2XMQA

Crystal structure of human ndrg2 protein provides insight into its role as a tumor suppressor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
281
structure length
281
Chain Sequence
AKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIENYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN NDRG2
publication title Crystal Structure of Human Ndrg2 Protein Provides Insight Into its Role as a Tumor Suppressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 89
structure length 281
sequence length 281
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03096 Ndr Ndr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xmqA00
3FLEA 3HI4A 5CURA 3RKSA 1E89A 2Z3WA 3G0CA 5ALDA 4KEAA 5LKAA 4PO3X 2VT7A 1N5MA 1Q84A 2WUEA 3W06A 2HFJA 4ZXFA 5AJHA 4FFWA 3TGLA 2GZRA 4FLFA 1IZ7A 4M0MA 3V1NA 2QJRA 3WA6A 1QIMA 1EB8A 2VAXA 3UMJA 4CI9A 2OCLA 5LZ8A 1AUOA 4N5IX 1X70A 2K2QB 2XDWA 1QIGA 4H7EA 1NU8A 3F8SA 4CCWA 2GYUA 4G8DA 3DQZA 3HEAA 3R3UA 3R3WA 3FYUC 2C5GA 5CRIA 4Y2SA 2CZQA 1XQYA 4B82A 3IUNA 1ODTC 5AKHA 1KEZA 3R40A 3I2FA 3DD5A 3KXPA 4OPMA 5H3HA 4FBMA 3V1MA 1UOQA 1ZJ4A 1SCQA 3H18A 3CN9A 4JYMA 2EDCA 5FDFA 4H7HA 3I1IA 3ZV7A 2OG1A 4J0CA 1DWQA 5C8VA 5F4ZA 3T52A 2ROQA 2GZSA 2JGMA 2WJ6A 2QS9A 2ZJ7A 1BU8A 4Y2RA 2WIJA 1LPPA 1Q83A 4CCYB 4X97A 2HA6A 1GPLA 2WHRA 3VDXA 5AHXA 5AICA 2ZYIA 2JGKA 4IH1A 4BVKA 4ARBA 5ALKA 3WA7A 3G0GA 4C87A 1R50A 2PX6A 5AIBA 1SFRA 5EGNA 1H2YA 2QOEA 3VVLA 1RWQA 3DL7A 2EDAA 5YASA 2B61A 3MVEA 1TAHA 1CUDA 1QZ3A 3PDCA 5ALLA 3OC0A 1QOZA 3HSSA 1ZD5A 4X7BA 4U2GA 5HQ3A 2OQIA 5AM1A 4K6KA 5LZ2A 5KWJA 3BJRA 2OGSA 2ORYA 2R11A 4PSDA 1LGYA 4X6UA 5ALPA 3QMWA 4X94A 3VVMA 2JBWA 1K6EA 2XUIA 3ANSA 1ISPA 5T4EA 2WJ4A 3WL7A 2ACKA 3ZWQA 3IURA 1XKTA 3K6KA 5EFZA 1JJFA 4HXFB 5E4TA 2WHPB 3MUOA 3PFCA 2WU3A 1ODSA 1UK9A 4X93A 5ALOA 3U0VA 1LPMA 1YA8A 5DYTA 1T4MA 2Z8ZA 3O4JA 3FSGD 2QXUA 3D0KA 1XZCA 4EB0A 3I6YA 1XFDA 3DOIA 1QJ4A 4QNNA 3U1TA 4V2IA 1IZ8A 1E8MA 2VSQA 2HU8A 2AJDA 3HABA 3WI7A 3FCXA 4XIIA 4ZV9A 2HA3A 5I7UA 3H19A 4BDTA 4BE4A 1VXRA 5SYNA 5K3BA 1LPOA 3BXPA 2QXTA 4OYYA 4X71A 3I2HA 4B84A 5AK3A 3D7RA 3TJMA 