2XLPA

Joint-functions of protein residues and nadp(h) in oxygen-activation by flavin-containing monooxygenase: asn78ser mutant
Total Genus 160
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
160
sequence length
446
structure length
446
Chain Sequence
b'ATRIAILGAGPSGMAQLRAFQSAQEKGAEIPELVCFEKQADWGGQWNYTWRTGLDENGEPVHSSMYRYLWSSGPKECLEFADYTFDEHFGKPIASYPPREVLWDYIKGRVEKAGVRKYIRFNTAVRHVEFNEDSQTFTVTVQDHTTDTIYSAAFDYVVCCTGHFSTPYVPEFEGFEKFGGRILHAHDFRDALEFKDKTVLLVGSSYSAEDIGSQCYKYGAKKLISCYRTAPMGYKWPENWDERPNLVRVDTENAYFADGSSEKVDAIILCTGYIHHFPFLNDDLRLVTNNRLWPLNLYKGVVWEDNPKFFYIGMQDQWYSFNMFDAQAWYARDVIMGRLPLPSKEEMKADSMAWREKELTLVTAEEMYTYQGDYIQNLIDMTDYPSFDIPATNKTFLEWKHHKKENIMTFRDHSYRSLMTGTMAPKHHTPWIDALDDSLEAYLSDK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FLAVIN-CONTAINING MONOOXYGENASE
publication title Joint functions of protein residues and NADP(H) in oxygen activation by flavin-containing monooxygenase.
pubmed doi rcsb
source organism Methylophaga aminisulfidivorans
molecule tags Oxidoreductase
total genus 160
structure length 446
sequence length 446
chains with identical sequence B, C, D
ec nomenclature ec 1.14.13.8: Flavin-containing monooxygenase.
pdb deposition date 2010-07-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00743 FMO-like Flavin-binding monooxygenase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xlpA01
3.50.50.60 Alpha Beta 3-Layer(bba) Sandwich FAD/NAD(P)-binding domain FAD/NAD(P)-binding domain 2xlpA02
3ABVA 4A65A 1E6EA 3ZDNA 4A99A 2CDUA 3DJDA 3NHOX 2X50A 4Z25A 2CULA 1CBOA 3K7TA 4B67A 2E4GA 2JB2A 2ZBWA 3BNMA 4ICYA 1PBCA 3NG7X 5BULA 3AB1A 3EAOA 5IQ4A 3DGZA 3GMBA 3BHFA 5KXJA 1Q9IA 3RP7A 1KSUA 1CHUA 2YVJA 1E39A 3CGDA 3DH9A 1D4DA 1EL9A 3DJJA 1CC2A 3GSIA 3EF6A 3R9UA 2FJDA 1IUXA 1DOEA 3F8PA 3UCLA 3IF9A 1CJ3A 1F8RA 5C3JA 4OPCA 2WP6A 2X3NA 4A9WA 2OLNA 2V60A 2DKHA 2C3CA 4BV6A 2RGJA 2RGHA 3G5QA 2X8CA 1OJ9A 2H89A 2XLTA 1O5WA 4ADWA 2PYXA 1GRAA 2BYBA 4FX9A 4H2QA 1D4CA 1B37A 1H6VA 2C64A 1XDIA 2GR2A 2C75A 2WESA 3AXBA 3IHMA 1NAAA 3NK2X 1S2QA 1FCDA 2C73A 2IVDA 3JSKA 3CNJA 2BS3A 1E1LA 2C3DA 3RP6A 4NTDA 4U8IA 4A5LA 1JRZA 1PXBA 3UKHA 4EQRA 3AEBA 2BCPA 2RABA 1SEZA 3L1RA 4JDRA 2Z5XA 2B9YA 3AYJA 4BK3A 4EMIA 2YR5A 3P4SA 2Q0KA 4BK2A 1IUWA 4C77A 1PJ5A 3GWDA 2XFQA 4J2WA 4N9XA 1MOKA 4TM4A 1O95A 3NKSA 4U2TA 3GWFA 1TYTA 4U8KA 2XFOA 3WE0A 1NHPA 2E5VA 1ZMDA 3H8IA 4EM4A 3QFBA 2XDOA 4H7UA 1NDAA 4H2RA 4WX1A 5DBJA 5JCKA 1K4QA 2BABA 1IUSA 2OA1A 2V3AA 2C72A 4TLXA 1JEHA 3VRBA 3LB8A 1GRTA 3NTAA 2YG3A 4J57A 1JOAA 3AD9B 3V3NA 3S5WA 4DSGA 1B5QA 4B1BA 4UP3A 2APGA 1M6IA 2YQUA 3GD3A 3NIXA 1KSSA 4UDQA 1REOA 1Y56A 1PBFA 3UTHA 2JBVA 4DNAA 2IIDA 3AE5A 3DK8A 1FEBA 1GESA 1YQ4A 4UDPA 3AWIA 2A87A 2R0PA 3L8KA 4X9MA 2WPEA 3K7MX 3UOVA 2YLRA 1OJAA 2OAMA 1PBBA 4O5QA 1B8SA 1GERA 1NENA 2WU2A 3AE2A 2EQ7A 3QJ4A 5U1OA 2JB1A 3FBSA 2O9ZA 3H4KA 3DK9A 4IV9A 2GF3A 2H88A 3ICSA 3GMCA 4H4RA 1F3PA 1PN0A 1GPEA 4U8NA 1LPFA 3AEDA 4U8OA 5IQ1A 5J60A 1EL5A 3BI2A 4DSHA 1GOSA 4AP3A 1JNRA 1NPXA 4B69A 4E0VA 3LADA 3UP5A 1XHCA 2VOUA 1H83A 4CY6A 4IA6A 4H50A 3S61A 2WOWA 4RG4A 3T37A 3VR8A 1D5TA 1Q1RA 2GQFA 2W0HA 5HYMA 2C67A 4U8PA 3SM8A 2B9WA 3OZ2A 3ZYXA 5BVAA 4PAAA 4GR1A 5ER0A 4B64A 1VG0A 4LIIA 1N1PA 1RYIA 1O94A 3C4AA 1JRYA 3URHA 3PVCA 3UOZA 1S3BA 2B7RA 3CNDA 1K0IA 1GTEA 4TLZA 3NTDA 2C66A 1P2HA 3GRSA 3AYIA 3IWAA 2Y6RA 4GUVA 4YWOA 2V61A 1V59A 4YTNA 1LV0A 1PDHA 3QSSA 3AD8B 3DMEA 4OPIA 4REKA 2YLTA 2GAHB 3BNUA 3GD4A 2YVGA 1TDEA 3AE3A 1D7LA 1L9EA 1AOGA 1OJDA 3HZLA 3DGHA 4K5RA 1GRFA 3BHKA 1VG9A 3IC9A 1GXFA 2R0GA 4C74A 2ZZCA 3D1CA 4WCTA 4J34A 3UTEA 2WDQA 4OPGA 4ZCCA 3P4RA 1CF3A 5M10A 3P4QA 4USRA 1CJCA 5HHFA 2WPCA 1D7YA 1NG3A 3H8LA 3NRNA 4PABA 2R4JA 4Y4NA 3UKPA 1MXTA 1E1NA 5HXIA 4J31A 1UKVG 3CGCA 1FECA 2YVFA 2B7SA 1LTXR 4K2XA 2XCGA 4AT2A 4IVMB 2GMJA 2NPXA 4GCMA 5CQFA 3REDA 1PBDA 3NGCX 4H4YA 2BA9A 1CC4A 3GRTA 4Y4MA 2VVLG 2YAUA 4YTMA 3RP8A 4U8MA 2R45A 4M52A 1NEKA 1Q1WA 5KRQA 2F5ZA 5EB4A 2VVLA 1FOHA 3OC4A 4JNAA 3FMWA 1GV4A 3NYCA 4XWZA 3D8XA 2WQYA 2XYOA 4H4PA 3F8RA 4HB9A 1GETA 1IUVA 4X4JA 1DJNA 1FEAA 2GH5A 3GDNA 3CPJG 4C5OA 1RP0A 4JY2A 1Z6LA 1H81A 1H82A 3LJPA 5U63A 2BACA 5FS9A 4HA6A 3BI4A 2C65A 2ZZBA 3AEEA 1H7WA 1CJ2A 4OPDA 1QJDA 4NTCA 4RG3A 2Y6QA 2WDRA 5EB5A 3UKQA 5IPYA 2VRMA 2C76A 1GRHA 2VVMA 3ISHA 3VRDB 4H4SA 4ZN0A 1EBDA 2BK3A 1JRXA 3NYFA 4APNA 3CNSA 4U8LA 1PS9A 2FJBA 4J36A 1KNPA 2XLUA 1RSGA 1N4WA 4Z26A 4P9SA 4CBQA 3QFAA 1ZK7A 2YM1A 4UDRA 3UTFA 4AP1A 3Q6JA 5GSNA 1K0LA 3ALJA 1NHQA 5M0ZA 3UOXA 4KPRA 1L0VA 3GYJA 2GB0A 2GR3A 4OPLA 4B65A 4B68A 4OPTA 3SQPA 4YT0A 1ONFA 2E1MA 4O5UA 4K7ZA 1GALA 4IA5A 4A79A 4YKFA 3KPFA 3VR9A 4A6NB 2EQ6A 2Q6UA 2YR6A 1H7XA 2B76A 3RHAA 3AE4A 2R9ZA 2WP9A 3G5RA 3AE1A 1L9DA 1KDGA 1TDNA 4NEWA 4ECHA 3AEGA 2WP5A 1E7PA 1OJTA 2RGOA 1E1MA 4Z2TA 5BRTA 4C3XA 2WPFA 3P1WA 2DKIA 4YSZA 2BK5A 2Z5YA 4BK1A 3NK1X 5KOXA 2YG7A 2VRLA 2OLOA 2R46A 1BWCA 3UTGA 4EQSA 1MO9A 2XVHA 4GRTA 4H4VA 3ALMA 3DA1A 5FMHA 4Z44A 4JQ9A 1LQUA 4U8JA 1P2EA 5L46A 1N4UA 3Q9TA 3KLJA 5KVIA 2Q7VA 1OJCA 2IVEA 1IJHA 1DODA 1PBEA 3B6DA 3QVRA 4CRTA 3NH3X 2X8HA 1DXLA 1KF6A 3CIRA 2BS4A 4J56A 1YKJA 1YQZA 2YLZA 1LQTA 3LXDA 3I3LA 4H2PA 3UKKA 2NVKX 2VQBA 2YG5A 3K7QX 3AD7B 3G5SA 3K30A 2HQMA 1GNDA 2CFYA 2QA1A 5JCLA 4FK1C 3ATRA 3AEFA 1X31B 3UKAA 3M0OA 4D03A 5JCNA 1PJ6A 2WOIA 3NN0X 3PO7A 3GYIA 4TM1A 4USQA 1Y0PA 3FIMB 4X9NA 1S2YA 2BC1A 2A89A 1ZOYA 2WETA 5FS6A 4LA1A 2ACZA 2XLRA 1COYA 3CGBA 1ZX9A 3FPZA 1L9CA 1H84A 3CN8A 4EMWA 2FJEA 1NHRA 3AECA 3LOVA 1BZLA 5FS8A 4DGKA 4J33A 4YSYA 4I58A 2QA2A 4RSLA 4K22A 4AOSA 1M64A 2YWLA 3EPTA 5BUKA 1VDCA 4YTPA 3EANA 3NK0X 2UZZA 3SFDA 4A7AA 4EIPA 2GEWA 1DJQA 3GDPA 2FJAA 3UP4A 4Z43A 1ELIA 1PHHA 3V76A 3ATQA 1YY5A 4LU6A 3ICRA 1ZP0A 2XVEA 1ZDLA 1E1KA 3QVPA 4ZCDA 3AE7A 3P9UA 2GVCA 4GDEA 3AEAA 5FS7A 3SGLA 1DOCA 2I0ZA 5JCIA 3KU9A 1F6MA 3DJGX 2JK6A 5U25A 1BGNA 2GR0A 2BXRA 4EQWA 1PXCA 5KWFA 4H4WA 4Z24A 2OALA 4OVIA 2BXSA 1TDKA 2BS2A 