2XMQA

Crystal structure of human ndrg2 protein provides insight into its role as a tumor suppressor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
281
structure length
281
Chain Sequence
b'AKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIENYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN NDRG2
publication title Crystal Structure of Human Ndrg2 Protein Provides Insight Into its Role as a Tumor Suppressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 89
structure length 281
sequence length 281
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03096 Ndr Ndr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xmqA00
1XKTA 4Y2RA 1ZD2P 4ARAA 5K5EA 5ALLA 1EI9A 2JGIA 4BZWA 2OGTA 3IUJA 4C4XA 4DGQA 1H2YA 4NZZA 1VE7A 5DYYA 1CUAA 3A2LA 1I6WA 1ZGBA 1W6RA 3FYUB 3QPAA 4PQEA 1AX9A 1CUXA 2WFLB 1ZOIA 4ZI5A 5LKRA 5FP0A 4UBMA 1ZICA 1JMKC 1PV1A 5AK3A 5CT8A 3C6YA 4Q3LA 2XQIA 1JI3A 5A7GA 3WJ2A 1TCAA 3PUIA 1MTZA 3R3UA 1B6GA 2Y2UA 1TKRA 4AO8A 4NVRA 1TCCA 4KAAA 4H7FA 5KREA 5AM1A 1DQZA 1XZBA 1HQDA 2P8SA 1DINA 3FCYA 4I4CA 5ALUA 4LYDA 4C01A 2XMRA 2X8BA 4FWBA 3AINA 1MX1A 2HA5A 4N5HX 3OG9A 1Y37A 3G02A 5J3JA 3PICA 5LZ8A 5LZ5A 3V1KA 3STYA 4MEAA 3JW8A 5FRDA 3VJMA 3BJMA 5LZ2A 4AO7A 3UMJA 3UUEA 4C89A 1XZEA 5LLSA 3C43A 3IUMA 4OCZA 2XE4A 2GBCA 1Q84A 1YASA 2PVSA 5AI8A 1U8EA 1WPXA 2WUGA 4W1PA 5EIHA 3TJMA 2QVBA 4GLBA 2WU4A 3LP5A 3W05A 5AM2A 4EUSA 3QZUA 3D2BA 1LPPA 3QH4A 2V96A 2PL5A 4AO6A 2AJLI 4Q82A 3K9BA 5HKAA 1CEXA 3UUFA 5I9IA 1X2BA 2WFMA 5HKBA 5A62A 4YK7A 1XKLA 3GROA 1BN6A 4S0XA 2V9ZA 4Z49A 4XVCA 2QUBA 4OD0A 5C81A 2CUTA 2HHAA 1AC5A 3V1MA 1RWQA 2ECFA 3MGAA 1BN7A 4B84A 1SFRA 3C6BA 4G8DA 1EH5A 2QKYA 4U2FA 4WFIA 5CMLA 4DSAA 1XRMA 4F21A 3WZLA 3QMMA 1U4NA 4CCWA 4X6XA 1TIBA 2JGFA 3STUA 3QM1A 4WFKA 1QTIA 1Y7IA 4UHEA 4KJXA 4Y2VA 4N8DA 4U2GA 5ALWA 4EY6A 2I78A 2WIKA 2XMDA 4RPCA 3L1HA 4MWTA 5JATA 4GHWA 2GYVA 3IUNA 3ZLVA 1GGVA 2GBFA 1WPRA 3K2IA 3C6ZA 1W52X 1A8SA 1XZKA 4WDRA 3SX4A 1X2EA 1XLVA 4EY4A 4QWWA 2G4LA 3BF7A 1SCIA 1WOMA 3H04A 1K4YA 1CUDA 3H1BA 2BKLA 2R8BA 3R0VA 3G9XA 4Y2SA 1VA4A 4KE7A 1A8QA 1Y7HA 1L7QA 4DMKA 3ZPXA 2JGMA 4X7BA 7YASA 3A2MA 1CPYA 2RHTA 3IURA 4EA6A 3V9AA 2VJAA 1FJ2A 2QR5A 3SC2A 1GQRA 1LPBB 4ZXFA 4TVKA 1EK2A 4BRZA 4LIPD 4YASA 1CQZA 3AIMA 3RM3A 4BC0A 5A6VA 4U2CA 2G5PA 4N8SA 5E4JA 1YS2X 3HACA 4UHCA 1UK7A 3VJKA 5AIAA 4MEBA 3SK0A 4PW0A 2O2GA 2OCGA 2WKWA 4FOLA 3WK5A 5CBKA 1CV2A 1R1DA 2J4FA 2QZPA 3ED1A 1OILA 5DYWA 2DQZA 1LPNA 3DEAA 1QFSA 2I3ZA 3PF8A 3KD2A 2XMCA 3G0IA 1SCQA 4PNZA 4W1QA 4LXIA 1CUVA 1TK3A 3WKAA 5HZGA 3CN9A 1ZI9A 4FHZA 1GKLA 5AI0A 3WL5A 3DOIA 5DYTA 3GELA 1XZDA 4QE3A 3O0DA 3HZOA 5SYMA 2DQYA 3I1YA 3BDIA 3PE6A 5JZBA 1H2ZA 4Q34A 1E3QA 2CB9A 4PV7A 4YX9A 4DTCA 4GW3A 4H7KA 3WJ1A 1B41A 1JU3A 1SC9A 1LPOA 3IUQA 5AI9A 2C58A 3TEJA 2DFPA 3KOOA 2OCIA 1CUJA 3BF8A 3QPDA 2XQGA 1F0PA 3D2AA 5D7BA 1FFEA 3B12A 5ALNA 1EHYA 4KAJA 4HXGA 4AN1A 1MX9A 3TGLA 3STTA 2WG1A 4DNFA 3BE8A 3GBSA 2B4KA 3EQ9A 3KXPA 2FJPA 3OPMA 4LKOA 3H19A 1XRNA 4JEIA 4L3WA 2XUPA 5H3HA 5AJHA 1UFOA 5EGNA 1EDEA 2O7RA 3QBJA 4OUKX 5AOCA 2O2HA 5FUMA 1E5TA 1O6FA 4HS9A 5E4TA 3I6YA 3V1LA 2OAEA 1TAHA 5DNVA 2HA4A 1CUIA 2XB6A 4FBMA 3LS2A 3HLKA 4CIBA 3D0KA 2WHRA 2XMSA 3F67A 4XX1A 4X92A 5EIEA 4QEKA 3O9MA 4E11A 1QLWA 5CW2A 4W9RA 1VJ5A 5JADA 3G9ZA 4EZIA 2OQIA 3H2JA 5AP9A 1XRQA 1IZ8A 4B9AA 2XMGA 4J0JA 4BATA 1CR6A 2YXPX 3ESBA 1HDEA 2EDCA 1W75A 5A2GA 3PI6A 4BE4A 1MO2A 2HA0A 1FFDA 2WLSA 2HA6A 2VSQA 5AK4A 2GYWA 3FWHA 4J0IA 4QDZA 2RONA 4AZ0A 3FSGD 2EEPA 1P0PA 3L1IA 1K5PA 4ETWA 2JGLA 5HQ3B 2V98A 5EHNA 3ICVA 4J7AA 3C5WP 1WCYA 4PSUA 5A7HA 2WFZA 2WU3A 2WJ4A 2XLBA 1UT6A 3EF3A 1WHSA 1UOPA 1JT2A 3G8YA 5ALVA 2GBIA 2Q0XA 3NOXA 4UHBA 3M3DA 3AZPA 4BCBA 1P0QA 3WKBA 5FLKA 2HRQA 1UKAA 3FAKA 4L9AA 2HU7A 2ZJ6A 1YB6A 3BIXA 3PDCA 5ALXA 4ZGBA 4QDUA 1GPLA 5K3EA 1UKCA 4U2EA 1R9NA 4KAFA 5T4HA 4E46A 4HXFB 3QVMA 1Z68A 2ZSHA 2ORYA 4X00A 2VJCA 1WHTA 1EVEA 5K3FA 3DNMA 1P0MA 3R3YA 4M0FA 4I19A 2ONCA 2JEYA 4MXDA 2VJDA 1HPLA 5CH5A 1WM1A 1DU4A 1QJ4A 3ANSA 5AKZA 4FMPA 3AJAA 1ODSA 1YSCA 1K8QA 3HXKA 2CEKA 3WYDA 2WM2A 1YR2A 4CI9A 3T52A 2XUOA 2BAGA 3G9UA 1UK9A 3KDAA 1DQYA 3FLBA 2X76A 4KRYA 3GA7A 2PSDA 1ZJ4A 3HJUA 1XZLA 2NW6A 3AFIA 1BS9A 4Y2UA 3FYUC 5K3BA 4QA9A 4DMCA 1TCBA 3LIPA 1YCDA 4BYMA 1LZLA 5ALOA 1R3DA 4F60A 4ZRDA 2CMFA 4H7EA 4J0GA 2J3DA 5T4BA 2XUIA 3LCRA 4BAZA 3C8DA 4BVJA 3C70A 2OCKA 2ROQA 4KACA 4HZGA 4CCYA 4G1FA 2V97A 5ALTA 2DR0A 5AI5A 3RLIA 1EDBA 1CUSA 3WK4A 5SYNA 1UWCA 3FLEA 2J3QA 1MAAA 4C6HA 4LYEA 3KSRA 5IH7A 1ACJA 4ROTA 5ALPA 1EK1A 1BRTA 2PSEA 5A71A 4MQLA 3WIBA 5I7UA 4Y2TA 2QMQA 5HCUA 1CVLA 4OSEA 4BBZA 3PF9A 3X3HA 1JJIA 4UHFA 3WK9A 5AKJA 1O6GA 2Y2VA 2GYUA 1BCRA 2RI6A 3EQ7A 3WA6A 2DCMA 5D6OA 2Z8XA 4BAUA 3O4HA 4UBLA 1H2XA 4N8EA 4K5QA 4Q05A 2QRUA 5LYYA 3A6ZA 3HRHA 4V2IA 4G8BA 4Q1VA 2WILA 4BVKA 3ANTA 3O4GA 2ZJ7A 4OU4A 1QIDA 4J03A 4B7ZA 3ESAA 2H7XA 2VJBA 5ALMA 4JH0A 2WTMA 3AILA 5JASA 4QZVA 5JAPA 4XIIA 3WIOA 3QPCA 4WCVA 3GUUA 2OGSA 2PU7A 1AUOA 1UOQA 3ZI7A 2BUAA 1KEZA 4X3CA 2WHQA 5FXMA 3DLTA 3R40A 4K6HA 3DCNA 2XUDA 2OAGA 1R50A 3BIWA 3DJYA 4G5XA 