A;  1ZOY A;  3T31 A;  1DNC A;  1EL7 A;  1N4V A;  1Q1R A;  2QA2 A;  4U8N A;  2C7G A;  4GUV A;  1E1N A;  1NDA A;  3AYJ A;  1F8W A;  3CN8 A;  3LB8 A;  2VRM A;  2I0Z A;  3CIR A;  2CVJ A;  2XLS A;  4APN A;  4EQR A;  2JB3 A;  3AE4 A;  4H7U A;  2C75 A;  2IVE A;  1PS9 A;  4B65 A;  1CJ2 A;  1TDO A;  2WET A;  3DA1 A;  5GSN A;  4A6N A;  4A65 A;  3M13 A;  3T2Y A;  2YVF A;  2JK6 A;  2R4J A;  1KFY A;  5LV9 A;  3V76 A;  1CHU A;  2OAM A;  1CF3 A;  2WDQ A;  1MO9 A;  2X8C A;  1N1P A;  2VQ7 A;  3NIX A;  2E1M A;  4CCQ A;  1GT8 A;  3AD8 B;  2YVJ A;  2V3A A;  3AD9 B;  4NTD A;  3SQP A;  4C74 A;  4YSY A;  4B66 A;  4P9S A;  1VDC A;  4BJY A;  2GR3 A;  1MOK A;  1ZP0 A;  4GDE A;  1TDK A;  1GSN A;  1JEH A;  1D5T A;  1GRA A;  2XFO A;  4OPG A;  3WE0 A;  4DSH A;  1KNR A;  2YG6 A;  4X4J A;  4H4T A;  1E6E A;  4JNQ A;  1N4W A;  3SZF A;  1E7P A;  3RNM A;  2VOU A;  2FJB A;  3AEC A;  2OA1 A;  3AXB A;  1ZDL A;  1Y56 B;  3BNM A;  1ZK7 A;  1HYU A;  5J7X A;  1ZY8 A;  3I6D A;  4TLX A;  4G6G A;  3KPF A;  5BUK A;  3P9U A;  4YTM A;  2YLT A;  3BNU A;  2FJA A;  3UCL A;  3OZ2 A;  4H4V A;  2X99 A;  2GQF A;  4O5Q A;  2XFU A;  1BF3 A;  1YQZ A;  5DBJ A;  2VVL G;  2JAE A;  3BI2 A;  1CJC A;  3NHO X;  1ZMC A;  4PAA A;  3CTY A;  1OJ9 A;  2GAH B;  2Q6U A;  1JRX A;  4JN9 A;  4Z2T A;  5EB4 A;  1BGN A;  3UKH A;  2WPC A;  4OPC A;  3SXI A;  4ECH A;  1DOE A;  3LZW A;  4H4R A;  3AEB A;  2BCG G;  3K7Q X;  1P2E A;  5FS6 A;  3GYI A;  1SEZ A;  4RG3 A;  1IUU A;  2WDV A;  3UKK A;  2Y6R A;  3VQR A;  1DOB A;  3H8L A;  4TM0 A;  4B63 A;  1FEA A;  1H7X A;  3P1W A;  3T37 A;  3LOV A;  2C66 A;  5EB5 A;  1Y56 A;  4A9W A;  4GDP A;  4I58 A;  1EL9 A;  3FMW A;  1JU2 A;  5JCI A;  4BUR A;  1PDH A;  1UKV G;  5HYM A;  3T14 A;  1GRF A;  2O9Z A;  4G73 A;  3P4P A;  1GTE A;  2BXS A;  4U8I A;  4NTC A;  3UTF A;  3QSM A;  4H4W A;  1FEC A;  4U2T A;  1H81 A;  1Q1W A;  5KWF A;  5HHF A;  3GDN A;  2CUL A;  3DJD A;  3VR8 A;  2C70 A;  5HY5 A;  1KSS A;  1F6M A;  3AE6 A;  1YQ4 A;  4ICY A;  5KMP A;  1O94 A;  2XVJ A;  3NLC A;  3C4N A;  2F5Z A;  5JCN A;  3H8I A;  1PXA A;  1CBO A;  3ICT A;  3V3O A;  4JY2 A;  1LVL A;  2YLW A;  3AWI A;  3EAN A;  4AOS A;  1BWC A;  2DKH A;  4X9M A;  3GD4 A;  3R9U A;  4EIQ A;  4U8J A;  1JOA A;  4RG4 A;  1KNP A;  3GYJ A;  3G5R A;  3UKA A;  3IWA A;  3ALJ A;  1IUT A;  4Z24 A;  5IQ4 A;  1TDE A;  3BI5 A;  3CGE A;  3UTE A;  1GTH A;  3UOY A;  1NEK A;  2XFN A;  1M6I A;  4CBQ A;  4ZN0 A;  2XLT A;  1RYI A;  4OPD A;  4H4X A;  4U8O A;  2XVE A;  3UP5 A;  3NYF A;  3AEG A;  1TYT A;  3CPJ G;  3IHM A;  2WPE A;  4XWR A;  5ER0 A;  4B1B A;  4GAP A;  2GR1 A;  3IHG A;  4A99 A;  2WHD A;  3DJJ A;  1M64 A;  1GRG A;  3DJE A;  1VG9 A;  1ZOV A;  4KPR A;  