3QSEA 4NEVA 2GR1A 2CVJA 2JAEA 3SFEA 4C3YA 3CTYA 1QLBA 1CJ4A 4A6NA 1NG4A 4OPUA 3KD9A 1LVLA 3KKJA 4CNJA 1PJ7A 1HYUA 1N4VA 2JKCA 2V3BA 1LJ1A 3NT6A 4BJYA 4YSXA 1W4XA 1IUUA 2X8GA 3UKFA 4NZHA 4XWRA 2WOVA 1FL2A 5C2TA 1NHSA 1BKWA 5KVHA 3UKLA 2V6OA 4JY3A 1B4VA 3ICTA 3PS9A 3P4PA 3RNMA 2TMDA 2WS3A 2FBWA 4MJWA 1F8SA 2A8XA 3FG2P 1S3EA 2YLWA 1JNZA 1GTHA 3B3RA 3ITJA 5JCMA 4Z2UA 3CPHG 2AQJA 1K0JA 3O0HA 3NN6X 4H4XA 3M12A 4K8DA 3C4NA 2J3NA 5KOWA 1KNRA 1DOBA 3CNTA 4TM3A 5CKUA 1XANA 2WEUA 4JN9A 2BCGG 4U2SA 5J7XA 2XVJA 2BC0A 4GF7A 4NTEA 4I59A 1YQ3A 3DJEA 4H4UA 1GEUA 3ADAB 1D4EA 3BI5A 3VRAA 3AE6A 3C96A 2VZ2A 2YLSA 2AAQA 2GV8A 4KX6A 1TRBA 1CC6A 2EQ9A 2YG6A 4YXDA 1KFYA 3AE9A 1DNCA 3V3OA 4BJZA 2EQ8A 3E1TA 2XLSA 1GRBA 1EL8A 2QAEA 1PXAA 1F8WA 5GRTA 2ZZ0A 4U2LA 3KVEA 3VQRA 2AR8A 2XFPA 1ZOVA 2R0CA 5HY5A 3NLCA 3AYLA 2WHDA 2XFNA 1GREA 2GAGB 2JB3A 1ZY8A 2VQ7A 3ALLA 1GSNA 4FDCB 4B66A 3II4A 2GQWA 5TR3A 4EMJA 2WDVA 1H86A 2PHHA 1ZKQA 4CNKA 3LZXA 2XVFA 5EBKA 4CCRA 5EOWA 1TDFA 3CPIG 3IHGA 3UOYA 1BF3A 3LZWA 4BURA 4YKGA 4GDPA 3I6DA 3F8DA 4Z2RA 4H2NA 2ARDA 2V5ZA 2Q0LA 4XXGA 4AT0A 4EIQA 4JNQA 2C70A 2YM2A 3COXA 2R4EA 1GRGA 2TPRA 4EQXA 4AOXA 1VQWA 4D04A 2QCUA 3KA7A 4YSHA 3AE8A 1CL0A 4IVOB 3CGEA 1TDOA 2XLPA 4FK1A 1XPQA 2GMHA 4H4TA 4OCGA 2YLXA 2C7GA 1VRQB 3CNPA 4B63A 1IUTA 4H4QA 1Y56B 4EM3A 4CCQA 2WBAA 3DK4A 3NYEA 4H4ZA 1EL7A 2X99A 4K5SA 2XFUA 2YG4A 2B9XA 1QO8A 2YR4A 2XVIA 3QSMA 4TM0A 5LV9A 1JU2A 3M13A 1TYPA 2BK4A 4CY8A 4Y4LA 2GRTA 3NNEA 1ZMCA 2WU5A 1GT8A 1BGJA
chains in the Genus database with same CATH superfamily
3ABVA 4A65A 1E6EA 3ZDNA 4A99A 2CDUA 3DJDA 3NHOX 2X50A 4Z25A 2CULA 1CBOA 3K7TA 4B67A 2E4GA 2JB2A 2ZBWA 3BNMA 3KPKA 1PBCA 3NG7X 4ICYA 3AB1A 3EAOA 5BULA 5IQ4A 3DGZA 3GMBA 3BHFA 5KXJA 1Q9IA 3RP7A 1KSUA 1CHUA 2YVJA 1E39A 3CGDA 3DH9A 1D4DA 1EL9A 3DJJA 1CC2A 3GSIA 3EF6A 3R9UA 2FJDA 1IUXA 1DOEA 3F8PA 3T2YA 3UCLA 3IF9A 1CJ3A 1F8RA 5C3JA 4OPCA 3SZWA 2WP6A 2X3NA 4A9WA 2OLNA 2V60A 2DKHA 2C3CA 4BV6A 2RGJA 2RGHA 3G5QA 2X8CA 1OJ9A 2H89A 2XLTA 1O5WA 4ADWA 2PYXA 1GRAA 2BYBA 4FX9A 4H2QA 1D4CA 1B37A 1H6VA 2C64A 1XDIA 2GR2A 2C75A 2WESA 3AXBA 3IHMA 1NAAA 3NK2X 1S2QA 1FCDA 2C73A 2IVDA 3JSKA 3CNJA 2BS3A 1E1LA 2C3DA 3RP6A 4NTDA 4U8IA 4A5LA 1JRZA 1PXBA 4G9KA 3UKHA 4EQRA 3AEBA 2BCPA 2RABA 1SEZA 3L1RA 4JDRA 2Z5XA 2B9YA 3AYJA 4BK3A 4EMIA 2YR5A 3P4SA 2Q0KA 4BK2A 1IUWA 4C77A 1PJ5A 3GWDA 2XFQA 4J2WA 4N9XA 1MOKA 4TM4A 1O95A 3NKSA 4U2TA 3GWFA 1TYTA 4U8KA 2XFOA 3WE0A 1NHPA 2E5VA 1ZMDA 3H8IA 4EM4A 3QFBA 2XDOA 4H7UA 1NDAA 4H2RA 4WX1A 5DBJA 5JCKA 1K4QA 2BABA 1IUSA 2OA1A 2V3AA 2C72A 4TLXA 1JEHA 3VRBA 3LB8A 1GRTA 3NTAA 2YG3A 4J57A 1JOAA 3AD9B 3V3NA 3S5WA 4DSGA 1B5QA 4B1BA 4UP3A 2APGA 1M6IA 2YQUA 3GD3A 3NIXA 1KSSA 4UDQA 1REOA 1Y56A 1PBFA 3UTHA 4II3A 3HYWA 2JBVA 4DNAA 2IIDA 3AE5A 3DK8A 3SZFA 1FEBA 1GESA 1YQ4A 4UDPA 3AWIA 2A87A 2R0PA 3L8KA 4X9MA 2WPEA 3K7MX 3UOVA 2YLRA 1OJAA 2OAMA 1PBBA 4O5QA 1B8SA 1GERA 1NENA 2WU2A 3AE2A 2EQ7A 3QJ4A 5U1OA 5KMSA 2BRAA 2JB1A 3FBSA 2O9ZA 3H4KA 3DK9A 4IV9A 4G73A 2GF3A 2H88A 3ICSA 3GMCA 4H4RA 1F3PA 1PN0A 1GPEA 4U8NA 1LPFA 3AEDA 4U8OA 5IQ1A 5J60A 1EL5A 3BI2A 4DSHA 1GOSA 4AP3A 1JNRA 1NPXA 4B69A 4E0VA 3LADA 3UP5A 1XHCA 2VOUA 1H83A 4CY6A 4IA6A 4H50A 3S61A 2WOWA 4RG4A 3T37A 3VR8A 1D5TA 1Q1RA 2GQFA 2W0HA 5HYMA 2C67A 4U8PA 3SM8A 2B9WA 3SYIA 3OZ2A 3ZYXA 5BVAA 4PAAA 4GR1A 5ER0A 4B64A 1VG0A 4LIIA 1N1PA 1RYIA 1O94A 3C4AA 1JRYA 3URHA 3PVCA 3UOZA 1S3BA 2B7RA 3CNDA 1K0IA 1GTEA 4TLZA 3NTDA 2C66A 1P2HA 3GRSA 3AYIA 3IWAA 2Y6RA 4GUVA 4YWOA 3SX6A 2V61A 1V59A 4YTNA 1LV0A 1PDHA 3QSSA 3AD8B 3DMEA 4OPIA 4REKA 2YLTA 2GAHB 3BNUA 3GD4A 2YVGA 1TDEA 3AE3A 1D7LA 1L9EA 1AOGA 1OJDA 3HZLA 3DGHA 4K5RA 1GRFA 3BHKA 1VG9A 3IC9A 1GXFA 2R0GA 4II2A 4C74A 2ZZCA 3D1CA 4WCTA 4J34A 3UTEA 2WDQA 4OPGA 4ZCCA 3P4RA 1CF3A 5M10A 3P4QA 4USRA 1CJCA 5HHFA 2WPCA 1D7YA 1NG3A 3H8LA 3NRNA 4PABA 2R4JA 4Y4NA 3UKPA 1MXTA 1E1NA 5HXIA 4J31A 1UKVG 3CGCA 1FECA 2YVFA 2B7SA 1LTXR 4K2XA 2XCGA 4AT2A 4IVMB 2GMJA 2NPXA 3GYXA 3SZ0A 4GCMA 5CQFA 3REDA 1PBDA 3NGCX 4H4YA 2BA9A 1CC4A 3GRTA 4Y4MA 2VVLG 2YAUA 4YTMA 3RP8A 4U8MA 2R45A 4M52A 1NEKA 1Q1WA 5KRQA 2F5ZA 5EB4A 2VVLA 1FOHA 3OC4A 4JNAA 3FMWA 1GV4A 3NYCA 4XWZA 3D8XA 2WQYA 2XYOA 4H4PA 3F8RA 4HB9A 1GETA 1IUVA 4X4JA 1DJNA 1FEAA 2GH5A 3GDNA 3CPJG 4C5OA 1RP0A 4JY2A 1Z6LA 1H81A 1H82A 3LJPA 5U63A 2C4CA 2BACA 5FS9A 4HA6A 3BI4A 2C65A 2ZZBA 3AEEA 1H7WA 1CJ2A 4OPDA 1QJDA 4NTCA 4RG3A 2Y6QA 2WDRA 5EB5A 3UKQA 5IPYA 2VRMA 2C76A 1GRHA 2VVMA 3ISHA 3VRDB 4H4SA 4ZN0A 1EBDA 2BK3A 1JRXA 3NYFA 4APNA 3CNSA 4U8LA 1PS9A 2FJBA 4J36A 1KNPA 3T0KA 2XLUA 1RSGA 1N4WA 4Z26A 4P9SA 4CBQA 3QFAA 1ZK7A 2YM1A 4UDRA 3UTFA 4AP1A 3Q6JA 5GSNA 1K0LA 3ALJA 1NHQA 5M0ZA 3SXIA 3UOXA 4KPRA 1L0VA 2BRYA 3GYJA 2GB0A 2GR3A 4OPLA 4B65A 4B68A 4OPTA 3SQPA 4YT0A 1ONFA 2E1MA 4O5UA 4K7ZA 1GALA 5KMPA 3HYVA 4IA5A 4A79A 4YKFA 3KPFA 3VR9A 4A6NB 2EQ6A 2Q6UA 2YR6A 3T2KA 1H7XA 2B76A 3RHAA 3AE4A 2R9ZA 2WP9A 3G5RA 3AE1A 1L9DA 1KDGA 1TDNA 4NEWA 4ECHA 3AEGA 2WP5A 1E7PA 1OJTA 2RGOA 1E1MA 4Z2TA 5BRTA 4C3XA 2WPFA 3P1WA 2DKIA 4YSZA 2BK5A 2Z5YA 4BK1A 3NK1X 5KOXA 2YG7A 2VRLA 2OLOA 2R46A 1BWCA 3UTGA 4EQSA 1MO9A 2XVHA 4GRTA 4H4VA 3ALMA 3DA1A 5FMHA 4Z44A 4JQ9A 1LQUA 4U8JA 1P2EA 5L46A 1N4UA 3Q9TA 3KLJA 5KVIA 5KNLA 2Q7VA 1OJCA 2IVEA 1IJHA 1DODA 1PBEA 3B6DA 3QVRA 4CRTA 3NH3X 2X8HA 1DXLA 5KMRA 1KF6A 3CIRA 2BS4A 4J56A 1YKJA 1YQZA 2YLZA 1LQTA 3LXDA 3I3LA 4H2PA 3UKKA 2NVKX 2VQBA 2YG5A 3K7QX 3AD7B 3G5SA 3K30A 2HQMA 1GNDA 2CFYA 2QA1A 5JCLA 4FK1C 3ATRA 3AEFA 1X31B 3UKAA 3M0OA 4D03A 5JCNA 1PJ6A 2WOIA 3NN0X 3PO7A 3GYIA 4TM1A 4USQA 1Y0PA 3FIMB 4X9NA 1S2YA 2BC1A 2A89A 1ZOYA 2WETA 5FS6A 3CMMA 4LA1A 2ACZA 2XLRA 1COYA 3CGBA 1ZX9A 3FPZA 1L9CA 1H84A 3CN8A 4EMWA 2FJEA 1NHRA 3AECA 3LOVA 1BZLA 5FS8A 4DGKA 4J33A 4YSYA 4I58A 3SZCA 2QA2A 4RSLA 4K22A 4AOSA 1M64A 4G6HA 2YWLA 3EPTA 5BUKA 1VDCA 4YTPA 3EANA 3NK0X 2UZZA 3SFDA 4A7AA 4EIPA 2GEWA 1DJQA 3GDPA 2FJAA 4G74A 3UP4A 4Z43A 1ELIA 1PHHA 3V76A 3ATQA 1YY5A 4LU6A 3ICRA 