1XQWA 2WUDA 4EBBA 4WY8A 5ALZA 3M81A 4UBOA 3VXKA 3U0VA 3TRDA 1MT3A 1LBTA 1R9MA 2WIGA 4G4IA 4K2AA 3I2HA 1WB6A 1P0IA 4J0HA 4P08A 3WLAA 4IQ4A 5CRIA 4AX4A 3ZLUA 3WK7A 3H18A 1F6WA 5JD4A 5DJ5A 4FTWA 1A7UA 1BEZA 4QDTA 4FNGA 3KWFA 5ALKA 2JEZA 3W04A 5YASA 1GT6A 1XZCA 4Q3KA 4H7IA 5K3FB 2VTVA 1A88A 3D4LA 1THTA 3I1IA 1XLWA 4B81A 2QT9A 1JU4A 1XZGA 3FVTA 1ORWA 4C4YA 3I28A 1H2WA 5JAUA 2QS9A 1RP1A 2D0DA 1EVQA 5C8ZA 2OPHA 5CXXA 4P9NA 4AXBA 3H1AA 2PUHA 5BWCA 5JD6A 1DT5A 5D3KA 4ITVA 1XFDA 4QDXA 4FLMA 3H2IA 2XUJA 2PSHA 3O95A 4P92A 4JYMA 3WL6A 3DS8A 4A16A 5ALDA 5EHZA 4HXEB 5FDFA 2IITA 5EI5A 4B85A 2ES4A 4YPVA 2HFKA 4CG3A 3A70A 4BP8A 4DMHA 4F5ZA 3IVMA 4WFJA 4Y2YA 1IVYA 1CQWA 2WIFA 3E0XA 1C7JA 4UBJA 4GI1A 1UOOA 4BE9A 2VEOA 1CUZA 5AOAA 1G5FA 1MNAA 4G9GA 4A5SA 1GPKA 5AKHA 3AIKA 1CFJA 4K6GA 3H2KA 3MUNA 1MX5A 2CKMA 4B0OA 1T2NA 1BROA 2X5XA 4LXHA 4PO3X 3WQHA 3W2TA 2VAXA 2C5FA 5KBYA 2XT0A 5BOVA 4BVLA 3ZLTA 5DNUA 2VQ6A 1YA4A 4BTLA 3FBWA 4OU5A 1IMJA 4HAIA 2JGEA 1N5RA 3EBLA 2XQJA 1XZIA 3FSGA 3WWCA 5AIBA 3FCXA 3OTQA 1IUNA 1VXRA 3F8SA 5FPQA 2PM8A 4J0CA 4MWSA 5AM0A 1XRPA 3DD5A 3D59A 1DX4A 4CFSA 5ALJA 4HRYA 1R88A 3IDAA 3CXUA 5AKKA 5FPPA 1BE0A 3I6MA 6YASA 4EB0A 2OG1A 2XUAA 3NWOA 1YS1X 5JARA 3I2GA 4UFNA 1LPMA 1WB4A 4JUIA 1DTEA 3HEAA 2CJPA 2HA7A 5HK9A 3PFBA 5CT4A 1DX6A 4E14A 3R3WA 4L0CA 2G63A 4BP9A 3WZMA 4AB1A 2WHPA 4BTVA 5CT5A 2WG2A 3O9VA 4DLNA 4LHEA 5JZSA 3FVRA 5ALRA 3I2FA 2PUJA 2PU5A 1A8UA 1U2EA 3C5VA 4C4ZA 1QONA 3FNBA 1FSSA 4W63A 1ZD5A 4H7HA 5IVHA 2OGZA 4X97A 2C7BA 1G66A 2QJWA 4P93A 4BRSA 3STXA 5JZ9A 2HDWA 1GQSA 4ZV9A 3WL7A 1L7RA 2FX5A 2JGKA 3ESDA 1W1IA 3FYUA 3CCCA 2WFLA 1DT3A 3C45A 3F9CA 4W1RA 5F4ZA 3P2MA 2H7CA 4QLOA 1LNSA 2HIHA 1W4LA 3R3XA 1J06A 1ISPA 1OCEA 4QLAA 5EHQA 5LKAA 1ZD4A 1CUWA 2HRRA 2HU8A 1MJ5A 3DQZA 1QZ3A 3C6XA 1AQLA 4EY7A 2RHWA 4UHDA 1QE3A 4TPKA 3IB3A 3D5EA 4BZZA 2WUEA 2OXEA 4OYLA 2HU5A 3PUHA 3MUOA 1KU0A 1W76A 3H0CA 4Y2JA 4OYYA 1AGYA 1YA8A 1CRLA 2WG0A 5JIBA 1HKHA 2VT7A 4U2DA 4CIAA 1EINA 5K3DA 4CG2A 2VAVA 2ZYHA 4J3JA 1K63A 3QMVA 4AZ3A 2AXEA 4TGLA 3EIOA 2AJDA 3CCBA 2AJ8A 5I8PA 4AQDA 3IIIA 4BC1A 1QIFA 3STVA 5LZ7A 4GEGA 3V1NA 3IA2A 3A2NA 4Y7DA 2WJ3A 4QNNA 1USWA 2Y1KA 4KR0A 4PF1A 4B6GA 4FLFA 4X94A 1LLFA 2RIPA 2JGJA 1N5MA 3F96A 2WIJA 1MNQA 5T4FA 4FFWA 1QGED 1PJAA 2EDAA 4BCDA 5K3AA 4QDOA 3R41A 3FYTA 1J2EA 3HYSA 4C88A 3WK8A 2HL6A 2DHDA 3ESCA 1CUCA 1G42A 2H7YA 4DM7A 5BV7A 2OQVA 4GECA 5K3CA 5FV4A 3HC7A 2Y6VA 4DSZA 3G0BA 1GPNA 2CZQA 1E8DA 1XRRA 1GXSA 1MAHA 2B20A 4BDSA 3LIIA 2WJ6A 1HLGA 2D5LA 4NMWA 2BGRA 1UKBA 5LZ9A 5AICA 3H2GA 1LPAB 4BAGA 3D3NA 2DSNA 4ZREA 3WWDA 2DHCA 1E66A 5JALA 4OB7A 1MN6A 1D07A 1XRLA 2PSJA 1YAJA 5FKJA 5IKXA 4G4JA 1RYYA 3H2HA 3AUKA 3ICWA 1YB7A 1CLEA 4B82A 5DTIA 5DNWA 1CUBA 1PFQA 3E4DA 2C0QA 3MVEA 3WMRA 4KE8A 1XZFA 4MYDA 3G9TA 1T4MA 5ALYA 2BUBA 2WUFA 1CUYA 1F8UA 1AKNA 4XWGA 3ZV7A 3V48A 4UBKA 2C0PA 4W1SA 1VZ3A 3Q0TA 4J0KA 3DYIA 4AMYA 1QIEA 5AK6A 3WA7A 4DIUA 4CG1A 2Z3WA 1QTRA 2XMZA 5C8XA 5T4EA 3S8YA 3QYJA 3AZOA 3ZWQA 2XUFA 3D2CA 3VISA 4KRXA 5CT9A 3PFCA 1XROA 1XLUA 4IO0A 1XZHA 3C87A 4HRXA 3VJLA 2AJBA 4C87A 4M0MA 3JWEA 4FNMA 3AZQA 2JF0A 2ZJFA 2HA3A 2B9VA 2QTBA 1J07A 2BFNA 1NU8A 2JIDA 3GZJA 1E89A 4MJ3A 4INZA 2VA9A 3RK4A 1QIJA 4GXNA 5ESRA 1XQYA 5AM5A 1WB5A 5CXUA 1SCKA 3BJRA 5DWDA 5JANA 4Y2QA 2OLEA 2Z8ZA 2ZVDA 3OM8A 3OOSA 1DWOA 4BCCA 3DKKA 5ALIA 1CUGA 1NU6A 1ZI8A 1LZKA 3S2ZA 5FOQA 3WKDA 4Y2PA 1UK6A 1JJBA 4MYSA 2XMBA 2UZ0A 2AJCA 4UFOA 5LZ4A 4F0JA 3N0TA 4FKBA 3R3ZA 4O08A 1J1IA 3QMWA 1VKHA 5AH0A 5KWJA 2WQZA 5JYCA 4X95A 5EFZA 5C7YA 5HFAA 5ALSA 4GWLA 2W22A 4HTAA 1CUEA 4X85A 3QITA 2ACEA 4RNCA 2GZRA 1QIKA 5CT6A 4LXGA 2QOEA 4DNOA 5JD5A 1UXOA 1QO9A 3HSSA 2GBGA 4HVTA 5IVDA 2Y6UA 4JNCA 4IH1A 4IHAA 5AKIA 5HFNA 4E15A 4H35A 1CIJA 2XQKA 1EB9A 1H23A 3BWXA 4H18A 1BCSA 3B5EA 3G0DA 2QM0A 3OURA 1VE6A 3E3AA 2PPLA 1IUOA 3ILSA 2GZSA 1DWQA 4KYVA 1XZJA 3NGMA 3L1JA 4UBIA 3KWJA 2ZYRA 3DL7A 4EY5A 1OXMA 4BDTA 1EDDA 3HI4A 3BL8A 3VVMA 5ALFA 1QO7A 4K6KA 1IZ7A 3F97A 4B0PA 3DYVA 1HBJA 2IIVA 4H77A 1S8OA 2XQFA 4UBNA 5AM3A 3YASA 4G8CA 3BXPA 4Y2XA 2Z5GA 1QIIA 3D7RA 5ALGA 5AKEA 1JJFA 4Q3OA 5IVIA 3AIOA 3K6KA 1ZJ5A 4Y9SA 4ARBA 4M0EA 3Q8WA 4G4GA 2ZYIA 2LIPA 2XMQA 2C4HA 4GBGA 5HQ3A 1JMYA 1AURA 4GDMA 3G0CA 2O7VA 2H9YA 2HA2A 5CTAA 5ISMA 2I3DA 3WWPA 1H22A 4RGYA 1MPXA 1Q0RA 1VZ2A 3WKCA 4EY8A 2CBGA 3F98A 5AO9A 1N1MA 1DWPA 4CCYB 3JYHA 2XI4A 4X93A 3I6ZA 3N2ZB 4KE6A 5CURA 1JFRA 2G5TA 2I03A 5DTJA 1ODCA 1N8SA 2ACKA 5CH3A 1GZ7A 2HADA 5LIPA 1AZWA 4X6YA 1EXWA 1NX9A 1UK8A 4H7JA 4DNQA 2O2IA 5HF5A 3NUZA 4OPMA 3EQ8A 1Q0ZA 2XUGA 4PSDA 5JAOA 1X70A 5AKGA 3DDUA 1XQVA 1AMNA 2YYSA 5IVKA 2W6CX 1M33A 1FFCA 1E8NA 1BEEA 3DKRA 4A23A 2WSLA 3O4JA 3FOBA 2JBWA 2BUCA 1QIHA 5ALHA 3BDVA 3FLAA 1U65A 5KWIA 3VDXA 3DL4A 4MQMA 5ALEA 4QWMA 4ZV7A 4U2BA 2WIDA 2PBLA 3RKSA 2PSFA 5AKYA 3WWEA 5AI4A 1IUPA 1QOZA 2ZYSA 1EX9A 3H17A 5EHXA 1XZAA 2VT6A 3I2KA 1VOTA 1ACLA 3HABA 4L72A 2H1IA 1KU6A 3OC0A 2QUAA 3SWWA 2FUKA 2XUQA 2B61A 3WI7A 3I2JA 2C5GA 4OB6A 4G9EA 1TQHA 3B3QA 2IX9A 5CH8A 1QFMA 4WDQA 5AKLA 2XLCA 1MU0A 1CUHA 2QXUA 1Q83A 1LGYA 2HM7A 4FDMA 5A7FA 4XJVA 