3L1IA 1U65A 4X6XA 1K8QA 2VT6A 5HKAA 1VXOA 3BIXA 4OYLA 3DJYA 1DX4A 1MNQA 4ITVA 3ZLTA 2QUBA 3AIKA 4BTLA 2PSHA 4F5ZA 3IUMA 4G9GA 5AK5A 2WTMA 3X3HA 4JH0A 1A8QA 1UT6A 2OGTA 1VKHA 4E14A 4FFVA 3V1KA 3M3DA 3AIMA 1CLEA 3QBJA 3G0BA 3KDAA 4OB6A 1C7IA 3W2TA 1CUSA 1QGED 3G9XA 1Y7IA 3WWCA 5HF6A 3ESBA 4UHDA 4N8DA 1LZKA 5HF5A 5K3FB 4J0JA 3AINA 3STVA 1XRQA 2HRRA 4EA6A 3I2JA 4OU4A 1B41A 1PFQA 1U8EA 2ZSHA 4BTVA 1ZD3A 4LXIA 2V98A 1UWCA 3QITA 4IH9A 1CUBA 4AXBA 1WB6A 5JAOA 3D3NA 1OCEA 1KU0A 3STYA 2BUAA 4PV7A 4BC1A 1IVYA 5K3DA 4P92A 3C87A 1G4HA 3QM1A 2C0QA 3C45A 4CCYA 4YX9A 2VTVA 5EIAA 5CXUA 1O6FA 4DNOA 1F8UA 1EVQA 2XMQA 4LYDA 3AZOA 1LPAB 3HJUA 2QTBA 3G9ZA 1G5FA 1Q0ZA 1MNAA 5IH7A 3WKDA 3E0XA 4YK7A 4G4GA 2WIFA 4AB1A 3O0DA 3BL8A 3EQ8A 2CMFA 4WJLA 5FXMA 4XX1A 1O6GA 4C4ZA 3L1HA 1YA4A 3K9BA 4DNPA 5AH0A 4KR0A 1ZIXA 4AN1A 2QVBA 4BYMA 1PJAA 1F6WA 3E4DA 3S2ZA 1BCRA 3O95A 3HYSA 3G8YA 1YSCA 3LP5A 1TCAA 2BGNA 1QO9A 2QM0A 4KRXA 4D9JA 2VATA 4ZV7A 2BUBA 3N0TA 2VJCA 4DLNA 1GQSA 2FUKA 1ZI9A 3MGAA 1J06A 5ALWA 2LIPA 3UUEA 2WSLA 4U2CA 1G42A 4U2EA 3LIPA 4F0JA 3G9TA 2ZJFA 1R88A 1Y7HA 2WFLB 2PSEA 2HA5A 3E3AA 5CH3A 5EI5A 1GXSA 3FNBA 2QUAA 3BWXA 1HPLA 1LPSA 4HZGA 1U4NA 3V9AA 1ETHA 5DNVA 3EQ7A 5EIHA 4BCDA 4Y9SA 2O2IA 1H2ZA 1LBSA 5JAUA 1C4XA 2WILA 4ZWNA 2XUQA 3H17A 2EEPA 3NWOA 5LZ7A 5JATA 3AILA 1R4ZA 4BCCA 3FLAA 4WDQA 3C5WP 4FLMA 3PE6A 1CEXA 1CQWA 4BVLA 5IVKA 1XZIA 3V48A 1CIJA 1BCSA 2WKWA 4KAFA 4L3WA 2WUGA 1CUIA 3ZLVA 5AKLA 2HA4A 4E15A 4H7DA 3DKRA 5ALUA 2WIDA 2X5XA 2G4LA 4P93A 3YASA 4EY8A 4ETWA 1CVLA 1MPXA 4I3FA 1W6RA 1ODCA 2OLEA 2DCMA 1VZ3A 4GWLA 1BN6A 5ALHA 1UKBA 1J2EA 2OCGA 4ZRDA 1GT6A 2XQGA 4Q05A 1MT3A 5ALEA 3IVMA 1E5TA 4Q34A 1XZMA 1B6GA 5KREA 3OPMA 1CUXA 2PU5A 4RGYA 4QE3A 4OUKX 3HC7A 2AXEA 4LXGA 1LPBB 3R3VA 3BDIA 1QTIA 4KAJA 4CFSA 2ONCA 3DOHA 4B80A 1XZEA 2XUGA 1CUJA 4Y2YA 5ALTA 4PNZA 4GBGA 4UFNA 3N2ZB 3M81A 5A7GA 1MU0A 1ZJ5A 1FFAA 3AFIA 2WQZA 2HADA 3BDVA 2ZYHA 2Y6VA 3H0CA 2G63A 1QIIA 4EY6A 4UHCA 5IVDA 5JD5A 1VE6A 5CTAA 3F98A 4UBLA 3ILSA 5AKGA 4KE7A 4G8BA 4DGQA 1XLVA 4UBOA 5HK9A 3ED1A 2Z3ZA 3FBWA 5FPQA 2R8BA 5HKBA 4H7KA 4EY4A 3QZUA 