1ZP0A 2XVEA 1ZDLA 3SY4A 1E1KA 3QVPA 4ZCDA 3AE7A 3P9UA 2GVCA 4GDEA 3AEAA 5FS7A 3SGLA 1DOCA 2I0ZA 5JCIA 3KU9A 1F6MA 3DJGX 2JK6A 5U25A 1BGNA 2GR0A 2BXRA 4EQWA 1PXCA 5KWFA 4H4WA 4Z24A 2OALA 4OVIA 2BXSA 1TDKA 2BS2A 3QSEA 4NEVA 2GR1A 2CVJA 2JAEA 3SFEA 4C3YA 3CTYA 1QLBA 1CJ4A 4A6NA 1NG4A 4OPUA 3KD9A 1LVLA 3KKJA 4NNJA 1PJ7A 1HYUA 1N4VA 2JKCA 2V3BA 1LJ1A 3HYXA 3NT6A 4BJYA 4YSXA 1W4XA 1IUUA 2X8GA 3UKFA 4NZHA 4XWRA 2WOVA 1FL2A 5C2TA 1NHSA 1BKWA 5KVHA 3UKLA 2V6OA 4JY3A 1B4VA 3ICTA 3PS9A 3P4PA 3RNMA 3T14A 2TMDA 2WS3A 2FBWA 4MJWA 1F8SA 2A8XA 3FG2P 1S3EA 2YLWA 1JNZA 1GTHA 3B3RA 3ITJA 5JCMA 4Z2UA 3CPHG 2AQJA 1K0JA 3O0HA 3NN6X 4H4XA 3M12A 4K8DA 4EIQA 3T2ZA 3C4NA 2J3NA 5KOWA 1KNRA 1DOBA 3CNTA 4TM3A 5CKUA 1XANA 2WEUA 4JN9A 2BCGG 4U2SA 5J7XA 2XVJA 2BC0A 4GF7A 4NTEA 4I59A 1YQ3A 3DJEA 4H4UA 1GEUA 3ADAB 1D4EA 3BI5A 3VRAA 3AE6A 3C96A 2VZ2A 2YLSA 2AAQA 2GV8A 4KX6A 1TRBA 1CC6A 2EQ9A 2YG6A 4YXDA 1KFYA 3AE9A 1DNCA 3V3OA 4BJZA 2EQ8A 3E1TA 2XLSA 1GRBA 1EL8A 2QAEA 1PXAA 1F8WA 5GRTA 2ZZ0A 4U2LA 3KVEA 3VQRA 2AR8A 2XFPA 1ZOVA 2R0CA 5HY5A 3NLCA 3AYLA 2WHDA 2XFNA 3T31A 1GREA 2GAGB 2JB3A 1ZY8A 2VQ7A 3ALLA 1GSNA 4FDCB 4B66A 3II4A 2GQWA 5TR3A 4EMJA 2WDVA 1H86A 2PHHA 1ZKQA 4CNKA 3LZXA 2XVFA 5EBKA 4CCRA 5EOWA 1TDFA 3CPIG 5KMQA 3IHGA 3UOYA 1BF3A 4NWZA 3LZWA 4BURA 4YKGA 4GDPA 3I6DA 3F8DA 4Z2RA 4H2NA 2ARDA 2V5ZA 2Q0LA 4XXGA 4AT0A 4GAVA 4GAPA 2C70A 2YM2A 3COXA 2R4EA 1GRGA 2TPRA 4JNQA 4AOXA 4EQXA 1VQWA 4D04A 2QCUA 3KA7A 4YSHA 3AE8A 1CL0A 4IVOB 3CGEA 1TDOA 2XLPA 4FK1A 1XPQA 2GMHA 4H4TA 4OCGA 2YLXA 2C7GA 1VRQB 3CNPA 4B63A 1IUTA 4H4QA 1Y56B 4EM3A 4CCQA 4CNJA 2WBAA 4G6GA 3DK4A 3NYEA 4H4ZA 1EL7A 2X99A 4K5SA 2XFUA 2YG4A 2B9XA 1QO8A 2YR4A 2XVIA 3QSMA 4TM0A 5LV9A 1JU2A 3M13A 1TYPA 2BK4A 4CY8A 4Y4LA 2GRTA 3NNEA 1ZMCA 2WU5A 1GT8A 1BGJA
chains in the Genus database with same CATH topology
3ABVA 4A65A 1E6EA 3ZDNA 4A99A 2CDUA 3DJDA 3NHOX 2X50A 4Z25A 2CULA 1CBOA 3K7TA 4B67A 2E4GA 2JB2A 2ZBWA 3BNMA 3KPKA 1PBCA 3NG7X 4ICYA 3AB1A 3EAOA 5BULA 5IQ4A 3DGZA 3GMBA 3BHFA 5KXJA 1Q9IA 3RP7A 1KSUA 1CHUA 2YVJA 1E39A 3CGDA 3DH9A 1D4DA 1EL9A 3DJJA 1CC2A 3GSIA 3EF6A 3R9UA 2FJDA 1IUXA 1DOEA 3F8PA 3T2YA 3UCLA 3IF9A 1CJ3A 1F8RA 5C3JA 4OPCA 3SZWA 2WP6A 2X3NA 4A9WA 2OLNA 2V60A 2DKHA 2C3CA 4BV6A 2RGJA 2RGHA 3G5QA 2X8CA 1OJ9A 2H89A 2XLTA 1O5WA 4ADWA 2PYXA 1GRAA 2BYBA 4FX9A 4H2QA 1D4CA 1B37A 1H6VA 2C64A 1XDIA 2GR2A 2C75A 2WESA 3AXBA 3IHMA 1NAAA 3NK2X 1S2QA 1FCDA 2C73A 2IVDA 3JSKA 3CNJA 2BS3A 1E1LA 2C3DA 3RP6A 4NTDA 4U8IA 4A5LA 1JRZA 1PXBA 4G9KA 3UKHA 4EQRA 3AEBA 2BCPA 2RABA 1SEZA 3L1RA 4JDRA 2Z5XA 2B9YA 3AYJA 4BK3A 4EMIA 2YR5A 3P4SA 2Q0KA 4BK2A 1IUWA 4C77A 1PJ5A 3GWDA 2XFQA 4J2WA 4N9XA 1MOKA 4TM4A 1O95A 3NKSA 4U2TA 3GWFA 1TYTA 4U8KA 2XFOA 3WE0A 1NHPA 2E5VA 1ZMDA 3H8IA 4EM4A 3QFBA 2XDOA 4H7UA 1NDAA 4H2RA 4WX1A 5DBJA 5JCKA 1K4QA 2BABA 1IUSA 2OA1A 2V3AA 2C72A 4TLXA 1JEHA 3VRBA 3LB8A 1GRTA 3NTAA 2YG3A 4J57A 1JOAA 3AD9B 3V3NA 3S5WA 4DSGA 1B5QA 4B1BA 4UP3A 2APGA 1M6IA 2YQUA 3GD3A 3NIXA 1KSSA 4UDQA 1REOA 1Y56A 1PBFA 3UTHA 4II3A 3HYWA 2JBVA 4DNAA 2IIDA 3AE5A 3DK8A 3SZFA 1FEBA 1GESA 1YQ4A 4UDPA 3AWIA 2A87A 2R0PA 3L8KA 4X9MA 2WPEA 3K7MX 3UOVA 2YLRA 1OJAA 2OAMA 1PBBA 4O5QA 1B8SA 1GERA 1NENA 2WU2A 3AE2A 2EQ7A 3QJ4A 5U1OA 5KMSA 2BRAA 2JB1A 3FBSA 2O9ZA 3H4KA 3DK9A 4IV9A 4G73A 2GF3A 2H88A 3ICSA 3GMCA 4H4RA 1F3PA 1PN0A 1GPEA 4U8NA 1LPFA 3AEDA 4U8OA 5IQ1A 5J60A 1EL5A 3BI2A 4DSHA 1GOSA 4AP3A 1JNRA 1NPXA 4B69A 4E0VA 3LADA 3UP5A 1XHCA 2VOUA 1H83A 4CY6A 4IA6A 4H50A 3S61A 2WOWA 4RG4A 3T37A 3VR8A 1D5TA 1Q1RA 2GQFA 2W0HA 5HYMA 2C67A 4U8PA 3SM8A 2B9WA 3SYIA 3OZ2A 3ZYXA 5BVAA 4PAAA 4GR1A 5ER0A 4B64A 1VG0A 4LIIA 1N1PA 1RYIA 1O94A 3C4AA 1JRYA 3URHA 3PVCA 3UOZA 1S3BA 2B7RA 3CNDA 1K0IA 1GTEA 4TLZA 3NTDA 2C66A 1P2HA 3GRSA 3AYIA 3IWAA 2Y6RA 4GUVA 4YWOA 3SX6A 2V61A 1V59A 4YTNA 1LV0A 1PDHA 3QSSA 3AD8B 3DMEA 4OPIA 4REKA 2YLTA 2GAHB 3BNUA 3GD4A 2YVGA 1TDEA 3AE3A 1D7LA 1L9EA 1AOGA 1OJDA 3HZLA 3DGHA 4K5RA 1GRFA 3BHKA 1VG9A 3IC9A 1GXFA 2R0GA 4II2A 4C74A 2ZZCA 3D1CA 4WCTA 4J34A 3UTEA 2WDQA 4OPGA 4ZCCA 3P4RA 1CF3A 5M10A 3P4QA 4USRA 1CJCA 5HHFA 2WPCA 1D7YA 1NG3A 3H8LA 3NRNA 4PABA 2R4JA 4Y4NA 3UKPA 1MXTA 1E1NA 5HXIA 4J31A 1UKVG 3CGCA 1FECA 2YVFA 2B7SA 1LTXR 4K2XA 2XCGA 4AT2A 4IVMB 2GMJA 2NPXA 3GYXA 3SZ0A 4GCMA 5CQFA 3REDA 1PBDA 3NGCX 4H4YA 2BA9A 1CC4A 3GRTA 4Y4MA 2VVLG 2YAUA 4YTMA 3RP8A 4U8MA 2R45A 4M52A 1NEKA 1Q1WA 5KRQA 2F5ZA 5EB4A 2VVLA 1FOHA 3OC4A 4JNAA 3FMWA 1GV4A 3NYCA 4XWZA 3D8XA 2WQYA 2XYOA 4H4PA 3F8RA 4HB9A 1GETA 1IUVA 4X4JA 1DJNA 1FEAA 2GH5A 3GDNA 3CPJG 4C5OA 1RP0A 4JY2A 1Z6LA 1H81A 1H82A 3LJPA 5U63A 2C4CA 2BACA 5FS9A 4HA6A 3BI4A 2C65A 2ZZBA 3AEEA 1H7WA 1CJ2A 4OPDA 1QJDA 4NTCA 4RG3A 2Y6QA 2WDRA 5EB5A 3UKQA 5IPYA 2VRMA 2C76A 1GRHA 2VVMA 3ISHA 3VRDB 4H4SA 4ZN0A 1EBDA 2BK3A 1JRXA 3NYFA 4APNA 3CNSA 4U8LA 1PS9A 2FJBA 4J36A 1KNPA 3T0KA 2XLUA 1RSGA 1N4WA 4Z26A 4P9SA 4CBQA 3QFAA 1ZK7A 2YM1A 4UDRA 3UTFA 4AP1A 3Q6JA 5GSNA 1K0LA 3ALJA 1NHQA 5M0ZA 3SXIA 3UOXA 4KPRA 1L0VA 2BRYA 3GYJA 2GB0A 2GR3A 4OPLA 4B65A 4B68A 4OPTA 3SQPA 4YT0A 1ONFA 2E1MA 4O5UA 4K7ZA 1GALA 5KMPA 3HYVA 4IA5A 4A79A 4YKFA 3KPFA 3VR9A 4A6NB 2EQ6A 2Q6UA 2YR6A 3T2KA 1H7XA 2B76A 3RHAA 3AE4A 2R9ZA 2WP9A 3G5RA 3AE1A 1L9DA 1KDGA 1TDNA 4NEWA 4ECHA 3AEGA 2WP5A 1E7PA 1OJTA 2RGOA 1E1MA 4Z2TA 5BRTA 4C3XA 2WPFA 3P1WA 2DKIA 4YSZA 2BK5A 2Z5YA 4BK1A 3NK1X 5KOXA 2YG7A 2VRLA 2OLOA 2R46A 1BWCA 3UTGA 4EQSA 1MO9A 2XVHA 4GRTA 4H4VA 3ALMA 3DA1A 5FMHA 4Z44A 4JQ9A 1LQUA 4U8JA 1P2EA 5L46A 1N4UA 3Q9TA 3KLJA 5KVIA 5KNLA 2Q7VA 1OJCA 2IVEA 1IJHA 1DODA 1PBEA 3B6DA 3QVRA 4CRTA 3NH3X 2X8HA 1DXLA 5KMRA 1KF6A 3CIRA 2BS4A 4J56A 1YKJA 1YQZA 2YLZA 1LQTA 3LXDA 3I3LA 4H2PA 3UKKA 2NVKX 2VQBA 2YG5A 3K7QX 3AD7B 3G5SA 3K30A 2HQMA 1GNDA 2CFYA 2QA1A 5JCLA 4FK1C 3ATRA 3AEFA 1X31B 3UKAA 3M0OA 4D03A 5JCNA 1PJ6A 2WOIA 3NN0X 3PO7A 3GYIA 4TM1A 4USQA 1Y0PA 3FIMB 4X9NA 1S2YA 2BC1A 2A89A 1ZOYA 2WETA 5FS6A 3CMMA 4LA1A 2ACZA 2XLRA 1COYA 3CGBA 1ZX9A 3FPZA 