5ALQA 1ZIYA 2QXTA 5DLPA 5BWBA 3LLCA 5AI6A 3CN7A 4DYHA 2WTNA 4AMZA 3T4UA 3U1TA 1SOMA 1BU8A 5AK5A 1ODTC 4N5IX 3RARA 1C7IA 4EHBA 2XUKA 5E2IA 2PX6A 1YAHA 1ZIXA 5HF9A 2XDWA 3VKFA 5LP1A 2BGNA 1EA5A 4DNPA 1K6EA 2VATA 1LPSA 1ORVA 4H7DA 5JAHA 2ZSIA 1QIGA 1HL7A 5E4YA 3M82A 4IH4A 1CUFA 2YASA 2E3JA 1THGA 1C4XA 4FLEA 4UUQA 4X6UA 5AM4A 3M83A 3WKEA 4D9JA 2RAUA 4UHHA 3W06A 4PSCA 5AOBA 4ZWNA 4UFPA 2K2QB 3C8HA 2J4CA 4KEAA 2HFJA 2DHEA 2FJ0A 3R3VA 3DOHA 3WWOA 1ZGCA 2XUHA 5AHXA 4RE6A 1F0NA 4NS4A 3W9UA 5HK8A 4FFVA 1XQXA 4OB8A 1VLQA 1JKMA 3WK6A 3E1GA 1L7AA 2OCLA 4X71A 4AN0A 4I3FA 4JYPA 3G0GA 5HF6A 2RGUA 4IH9A 4KE9A 1E8MA 3G7NA 1EB8A 1LBSA 2PKYX 1G4HA 4UPDA 5EIAA 1TRHA 2QJRA 3O4IA 4X91A 3WYNA 1ETHA 2YH2A 2Z3ZA 1CUUA 4WY5A 4X90A 1FFAA 3I2IA 4B83A 1R4ZA 1UZAA 1VA5A 3GFFA 4WJLA 4DMFA 1FFBA 4FBLA 1VXOA 2BCEA 2R11A 4BB0A 1GKKA 5HF8A 5D3ZA 4RE5A 4B9EA 4B80A 5AKXA 1XZMA 5C8VA 2BJHA 2VF2A 3W9BA 3VVLA 1ZI6A 4J0DA 1ZD3A 3STWA 3WL8A 1QIMA 2WHPB 3IBTA 4H0CA 3IULA
chains in the Genus database with same CATH superfamily
3NVKI 2P9GA 3R5FA 3FGNA 4OMDA 4P22A 1M74A 3BULA 2ET6A 1BVYF 3MMPA 4ZO9A 5BYJA 1NE7A 4FS8A 2ODQA 1GSIA 2IT1A 5K5EA 5ALLA 1PSWA 4LI0A 1B43A 3BFKA 4PXSA 2CXHA 2C8LA 3PGLA 4EYSA 2GEUA 2Q4RA 3ECAA 5KYWA 3CEJA 1B2RA 5AW7A 1B74A 2OGTA 1U6IA 2AWOA 2PDAA 3QEMA 3LCMA 4J91A 1YQ9A 4K0RA 1TCUA 2W2QA 4NZZA 1VE7A 4DWOA 4GXTA 2MSEB 5J59A 1PU2A 4YROA 2Q3CA 2ODNA 3GUVA 4N5MA 5BMVA 1F2UB 4BIMA 4PZ9A 3DSRA 1RQRA 3QPAA 1FOEB 5G4KA 1P4JA 3NBYC 2H5LA 3A4LA 3DEHA 3PFNA 6GPBA 1IB0A 2WFLB 4LMBA 1QPGA 3O2QB 1XD2B 1EDZA 3P9YA 2WVAA 3Q9LA 2I22A 1O95D 1P1IA 2E4UA 4LJLA 4PG4A 4B5LA 4N7BA 3M4XA 5LNK1 3ELYA 4UBMA 1ZICA 1JMKC 1R64A 1PV1A 2ASEA 2C4UA 1RXVA 3A6PC 4TROA 3VKGA 1XHFA 2NUBA 3L40A 1U8XX 3DLPX 4LTNA 3WBJA 2XQIA 1UAAA 3WJ2A 2UXCB 4CT0A 1FNCA 1YFZA 1Z08A 2GOYA 2B94A 3QXGA 4XUGB 2LCQA 3ZU3A 4QG3A 2PANA 3ZD6A 4O4JA 4RZ3A 1A2BA 3LA6A 3MWGA 2WNHA 3NWPA 4EW2A 3K9HA 2B1JA 4H3HB 1GG9A 4MOWA 4DL9A 1NQWA 1H94A 4M0PA 1Z34A 3PNOA 3AM5A 3KUDA 6REQB 3EDRA 5BW4A 1NVFA 4W7SA 4XKJA 2QE7A 1NC3A 1TTHA 4H7FA 3FHLA 3NGLA 3IIMA 4R71A 3TUJC 4HH3C 4LPKA 1NGSA 3PXAA 2C1ZA 3QFHA 4YC7A 1DINA 3CZQA 1SRQA 3D8TA 4NE9A 2IEYA 3B3AA 2D1SA 3L8ZA 1T8SA 4YGYA 2FR8A 2JKYA 3G2OA 3MOGA 4MKIA 5JSFA 8AT1A 2X8BA 2K4MA 3PI7A 4MRAA 3SP1A 2RK4A 3MWLA 5BMOA 1ML4A 1DP4A 3QU7A 5IM4F 4N5HX 1JN0A 1MX1A 2M6KA 2IYFA 3O1IC 3V4OA 4RHTA 3M2PA 4HDSA 2XD9A 2BLLA 5E3HA 5F1OA 1U9CA 1UFRA 3OZGA 3G2QA 3QJGA 3P8ZA 5A9SA 3NYRA 4O3FA 1MJFA 5CM8B 3AQIA 4CU5A 1EUDA 5LZ8A 1RQ2A 4NBKA 4XWAA 5LZ5A 1GRCA 1XL1A 2O50A 3DHYA 4MEAA 4AF6A 4EK9A 2JAHA 1EBFA 3L2OB 4MUJA 3VJMA 4E1VA 5L4SA 3ER8A 3WL4A 4DR2B 3BJMA 3DWEX 2AFHA 1O08A 5EKSA 2UZ3A 3DEJA 1NLMA 5FHRA 2PV0A 2ZE5A 4IDGA 2PPVA 3QA9A 2X2PA 1VE5A 3WLKX 3C43A 3IUMA 4OXNA 1JR2A 5JS2A 4WOPA 1BDIA 3BEOA 3KOXA 4OCZA 4JY7A 5HTKA 4FYKA 2RHBA 1XVIA 4GOXA 1DDIA 3UUWA 2BONA 4PGGA 1J49A 4C2AA 1JLMA 3NUQA 2WUGA 2CNBA 2PZGA 1Y42X 5AJZA 3HNPA 2QVBA 4PCVA 4GLBA 3TJMA 5COQA 1OASA 3AHFA 4H3VA 1BJRE 3V2HA 1JSXA 1VHDA 4X1KA 4P53A 3TTYA 1Y48E 2ZBDA 2BMVA 2VSYA 1U0NA 3QH4A 4GPTA 4ENWA 3EB9A 2F00A 2XRMA 3L7JA 2DC1A 3OLQA 4CFYA 1DI0A 1LFDB 4G1UC 3FVQA 6LDHA 3D6HA 2OP0A 4TYMA 1VMKA 3SU8A 2UKDA 1Y4SA 4YAFA 4D0RA 4NL4H 8ADHA 3AVUA 1FRNA 3W7VA 2CC2A 2RHMA 1L5HB 3NWJA 1VFNA 2AB0A 1XV5A 5ERYA 5FFMA 4OA5A 1X2BA 4BFSA 3PJFA 4MYHA 1MF7A 5E7MA 5HKBA 3P2EA 3K8ZA 1T9ZA 1VSBA 1XEAA 3TZEA 1JR4A 3FWYA 3ZDZB 1FTWA 3FRIA 4HS4A 5EL0A 4EUEA 5EE0A 4HSGA 4MJXA 4QX6A 1XKLA 3UMRA 3UVEA 3BBLA 4GX0A 1SU4A 1V5IA 1GR1A 4RZUA 4WE3A 3IJPA 3V00A 2Q07A 3JWPA 3MIZA 4Z49A 3D1LA 4G0QA 1UXJA 4IZ6A 3ZJTA 1K66A 1L5RA 2DVMA 3UC9A 2BI7A 5IULC 3QK7A 1EWVA 3RT7A 4P3KA 4IAOA 3CVXA 9ABPA 3TIIA 1L5FA 1NBIA 1NPTO 4DBVO 4D45A 4GSLA 1NRJB 1CBUA 1W2GA 3IIJA 2XWBF 4KUHA 4G5HA 4QXRA 1E3JA 1RJDA 4YP0A 1IN4A 2YX1A 1DBRA 2ECFA 4WI1A 2BEWA 4MX8A 2V7EA 4D74A 1J2RA 4PX3A 1SFRA 1KBOA 1II9A 2ZGVA 3C6BA 3ZTTA 5IVKA 2QVCA 1HR0B 1RZUA 2QKYA 4BV8A 3AP2A 4OM7A 3W8RA 1W85A 1Z5UA 1UJ2A 3ER6A 4F21A 3NH9A 1I6LA 4K9PA 3GEMA 4RKRA 4EJSA 3CLSC 1D8TA 4GXQA 1GXSB 3L1VA 1RPJA 5ILQA 3DT8A 4CCWA 1TJ3A 2QNIA 4R0VA 3E9RA 1SOVA 2N42A 3QLEA 1TVMA 1F51E 4M38A 5LQAA 1D3AA 1EZZA 1TIBA 2GN8A 1NXXA 2I7DA 2JGFA 3DTNA 1DBPA 5LP6B 3N74A 3OETA 3KR2A 1QTIA 4B4UA 5BN3A 2QUJA 5E1MA 1Y7IA 4R1SA 3HCAA 3KTFA 3TZCA 1P9NA 4WX2B 5F98A 2AOTA 1U1GA 3QY0A 1MP0A 5DISB 4K28A 3MHTA 5GTDA 2G1AA 1QMGA 2ZI9A 4N8DA 4TZTA 3UAOA 3ONDA 4OFXA 1BMTA 2BRUC 4ND8A 5C37A 1E5LA 3WISA 1Q5PA 2YWEA 4ZQBA 4PONA 3SEZA 4I9FA 2ZR0A 2FW6A 2WIAA 3PG5A 3SR3A 4ENTA 2A3RA 4QXQA 4R2JA 1X9GA 3HI6A 4QYXA 1KDYA 1HF3A 3I2YX 4GHWA 5IS2A 3GRVA 1XAIA 3RIYA 5EZSA 3ZLVA 1PT9A 2X77A 2XV1A 3PNQA 2GBFA 2H51A 2A35A 3HDGA 3DAPA 1QZUA 1RXWA 3PEEA 4LF5B 4UMFA 4B3MB 1A8SA 4DIOA 3QSGA 3QKSA 1ZMOA 2X2OA 4WDRA 1LXCA 3BE6A 5LOVF 1QX3A 4BIIA 3ED5A 2Q2VA 2VWPA 1NXOA 2GHIA 1VRWA 1M2JA 2AC7A 1MG0A 2QI9C 5FOXA 3BXEA 4EY4A 1VE1A 4V0NA 1GPAA 1QHEA 2G08A 2Z1MA 2ZS9A 3EIWA 5ERXA 3RHFA 3FWZA 3QWIA 2SECE 4RPGA 3TZ6A 4YRGA 2CE2X 1VLZA 3H04A 4UD2A 5CPBA 4ZTZB 1XTTA 2J7PA 4G5GA 1F7VA 1ZOPA 3DHWC 