3S8YA 2I3ZA 2XUOA 1AURA 1CUZA 5E4JA 5CH8A 1JJIA 1TK3A 3CCCA 1P0IA 1FFBA 3A6ZA 5HF9A 4IQ4A 4B83A 1WB5A 3WYNA 2Q0XA 1PV1A 3O9MA 3OTQA 3QMMA 1QIKA 4MXDA 5CW2A 4B85A 4DNQA 5FRDA 4ZI5A 2AJLI 1R9NA 3WWPA 1EDBA 4H7JA 2VA9A 4B7ZA 5CT5A 1TIBA 2YASA 4BZZA 3UUFA 3H2IA 4YPVA 2DQYA 5LIPA 1UOPA 2FJPA 4U2FA 2OAGA 1AMNA 1E8NA 4Y2XA 2NW6A 3FCYA 4QEKA 2XMSA 5FP0A 4HTAA 3I6MA 2WM2A 3PF8A 5BOVA 1IUNA 5JYCA 3NUZA 3FAKA 5T4BA 3DYVA 3EBLA 2XQFA 1AZWA 2HM7A 1XZKA 1MTZA 4MQMA 1HLGA 1HBJA 4L72A 2BFNA 5A7HA 3GROA 1R3DA 5JAPA 4BATA 3HLKA 2P8SA 1XZAA 1XRNA 4FLEA 1XQVA 3H2KA 3OOSA 5T4FA 2E3JA 5D7BA 1EH5A 3BIWA 2HIHA 5DNWA 3WL5A 3LS2A 1I6WA 1E66A 1XRPA 1CUEA 5BWCA 4A23A 7YASA 1W1IA 2ZYSA 1OILA 4B81A 1CFJA 1GGVA 4UBIA 4Q3LA 5LP1A 3QPDA 5JASA 4MWSA 2H7YA 3KOOA 3NGMA 4HAIA 4MEAA 1THTA 3WKBA 1XROA 1E3QA 4YASA 1L7AA 1EXWA 4ZGBA 1KU6A 4BAUA 3H2GA 1IUOA 5KBYA 2Y1KA 2DHCA 4B0OA 4BP9A 1H2WA 4QDXA 5AI4A 3ESDA 5AIAA 2XB6A 4BC0A 5AK4A 1YR2A 1F0PA 3VISA 1W52X 1TKRA 1UOOA 4NMWA 5CT4A 4GECA 4X95A 1CUYA 4ZREA 4PQEA 2HFKA 4L0CA 2W22A 3WZLA 4DMCA 1JMKC 3I6ZA 5IVIA 5A62A 2WU4A 2HU7A 4Q1VA 2YXPX 3IUJA 3G0IA 3C8DA 4E46A 2HRQA 1XLWA 4QZVA 5AKKA 3HACA 3ICVA 1EINA 2IIVA 3HRHA 3ZLUA 1VE7A 5AKYA 3AZPA 3PICA 3CCBA 1SC9A 4FHZA 3FYUA 3FOBA 1XZFA 4AMYA 2XI4A 2HL6A 5DYWA 1JMYA 4UBJA 5IVHA 4KYVA 4GHWA 2JGIA 3VKFA 1H2XA 4FOLA 1TCBA 4C6HA 1DQZA 1F0NA 5DJ5A 4FDMA 4EBBA 2XUHA 1TQHA 2PVSA 1ORWA 4UHHA 4F60A 4QDUA 3B5EA 1HKHA 5AI0A 1XZHA 1OXMA 1DT3A 3HXKA 1NX9A 1XLUA 2WLSA 4O08A 5JZSA 3RM3A 4LXHA 4P08A 1JJBA 2PSDA 3D2AA 4X90A 4RNCA 1XRLA 4DYHA 4F21A 3R3ZA 3C6XA 2Z8XA 3WK4A 2DSNA 2DHEA 1WHTA 4MYDA 4J0GA 1DINA 4AO6A 1JT2A 1MN6A 3GELA 5AKJA 1WM1A 2AJCA 5ALNA 1QFSA 1UK8A 4BRSA 4TVKA 3A2MA 4W1SA 3IUQA 4Z49A 3DDUA 3L1JA 2JGLA 2WFMA 4DSZA 4XWGA 3SX4A 3WK6A 1CV2A 4W1RA 1VLQA 3SWWA 1HL7A 3RARA 1MAHA 3DLTA 1EK2A 1BROA 4GDMA 1TRHA 4AX4A 1YS1X 2C5FA 2HA7A 2C58A 4UBKA 3OG9A 3F67A 4C4XA 4GW3A 1XZLA 3I28A 4G9EA 4IHAA 4B0PA 2XMDA 2HHAA 2XE4A 5EHNA 1LLFA 2CEKA 1G66A 5EHXA 2PSFA 5AM3A 3LIIA 4FMPA 1CUWA 2C0PA 4W1QA 3C6YA 1XRRA 3O4HA 4P9NA 1VA5A 3Q0TA 1P0MA 1H23A 3ANTA 2WG2A 