1L9CA 1H84A 3CN8A 4EMWA 2FJEA 1NHRA 3AECA 3LOVA 1BZLA 5FS8A 4DGKA 4J33A 4YSYA 4I58A 3SZCA 2QA2A 4RSLA 4K22A 4AOSA 1M64A 4G6HA 2YWLA 3EPTA 5BUKA 1VDCA 4YTPA 3EANA 3NK0X 2UZZA 3SFDA 4A7AA 4EIPA 2GEWA 1DJQA 3GDPA 2FJAA 4G74A 3UP4A 4Z43A 1ELIA 1PHHA 3V76A 3ATQA 1YY5A 4LU6A 3ICRA 1ZP0A 2XVEA 1ZDLA 3SY4A 1E1KA 3QVPA 4ZCDA 3AE7A 3P9UA 2GVCA 4GDEA 3AEAA 5FS7A 3SGLA 1DOCA 2I0ZA 5JCIA 3KU9A 1F6MA 3DJGX 2JK6A 5U25A 1BGNA 2GR0A 2BXRA 4EQWA 1PXCA 5KWFA 4H4WA 4Z24A 2OALA 4OVIA 2BXSA 1TDKA 2BS2A 3QSEA 4NEVA 2GR1A 2CVJA 2JAEA 3SFEA 4C3YA 3CTYA 1QLBA 1CJ4A 4A6NA 1NG4A 4OPUA 3KD9A 1LVLA 3KKJA 4NNJA 1PJ7A 1HYUA 1N4VA 2JKCA 2V3BA 1LJ1A 3HYXA 3NT6A 4BJYA 4YSXA 1W4XA 1IUUA 2X8GA 3UKFA 4NZHA 4XWRA 2WOVA 1FL2A 5C2TA 1NHSA 1BKWA 5KVHA 3UKLA 2V6OA 4JY3A 1B4VA 3ICTA 3PS9A 3P4PA 3RNMA 3T14A 2TMDA 2WS3A 2FBWA 4MJWA 1F8SA 2A8XA 3FG2P 1S3EA 2YLWA 1JNZA 1GTHA 3B3RA 3ITJA 5JCMA 4Z2UA 3CPHG 2AQJA 1K0JA 3O0HA 3NN6X 4H4XA 3M12A 4K8DA 4EIQA 3T2ZA 3C4NA 2J3NA 5KOWA 1KNRA 1DOBA 3CNTA 4TM3A 5CKUA 1XANA 2WEUA 4JN9A 2BCGG 4U2SA 5J7XA 2XVJA 2BC0A 4GF7A 4NTEA 4I59A 1YQ3A 3DJEA 4H4UA 1GEUA 3ADAB 1D4EA 3BI5A 3VRAA 3AE6A 3C96A 2VZ2A 2YLSA 2AAQA 2GV8A 4KX6A 1TRBA 1CC6A 2EQ9A 2YG6A 4YXDA 1KFYA 3AE9A 1DNCA 3V3OA 4BJZA 2EQ8A 3E1TA 2XLSA 1GRBA 1EL8A 2QAEA 1PXAA 1F8WA 5GRTA 2ZZ0A 4U2LA 3KVEA 3VQRA 2AR8A 2XFPA 1ZOVA 2R0CA 5HY5A 3NLCA 3AYLA 2WHDA 2XFNA 3T31A 1GREA 2GAGB 2JB3A 1ZY8A 2VQ7A 3ALLA 1GSNA 4FDCB 4B66A 3II4A 2GQWA 5TR3A 4EMJA 2WDVA 1H86A 2PHHA 1ZKQA 4CNKA 3LZXA 2XVFA 5EBKA 4CCRA 5EOWA 1TDFA 3CPIG 5KMQA 3IHGA 3UOYA 1BF3A 4NWZA 3LZWA 4BURA 4YKGA 4GDPA 3I6DA 3F8DA 4Z2RA 4H2NA 2ARDA 2V5ZA 2Q0LA 4XXGA 4AT0A 4GAVA 4GAPA 2C70A 2YM2A 3COXA 2R4EA 1GRGA 2TPRA 4JNQA 4AOXA 4EQXA 1VQWA 4D04A 2QCUA 3KA7A 4YSHA 3AE8A 1CL0A 4IVOB 3CGEA 1TDOA 2XLPA 4FK1A 1XPQA 2GMHA 4H4TA 4OCGA 2YLXA 2C7GA 1VRQB 3CNPA 4B63A 1IUTA 4H4QA 1Y56B 4EM3A 4CCQA 4CNJA 2WBAA 4G6GA 3DK4A 3NYEA 4H4ZA 1EL7A 2X99A 4K5SA 2XFUA 2YG4A 2B9XA 1QO8A 2YR4A 2XVIA 3QSMA 4TM0A 5LV9A 1JU2A 3M13A 1TYPA 2BK4A 4CY8A 4Y4LA 2GRTA 3NNEA 1ZMCA 2WU5A 1GT8A 1BGJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ABV A;  4A65 A;  1E6E A;  3ZDN A;  4A99 A;  2CDU A;  3DJD A;  3NHO X;  2X50 A;  4Z25 A;  2CUL A;  1CBO A;  3K7T A;  4B67 A;  2E4G A;  2JB2 A;  2ZBW A;  3BNM A;  4ICY A;  1PBC A;  3NG7 X;  5BUL A;  3AB1 A;  3EAO A;  5IQ4 A;  3DGZ A;  3GMB A;  3BHF A;  5KXJ A;  1Q9I A;  3RP7 A;  1KSU A;  1CHU A;  2YVJ A;  1E39 A;  3CGD A;  3DH9 A;  1D4D A;  1EL9 A;  3DJJ A;  1CC2 A;  3GSI A;  3EF6 A;  3R9U A;  2FJD A;  1IUX A;  1DOE A;  3F8P A;  3UCL A;  3IF9 A;  1CJ3 A;  1F8R A;  5C3J A;  4OPC A;  2WP6 A;  2X3N A;  4A9W A;  2OLN A;  2V60 A;  2DKH A;  2C3C A;  4BV6 A;  2RGJ A;  2RGH A;  3G5Q A;  2X8C A;  1OJ9 A;  2H89 A;  2XLT A;  1O5W A;  4ADW A;  2PYX A;  1GRA A;  2BYB A;  4FX9 A;  4H2Q A;  1D4C A;  1B37 A;  1H6V A;  2C64 A;  1XDI A;  2GR2 A;  2C75 A;  2WES A;  3AXB A;  3IHM A;  1NAA A;  3NK2 X;  1S2Q A;  1FCD A;  2C73 A;  2IVD A;  3JSK A;  3CNJ A;  2BS3 A;  1E1L A;  2C3D A;  3RP6 A;  4NTD A;  4U8I A;  4A5L A;  1JRZ A;  1PXB A;  3UKH A;  4EQR A;  3AEB A;  2BCP A;  2RAB A;  1SEZ A;  3L1R A;  4JDR A;  2Z5X A;  2B9Y A;  3AYJ A;  4BK3 A;  4EMI A;  2YR5 A;  3P4S A;  2Q0K A;  4BK2 A;  1IUW A;  4C77 A;  1PJ5 A;  3GWD A;  2XFQ A;  4J2W A;  4N9X A;  1MOK A;  4TM4 A;  1O95 A;  3NKS A;  4U2T A;  3GWF A;  1TYT A;  4U8K A;  2XFO A;  3WE0 A;  1NHP A;  2E5V A;  1ZMD A;  3H8I A;  4EM4 A;  3QFB A;  2XDO A;  4H7U A;  1NDA A;  4H2R A;  4WX1 A;  5DBJ A;  5JCK A;  1K4Q A;  2BAB A;  1IUS A;  2OA1 A;  2V3A A;  2C72 A;  4TLX A;  1JEH A;  3VRB A;  3LB8 A;  1GRT A;  3NTA A;  2YG3 A;  4J57 A;  1JOA A;  3AD9 B;  3V3N A;  3S5W A;  4DSG A;  1B5Q A;  4B1B A;  4UP3 A;  2APG A;  1M6I A;  2YQU A;  3GD3 A;  3NIX A;  1KSS A;  4UDQ A;  1REO A;  1Y56 A;  1PBF A;  3UTH A;  2JBV A;  4DNA A;  2IID A;  3AE5 A;  3DK8 A;  1FEB A;  1GES A;  1YQ4 A;  4UDP A;  3AWI A;  2A87 A;  2R0P A;  3L8K A;  4X9M A;  2WPE A;  3K7M X;  3UOV A;  2YLR A;  1OJA A;  2OAM A;  1PBB A;  4O5Q A;  1B8S A;  1GER A;  1NEN A;  2WU2 A;  3AE2 A;  2EQ7 A;  3QJ4 A;  5U1O A;  2JB1 A;  3FBS A;  2O9Z A;  3H4K A;  3DK9 A;  4IV9 A;  2GF3 A;  2H88 A;  3ICS A;  3GMC A;  4H4R A;  1F3P A;  1PN0 A;  1GPE A;  4U8N A;  1LPF A;  3AED A;  4U8O A;  5IQ1 A;  5J60 A;  1EL5 A;  3BI2 A;  4DSH A;  1GOS A;  4AP3 A;  1JNR A;  1NPX A;  4B69 A;  4E0V A;  3LAD A;  3UP5 A;  1XHC A;  2VOU A;  1H83 A;  4CY6 A;  4IA6 A;  4H50 A;  3S61 A;  2WOW A;  4RG4 A;  3T37 A;  3VR8 A;  1D5T A;  1Q1R A;  2GQF A;  2W0H A;  5HYM A;  2C67 A;  4U8P A;  3SM8 A;  2B9W A;  3OZ2 A;  3ZYX A;  5BVA A;  4PAA A;  4GR1 A;  5ER0 A;  4B64 A;  1VG0 A;  4LII A;  1N1P A;  1RYI A;  1O94 A;  3C4A A;  1JRY A;  3URH A;  3PVC A;  3UOZ A;  1S3B A;  2B7R A;  3CND A;  1K0I A;  1GTE A;  4TLZ A;  3NTD A;  2C66 A;  1P2H A;  3GRS A;  3AYI A;  3IWA A;  2Y6R A;  4GUV A;  4YWO A;  2V61 A;  1V59 A;  4YTN A;  1LV0 A;  1PDH A;  3QSS A;  3AD8 B;  3DME A;  4OPI A;  4REK A;  2YLT A;  2GAH B;  3BNU A;  3GD4 A;  2YVG A;  1TDE A;  3AE3 A;  1D7L A;  1L9E A;  1AOG A;  1OJD A;  3HZL A;  3DGH A;  4K5R A;  1GRF A;  3BHK A;  1VG9 A;  3IC9 A;  1GXF A;  2R0G A;  4C74 A;  2ZZC A;  3D1C A;  4WCT A;  4J34 A;  3UTE A;  2WDQ A;  4OPG A;  4ZCC A;  3P4R A;  1CF3 A;  5M10 A;  3P4Q A;  4USR A;  1CJC A;  5HHF A;  2WPC A;  1D7Y A;  1NG3 A;  3H8L A;  3NRN A;  4PAB A;  2R4J A;  4Y4N A;  3UKP A;  1MXT A;  1E1N A;  5HXI A;  4J31 A;  1UKV G;  3CGC A;  1FEC A;  2YVF A;  2B7S A;  1LTX R;  4K2X A;  2XCG A;  4AT2 A;  4IVM B;  2GMJ A;  2NPX A;  4GCM A;  5CQF A;  3RED A;  1PBD A;  3NGC X;  4H4Y A;  2BA9 A;  1CC4 A;  3GRT A;  4Y4M A;  2VVL G;  2YAU A;  4YTM A;  3RP8 A;  4U8M A;  2R45 A;  4M52 A;  1NEK A;  1Q1W A;  5KRQ A;  2F5Z A;  5EB4 A;  2VVL A;  1FOH A;  3OC4 A;  4JNA A;  3FMW A;  1GV4 A;  3NYC A;  4XWZ A;  3D8X A;  2WQY A;  2XYO A;  4H4P A;  3F8R A;  