2V6FA 5BWNA 1AE1A 1P3DA 1ZR4A 4ZI3A 3L77A 4QYIB 2WYUA 4YRPA 4LOLA 5B6JA 3TDMA 4AL4A 5MF6A 4IFBA 3PSAA 4FMDF 3SICE 1Y7HA 3D8BA 3IKLA 3LFHA 4KW7A 5EQFA 4MUIA 2J9FB 2O06A 3T4PA 3WHPA 1PL8A 2CK3A 2JGMA 2VRCD 3ZPXA 1P9WA 1VSTA 1JG2A 3PX3A 4X7BA 1RZVA 3O8QA 3OUUA 1SXHA 7YASA 2VHQA 4OQEA 3V9AA 4K0KB 2G28A 2WD7A 5EAIA 1QE0A 3FM9A 3EGXA 2K7ZA 2QR5A 4MJ7A 3T54A 5BYAA 3D31A 1UBMS 5FEMA 3SC2A 2QLLA 4CIYA 3IAXA 4B7CA 1APBA 3IEVA 3CHYA 3LO8A 3WAKA 4C3OB 3BK1A 1U8AA 1PGJA 4TXHA 5F33A 3PR3A 2DETA 1CQJB 2POQX 4R1OA 5EJEA 5JVDB 4BKPA 3Q9NA 1E7MA 2GAOA 2WA2A 3HXTA 2IDZA 3WIDA 3HMQA 2ZSJA 1CQZA 2X2EA 4EHHA 2HBRA 5D8DA 5GONF 4CUKA 1U3DA 5E1BA 5A1JA 3I37X 4I1UA 3GLIA 3ZN2A 2DSTA 3UAYA 2ZUUA 4BC0A 3MCWA 2I2BA 3FPSA 3LGSA 4OATA 3DM9B 4IM7A 1KE2A 2PUCA 1KAQA 3DL2A 3UB4A 4ZOCA 4C4PA 3OE7A 5KYXA 1VDZA 2W58A 2EFGA 3M6XA 3VYUB 2EZUA 4E5NA 4OKSA 1YS2X 3HACA 4FFOA 4UHCA 4AZWA 2QRVB 2R6FA 5G02A 4R4JA 3C1UA 3QMPA 1EXNA 3DTVA 3FMPB 1RI1A 1P2FA 5AIAA 4Q3EA 3ZI0A 1HFWA 3GLRA 3HA5A 3SK0A 4XZ3A 2PGDA 3QYPA 3ERCA 4AUEA 1ILWA 4Z9FA 1X0VA 4YCDA 2VP5A 2BE7A 3KP1A 2FWPA 2OCGA 3GK3A 1FX1A 3KVVA 5DPMA 3ISVA 2VPQA 1D4OA 1T5BA 5HS6A 3E7WA 2QD2A 1Y80A 1K08A 4F5WA 5C3UA 5KQMA 3A1DA 2NAFA 5IN5A 1ZRHA 4U5XA 4F46A 1P8JA 4Y6GB 1JHXA 4MAAA 1X1EA 1IJKA 4NZMA 1F8YA 3UMVA 5K4AA 5GJWC 5HJ5A 4PZUA 4KN5A 2ZWAA 3JRWA 1Y6RA 3FNIA 2OGUA 1MIOB 3OA2A 4IQGA 1F6DA 4UOZA 4TV9A 1X7XB 4HLNA 2IYPA 3QBVA 1ZSYA 3L8HA 4RD1A 2NAPA 3W77A 1KYIA 4NCAA 2F1RA 2OBBA 3G0IA 3ZYCA 1UJ5A 2Q50A 3F73A 5ULLA 5AESA 2XDAA 3K6JA 1ZI9A 4L6AA 5K2MA 3EY4A 4G9BA 5EIXA 4OBBA 4MUBA 3C7CB 1BE1A 1Q0PA 1O4WA 2CE7A 4X7PA 5D86A 4HV4A 3O31A 2FPPB 4D5GA 3GELA 1KPHA 4QHSA 1KARA 4O0LA 3U3DA 3HZOA 3N5CA 2DQYA 3FOAA 4DZRA 1D4FA 3IKVA 4B44A 4JOSA 4DVJA 4E33A 1MO3A 1NBMD 1A5AB 2OUKA 1ZH0A 3GFPA 3PE6A 1S9DA 2HRDA 2PXHA 3QKRB 3G8BA 2J3HA 1YVPA 1R4MB 1I10A 1GU0A 4OGGA 1BWPA 2P1DA 1CRQA 4HGRA 3RVBA 1PZMA 3ZU2A 4DA6A 3SJBA 2BH2A 3FDJA 3D6TB 1ORDA 1E3QA 4DBLE 4IJ6A 1JEAA 5A4MS 3GJQA 4GFDA 1OZAA 2WE7A 1WW3A 4HLQB 5F52A 1B41A 4W9NA 3WGYA 2DBYA 4EM6A 4CLRA 4EX7A 2FFBA 1LPOA 2GKOA 3SHWA 3GDFA 3LW8A 1TK9A 2W98A 1U81A 3OZIA 4Z86A 4DQDA 4BFTA 4YACA 3P9CA 5DM70 2C58A 1JZTA 3TEJA 1LU9A 2FPOA 4CTKA 2GI4A 3V9PA 5HE9A 4YXFA 3UK1A 5AXDA 1CUJA 1J8DA 1RJFA 3VQTA 2RCYA 1DXOA 3QPDA 3CUUA 1Z63A 2R1TB 1U11A 4YXWA 2X2FA 3D2AA 4IOKA 3EZ9A 1R0CA 4NZYA 4C4AA 4E30A 1PT6A 4TRJA 5A6SA 3NM5A 1JHPA 2JJ1A 4O6VA 1HQYE 1I0IA 3H8WA 4DC0A 1LQ2A 2HZ7A 1ZJWA 5CG2A 3BRWA 4HXGA 2YL2A 1X7GA 4U7JA 4Y6PA 3WNCA 1DKOA 1MW8X 4ZVTA 2ZIVB 2NXNA 5TQ0B 1IEWA 4JI8B 3CUKA 3P26A 1MX9A 3G5UA 4KBGA 2XOXA 3VO9A 3UT6A 3JYOA 4HN9A 1EUCA 3STTA 3PJRA 2AOXA 3MAAC 4PYQA 1GM5A 4MTCA 3U9LA 3BE8A 3PC8C 3RS9A 2V7BA 1UBRS 1B23P 2FJPA 2C9BA 4GKKB 4XARA 1ZQ1A 2BFEA 3C1OA 1UBHS 2W6JD 2JRLA 4PICA 2GA9A 1PS0A 3NCHA 4K9LA 1FFGA 5JECA 5AJHA 3ANYB 1IEQA 4RA9B 2YFQA 4TL7A 5TQ2A 2GX6A 2O7RA 3LWDA 1H2RS 2F1HA 3IIKA 1Y6JA 2DWUA 5AOCA 3QU9A 3TXXA 3DWFA 2QUZA 2VHWA 1O6FA 2BHRA 3KXKA 4NOKA 2J48A 3KT8A 3K6RA 2OOSA 3R77A 3ES9A 3I6YA 2XOKA 3MOSA 5A3VA 1MABA 4QEDA 3LHIA 3PC7A 3AHGA 3MJCA 1XBTA 2DUJA 2BHNA 2C1XA 2FZWA 2HA4A 3GA0A 4FBMA 4MGZR 4QU5A 3I5MA 2WZQA 3LS2A 3OEHD 5IARA 5FTKA 3D6NB 4DCTA 4CIBA 2UZ1A 3O4RA 2WHRA 3TLXA 2DXIA 2HLNA 3W6PA 4LSGA 5DN6D 4FHDA 1YS4A 3AUYA 5ESXA 4HQ6A 2XCIA 2IDKA 2IOFK 2ISCA 2PD3A 4AWBA 4BFZA 4NG4A 4E11A 2J33A 4LHXA 4F5EA 2R84A 3QVUA 4RVFA 1XZPA 2JI7A 5CR9A 1QK3A 3GLTA 5SZIA 1HQCA 2B2NA 3IDQA 3VTAA 1XKXA 1GAJA 1QLHA 4B3JA 2OENG 4RJLA 5GADl 3A3PA 4D8XA 3IVGA 3PKIA 4Q0MA 3P52A 5FWXA 1QCDA 4MUKA 4M60A 5AW1A 4B4KA 3JSAA 3N7UA 3BORA 1HE1C 2AT1A 3IO5A 2JAUA 1DAHA 3COWA 3Q11A 5EYPB 1WV1A 5TVGA 3VTKA 4DPLA 2PUDA 1KOFA 1NOJA 1GLNA 2JFXA 3VR4H 1DQPA 4JROA 3DMYA 4MR8A 1PQWA 5J58A 3WO1A 1IH8A 3ZK9A 2EV9A 3DC2A 2AG5A 1C4OA 5TPWB 1D2MA 2Q6LA 2HJGA 1OY1A 3ZWOA 5LUAA 4NQZA 1F0YA 1W75A 2V5UA 1CZOA 4D82A 5A2GA 1AMUA 5G1OA 3T3PB 2IIQA 3L7YA 4XOUA 3CE9A 1Y1RA 4BE4A 3U4QA 5CDFA 2BJVA 4TTQA 4FGKA 2A14A 1Q6ZA 3MTGA 5LNK6 4CM4B 2VWQA 1UJ4A 2WLSA 2HA6A 3KUXA 5TVKA 1FNMA 1YJQA 1P4SA 4JHXA 3VPSA 5AK4A 2GYWA 5LMUB 2IH2A 4L4ZA 1XRJA 1X80A 2PMEA 1JXOA 2XJ4A 4J0IA 4QDZA 1ZISA 2FOIA 4AZ0A 2EEPA 1EA7A 1GPUA 2QGFA 4NBRA 3NUGA 2V7VA 1BH2A 5IK2A 1IPFA 4FCCA 2ZRKA 1GJRA 1H4SA 1UBJS 3JATA 1BNCA 2H48A 1Q1BA 2WK1A 4OA8A 5PGMA 3UAXA 5LL6P 3P9XA 4PSUA 5A7HA 1R6DA 2DE0X 3OO0A 3R74A 1EESA 4N7JA 5EZ6B 3IP9A 4D3YA 2WJ4A 4XB1A 4Y1FA 1XDZA 2ZYUX 4IIYA 2I4NA 2VCYA 3CINA 4IV8A 1PJLA 3GA5A 1KY2A 2PS3A 4YJFA 2X0FA 3EZXA 1KRHA 3K16A 1XF1A 2FR0A 2GBIA 3GUHA 4EDFA 3CS3A 3JASA 3EAFA 3EGDB 2XNJA 4MVJF 3WMXA 2ZT7A 4Q4AA 4C76A 1ZAYA 2GWRA 1XR3A 1O87A 4V0MA 4C0AC 4ZI7B 4ZOLF 5HJEA 2H1LA 1KWGA 3H7AA 2DUMA 2W43A 3VHXB 1V8OA 1TL7C 3BS4A 1M6YA 1JG4A 3NBZC 4MKFA 4QVGA 1GG8A 3X1XA 1FLNA 1YB6A 2CEAA 1Z4MA 2E49A 1B4DA 4CLEA 4NDAA 1FW8A 3PDCA 5ALXA 8ATCA 1E7RA 3AX6A 4URHA 5EZYF 1F1BA 4XLLA 3PGVA 1FU8A 4QDUA 1BW9A 3LXXA 1U3GA 4RETA 4DA4A 3K1AB 2QQGA 5FNVF 3T9FA 4E4TA 4U2EA 3S81A 1ABBA 2PH7A 4R2KA 2V03A 3RVOA 1MA3A 3HYRA 3QVMA 5JTUA 1GWNA 2JA2A 3Q3JB 3AK4A 4PYKA 2BIFA 1R0KA 