2Z5Y A;  4LA1 A;  4EQX A;  4EQS A;  1NG3 A;  1L9D A;  2IVD A;  2NPX A;  2WP9 A;  2YLZ A;  1XDI A;  1RSG A;  3PO7 A;  3SY4 A;  3VRD B;  3ITJ A;  4AP3 A;  2WEU A;  3CMM A;  5J60 A;  4M52 A;  1ZX9 A;  2V60 A;  1VRQ B;  3F8P A;  4GCM A;  1S2Y A;  3KU9 A;  1GET A;  5FS8 A;  4O5U A;  4BK1 A;  3UOZ A;  3UTH A;  4CNK A;  4WCT A;  3CPI G;  1EL5 A;  1H7W A;  1CJ3 A;  2B9W A;  1F8R A;  3NNE A;  2TMD A;  3GWF A;  1V59 A;  2R0C A;  2YG3 A;  2GH5 A;  2C76 A;  1P2H A;  2PYX A;  4H4U A;  1XHC A;  3NGC X;  4U8K A;  1NG4 A;  3G5Q A;  3P4Q A;  4Z44 A;  5FS7 A;  1IJH A;  3UP4 A;  4C3X A;  4NZH A;  1E1K A;  4DNA A;  1LQU A;  1N4U A;  3LXD A;  4N9X A;  4Z43 A;  2JKC A;  1FOH A;  1LV0 A;  2YG5 A;  1B5Q A;  4K22 A;  2YLX A;  3FG2 P;  1QLB A;  3GSI A;  1FCD A;  2BCP A;  1PJ5 A;  3ATR A;  4K7Z A;  4GF7 A;  5C3J A;  3LJP A;  5FS9 A;  2BA9 A;  2V6O A;  2VQB A;  2QAE A;  4UDQ A;  4UDR A;  2ZZ0 A;  4USR A;  1GRE A;  1PBE A;  2C4C A;  2V61 A;  3GD3 A;  4EMW A;  2X50 A;  2BAB A;  2YAU A;  3D1C A;  4Z2R A;  5KMR A;  4YSZ A;  4IVM B;  1H84 A;  3M12 A;  2AR8 A;  2XLR A;  4D03 A;  3AEA A;  3QJ4 A;  2RGO A;  1MXT A;  4TM4 A;  3UKP A;  3PVC A;  3FBS A;  4EM4 A;  1CL0 A;  3URH A;  2BS3 A;  2TPR A;  4H4Y A;  2APG A;  1BKW A;  4WX1 A;  4EMI A;  4J36 A;  2WBA A;  3UTG A;  5KRQ A;  4YTN A;  3G5S A;  4II3 A;  1QO8 A;  1DJQ A;  2PHH A;  4XXG A;  3UOX A;  4YSH A;  5FMH A;  1BZL A;  2V5Z A;  2C67 A;  4EMJ A;  5IPY A;  1K0L A;  2B9Y A;  2BK5 A;  2B7R A;  1GRT A;  5IQ1 A;  5U1O A;  1BGJ A;  1GES A;  1L9C A;  3UKQ A;  2WOI A;  4CY8 A;  4K5S A;  3BHK A;  2VZ2 A;  2WPF A;  2WS3 A;  4GRT A;  3I3L A;  1KSU A;  1PHH A;  3JSK A;  3GMC A;  5U25 A;  3AE7 A;  1PBB A;  4NEV A;  3C96 A;  4YXD A;  2YG7 A;  4II2 A;  1TDN A;  4Z26 A;  2VVM A;  3KPK A;  1TYP A;  2X3N A;  5JCL A;  3VR9 A;  3SFE A;  4A7A A;  3RP8 A;  1PBD A;  3DK4 A;  4U2S A;  4ZCC A;  3NRN A;  5KOX A;  3NT6 A;  4GR1 A;  2ARD A;  3DK9 A;  2GB0 A;  2XLP A;  3HYW A;  5KMS A;  3T2K A;  2OLO A;  3P4R A;  1OJD A;  5L46 A;  3NG7 X;  4OPT A;  4JQ9 A;  4RSL A;  4ZCD A;  2RGH A;  4H2R A;  1H6V A;  4A5L A;  4OVI A;  2XVF A;  3E1T A;  1NHQ A;  1JRY A;  3ICR A;  3ADA B;  4J2W A;  3S61 A;  4AT0 A;  4B64 A;  3HZL A;  5M10 A;  2Q7V A;  1B37 A;  2JBV A;  1D7L A;  3KD9 A;  4FDC B;  3HYV A;  3SZ0 A;  2X8G A;  1ONF A;  1S3B A;  1W4X A;  4H50 A;  1NEN A;  1E39 A;  2WQY A;  3D8X A;  1O5W A;  3EAO A;  1DXL A;  1IUX A;  4IV9 A;  4XWZ A;  4CY6 A;  3RHA A;  2C3C A;  2AQJ A;  3AE9 A;  1IUV A;  1NPX A;  1JNZ A;  3GDP A;  1RP0 A;  3CGB A;  3LAD A;  4NTE A;  5C2T A;  4X9N A;  3ZDN A;  1E1L A;  5HXI A;  1OJA A;  4H4S A;  2GMJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...