4HB9 A;  1GET A;  1IUV A;  4X4J A;  1DJN A;  1FEA A;  2GH5 A;  3GDN A;  3CPJ G;  4C5O A;  1RP0 A;  4JY2 A;  1Z6L A;  1H81 A;  1H82 A;  3LJP A;  5U63 A;  2BAC A;  5FS9 A;  4HA6 A;  3BI4 A;  2C65 A;  2ZZB A;  3AEE A;  1H7W A;  1CJ2 A;  4OPD A;  1QJD A;  4NTC A;  4RG3 A;  2Y6Q A;  2WDR A;  5EB5 A;  3UKQ A;  5IPY A;  2VRM A;  2C76 A;  1GRH A;  2VVM A;  3ISH A;  3VRD B;  4H4S A;  4ZN0 A;  1EBD A;  2BK3 A;  1JRX A;  3NYF A;  4APN A;  3CNS A;  4U8L A;  1PS9 A;  2FJB A;  4J36 A;  1KNP A;  2XLU A;  1RSG A;  1N4W A;  4Z26 A;  4P9S A;  4CBQ A;  3QFA A;  1ZK7 A;  2YM1 A;  4UDR A;  3UTF A;  4AP1 A;  3Q6J A;  5GSN A;  1K0L A;  3ALJ A;  1NHQ A;  5M0Z A;  3UOX A;  4KPR A;  1L0V A;  3GYJ A;  2GB0 A;  2GR3 A;  4OPL A;  4B65 A;  4B68 A;  4OPT A;  3SQP A;  4YT0 A;  1ONF A;  2E1M A;  4O5U A;  4K7Z A;  1GAL A;  4IA5 A;  4A79 A;  4YKF A;  3KPF A;  3VR9 A;  4A6N B;  2EQ6 A;  2Q6U A;  2YR6 A;  1H7X A;  2B76 A;  3RHA A;  3AE4 A;  2R9Z A;  2WP9 A;  3G5R A;  3AE1 A;  1L9D A;  1KDG A;  1TDN A;  4NEW A;  4ECH A;  3AEG A;  2WP5 A;  1E7P A;  1OJT A;  2RGO A;  1E1M A;  4Z2T A;  5BRT A;  4C3X A;  2WPF A;  3P1W A;  2DKI A;  4YSZ A;  2BK5 A;  2Z5Y A;  4BK1 A;  3NK1 X;  5KOX A;  2YG7 A;  2VRL A;  2OLO A;  2R46 A;  1BWC A;  3UTG A;  4EQS A;  1MO9 A;  2XVH A;  4GRT A;  4H4V A;  3ALM A;  3DA1 A;  5FMH A;  4Z44 A;  4JQ9 A;  1LQU A;  4U8J A;  1P2E A;  5L46 A;  1N4U A;  3Q9T A;  3KLJ A;  5KVI A;  2Q7V A;  1OJC A;  2IVE A;  1IJH A;  1DOD A;  1PBE A;  3B6D A;  3QVR A;  4CRT A;  3NH3 X;  2X8H A;  1DXL A;  1KF6 A;  3CIR A;  2BS4 A;  4J56 A;  1YKJ A;  1YQZ A;  2YLZ A;  1LQT A;  3LXD A;  3I3L A;  4H2P A;  3UKK A;  2NVK X;  2VQB A;  2YG5 A;  3K7Q X;  3AD7 B;  3G5S A;  3K30 A;  2HQM A;  1GND A;  2CFY A;  2QA1 A;  5JCL A;  4FK1 C;  3ATR A;  3AEF A;  1X31 B;  3UKA A;  3M0O A;  4D03 A;  5JCN A;  1PJ6 A;  2WOI A;  3NN0 X;  3PO7 A;  3GYI A;  4TM1 A;  4USQ A;  1Y0P A;  3FIM B;  4X9N A;  1S2Y A;  2BC1 A;  2A89 A;  1ZOY A;  2WET A;  5FS6 A;  4LA1 A;  2ACZ A;  2XLR A;  1COY A;  3CGB A;  1ZX9 A;  3FPZ A;  1L9C A;  1H84 A;  3CN8 A;  4EMW A;  2FJE A;  1NHR A;  3AEC A;  3LOV A;  1BZL A;  5FS8 A;  4DGK A;  4J33 A;  4YSY A;  4I58 A;  2QA2 A;  4RSL A;  4K22 A;  4AOS A;  1M64 A;  2YWL A;  3EPT A;  5BUK A;  1VDC A;  4YTP A;  3EAN A;  3NK0 X;  2UZZ A;  3SFD A;  4A7A A;  4EIP A;  2GEW A;  1DJQ A;  3GDP A;  2FJA A;  3UP4 A;  4Z43 A;  1ELI A;  1PHH A;  3V76 A;  3ATQ A;  1YY5 A;  4LU6 A;  3ICR A;  1ZP0 A;  2XVE A;  1ZDL A;  1E1K A;  3QVP A;  4ZCD A;  3AE7 A;  3P9U A;  2GVC A;  4GDE A;  3AEA A;  5FS7 A;  3SGL A;  1DOC A;  2I0Z A;  5JCI A;  3KU9 A;  1F6M A;  3DJG X;  2JK6 A;  5U25 A;  1BGN A;  2GR0 A;  2BXR A;  4EQW A;  1PXC A;  5KWF A;  4H4W A;  4Z24 A;  2OAL A;  4OVI A;  2BXS A;  1TDK A;  2BS2 A;  3QSE A;  4NEV A;  2GR1 A;  2CVJ A;  2JAE A;  3SFE A;  4C3Y A;  3CTY A;  1QLB A;  1CJ4 A;  4A6N A;  1NG4 A;  4OPU A;  3KD9 A;  1LVL A;  3KKJ A;  4CNJ A;  1PJ7 A;  1HYU A;  1N4V A;  2JKC A;  2V3B A;  1LJ1 A;  3NT6 A;  4BJY A;  4YSX A;  1W4X A;  1IUU A;  2X8G A;  3UKF A;  4NZH A;  4XWR A;  2WOV A;  1FL2 A;  5C2T A;  1NHS A;  1BKW A;  5KVH A;  3UKL A;  2V6O A;  4JY3 A;  1B4V A;  3ICT A;  3PS9 A;  3P4P A;  3RNM A;  2TMD A;  2WS3 A;  2FBW A;  4MJW A;  1F8S A;  2A8X A;  3FG2 P;  1S3E A;  2YLW A;  1JNZ A;  1GTH A;  3B3R A;  3ITJ A;  5JCM A;  4Z2U A;  3CPH G;  2AQJ A;  1K0J A;  3O0H A;  3NN6 X;  4H4X A;  3M12 A;  4K8D A;  3C4N A;  2J3N A;  5KOW A;  1KNR A;  1DOB A;  3CNT A;  4TM3 A;  5CKU A;  1XAN A;  2WEU A;  4JN9 A;  2BCG G;  4U2S A;  5J7X A;  2XVJ A;  2BC0 A;  4GF7 A;  4NTE A;  4I59 A;  1YQ3 A;  3DJE A;  4H4U A;  1GEU A;  3ADA B;  1D4E A;  3BI5 A;  3VRA A;  3AE6 A;  3C96 A;  2VZ2 A;  2YLS A;  2AAQ A;  2GV8 A;  4KX6 A;  1TRB A;  1CC6 A;  2EQ9 A;  2YG6 A;  4YXD A;  1KFY A;  3AE9 A;  1DNC A;  3V3O A;  4BJZ A;  2EQ8 A;  3E1T A;  2XLS A;  1GRB A;  1EL8 A;  2QAE A;  1PXA A;  1F8W A;  5GRT A;  2ZZ0 A;  4U2L A;  3KVE A;  3VQR A;  2AR8 A;  2XFP A;  1ZOV A;  2R0C A;  5HY5 A;  3NLC A;  3AYL A;  2WHD A;  2XFN A;  1GRE A;  2GAG B;  2JB3 A;  1ZY8 A;  2VQ7 A;  3ALL A;  1GSN A;  4FDC B;  4B66 A;  3II4 A;  2GQW A;  5TR3 A;  4EMJ A;  2WDV A;  1H86 A;  2PHH A;  1ZKQ A;  4CNK A;  3LZX A;  2XVF A;  5EBK A;  4CCR A;  5EOW A;  1TDF A;  3CPI G;  3IHG A;  3UOY A;  1BF3 A;  3LZW A;  4BUR A;  4YKG A;  4GDP A;  3I6D A;  3F8D A;  4Z2R A;  4H2N A;  2ARD A;  2V5Z A;  2Q0L A;  4XXG A;  4AT0 A;  4EIQ A;  4JNQ A;  2C70 A;  2YM2 A;  3COX A;  2R4E A;  1GRG A;  2TPR A;  4EQX A;  4AOX A;  1VQW A;  4D04 A;  2QCU A;  3KA7 A;  4YSH A;  3AE8 A;  1CL0 A;  4IVO B;  3CGE A;  1TDO A;  2XLP A;  4FK1 A;  1XPQ A;  2GMH A;  4H4T A;  4OCG A;  2YLX A;  2C7G A;  1VRQ B;  3CNP A;  4B63 A;  1IUT A;  4H4Q A;  1Y56 B;  4EM3 A;  4CCQ A;  2WBA A;  3DK4 A;  3NYE A;  4H4Z A;  1EL7 A;  2X99 A;  4K5S A;  2XFU A;  2YG4 A;  2B9X A;  1QO8 A;  2YR4 A;  2XVI A;  3QSM A;  4TM0 A;  5LV9 A;  1JU2 A;  3M13 A;  1TYP A;  2BK4 A;  4CY8 A;  4Y4L A;  2GRT A;  3NNE A;  1ZMC A;  2WU5 A;  1GT8 A;  1BGJ A; 
#chains in the Genus database with same CATH topology