2VJCA 4YR7A 4CL2A 1P7CA 2I34A 2UV8A 3NETA 4Y18A 2IYZA 5KNCD 3R7BA 5L4NA 2DPLA 5K3FA 2HIAA 2FX2A 4L0MA 1EXDA 1NJ2A 2HNAA 4YV7A 2QAGA 5E3JA 4AJNA 2JFVA 4WBSA 4OXXA 2CZCA 4IXMA 5JCXA 4M0FA 3NXKA 1JJ7A 1F1JA 1DE0A 4XWYA 5DHUA 1EP3B 4DRXB 2PLNA 4W82A 1YZVA 4Y9TA 1BYIA 2GZ2A 3ZJVA 4IMJB 2Y76A 4CKWA 1YBVA 1DU4A 1GTZA 2JFZA 2PUBA 2GLUA 5KVAA 5H59A 4CM1A 4M8NE 2IPAB 3ANSA 3G0OA 1GU1A 2VIIA 3G6KA 5AKZA 4FMPA 5TRTA 1JEYA 4BJ3A 5JI3E 2XTNA 2YHSA 1K8QA 1P5FA 4NV1A 4E7PA 3ZHSA 3IKTA 3HXKA 3HYCA 4TL9A 3VX3A 5HYVA 1DGQA 3WYDA 3QEKA 1ECFA 3CX7A 3PNSA 3B1FA 3ZW8A 1KPIA 2R97A 1U8CB 1F8GA 2FN4A 2BRUA 3SEAA 1CQIA 1RS0A 2XCLA 2QG4A 2VHXA 4A8TA 4UTPA 2W70A 5KYNA 4DKJA 3R7NA 2XGOA 4YUZA 1B16A 2EJTA 3ELDA 4Y7CA 1QYRA 3CLUD 4MVJG 2A5JA 4R68A 5KOHA 2X76A 3A9TA 1D2RA 2A30A 4TV8A 3G88A 4HBZA 4KPFC 3WLPA 4XLZA 1B0UA 2R96A 3L7NA 5MHTA 3ZH2A 1XZLA 2NW6A 3ACBA 1YZQA 2R2AA 3UJPA 4KQKA 1PNVA 1XC7A 2GPYA 2ZTMA 3V42A 4YTEA 4ESHA 1QPBA 1UFVA 4Q5IA 1MUUA 1RQPA 2GTPA 3WQSB 4XGNA 3EZYA 2V3VA 1ZC4A 1L5YA 2CHVA 2ZJBA 3AVQA 1CULC 1Z12A 3JYQA 4QA9A 4F12A 3LIPA 1LI5A 4ZZ1A 5L9AA 2XYRA 5BVGA 5GZ6A 4BYMA 1F3OA 1I1QB 2WPDD 4Y1GA 5ALOA 2RG1A 1V39A 2VLBA 1R3DA 3A26A 3LT4A 3L9WA 3FXAA 4F60A 3IIEA 2CMFA 4QOHA 4YJHA 3WYGA 1NW5A 2JKZA 3QQPA 5T4BA 4HFRA 1DTWA 1YQEA 1JG6A 3LCRA 1V41E 5GINE 2FJUA 2C4VA 5KHOC 2P9TA 1N0UA 3U48A 1I5EA 5TMPA 2OCKA 2CHQA 5KVQA 2QRHA 3P32A 1Q7GA 4KACA 3PPYA 4AKSA 3TRIA 3TH5A 1EK0A 3ZR4B 2VYQA 4MDEA 4DDTA 1HDRA 1H93A 3PXCX 4CQMA 2O57A 4G1FA 2EKZA 2V97A 3Q7QA 4Y67A 2DERA 2DR0A 2BDTA 4Q3DA 1UEJA 4IUYA 3RLIA 5JJIA 3TBHA 1FX0A 3BWDD 1R4NA 2P0EA 3V33A 1JPNA 4PC7A 4XB2A 5DHSA 4DSTA 1ITZA 1QCZA 2R1VA 4FWTA 5CA1F 2L18A 3WK4A 2FG5A 1VL8A 4H3KB 2Q0HA 4DXAA 2IHVA 1P8AA 4LZOA 2J3QA 2XYQA 4BO7A 2AFHE 4PR3A 3VRHA 4K1XA 1NP6A 1J7JA 1TMKA 1RKBA 2NACA 4HSEA 4IEFB 1T8WA 3OF3A 1LBIA 4KWCA 2WKPA 4ND4A 3DH0A 3WYBA 3PEUA 2YVLA 1E6MA 2JVKA 2YQ5A 3MCAA 4CKZA 5K4HA 3X44A 2NVOA 3Q2OA 2EF0A 2XGJA 1P3JA 3LQ1A 3UMYA 4DANA 2O3QA 1XVVA 3AUXA 4KVAA 3WIBA 1VKRA 4GT1A 1XA0A 2NTYC 2DTXA 2Q7XA 3NTXA 1NY6A 3OLYA 4UUNA 2YJ3A 4CETA 2PJUA 5EWMA 1T4CB 3NHAA 1M54A 3L02A 3Q3IA 4TMTA 1L9XA 1RI3A 1SHLA 3TE7A 4ER5A 2D1TA 3KQSA 5G0TA 1JJIA 3PWSA 4ALIA 3PQFA 4PSVA 4QDKA 3PPXA 4R7ZA 2E9SA 1ZN7A 2I1VB 3I1FA 4LHVA 3L8DA 3O4HA 4JELA 2G5GX 1BS1A 1Z07A 3N7TA 4E21A 4AIRA 1XDUA 3HHPA 1U0RA 5C34B 4YAKA 4M9RA 3FFTA 2V5AA 5LYYA 4ER3A 3HRHA 1SG0A 2LVBA 1PCXA 1D7OA 2X1MA 2JHPA 3COJA 1RADA 2CLEB 2GZHA 3ON5A 4F8EA 1KMHB 3REOA 2GD2A 4AW9A 5JR3A 2VHUA 4MWZA 4TWBA 4UUOA 1AVTA 1NN5A 4FSDA 5DSXA 2ZYDA 3A1UA 2WILA 2QSZA 4D4IA 4AM8A 1C7EA 2ZJ7A 1KEUA 5KNBA 4RENA 4BMNA 2X4LA 1TJPB 1UOEA 2G70A 2GEJA 3C14C 4OU4A 3SOZA 5MGBA 2BEJA 2XVAA 3ZXSA 1QE5A 1XMXA 1DDOA 5ALMA 4DG9A 1W34A 1NSFA 3UOWA 4OHPA 2XNDA 2WTMA 4JH0A 1JS1X 1WDMA 2GD6A 4YMLA 3ZV5A 5JASA 4TKUA 2VFAA 2RHDA 1ZH8A 3AT1A 1MXHA 3FCCA 3PRJA 3W3AA 5CX1B 3H1PA 2FZLA 3DOUA 1ONSA 2H11A 5JAQA 2J6HA 3V2UA 3FNFA 4KR7A 2R6CA 3GUUA 4G1EB 1RCTE 1TU3A 2C2KA 2HMWA 2VSOA 1AUOA 4NEQA 4S1OA 2WTEA 1N0VC 3S2GA 4BVGA 1XFAA 4UQPA 3LCCA 4MS1B 4CHGA 3QVLA 2CLSA 3SKYA 1E2NA 3SQXA 1URPA 3C3AA 5ARCA 1MEOA 1PTJA 2QYTA 1P7YA 4IIEA 1C50A 2PZLA 1L7VC 4ZA2A 3DLTA 4DAEA 1SMKA 1QGDA 3OM0A 4E03A 4K6HA 1A7AA 1NR7A 3DCNA 1LLUA 4UDOA 3SJZA 1MH9A 4HB0A 2H4ZA 2OAGA 1R50A 3BIWA 1ZUNB 3PK0A 3K0CA 221PA 2QYHA 4MQEB 4C04A 4EJ0A 3B48A 1Y98A 2OBYA 4RMIA 1YZFA 3B9BA 3EAGA 1TW2A 5ERGB 3V6LA 1PGOA 5EUCA 3O4VA 4PLCA 5CD9A 1AZLA 2ERXA 3DF7A 2WVGA 4R2LA 2XBMA 4HHEA 1ANKA 4WY8A 5H4GA 5ALZA 3I6BA 2BH9A 4UBOA 4RZQA 1Z6XA 2HJWA 4PHCA 1MT3A 5TB5A 3TRDA 4HYYA 4IIUA 4NMHA 3VBEA 4K2AA 1D4ZA 4ZHQF 2RK6A 2ZSKA 1PUXA 4P08A 2GMWA 4J0HA 4B4OA 4CM6A 2D62A 2C9OA 3GJ7A 3JR7A 3PFKA 4JX9A 5CYFA 4P34A 1T9GR 3WLAA 2CLHB 1DJPA 2QGZA 1T2EA 1UBKS 2P2NA 4AX4A 3ZLUA 3GLHB 2C4KA 5B3JC 1RRKA 1TYZA 4EFMA 3GRKA 1UMDB 1K7FB 1K2VN 3A1FA 1XTZA 4R7TA 1A96A 1G1MA 1Z6QA 3T7EA 3I64A 4PBTA 3LPCA 1FNDA 2VH2A 4DR7B 1DBWA 2I6QA 3FUVA 4QSMA 3RUFA 1QCCA 5FWYB 2V58A 3GZNA 3Q6NA 3PGXA 4KFSA 1P7WA 2AV6A 3BZBA 3QWAA 1UC5B 3OM1A 3PD1A 4IEEA 4J43A 5D1HA 5B58T 5IXSA 2YWFA 3RTGA 3CLRD 2ETXA 4JVNA 4HEHA 1TO2E 5J5CA 2E87A 1XP5A 2YYAA 3C6MA 5A04A 1HNZB 2RH8A 1WHTB 2XHEA 4FSHA 5YASA 5G0UA 3P1JA 4ESVA 2WVHA 3D4LA 4AMGA 2AN5A 3MWFA 1THTA 3I1IA 4A03A 5BVGB 2KI5A 1X0XA 1L4BA 1H3EA 3ASUA 4B81A 2QT9A 3MGGA 1XZGA 3MPUA 4KLNA 4RKYA 1PEYA 3SSAA 4RLSA 2J85A 2JATA 3GT7A 4I1RA 3ZWAA 1D1SA 4LNHA 1LRJA 2JFBA 5H0IA 3GFOA 4OQPA 1PIWA 3SPXA 1RP1A 2V6MA 2XE8A 3A6EA 2Z95A 3E3NA 1EVQA 4DCPA 2OPHA 5C8ZA 1X7ZB 3FYDA 4HNQA 5U9CA 1ZS9A 5TV2A 2PUHA 3RU7A 4FYPA 2H3EA 4JI3B 3MJRA 1TAGA 2W2LD 3REQB 3OKPA 4AKTA 2GCOB 3F5FA 1K1EA 1DOZA 2EJBA 1M7HA 3FPGA 3H2IA 3X2SA 2UYCA 2AHOA 3OUTA 3T12A 1DV1A 3ZU4A 5H83A 3BRSA 2P77A 1ULAA 3VKHA 2ZYWX 4CIDA 1KKLA 2Q3DA 4QGFA 3QFSA 1TM1E 4F38A 3QEAZ 5AVJA 4HADA 2ODEA 3L06A 5JAIA 2JFHA 5FDFA 1V2GA 2BTQB 2XCOA 3EIFA 3OIDA 1O54A 2IITA 2Q3BA 4KN8A 2R9VA 3JQCA 4LDPA 5CJ2A 4CV0A 4DLKA 8ABPA 4KLZA 1AS0A 2AR7A 1N6IA 1KERA 5F9FA 4FOTA 3BWBA 3V55A 2HK7A 3RJZA 3NV7A 1A5BB 1II8A 2BFWA 3IAFA 1DUSA 2QZJA 5IF9A 1COWA 1PTKA 2QIOA 2GRUA 4S35A 1P2TA 4EQ6B 4DUZB 4YO8A 3CLTD 2N46A 4JKYA 4QODA 3AEXA 4TXLA 1SC3A 3CSUA 4E4YA 1C7JA 2FVYA 2GD0A 2WWHA 1VRVA 3OF5A 4ZTBA 3AKEA 2PLFA 3JQ8B 4GI1A 4RF3A 5FNZA 2PFSA 1HT3A 2IV7A 4EUKA 1Y63A 1QQTA 1E3WB 4O5OA 3ZCQA 4EEKA 3UKJA 4RF4A 3Q2IA 5KNDD 1G5FA 4G9GA 1NLFA 1UDWA 4MUAA 4NCBA 3O3CA 2Q5OA 4YRFA 2WF5A 3CGGA 5KSZA 2CLCX 4A5SA 2XD4A 4MQBA 1E6CA 2P27A 2CV0A 1CEEA 2D4HA 3UAVA 3FMFA 1ZINA 3QUCA 1U1IA 5M04A 1Z73A 4IQ0A 4EI8A 1GO2A 3QE3A 2VZ0A 4DMLA 3ZDBA 4ZCRA 1F4PA 1ZD8A 1ZX1A 1BROA 5KJEA 1G20A 2X5XA 4LXHA 5B7GA 5IJ0A 3K70B 4PO3X 3WQHA 3KAJA 2JFYA 2R6HA 3N3BC 2Z2YA 3SXJA 3W2TA 4F3NA 3GHYA 2I6SA 5K01A 3WTBA 1NLZA 4M9QA 4PZLA 3F3SA 2AF3C 3ZLTA 3UGTA 4QUEA 1RKQA 1T5LA 2AG8A 4YMWA 4JJZA 4QGHA 3A9CA 1TIKA 2AI1A 2FP4A 4B87A 2PT7A 3C48A 3RYIA 3FBWA 3VZRA 3RUAA 2ZZNA 1RHUA 1REQB 1Y3AA 3KEFA 4MHOA 3TB6A 2YXEA 3H86A 4KITB 5KYUB 3ZCVA 1XZIA 3H9QA 5EESA 3DE0X 1VJ1A 2CXSA 3OZUA 1YJ5A 2GVZC 4OQFA 4C05A 1V6AA 4G0WA 2B7LA 3AF4A 4PN7A 2V45A 5IZ4A 5JO0A 1YDEA 4URUR 1I4TD 1YHNA 2GVNA 2J46A 3UQZA 1AA6A 1VXRA 1P1CA 4FQ8A 1Q0UA 2G67A 3GH1A 3WGTA 4E5UA 4FEYA 1ULTA 2NZ8A 3GPBA 2PM8A 4CKXA 1AKQA 1T9GS 1P9RA 4HTFA 1G5TA 4W7HA 5FHQA 2Q28A 3E58A 2A1UB 4YAGA 2R6GA 1OA1A 2NV6A 1DX4A 3D59A 1PLLA 2ZQYA 1CIPA 2LD4A 3GVCA 5ALJA 2CHGA 2YZ2A 3LVRE 4HRYA 1MFPA 2CWWA 3LXUX 4Q7KA 3L4EA 5M3BA 3RS5A 4D6XA 1B15A 3GRRA 4UVEA 2HMAA 3K0FA 1SCUB 3CXUA 1ULUA 4BMZA 4MUEA 1B73A 1T1IA 5FPPA 3I6MA 2E5LB 3BXXA 3TRFA 4CTOA 4HWTA 3LT0A 3L49A 1BWSA 1ODLA 4YJ2F 4LFAB 4PC2A 5BQXA 3IUYA 2BF7A 1U7TA 2XUAA 4ENPA 4PX9A 1YK0A 3I2GA 2GPTA 1MC8A 4LYGA 2NIPA 4MUFA 4RKEA 1Y4DE 3ADOA 1LPMA 2GLXA 2E5WA 4MK4A 4DJDC 3PNMA 1VPWA 1DIGA 3F7TA 4C1BA 4KKXB 4QEZA 2HIMA 3LU1A 2VPXA 4GX1A 1R18A 2OD7A 3FDZB 3HEAA 4KYIB 1ID1A 1H2BA 2HA7A 4MWDA 2C4TA 5LYJA 4HJRA 5HK9A 2CL6X 2HDNB 4AY6A 2P5SA 2ZBUA 3H5OA 3NEAA 4WLOA 3W79A 3CBGA 2UXDB 4D98A 3AFHA 4LK3A 4AB1A 4BTVA 2FWMX 1MV8A 2EYQA 4CGZA 1IWOA 3O9VA 5J4KA 1MEJA 1D1QA 5ICGA 3ELBA 1GPJA 1Z0ZA 3BG5A 4ZVMA 5L6MB 1F5NA 1U9IC 3PGMA 1MMFB 2IXEA 2AMLA 3FVRA 4QFMA 1YMVA 4S1WA 4HLCA 5ALRA 5E9AA 1R5OA 2PU5A 2DH5A 5ADVA 3AYZB 3W8NA 2P2DA 5CVDA 2DT8A 4RK4A 3EDYA 1WB9A 2QI9F 1OXUA 1KO7A 2BM8A 1EFCA 3LT2A 4RK0A 2VCEA 4MUNA 1ZD5A 4KDRA 5GMOA 3WMEA 1PJQA 2FA9A 1M10A 1Z0KA 2QGNA 3CUEF 4QTXA 5LDGA 2OGZA 2FWRA 2C7BA 1GQQA 2VQEB 1GZ5A 4YRLA 2L2QA 4BRSA 1F5SA 5JZ9A 4FMBB 1ZCZA 4KO2S 1GQSA 1R15A 3HCPA 4D6PA 2JGKA 1ENPA 4TL6A 1EEHA 1G9SA 2G0NA 4BUCA 5J2UF 4WZAB 4UAJA 1GQFA 3INGA 3KVRA 1Z0AA 4M46A 4GLJA 1RAFA 4QREA 3CCCA 2MSCB 1ZRNA 5B2EA 4JB2A 3GNQA 1DT3A 1CCWA 1VE3A 1Z8HA 2OOKA 5DCLA 3CJQA 3UXEA 4B17A 1TO1E 1YVEI 5F4ZA 1YZKA 4FR2A 1CERA 1GTJ1 4RQBA 4RL6A 3Q7RA 4LVNA 4QLOA 1LNSA 2YHAA 1PQ4A 4XUCA 4KGXA 4XM0A 2RC5A 1XTJA 4O4IA 2NZXA 2VJNA 3B9QA 3TOXA 3O8OB 4MO2A 1E3IA 1CUWA 1SD2A 3H11A 4MIEA 4OK5A 3UCEA 1QR2A 2MMCA 2E4WA 1AK2A 3FKJA 2GRJA 4N0DA 4WHMA 1HNXB 1KAHA 3ZTWA 4Z4HA 3LUDA 1QZ3A 3C6XA 2AJTA 1T36B 5HIJA 2AEJA 4Z0PA 3UW3A 1NMEA 4EY7A 4HG2A 3U7IA 4HGQA 4X7MA 5DYIA 2PGXA 3JU3A 4OKNA 5CDFE 1KC1A 2ZB7A 2BM0A 3A1TA 3NJRA 5EJ8A 2CJWB 3ZHZA 5AVWA 1NF8A 4C01A 5FQNA 3M4JA 3EXFA 1KU0A 4C4TA 5I8WA 1F4LA 2NUAA 1EVYA 2HMUA 3JS5A 4MRMB 4NR0A 1YB1A 2JKVA 4OYYA 3B2QA 4TWAA 1GGHA 4U3JB 1MO6A 1PJCA 1ZUD1 2NO5A 3F4BA 3ADKA 1UBLS 3GIWA 3NATA 4PANA 1TOAA 2COUA 4WXMA 4G0YA 4YCSA 2GCIA 3EWAA 3V8QA 4HH4A 2QSYA 2J7KA 2P7HA 3R75A 4CIAA 2Y05A 4PGAA 4D41A 3BYZA 2D1RA 3TD2A 5JRJA 2ZYHA 3P0EA 2FRDA 1II0A 3GH3A 3O0TA 4HMQA 4AICA 3U5ZB 4QOSA 5BSFA 3CH6A 1WVMA 3EIQA 3OHPA 7MHTA 1X7WA 3CVOA 3RUEA 7REQB 4TGLA 1DJMA 2GN2A 3GAAA 1EFRD 3IAEA 1Z6TA 2AJDA 3CH4B 5IBQA 1A2QA 1J9GA 4DJ5X 4PYMA 2HMVA 1PBTA 2CCGA 3IIIA 3CVUA 2BEVB 1JA1A 2CFTA 3IPRA 3F3MA 2C29D 4HEA1 1Q77A 2KE5A 3V1NA 3VAYA 3WO0A 4I1PA 2VH1A 4LF8B 4BN0A 4V0ME 1E4VA 4A2PA 4BLVA 4EPRA 2FDRA 5LU8A 3QX7A 5DFAA 1U5BA 1JIKA 4CT4B 2NP6A 2ETVA 2MYPA 3SEFA 1Q0HA 1AV7A 1QG0A 1U2PA 3ZY6A 4AJOA 2A0UA 3V3KA 2FGKA 5FPYA 3I6QA 3LGXA 3R0IA 4CL3A 4JJ6A 1GCAA 5A2QA 4MB0A 3ZE6A 421PA 1TLLA 4D9NA 2OYCA 2ONKA 4ZAFA 2F4NA 4MRNA 5JMTA 2GNAA 1LQUA 3OHMA 2ZUTA 4CVNA 1C5KA 2VBIA 4WACA 5MFPA 4LXUA 4I7EA 4WXEA 4A2QA 1G7SA 1L8OA 3EA5A 3TIXB 1QRUA 3VSEA 4C7JA 1IY8A 2QLFA 5E6SA 4FMCB 4FFWA 4HKTA 4YLGA 3SXUA 3UV6A 4AXXA 4AG5A 1N6RA 5ILGA 1R0BA 5A4FS 3A6LA 1NVBA 1QG6A 2EDAA 1DC6A 3SFZA 4BCDA 2CD7A 3PC2A 4NNOA 2O0KA 4N3NA 3LSTA 4OH1A 2WSIA 2L19A 3H13A 3H87A 1QK5A 3O6VA 1XEFA 2R85A 1NM5A 2O0LA 3QOXA 4QARA 2FEOA 1KAMA 4KQ2A 4OYHA 1G0OA 5G53C 2YOHA 2ZWVA 4YQZA 1EU1A 1DJNA 2NPIA 3X1MA 4CN9A 1GV1A 4BECA 4Z4FA 4Q9JA 5C0OE 1G42A 3OQVA 4KVGA 4Y0VA 4UVDA 4FHCA 1L4GA 1M6VB 4JDUA 4BNUA 4DM7A 3R24A 1XYVA 4GECA 4GNRA 2IYEA 2CXQA 3USES 3W90A 2O5CA 1N1EA 2GH1A 2AZDA 2V6IA 2D7DA 2VUHB 1GPNA 2A5GA 3PQ8A 4N3GA 2L69A 5AW9A 2NVUB 4ARUA 1H69A 3VU9A 4S24A 1G2OA 1KY4A 2B20A 3BM5A 3DEZA 5KJ6A 4D8YA 3ROXA 4G56A 3NYQA 4LPSA 2ATIA 1PFUA 1W88A 3EODA 2CL0X 2D5LA 4Z8YA 3SZRA 2LTAA 5EJGA 3AR3A 1IBKB 4H4CA 5AK0A 3UPUA 2BGRA 1UKBA 2W71A 1XJWA 3EXHB 1RYNA 1Y8RB 2AMVA 1WMBA 2I7XA 2I4IA 2BVNA 2GB4A 3QF7A 1U9ZA 