 3ABV A;  4A65 A;  1E6E A;  3ZDN A;  4A99 A;  2CDU A;  3DJD A;  3NHO X;  2X50 A;  4Z25 A;  2CUL A;  1CBO A;  3K7T A;  4B67 A;  2E4G A;  2JB2 A;  2ZBW A;  3BNM A;  3KPK A;  1PBC A;  3NG7 X;  4ICY A;  3AB1 A;  3EAO A;  5BUL A;  5IQ4 A;  3DGZ A;  3GMB A;  3BHF A;  5KXJ A;  1Q9I A;  3RP7 A;  1KSU A;  1CHU A;  2YVJ A;  1E39 A;  3CGD A;  3DH9 A;  1D4D A;  1EL9 A;  3DJJ A;  1CC2 A;  3GSI A;  3EF6 A;  3R9U A;  2FJD A;  1IUX A;  1DOE A;  3F8P A;  3T2Y A;  3UCL A;  3IF9 A;  1CJ3 A;  1F8R A;  5C3J A;  4OPC A;  3SZW A;  2WP6 A;  2X3N A;  4A9W A;  2OLN A;  2V60 A;  2DKH A;  2C3C A;  4BV6 A;  2RGJ A;  2RGH A;  3G5Q A;  2X8C A;  1OJ9 A;  2H89 A;  2XLT A;  1O5W A;  4ADW A;  2PYX A;  1GRA A;  2BYB A;  4FX9 A;  4H2Q A;  1D4C A;  1B37 A;  1H6V A;  2C64 A;  1XDI A;  2GR2 A;  2C75 A;  2WES A;  3AXB A;  3IHM A;  1NAA A;  3NK2 X;  1S2Q A;  1FCD A;  2C73 A;  2IVD A;  3JSK A;  3CNJ A;  2BS3 A;  1E1L A;  2C3D A;  3RP6 A;  4NTD A;  4U8I A;  4A5L A;  1JRZ A;  1PXB A;  4G9K A;  3UKH A;  4EQR A;  3AEB A;  2BCP A;  2RAB A;  1SEZ A;  3L1R A;  4JDR A;  2Z5X A;  2B9Y A;  3AYJ A;  4BK3 A;  4EMI A;  2YR5 A;  3P4S A;  2Q0K A;  4BK2 A;  1IUW A;  4C77 A;  1PJ5 A;  3GWD A;  2XFQ A;  4J2W A;  4N9X A;  1MOK A;  4TM4 A;  1O95 A;  3NKS A;  4U2T A;  3GWF A;  1TYT A;  4U8K A;  2XFO A;  3WE0 A;  1NHP A;  2E5V A;  1ZMD A;  3H8I A;  4EM4 A;  3QFB A;  2XDO A;  4H7U A;  1NDA A;  4H2R A;  4WX1 A;  5DBJ A;  5JCK A;  1K4Q A;  2BAB A;  1IUS A;  2OA1 A;  2V3A A;  2C72 A;  4TLX A;  1JEH A;  3VRB A;  3LB8 A;  1GRT A;  3NTA A;  2YG3 A;  4J57 A;  1JOA A;  3AD9 B;  3V3N A;  3S5W A;  4DSG A;  1B5Q A;  4B1B A;  4UP3 A;  2APG A;  1M6I A;  2YQU A;  3GD3 A;  3NIX A;  1KSS A;  4UDQ A;  1REO A;  1Y56 A;  1PBF A;  3UTH A;  4II3 A;  3HYW A;  2JBV A;  4DNA A;  2IID A;  3AE5 A;  3DK8 A;  3SZF A;  1FEB A;  1GES A;  1YQ4 A;  4UDP A;  3AWI A;  2A87 A;  2R0P A;  3L8K A;  4X9M A;  2WPE A;  3K7M X;  3UOV A;  2YLR A;  1OJA A;  2OAM A;  1PBB A;  4O5Q A;  1B8S A;  1GER A;  1NEN A;  2WU2 A;  3AE2 A;  2EQ7 A;  3QJ4 A;  5U1O A;  5KMS A;  2BRA A;  2JB1 A;  3FBS A;  2O9Z A;  3H4K A;  3DK9 A;  4IV9 A;  4G73 A;  2GF3 A;  2H88 A;  3ICS A;  3GMC A;  4H4R A;  1F3P A;  1PN0 A;  1GPE A;  4U8N A;  1LPF A;  3AED A;  4U8O A;  5IQ1 A;  5J60 A;  1EL5 A;  3BI2 A;  4DSH A;  1GOS A;  4AP3 A;  1JNR A;  1NPX A;  4B69 A;  4E0V A;  3LAD A;  3UP5 A;  1XHC A;  2VOU A;  1H83 A;  4CY6 A;  4IA6 A;  4H50 A;  3S61 A;  2WOW A;  4RG4 A;  3T37 A;  3VR8 A;  1D5T A;  1Q1R A;  2GQF A;  2W0H A;  5HYM A;  2C67 A;  4U8P A;  3SM8 A;  2B9W A;  3SYI A;  3OZ2 A;  3ZYX A;  5BVA A;  4PAA A;  4GR1 A;  5ER0 A;  4B64 A;  1VG0 A;  4LII A;  1N1P A;  1RYI A;  1O94 A;  3C4A A;  1JRY A;  3URH A;  3PVC A;  3UOZ A;  1S3B A;  2B7R A;  3CND A;  1K0I A;  1GTE A;  4TLZ A;  3NTD A;  2C66 A;  1P2H A;  3GRS A;  3AYI A;  3IWA A;  2Y6R A;  4GUV A;  4YWO A;  3SX6 A;  2V61 A;  1V59 A;  4YTN A;  1LV0 A;  1PDH A;  3QSS A;  3AD8 B;  3DME A;  4OPI A;  4REK A;  2YLT A;  2GAH B;  3BNU A;  3GD4 A;  2YVG A;  1TDE A;  3AE3 A;  1D7L A;  1L9E A;  1AOG A;  1OJD A;  3HZL A;  3DGH A;  4K5R A;  1GRF A;  3BHK A;  1VG9 A;  3IC9 A;  1GXF A;  2R0G A;  4II2 A;  4C74 A;  2ZZC A;  3D1C A;  4WCT A;  4J34 A;  3UTE A;  2WDQ A;  4OPG A;  4ZCC A;  3P4R A;  1CF3 A;  5M10 A;  3P4Q A;  4USR A;  1CJC A;  5HHF A;  2WPC A;  1D7Y A;  1NG3 A;  3H8L A;  3NRN A;  4PAB A;  2R4J A;  4Y4N A;  3UKP A;  1MXT A;  1E1N A;  5HXI A;  4J31 A;  1UKV G;  3CGC A;  1FEC A;  2YVF A;  2B7S A;  1LTX R;  4K2X A;  2XCG A;  4AT2 A;  4IVM B;  2GMJ A;  2NPX A;  3GYX A;  3SZ0 A;  4GCM A;  5CQF A;  3RED A;  1PBD A;  3NGC X;  4H4Y A;  2BA9 A;  1CC4 A;  3GRT A;  4Y4M A;  2VVL G;  2YAU A;  4YTM A;  3RP8 A;  4U8M A;  2R45 A;  4M52 A;  1NEK A;  1Q1W A;  5KRQ A;  2F5Z A;  5EB4 A;  2VVL A;  1FOH A;  3OC4 A;  4JNA A;  3FMW A;  1GV4 A;  3NYC A;  4XWZ A;  3D8X A;  2WQY A;  2XYO A;  4H4P A;  3F8R A;  4HB9 A;  1GET A;  1IUV A;  4X4J A;  1DJN A;  1FEA A;  2GH5 A;  3GDN A;  3CPJ G;  4C5O A;  1RP0 A;  4JY2 A;  1Z6L A;  1H81 A;  1H82 A;  3LJP A;  5U63 A;  2C4C A;  2BAC A;  5FS9 A;  4HA6 A;  3BI4 A;  2C65 A;  2ZZB A;  3AEE A;  1H7W A;  1CJ2 A;  4OPD A;  1QJD A;  4NTC A;  4RG3 A;  2Y6Q A;  2WDR A;  5EB5 A;  3UKQ A;  5IPY A;  2VRM A;  2C76 A;  1GRH A;  2VVM A;  3ISH A;  3VRD B;  4H4S A;  4ZN0 A;  1EBD A;  2BK3 A;  1JRX A;  3NYF A;  4APN A;  3CNS A;  4U8L A;  1PS9 A;  2FJB A;  4J36 A;  1KNP A;  3T0K A;  2XLU A;  1RSG A;  1N4W A;  4Z26 A;  4P9S A;  4CBQ A;  3QFA A;  1ZK7 A;  2YM1 A;  4UDR A;  3UTF A;  4AP1 A;  3Q6J A;  5GSN A;  1K0L A;  3ALJ A;  1NHQ A;  5M0Z A;  3SXI A;  3UOX A;  4KPR A;  1L0V A;  2BRY A;  3GYJ A;  2GB0 A;  2GR3 A;  4OPL A;  4B65 A;  4B68 A;  4OPT A;  3SQP A;  4YT0 A;  1ONF A;  2E1M A;  4O5U A;  4K7Z A;  1GAL A;  5KMP A;  3HYV A;  4IA5 A;  4A79 A;  4YKF A;  3KPF A;  3VR9 A;  4A6N B;  2EQ6 A;  2Q6U A;  2YR6 A;  3T2K A;  1H7X A;  2B76 A;  3RHA A;  3AE4 A;  2R9Z A;  2WP9 A;  3G5R A;  3AE1 A;  1L9D A;  1KDG A;  1TDN A;  4NEW A;  4ECH A;  3AEG A;  2WP5 A;  1E7P A;  1OJT A;  2RGO A;  1E1M A;  4Z2T A;  5BRT A;  4C3X A;  2WPF A;  3P1W A;  2DKI A;  4YSZ A;  2BK5 A;  2Z5Y A;  4BK1 A;  3NK1 X;  5KOX A;  2YG7 A;  2VRL A;  2OLO A;  2R46 A;  1BWC A;  3UTG A;  4EQS A;  1MO9 A;  2XVH A;  4GRT A;  4H4V A;  3ALM A;  3DA1 A;  5FMH A;  4Z44 A;  4JQ9 A;  1LQU A;  4U8J A;  1P2E A;  5L46 A;  1N4U A;  3Q9T A;  3KLJ A;  5KVI A;  5KNL A;  2Q7V A;  1OJC A;  2IVE A;  1IJH A;  1DOD A;  1PBE A;  3B6D A;  3QVR A;  4CRT A;  3NH3 X;  2X8H A;  1DXL A;  5KMR A;  1KF6 A;  3CIR A;  2BS4 A;  4J56 A;  1YKJ A;  1YQZ A;  2YLZ A;  1LQT A;  3LXD A;  3I3L A;  4H2P A;  3UKK A;  2NVK X;  2VQB A;  2YG5 A;  3K7Q X;  3AD7 B;  3G5S A;  3K30 A;  2HQM A;  1GND A;  2CFY A;  2QA1 A;  5JCL A;  4FK1 C;  3ATR A;  3AEF A;  1X31 B;  3UKA A;  3M0O A;  4D03 A;  5JCN A;  1PJ6 A;  2WOI A;  3NN0 X;  3PO7 A;  3GYI A;  4TM1 A;  4USQ A;  1Y0P A;  3FIM B;  4X9N A;  1S2Y A;  2BC1 A;  2A89 A;  1ZOY A;  2WET A;  5FS6 A;  3CMM A;  4LA1 A;  2ACZ A;  2XLR A;  1COY A;  3CGB A;  1ZX9 A;  3FPZ A;  1L9C A;  1H84 A;  3CN8 A;  4EMW A;  2FJE A;  1NHR A;  3AEC A;  3LOV A;  1BZL A;  5FS8 A;  4DGK A;  4J33 A;  4YSY A;  4I58 A;  3SZC A;  2QA2 A;  4RSL A;  4K22 A;  4AOS A;  1M64 A;  4G6H A;  2YWL A;  3EPT A;  5BUK A;  1VDC A;  4YTP A;  3EAN A;  3NK0 X;  2UZZ A;  3SFD A;  4A7A A;  4EIP A;  2GEW A;  1DJQ A;  3GDP A;  2FJA A;  4G74 A;  3UP4 A;  4Z43 A;  1ELI A;  1PHH A;  3V76 A;  3ATQ A;  1YY5 A;  4LU6 A;  3ICR A;  1ZP0 A;  2XVE A;  1ZDL A;  3SY4 A;  1E1K A;  3QVP A;  4ZCD A;  3AE7 A;  3P9U A;  2GVC A;  4GDE A;  3AEA A;  5FS7 A;  3SGL A;  1DOC A;  2I0Z A;  5JCI A;  3KU9 A;  1F6M A;  3DJG X;  2JK6 A;  5U25 A;  1BGN A;  2GR0 A;  2BXR A;  4EQW A;  1PXC A;  5KWF A;  4H4W A;  4Z24 A;  2OAL A;  4OVI A;  2BXS A;  1TDK A;  2BS2 A;  3QSE A;  4NEV A;  2GR1 A;  2CVJ A;  2JAE A;  3SFE A;  4C3Y A;  3CTY A;  1QLB A;  1CJ4 A;  4A6N A;  1NG4 A;  4OPU A;  3KD9 A;  1LVL A;  3KKJ A;  4NNJ A;  1PJ7 A;  1HYU A;  1N4V A;  2JKC A;  2V3B A;  1LJ1 A;  3HYX A;  3NT6 A;  4BJY A;  4YSX A;  1W4X A;  1IUU A;  2X8G A;  3UKF A;  4NZH A;  4XWR A;  2WOV A;  1FL2 A;  5C2T A;  1NHS A;  1BKW A;  5KVH A;  3UKL A;  2V6O A;  4JY3 A;  1B4V A;  3ICT A;  3PS9 A;  3P4P A;  3RNM A;  3T14 A;  2TMD A;  2WS3 A;  2FBW A;  4MJW A;  1F8S A;  2A8X A;  3FG2 P;  1S3E A;  2YLW A;  1JNZ A;  1GTH A;  3B3R A;  3ITJ A;  5JCM A;  4Z2U A;  3CPH G;  2AQJ A;  1K0J A;  3O0H A;  3NN6 X;  4H4X A;  3M12 A;  4K8D A;  4EIQ A;  3T2Z A;  3C4N A;  2J3N A;  5KOW A;  1KNR A;  1DOB A;  3CNT A;  4TM3 A;  5CKU A;  1XAN A;  2WEU A;  4JN9 A;  2BCG G;  4U2S A;  5J7X A;  2XVJ A;  2BC0 A;  4GF7 A;  4NTE A;  4I59 A;  1YQ3 A;  3DJE A;  4H4U A;  1GEU A;  3ADA B;  1D4E A;  3BI5 A;  3VRA A;  3AE6 A;  3C96 A;  2VZ2 A;  2YLS A;  2AAQ A;  2GV8 A;  4KX6 A;  1TRB A;  1CC6 A;  2EQ9 A;  2YG6 A;  4YXD A;  1KFY A;  3AE9 A;  1DNC A;  3V3O A;  4BJZ A;  2EQ8 A;  3E1T A;  2XLS A;  1GRB A;  1EL8 A;  2QAE A;  1PXA A;  1F8W A;  5GRT A;  2ZZ0 A;  4U2L A;  3KVE A;  3VQR A;  2AR8 A;  2XFP A;  1ZOV A;  2R0C A;  5HY5 A;  3NLC A;  3AYL A;  2WHD A;  2XFN A;  3T31 A;  1GRE A;  2GAG B;  2JB3 A;  1ZY8 A;  2VQ7 A;  3ALL A;  1GSN A;  4FDC B;  4B66 A;  3II4 A;  2GQW A;  5TR3 A;  4EMJ A;  2WDV A;  1H86 A;  2PHH A;  1ZKQ A;  4CNK A;  3LZX A;  2XVF A;  5EBK A;  4CCR A;  5EOW A;  1TDF A;  3CPI G;  5KMQ A;  3IHG A;  3UOY A;  1BF3 A;  4NWZ A;  3LZW A;  4BUR A;  4YKG A;  4GDP A;  3I6D A;  3F8D A;  4Z2R A;  4H2N A;  2ARD A;  2V5Z A;  2Q0L A;  4XXG A;  4AT0 A;  4GAV A;  4GAP A;  2C70 A;  2YM2 A;  3COX A;  2R4E A;  1GRG A;  2TPR A;  4JNQ A;  4AOX A;  4EQX A;  1VQW A;  4D04 A;  2QCU A;  3KA7 A;  4YSH A;  3AE8 A;  1CL0 A;  4IVO B;  3CGE A;  1TDO A;  2XLP A;  4FK1 A;  1XPQ A;  2GMH A;  4H4T A;  4OCG A;  2YLX A;  2C7G A;  1VRQ B;  3CNP A;  4B63 A;  1IUT A;  4H4Q A;  1Y56 B;  4EM3 A;  4CCQ A;  4CNJ A;  2WBA A;  4G6G A;  3DK4 A;  3NYE A;  4H4Z A;  1EL7 A;  2X99 A;  4K5S A;  2XFU A;  2YG4 A;  2B9X A;  1QO8 A;  2YR4 A;  2XVI A;  3QSM A;  4TM0 A;  5LV9 A;  1JU2 A;  3M13 A;  1TYP A;  2BK4 A;  4CY8 A;  4Y4L A;  2GRT A;  3NNE A;  1ZMC A;  2WU5 A;  1GT8 A;  1BGJ A; 
#chains in the Genus database with same CATH homology
 3ABV A;  4A65 A;  1E6E A;  3ZDN A;  4A99 A;  2CDU A;  3DJD A;  3NHO X;  2X50 A;  4Z25 A;  2CUL A;  1CBO A;  3K7T A;  4B67 A;  2E4G A;  2JB2 A;  2ZBW A;  3BNM A;  3KPK A;  1PBC A;  3NG7 X;  4ICY A;  3AB1 A;  3EAO A;  5BUL A;  5IQ4 A;  3DGZ A;  3GMB A;  3BHF A;  5KXJ A;  1Q9I A;  3RP7 A;  1KSU A;  1CHU A;  2YVJ A;  1E39 A;  3CGD A;  3DH9 A;  1D4D A;  1EL9 A;  3DJJ A;  1CC2 A;  3GSI A;  3EF6 A;  3R9U A;  2FJD A;  1IUX A;  1DOE A;  3F8P A;  3T2Y A;  3UCL A;  3IF9 A;  1CJ3 A;  1F8R A;  5C3J A;  4OPC A;  3SZW A;  2WP6 A;  2X3N A;  4A9W A;  2OLN A;  2V60 A;  2DKH A;  2C3C A;  4BV6 A;  2RGJ A;  2RGH A;  3G5Q A;  2X8C A;  1OJ9 A;  2H89 A;  2XLT A;  1O5W A;  4ADW A;  2PYX A;  1GRA A;  2BYB A;  4FX9 A;  4H2Q A;  1D4C A;  1B37 A;  1H6V A;  2C64 A;  1XDI A;  2GR2 A;  2C75 A;  2WES A;  3AXB A;  3IHM A;  1NAA A;  3NK2 X;  1S2Q A;  1FCD A;  2C73 A;  2IVD A;  3JSK A;  3CNJ A;  2BS3 A;  1E1L A;  2C3D A;  3RP6 A;  4NTD A;  4U8I A;  4A5L A;  1JRZ A;  1PXB A;  4G9K A;  3UKH A;  4EQR A;  3AEB A;  2BCP A;  2RAB A;  1SEZ A;  3L1R A;  4JDR A;  2Z5X A;  2B9Y A;  3AYJ A;  4BK3 A;  4EMI A;  2YR5 A;  3P4S A;  2Q0K A;  4BK2 A;  1IUW A;  4C77 A;  1PJ5 A;  3GWD A;  2XFQ A;  4J2W A;  4N9X A;  1MOK A;  4TM4 A;  1O95 A;  3NKS A;  4U2T A;  3GWF A;  1TYT A;  4U8K A;  2XFO A;  3WE0 A;  1NHP A;  2E5V A;  1ZMD A;  3H8I A;  4EM4 A;  3QFB A;  2XDO A;  4H7U A;  1NDA A;  4H2R A;  4WX1 A;  5DBJ A;  5JCK A;  1K4Q A;  2BAB A;  1IUS A;  2OA1 A;  2V3A A;  2C72 A;  4TLX A;  1JEH A;  3VRB A;  3LB8 A;  1GRT A;  3NTA A;  2YG3 A;  4J57 A;  1JOA A;  3AD9 B;  3V3N A;  3S5W A;  4DSG A;  1B5Q A;  4B1B A;  4UP3 A;  2APG A;  1M6I A;  2YQU A;  3GD3 A;  3NIX A;  1KSS A;  4UDQ A;  1REO A;  1Y56 A;  1PBF A;  3UTH A;  4II3 A;  3HYW A;  2JBV A;  4DNA A;  2IID A;  3AE5 A;  3DK8 A;  3SZF A;  1FEB A;  1GES A;  1YQ4 A;  4UDP A;  3AWI A;  2A87 A;  2R0P A;  3L8K A;  4X9M A;  2WPE A;  3K7M X;  3UOV A;  2YLR A;  1OJA A;  2OAM A;  1PBB A;  4O5Q A;  1B8S A;  1GER A;  1NEN A;  2WU2 A;  3AE2 A;  2EQ7 A;  3QJ4 A;  5U1O A;  5KMS A;  2BRA A;  2JB1 A;  3FBS A;  2O9Z A;  3H4K A;  3DK9 A;  4IV9 A;  4G73 A;  2GF3 A;  2H88 A;  3ICS A;  3GMC A;  4H4R A;  1F3P A;  1PN0 A;  1GPE A;  4U8N A;  1LPF A;  3AED A;  4U8O A;  5IQ1 A;  5J60 A;  1EL5 A;  3BI2 A;  4DSH A;  1GOS A;  4AP3 A;  1JNR A;  1NPX A;  4B69 A;  4E0V A;  3LAD A;  3UP5 A;  1XHC A;  2VOU A;  1H83 A;  4CY6 A;  4IA6 A;  4H50 A;  3S61 A;  2WOW A;  4RG4 A;  3T37 A;  3VR8 A;  1D5T A;  1Q1R A;  2GQF A;  2W0H A;  5HYM A;  2C67 A;  4U8P A;  3SM8 A;  2B9W A;  3SYI A;  3OZ2 A;  3ZYX A;  5BVA A;  4PAA A;  4GR1 A;  5ER0 A;  4B64 A;  1VG0 A;  4LII A;  1N1P A;  1RYI A;  1O94 A;  3C4A A;  1JRY A;  3URH A;  3PVC A;  3UOZ A;  1S3B A;  2B7R A;  3CND A;  1K0I A;  1GTE A;  4TLZ A;  3NTD A;  2C66 A;  1P2H A;  3GRS A;  3AYI A;  3IWA A;  2Y6R A;  4GUV A;  4YWO A;  3SX6 A;  2V61 A;  1V59 A;  4YTN A;  1LV0 A;  1PDH A;  3QSS A;  3AD8 B;  3DME A;  4OPI A;  4REK A;  2YLT A;  2GAH B;  3BNU A;  3GD4 A;  2YVG A;  1TDE A;  3AE3 A;  1D7L A;  1L9E A;  1AOG A;  1OJD A;  3HZL A;  3DGH A;  4K5R A;  1GRF A;  3BHK A;  1VG9 A;  3IC9 A;  1GXF A;  2R0G A;  4II2 A;  4C74 A;  2ZZC A;  3D1C A;  4WCT A;  4J34 A;  3UTE A;  2WDQ A;  4OPG A;  4ZCC A;  3P4R A;  1CF3 A;  5M10 A;  3P4Q A;  4USR A;  1CJC A;  5HHF A;  2WPC A;  