2DSNA 4KBYA 4CODB 1ODKA 4KODA 4O1IA 1WCIA 2P6MA 2ZZMA 2VF5X 1KDVA 1W4BA 3IQHX 1RRCA 3I8XA 3HJHA 1RQGA 2PCLA 3A8TA 3FF4A 1KYXA 4PYJA 1N0IA 2CUKA 3M6VA 3S27A 4FJ1A 1A7JA 4E1AA 1GQOA 3ZHVA 4AS1A 3D4BA 5D87A 4K88A 4XTRA 2C7GA 1J0CA 2D0OB 3LKDA 4Y2HA 4B3FX 3WVNA 4B31A 4Y2GA 2ENUA 2XSZA 5DTMA 3HCWA 2MJLA 1N2CB 3DLBA 1EP9A 3AUKA 3SZLA 5IDQA 4L4YA 3FBGA 3ICWA 4D4KA 4MW1A 1XXHB 1GOTA 4TTAA 3RKRA 1N92A 4D7AA 2WSSD 3UJ9A 5FJIA 2Z58A 4YRZA 4P2GA 2OLJA 4B8ZA 4HXYA 2RGYA 1ZNQO 2HF2A 4BL5A 5L53A 3BSSA 1M1NA 1CY1A 3VYRB 4PFJA 3CEMA 2NG1A 2C0QA 3RB8A 3IILA 1K6MA 3R9IA 5JE8A 7AT1A 1N6HA 4KE8A 3QVTA 5G0VA 4LOHA 4A8JB 2VOJA 1RXCA 1K4KA 4MVJH 4CM8A 4MYDA 2CBXA 2Q9AA 1XQ9A 3G9TA 1DG1G 3WFZA 3PX7A 1OXVA 4QL3A 4BX9A 4KWHA 1T4MA 1S3IA 2BUBA 3LZCA 1CUYA 1F8UA 1AKNA 3LD9A 4LTDA 4XWGA 2EL7A 1M2FA 1PWZA 5CJPA 3IA7A 2RBKA 2C0PA 3QLTA 5ICMA 2FQYA 4PZZA 4BFCA 1PF7E 1EHIA 2RB4A 4FU0A 3PEFA 4W5HA 2HEIA 3PR1A 3Q0TA 1TVKB 2A57A 3V7FA 1RAIA 1YRYE 2YUIA 1PEAA 1V71A 4GBMA 1QIEA 4J0KA 3QPUA 2AEMA 3E9YA 3QG5A 3FSRA 4DIUA 1YU9A 5FTNA 2PRJA 1ZJJA 3SZOA 4HI0E 4XI9A 3J81A 2OHHA 4XGQA 4RA6A 3DWGA 3EMDA 1DCMA 2EGUA 2OCDA 5K03A 1BIFA 1XUOA 2P4HX 5JZOA 3S8YA 2BDUA 2P9HA 3C1TA 3HCNA 1YJ8A 1U99A 1JKJA 1QF9A 2H57A 3NHKA 1DAGA 4L76A 3D2CA 2FPKA 5I4IA 2R5WA 3K53A 4XDYA 1J0DA 3ZX4A 5KMGB 1XXLA 3VDNB 3I6IA 1W5EA 1R74A 4HCJA 1NBHA 2OZLB 3ADPA 4PIVA 3LMKA 4RJ2A 4JWTA 4ZAXA 3F6BX 4QUGA 3VJLA 3FYHA 5J9FA 2I62A 2PA3A 2JLVA 4K9NA 3BERA 2Q45A 2NSDA 3HJCA 4QYTA 4C87A 4MRSA 5KZMB 3X1DA 4OHVA 3F8WA 3AZQA 2JF0A 3RG8A 3TDNA 4JBXA 1JAHA 3T99A 2C2YA 4BQOA 4CIXA 4BQEA 1NV9A 2XDQA 2AXQA 1AXGA 3IERA 1J07A 1G17A 3OJEA 3F4KA 3NDRA 4K9MA 4QTUB 4P31A 3KWLA 1EUYA 3PQEA 2ZJOA 1A1VA 1USVA 3RFUA 1OH5A 1C0IA 3P71T 2FMXA 1E89A 4MJ3A 2IY8A 3I04A 3NX4A 3R5TA 4INZA 3T3EA 4BLPA 4FGJA 4JKOA 1Y1QA 3DAGA 3FKSD 4UASA 2BTEA 2BEUA 1RYHA 5G41A 1IVNA 4WA8A 3CWQA 3NWEA 4JODA 5AM5A 1SXIA 5D5QA 3HRIA 1AF4A 1UCFA 2ZULA 1SCKA 4AJHA 4JAVC 3ZVMA 5DWDA 2VP3A 1XLTA 5DNVA 5L40A 3ENVA 3H42B 1E2LA 1RCFA 3ORRA 4I9NA 4K9SA 3THYB 3WHKA 1ZL0A 2A8YA 4FFBB 1PL6A 1YJCA 2R7AA 5IYZB 2C5HA 1P0FA 2Y4NA 4RVHA 5JCJA 5TC4A 1QGZA 3OOSA 3ZWPA 3Q88A 4PG6A 3CT6A 5JY1A 4JXZA 5ALIA 1SHKA 3TAHA 3C5HA 2FF7A 4D99A 4C7OB 1DKRA 2OCYC 1NU6A 2OBNA 4DT1A 1HLPA 3TEMA 1ZI8A 2B36A 4L0DA 2QTTA 1B93A 1LZKA 4LVCA 3S2ZA 4CM7A 2WYWA 1L4EA 2K5UA 1VI2A 5KTRA 1P75A 3D8UA 1SD1A 3UV7A 1N2OA 2BFAA 2XMBA 2UZ0A 4WLFA 3H65A 2H16A 3KQMA 4JUBA 4EG4A 3MS4A 5LOVB 1O94D 1OZ0A 1WPGA 5HNKA 4JBYA 4N01A 1GYRA 2IYRA 2OG2A 3G8CA 3N0TA 4NJOA 3WG9A 4O08A 4TTRA 1J1IA 3QMWA 3NBQA 3LUAA 4RYDA 3TDKA 4JXXA 1J70A 5KWJA 1UC8A 3CRZA 4IUCS 4EF6A 5IW8A 1WQ1R 5EZQA 1C2TA 4GPEA 4LXYA 4PNHA 3EEYA 3HU3A 2QL7A 2YMQA 2HV8A 4BMDA 5C7YA 1Y34E 4LDRA 5PNTA 3ETCA 2RAVA 1BKSB 2CFOA 1ESCA 1LTQA 2OBLA 3FPBA 3KXLA 4GWLA 4EBBA 2QSJA 2OUIA 1YXMA 1JNYA 1CUEA 1QHFA 2XWSA 4HTAA 3SVZA 3QITA 2CWDA 4ZVPA 3VZPA 4MI1A 5IXYA 4RNCA 2IEGA 3ZIAD 1UBNA 2RJNA 1WXFA 3PQ3A 1JYSA 1QUFA 2AN3A 2H2GA 1DMSA 4FYJA 3F5SA 4BMXA 1W4RA 1Y1KE 3A37A 3ABSB 1YZTA 3A6KA 4TUYF 4WKGA 4EEZA 3IL2A 2FG6C 2QOEA 4GBED 5FA6A 1E1KA 1YNSA 2A9RA 3G82C 5FBQB 3W9YA 1UODA 2PV7A 3BWEA 2IU0A 3MGBA 2PZ8A 2QRNA 1G3IA 2BISA 4M21A 1JDZA 1UXOA 2FPMA 3AESA 4B3DA 4ABTA 2GBGA 2OO3A 4A73A 3AEKB 3JZDA 1LFAA 2WD8A 2Z04A 3EY9A 5KQLA 3N59A 5LP6C 3A06A 3G1TA 3G85A 4JNCA 1XTPA 4IH1A 4QJ5A 2WA1A 4UUAA 2BBOA 4E0BA 2GZ3A 1ZQ9A 4X8LA 3HJRA 1RQXA 3KE9A 1BQEA 1INLA 4RFVA 1UMBB 4ZVLA 2YNMD 5HFNA 1TB4A 3U4GA 3BH0A 1YONA 3IR5A 1N2ZA 4GLOA 4UUPA 2PMDA 4AKGA 1XPUA 1EP2B 1PR6A 1H23A 3AEUB 2NU8B 2MSWA 1RP7A 2CT8A 5JAMA 1PLKA 4QPJC 5DHAA 3CF4G 4CG0A 1XDBA 5I3CA 1ADJA 1BCSA 1K89A 5SICE 2FUG1 2QN6A 3ZOKA 4GP9A 4D96A 2QM0A 3OURA 2FZ4A 1KQGA 3MQ4A 3RTAA 4MROA 3H0KA 3PWKA 3RBXA 2NU7A 3E3AA 2TYSB 3EGIA 4IHJA 4B75A 2O8DA 3UGQA 3K0KA 2J41A 2FPIB 2BMDA 2ZPTX 3O7WA 3N9IA 4LY9A 5JMWA 1GIAA 1ATZA 1E9EA 2GZSA 2ZBVA 4RX1A 1JAYA 4B09A 5KQRA 3TLGB 4KYVA 2GK3A 3NGMA 3L7OA 3F5DA 4UBIA 1PR1A 1OGIA 3KWJA 3DHNA 2F43B 1T3LA 3G5TA 1VIDA 3DL7A 3INTA 4UU0A 4BWGA 2X9VA 4C2BA 4ZFNA 4TYYA 2IPMA 4CIVA 3ZUGA 3LC1O 3RIMA 4GZMA 1S9HA 1EFTA 2I1WA 3TPCA 3BL8A 1NVTA 4MCIA 3HJFA 4PG5A 5DW0A 2A88A 5H3LA 4KIJA 3RROA 1JQ5A 1QO7A 4YFYA 4K6KA 4Q16A 3L5OA 2XBLA 1HDYA 1QG4A 4JVSB 1NL3A 1CJBA 3G89A 1UM8A 4ND7A 1Q14A 4RIGA 5DDIP 3KVNA 2Y66A 5C1OA 1R7RA 2ZYTX 4NZ9A 3A1VA 3M8KA 1BO6A 4RZHA 4L3OA 1RYBA 4OP1A 5B4TA 4G8CA 5EJ2A 1VGRA 2R6ZA 1NW7A 2NO4A 1IWBB 4CLOB 1FF9A 4RC9A 1D6NA 2FMTA 4RXUA 4N6NA 1G20E 2BFBA 2BBWA 2REOA 4F6RA 5IDWA 3J81k 4J1NA 2G17A 3KLNA 3FAZA 1ECJA 4X1IA 4XX0B 2G1KA 1D6SA 3VUEA 4MWEA 5FPKA 4Q3OA 3REFA 4F9GA 1D6MA 4UU1A 3K6KA 3MZ0A 2R2GA 4JS0A 4I1IA 5EMHA 4YEDA 3E7FA 5HGXA 4RAOA 4S0ZA 4DY4A 4ZEMA 1SPXA 1E1QA 2YR0A 3IUSA 4H08A 4Y9SA 5JG7A 4ARBA 3E9NA 4LE0A 1QHIA 3Q8WA 4G4GA 2O1SA 5KDDA 2ZYIA 1I2AA 4IIJF 2QE7D 4GBGA 4QQRA 1JMYA 3LT5A 4JX8A 3PUWA 2Z5LA 1GTL1 1EFDN 1G5IA 2O7VA 1S89A 2ZKLA 2PJRA 5JSQA 4AI6A 3C15C 4W4TA 2UVPB 1HEIA 3WWPA 1UEIA 1KDTA 2CFRA 3BQNB 1Z13A 3ZVLA 4RGYA 1MPXA 4GPZA 1Q3TA 5LCXA 1FDSA 3D5QA 4JOBA 1YUNA 3AF3A 2EW8A 