1D7Y A;  1NG3 A;  3H8L A;  3NRN A;  4PAB A;  2R4J A;  4Y4N A;  3UKP A;  1MXT A;  1E1N A;  5HXI A;  4J31 A;  1UKV G;  3CGC A;  1FEC A;  2YVF A;  2B7S A;  1LTX R;  4K2X A;  2XCG A;  4AT2 A;  4IVM B;  2GMJ A;  2NPX A;  3GYX A;  3SZ0 A;  4GCM A;  5CQF A;  3RED A;  1PBD A;  3NGC X;  4H4Y A;  2BA9 A;  1CC4 A;  3GRT A;  4Y4M A;  2VVL G;  2YAU A;  4YTM A;  3RP8 A;  4U8M A;  2R45 A;  4M52 A;  1NEK A;  1Q1W A;  5KRQ A;  2F5Z A;  5EB4 A;  2VVL A;  1FOH A;  3OC4 A;  4JNA A;  3FMW A;  1GV4 A;  3NYC A;  4XWZ A;  3D8X A;  2WQY A;  2XYO A;  4H4P A;  3F8R A;  4HB9 A;  1GET A;  1IUV A;  4X4J A;  1DJN A;  1FEA A;  2GH5 A;  3GDN A;  3CPJ G;  4C5O A;  1RP0 A;  4JY2 A;  1Z6L A;  1H81 A;  1H82 A;  3LJP A;  5U63 A;  2C4C A;  2BAC A;  5FS9 A;  4HA6 A;  3BI4 A;  2C65 A;  2ZZB A;  3AEE A;  1H7W A;  1CJ2 A;  4OPD A;  1QJD A;  4NTC A;  4RG3 A;  2Y6Q A;  2WDR A;  5EB5 A;  3UKQ A;  5IPY A;  2VRM A;  2C76 A;  1GRH A;  2VVM A;  3ISH A;  3VRD B;  4H4S A;  4ZN0 A;  1EBD A;  2BK3 A;  1JRX A;  3NYF A;  4APN A;  3CNS A;  4U8L A;  1PS9 A;  2FJB A;  4J36 A;  1KNP A;  3T0K A;  2XLU A;  1RSG A;  1N4W A;  4Z26 A;  4P9S A;  4CBQ A;  3QFA A;  1ZK7 A;  2YM1 A;  4UDR A;  3UTF A;  4AP1 A;  3Q6J A;  5GSN A;  1K0L A;  3ALJ A;  1NHQ A;  5M0Z A;  3SXI A;  3UOX A;  4KPR A;  1L0V A;  2BRY A;  3GYJ A;  2GB0 A;  2GR3 A;  4OPL A;  4B65 A;  4B68 A;  4OPT A;  3SQP A;  4YT0 A;  1ONF A;  2E1M A;  4O5U A;  4K7Z A;  1GAL A;  5KMP A;  3HYV A;  4IA5 A;  4A79 A;  4YKF A;  3KPF A;  3VR9 A;  4A6N B;  2EQ6 A;  2Q6U A;  2YR6 A;  3T2K A;  1H7X A;  2B76 A;  3RHA A;  3AE4 A;  2R9Z A;  2WP9 A;  3G5R A;  3AE1 A;  1L9D A;  1KDG A;  1TDN A;  4NEW A;  4ECH A;  3AEG A;  2WP5 A;  1E7P A;  1OJT A;  2RGO A;  1E1M A;  4Z2T A;  5BRT A;  4C3X A;  2WPF A;  3P1W A;  2DKI A;  4YSZ A;  2BK5 A;  2Z5Y A;  4BK1 A;  3NK1 X;  5KOX A;  2YG7 A;  2VRL A;  2OLO A;  2R46 A;  1BWC A;  3UTG A;  4EQS A;  1MO9 A;  2XVH A;  4GRT A;  4H4V A;  3ALM A;  3DA1 A;  5FMH A;  4Z44 A;  4JQ9 A;  1LQU A;  4U8J A;  1P2E A;  5L46 A;  1N4U A;  3Q9T A;  3KLJ A;  5KVI A;  5KNL A;  2Q7V A;  1OJC A;  2IVE A;  1IJH A;  1DOD A;  1PBE A;  3B6D A;  3QVR A;  4CRT A;  3NH3 X;  2X8H A;  1DXL A;  5KMR A;  1KF6 A;  3CIR A;  2BS4 A;  4J56 A;  1YKJ A;  1YQZ A;  2YLZ A;  1LQT A;  3LXD A;  3I3L A;  4H2P A;  3UKK A;  2NVK X;  2VQB A;  2YG5 A;  3K7Q X;  3AD7 B;  3G5S A;  3K30 A;  2HQM A;  1GND A;  2CFY A;  2QA1 A;  5JCL A;  4FK1 C;  3ATR A;  3AEF A;  1X31 B;  3UKA A;  3M0O A;  4D03 A;  5JCN A;  1PJ6 A;  2WOI A;  3NN0 X;  3PO7 A;  3GYI A;  4TM1 A;  4USQ A;  1Y0P A;  3FIM B;  4X9N A;  1S2Y A;  2BC1 A;  2A89 A;  1ZOY A;  2WET A;  5FS6 A;  3CMM A;  4LA1 A;  2ACZ A;  2XLR A;  1COY A;  3CGB A;  1ZX9 A;  3FPZ A;  1L9C A;  1H84 A;  3CN8 A;  4EMW A;  2FJE A;  1NHR A;  3AEC A;  3LOV A;  1BZL A;  5FS8 A;  4DGK A;  4J33 A;  4YSY A;  4I58 A;  3SZC A;  2QA2 A;  4RSL A;  4K22 A;  4AOS A;  1M64 A;  4G6H A;  2YWL A;  3EPT A;  5BUK A;  1VDC A;  4YTP A;  3EAN A;  3NK0 X;  2UZZ A;  3SFD A;  4A7A A;  4EIP A;  2GEW A;  1DJQ A;  3GDP A;  2FJA A;  4G74 A;  3UP4 A;  4Z43 A;  1ELI A;  1PHH A;  3V76 A;  3ATQ A;  1YY5 A;  4LU6 A;  3ICR A;  1ZP0 A;  2XVE A;  1ZDL A;  3SY4 A;  1E1K A;  3QVP A;  4ZCD A;  3AE7 A;  3P9U A;  2GVC A;  4GDE A;  3AEA A;  5FS7 A;  3SGL A;  1DOC A;  2I0Z A;  5JCI A;  3KU9 A;  1F6M A;  3DJG X;  2JK6 A;  5U25 A;  1BGN A;  2GR0 A;  2BXR A;  4EQW A;  1PXC A;  5KWF A;  4H4W A;  4Z24 A;  2OAL A;  4OVI A;  2BXS A;  1TDK A;  2BS2 A;  3QSE A;  4NEV A;  2GR1 A;  2CVJ A;  2JAE A;  3SFE A;  4C3Y A;  3CTY A;  1QLB A;  1CJ4 A;  4A6N A;  1NG4 A;  4OPU A;  3KD9 A;  1LVL A;  3KKJ A;  4NNJ A;  1PJ7 A;  1HYU A;  1N4V A;  2JKC A;  2V3B A;  1LJ1 A;  3HYX A;  3NT6 A;  4BJY A;  4YSX A;  1W4X A;  1IUU A;  2X8G A;  3UKF A;  4NZH A;  4XWR A;  2WOV A;  1FL2 A;  5C2T A;  1NHS A;  1BKW A;  5KVH A;  3UKL A;  2V6O A;  4JY3 A;  1B4V A;  3ICT A;  3PS9 A;  3P4P A;  3RNM A;  3T14 A;  2TMD A;  2WS3 A;  2FBW A;  4MJW A;  1F8S A;  2A8X A;  3FG2 P;  1S3E A;  2YLW A;  1JNZ A;  1GTH A;  3B3R A;  3ITJ A;  5JCM A;  4Z2U A;  3CPH G;  2AQJ A;  1K0J A;  3O0H A;  3NN6 X;  4H4X A;  3M12 A;  4K8D A;  4EIQ A;  3T2Z A;  3C4N A;  2J3N A;  5KOW A;  1KNR A;  1DOB A;  3CNT A;  4TM3 A;  5CKU A;  1XAN A;  2WEU A;  4JN9 A;  2BCG G;  4U2S A;  5J7X A;  2XVJ A;  2BC0 A;  4GF7 A;  4NTE A;  4I59 A;  1YQ3 A;  3DJE A;  4H4U A;  1GEU A;  3ADA B;  1D4E A;  3BI5 A;  3VRA A;  3AE6 A;  3C96 A;  2VZ2 A;  2YLS A;  2AAQ A;  2GV8 A;  4KX6 A;  1TRB A;  1CC6 A;  2EQ9 A;  2YG6 A;  4YXD A;  1KFY A;  3AE9 A;  1DNC A;  3V3O A;  4BJZ A;  2EQ8 A;  3E1T A;  2XLS A;  1GRB A;  1EL8 A;  2QAE A;  1PXA A;  1F8W A;  5GRT A;  2ZZ0 A;  4U2L A;  3KVE A;  3VQR A;  2AR8 A;  2XFP A;  1ZOV A;  2R0C A;  5HY5 A;  3NLC A;  3AYL A;  2WHD A;  2XFN A;  3T31 A;  1GRE A;  2GAG B;  2JB3 A;  1ZY8 A;  2VQ7 A;  3ALL A;  1GSN A;  4FDC B;  4B66 A;  3II4 A;  2GQW A;  5TR3 A;  4EMJ A;  2WDV A;  1H86 A;  2PHH A;  1ZKQ A;  4CNK A;  3LZX A;  2XVF A;  5EBK A;  4CCR A;  5EOW A;  1TDF A;  3CPI G;  5KMQ A;  3IHG A;  3UOY A;  1BF3 A;  4NWZ A;  3LZW A;  4BUR A;  4YKG A;  4GDP A;  3I6D A;  3F8D A;  4Z2R A;  4H2N A;  2ARD A;  2V5Z A;  2Q0L A;  4XXG A;  4AT0 A;  4GAV A;  4GAP A;  2C70 A;  2YM2 A;  3COX A;  2R4E A;  1GRG A;  2TPR A;  4JNQ A;  4AOX A;  4EQX A;  1VQW A;  4D04 A;  2QCU A;  3KA7 A;  4YSH A;  3AE8 A;  1CL0 A;  4IVO B;  3CGE A;  1TDO A;  2XLP A;  4FK1 A;  1XPQ A;  2GMH A;  4H4T A;  4OCG A;  2YLX A;  2C7G A;  1VRQ B;  3CNP A;  4B63 A;  1IUT A;  4H4Q A;  1Y56 B;  4EM3 A;  4CCQ A;  4CNJ A;  2WBA A;  4G6G A;  3DK4 A;  3NYE A;  4H4Z A;  1EL7 A;  2X99 A;  4K5S A;  2XFU A;  2YG4 A;  2B9X A;  1QO8 A;  2YR4 A;  2XVI A;  3QSM A;  4TM0 A;  5LV9 A;  1JU2 A;  3M13 A;  1TYP A;  2BK4 A;  4CY8 A;  4Y4L A;  2GRT A;  3NNE A;  1ZMC A;  2WU5 A;  1GT8 A;  1BGJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...