4OL0A 3ZEAA 3IYLW 4FCTA 3B5JA 1EVZA 1NNI1 2PLRA 5AO9A 3LH5A 1IBLB 1DAIA 2HYIC 3CIOA 4O2BB 4JUCA 3TZLA 3ZKWA 5E38A 5KNLA 3H5LA 4I3GA 2DMRA 3ROGA 4YRRA 3I6ZA 1H66A 3AVVA 2VTEA 4O63O 3WS7A 3EG5A 4IJQA 3M9WA 2J31A 4I4NA 4CDGA 5JZMA 1UZLA 1X1TA 1C1YA 2P9EA 4FS3A 4YI3A 4DZTA 3RRNA 3KSDO 3INNA 3ZJ4A 3R4VA 1OX5A 4H27A 3RLFA 4DPKA 1S8NA 2PTHA 1EAYA 1AZWA 1KMQA 2AX4A 3G2NA 4UM8B 1IOLA 1L1QA 3HG7A 4KXQA 2O8BA 3CGWA 1SXGA 1WIWA 2X9QA 4HYTA 2ZPUA 1UK8A 2B8TA 2OCPA 1S2LA 4H7JA 4DNQA 1CYDA 3L8FA 4YRJA 3P0RA 4BV9A 4D4JA 3IEUA 2EYUA 4M8LA 4HEA6 1QZXA 5JAOA 4B2PA 1MB9A 2Q5FA 4NENB 4N5NA 1OWOA 4NONA 1V5GA 1N75A 2IUFA 4NEHB 1K68A 3MCVA 4V0SA 2W6OA 4YCNA 5IFKA 1GRNA 5FV7A 4Q01A 5FO0A 4US1R 1IY0A 1C30B 3RAEC 4FZJA 3WNQA 3PL5A 4WEOA 4ZZ0A 3DE1X 2W6CX 4PSKA 3W6OA 2NQTA 2QMYA 4PHTA 4KIUA 4DR1B 5G1NA 1JIQA 3B3GA 4Q9NA 4C7BA 1LJLA 2DX7A 1E8NA 3NYWA 4HUTA 5DM2A 2JLWA 4QASA 1YFLA 3IAUA 1EJ2A 3FOBA 5I7SA 2JBWA 1WSBA 2YW9A 4HATA 1U9YA 4M7WA 1ZGGA 2IZ0A 4M7OA 4OHBA 3UG7A 5M29A 3LBNA 2ZSEA 1P1FA 3IX7A 3UOGA 1AO0A 3GUCA 2Q27A 4OK3A 3CWZA 1C9EA 4TYQA 4DXHA 3PA6A 2BFDB 3WQRA 3G8DA 1KBZA 3ESQA 3GF4A 4AJLA 1D2HA 4X62B 4FD2A 5DTRA 2ZXEA 1P6QA 4IG4A 3AETA 2J0EA 3DL4A 4MQMA 4RHXA 5ALEA 4O2AA 4B48A 5M2QA 1NTOA 1L3IA 1JQDA 1M8FA 4RD4A 3ZE0B 4EZEA 1RI4A 3R2JA 5BYKA 4DR3B 1Y5LA 2C4WA 4RHCA 1JV2B 3W4IA 1RLJA 4NYIQ 5DGDA 4R84A 3RGGA 4GS5A 4LNUA 3E9DA 2PSFA 5AKYA 3TMAA 1VPEA 3ZG6A 1Y9DA 3ANLA 4CIWA 4HQ0A 2BCGY 4IMIB 1OYVA 4GVXA 5I8ZA 3HL0A 2JCYA 2I33A 3L8GA 1QVVA 2XDYA 3AF5A 3OZCA 4F4JA 1U2RA 3J7AC 3ZHCA 1KO1A 3N76A 2H06A 1CP2A 2H1SA 4WUVA 4S1VA 1VOTA 4E1BA 4I3HA 1ATIA 4QAQA 1ZA2A 3QJ5A 2X86A 3CR7A 2H9IA 3RYFA 4Z4IA 3DNPA 1C4WA 3MJSA 3OC0A 4R9SA 3UJHA 4AJ1A 3KL2A 3KYDB 2QUAA 2SCUB 3SWWA 3EEBA 1DXYA 1VRCA 1O97D 2XUQA 4FB4A 3S1AB 1SQ0A 1GRRA 2B61A 3ZE8A 3WI7A 4BX8A 1W5BA 1FP2A 1N8KA 3IVCA 5IC5A 2GO1A 2GASA 3LLSA 1P60A 4FNOA 4FSXA 4NHEA 3BRQA 4II2A 2QVXX 4R0NA 2BMAA 4N82A 3RH0A 2BD0A 4MINA 4N7RA 4NYMQ 4BMOB 1I0ZA 2WVJA 4YCCA 1TQHA 3B7PA 3T5GA 4FE4A 2QTWB 1K5HA 3LC0A 2R4QA 3QI7A 2VL7A 5L3SA 1D1TA 3LTEA 2XHZA 1IYZA 3A4TA 2C8JA 1NF2A 1ZVQA 1Z06A 4O33A 2ZRJA 1M5RA 2X0KA 3OD1A 3OOJA 3PJGA 3QA3E 3OJLA 4D4GA 3ZTYA 4IS3A 4XJVA 3X1JA 2IC5A 5ALQA 3DYBA 3ET5A 5ED0A 5BSWA 1W36D 2QXTA 2R48A 1YVDA 2J7PD 3KK0A 4EIWA 2C54A 3CN7A 1T15A 2A9FA 3QV2A 3VSCA 1RSZA 4X8HA 2W6MA 5EZYB 2VPWA 1PR5A 2QMZA 1WULS 2IVFA 4P3OA 1YOVB 2H2AA 5SZKB 5IEJA 1DG9A 1ZMBA 2JLAA 1FYWA 3AF1A 4RHUA 2XRYA 2CK3D 3ANMA 1B2LA 2CXPA 1KOJA 1R2QA 1C7IA 2GSWA 3NANA 2XUKA 3S3TA 4KR6A 2LPMA 1TJ4A 1HMYA 1JMVA 4JLUA 5THKA 4U2KA 4NSNA 1JDJA 5HIAA 3U62A 4C9BA 2WWIA 5AUPB 3ICQB 4ZT7A 2EW2A 2G7MC 2BGWA 3EVDA 2BZSA 3HM2A 3CRW1 4G1MB 5FWAA 5HF9A 5J63A 1UDXA 4C6TB 5BSKA 3FD8A 5B4VA 2ST1A 3GJYA 3R7WA 4R3WA 2EP8A 4K3VA 2XAUA 3QPBA 3KKMA 1Y3FE 4P4SA 2BGNA 3HUDA 5LP1A 5CCBA 1CE8A 4DNPA 2JLSA 4EB6B 2VATA 4TL8A 4AJPA 1ZGJA 3CZAA 3JSXA 1ZWLA 4YAJA 4F2HA 3BZUA 5IN4A 1J0EA 3WLOA 3ZS9A 4CF3A 4KR3A 4Z3OA 3W6NA 5J1SB 1T3SA 1IZZA 3FUUA 2AZ4A 1DKPA 3OLCX 3VNSA 3M82A 2B8JA 1CUFA 3CH7A 3L6OO 3BHMA 3EA0A 4KWIA 1RC8A 1E2JA 2B98A 4AS3A 5B57C 1E0JA 4K3UA 3DVAB 1QB8A 3BVPA 5DOVA 3MM4A 4DMGA 3FH0A 2JGAA 2C98A 4LZZA 4XWOA 1THGA 1O9GA 3EC1A 5CFOA 3U81A 3F47A 5DBGA 4ARZB 3TSYA 3DTVD 1IU9A 1D0IA 4RTNA 2C1EA 2VNKA 2QSUA 5F78A 3GD7A 3HVUA 4RIFA 3G23A 3LPMA 3Q5GA 5DNYB 1GUYA 3EXEB 1EG7A 4O1MA 4Q7JB 1Z38A 4M3NA 1JI0A 5A4DA 2GA8A 1VL0A 1UDCA 4FJ0A 3WMWA 3PUJA 3UGJA 2Z9BA 6PFKA 1TMYA 2OLKA 1XVLA 2K2QB 2ZRNA 2XCQA 3C8HA 3P20A 1TYEB 3CBQA 5FADA 4Q4DA 2C96A 4OMFG 1VIMA 4IF6A 2HFJA 3L84A 3AFOA 4LBVA 4EKDA 1GN9A 1YJAA 5FO1A 3ITKA 5CITA 1YH3A 4RIHA 2H2IA 2UUBB 1Y8QB 1HDCA 1ZGCA 3UYLA 1Q92A 5HS4A 4KXXA 3ENKA 4A26A 4RE6A 2QZZA 3HLYA 2QL6A 1I2ZA 3DEFA 1FSFA 3PZRA 1MR3F 4HQLA 1YD7A 1NZJA 3TZKA 3FSEA 4ERNA 2Z2XA 4FFVA 1OF1A 1UWKA 3K05A 3WB1A 5AUOB 5KYYB 3GUZA 1VLQA 1LV8A 4QQKA 1YR9A 3E1GA 1L7AA 4MQ5A 1WBDA 4ZK2A 3LK6A 2A3NA 3A25A 5JQGA 4RGQA 4AN0A 2PWZA 1BGWA 2J0UB 3P2JA 3KX2A 4I3FA 3U3KA 3M4YA 1Y1PA 4KE9A 1U8YA 3EWSA 3LOQA 4M1ZA 2G8NA 2DULA 4RZSA 2AHRA 5DM4A 4CMCA 4GKVA 1QQ7A 1WF3A 4IKEA 1KI3A 1WJGA 3KTDA 4JL5A 2H29A 4ONEA 1EFKA 3C16C 1YRAA 4NHOA 5K0GA 1XCGB 2G3YA 1G4UR 1OFTA 1SUEA 3G7NA 3HCEA 4HH1A 3Q3HA 1D2EA 2DBZA 5F2NA 3NMUF 4MO9A 3KKZA 1AKMA 1ONOA 1DRJA 1JXMA 1Y1LA 1C0KA 1ZO8A 2ZVJA 4V24A 1SGWA 2DFNA 2ZM5A 4UPDA 1V47A 1HOXA 5COAA 5E1DA 1F14A 2HB6A 3SS9X 2XT9A 3O4IA 4HRAA 2CVQA 1NQ5A 1Z4KA 3EHEA 1FRQA 2YH2A 3IOCA 5G2OA 5EPOA 4I0WB 4PR0A 3BCUA 4YP1A 1M2EA 4H0NA 4QM7A 5DV9A 3T9CA 4NXMB 1Z8NA 5IPFA 1FFAA 3I2IA 4R1PA 1UZAA 2GRAA 5A3QA 4YUXA 1G1AA 3IQIX 2P35A 8GPBA 2G5CA 4LZWA 4NH0A 4XAQA 4JQCA 3N8NA 1EUQA 1S4QA 1SIWA 2C5AA 4YXWD 1N7GA 4CKEB 2ZDHA 1PJRA 1CR1A 3Q3VA 4HAVA 1W46A 2JJ1D 1LCIA 2GXSA 2VAMA 2CJXA 1YDMA 2X1HA 1L1RA 3ZNNA 4E7OA 4UTRA 5M7EA 1EM8A 4CKCB 4F4CA 3BRWD 3DP7A 1Z2NX 2R11A 3O8DA 1E0SA 2QV0A 3H3XA 1M1YE 3EYAA 1GKKA 2EX1A 3PD0A 5EWJA 2ZIXB 4GOKA 1X1BA 3U6KA 2H8GA 1SCJA 2Y9PB 3GT0A 5C8VA 3GV0A 2BJHA 1L7PA 3SS8A 1P33A 5EIOA 3WDSA 3VVLA 2ATCA 4A8HA 3FTQA 1M8JA 3IQZA 4BNWA 3KRTA 4CXMA </