3TRDA 4QWMA 2OCKA 2WJ3A 4J3JA 4AO7A 4CG1A 3IULA 2IITA 1QIFA 3NOXA 5ALSA 1WPXA 2OXEA 3STXA 3F96A 1CUFA 3AIOA 4M0FA 2RHWA 3WWEA 4Y2PA 5HCUA 2XMRA 3ICWA 2I78A 5BV7A 4GEGA 2V9ZA 3KWFA 4DM7A 4WFIA 2PUJA 5FKJA 2B4KA 4LIPD 3I2IA 2QT9A 3WJ2A 1XZBA 5CBKA 3WQHA 2VJAA 4RPCA 4HRYA 2BGRA 3B12A 2OPHA 4C01A 5AI6A 4AN0A 4J0KA 4DMKA 2GBGA 1BE0A 2D5LA 1J1IA 4TPKA 4NZZA 1QONA 5FPPA 2XUKA 5CT9A 1QLWA 3DCNA 1YCDA 1ZICA 4GXNA 2B20A 5FOQA 4KJXA 3RLIA 3VXKA 1QE3A 5AO9A 2WHPA 4INZA 4QDZA 3PI6A 3R41A 4UPDA 4G8CA 1EA5A 1D07A 2VJBA 1YB7A 4QDTA 1SCKA 1DU4A 1LNSA 1ZOIA 1WPRA 3C8HA 3PF9A 4HVTA 4C4YA 3WKAA 5LLSA 3F97A 1WB4A 1L7QA 2VJDA 1XQXA 2WIGA 2Y6UA 3D2CA 3WL8A 5EIEA 1UZAA 2XMCA 3D5EA 5JD6A 2XT0A 5JD4A 2XMGA 4EZIA 4C88A 2CB9A 1ZGBA 3A2NA 3IDAA 3STWA 5CT6A 4BVJA 1T2NA 4UHEA 3QMVA 4ARAA 1EVEA 2W6CX 3WMRA 3WKCA 1MJ5A 3BF8A 4BRZA 2PUHA 3GA7A 4N5HX 2XQKA 4W1PA 4DNFA 1UK6A 1XRMA 4BDSA 1DQYA 4BP8A 2GYVA 3DL4A 5KWIA 2O7RA 1ACJA 5EHZA 4MEBA 3C43A 1S8OA 2BCEA 1BEEA 3K2IA 2XLCA 4UUQA 5AI5A 5CH5A 3E1GA 5A2GA 5K3FA 4BB0A 4OCZA 2JEZA 5CT8A 1XQWA 1QIHA 4B9AA 3G02A 3G9UA 3FSGA 3C6BA 5ALZA 3I2GA 1K5PA 3GUUA 2VF2A 1FFDA 5HQ3B 4PSUA 2B9VA 1ORVA 5C81A 2GYWA 1H22A 4OD0A 1IUPA 4XJVA 5JIBA 3FVTA 4G4JA 3BE8A 4CIAA 4KACA 2PSJA 2J4CA 2XUJA 4W63A 3IB3A 5ALQA 2DQZA 2WTNA 3PFBA 4G4IA 2VQ6A 2RAUA 1CUUA 4PF1A 1R1DA 5DNUA 2ZSIA 4BBZA 4MJ3A 1P0QA 2ECFA 3G7NA 3TEJA 2RHTA 5DTIA 1BEZA 4WFJA 1WHSA 1ZD4A 4J0HA 2CBGA 2BUCA 2QZPA 3WL6A 5C7YA 2RONA 1MX1A 3JWEA 4QLAA 4M0EA 2QR5A 4EY7A 1EDEA 1EDDA 3PUHA 5LKRA 2J3DA 2RIPA 2Y2UA 4H7IA 1EB9A 5ESRA 4KE6A 1K63A 2BJHA 2V97A 2XMZA 3CN7A 4E11A 5AKIA 1FFCA 1Q0RA 2O7VA 1BS9A 3KD2A 2O2GA 1YASA 3V1LA 1GPKA 2Y2VA 3R0VA 2WFLA 2XUDA 2VEOA 4K5QA 3R3XA 1YB6A 2ACEA 3WLAA 1CUAA 3ZPXA 4AQDA 1HQDA 2HDWA 2UZ0A 1Y37A 3I2KA 3WYDA 1A8UA 3EQ9A 4FTWA 1RYYA 2X8BA 1XKLA 5AM4A 1UK7A 2XQJA 2H7CA 4RE5A 3MUNA 4A5SA 4UFOA 3H1BA 1J07A 4L9AA 4HRXA 2WUDA 4C89A 5I9IA 1W4LA 1XZDA 3ESCA 4LKOA 1NU6A 1ZGCA 1QO7A 2X76A 5HFNA 2PU7A 4OB7A 4Q3OA 1UXOA 2DFPA 4J0DA 5AM5A 1MAAA 4JNCA 2PM8A 4AZ3A 3DEAA 3EF3A 4Y2QA 4KAAA 4B9EA 1MX5A 2OCIA 4RE6A 4UFPA 4IH4A 4FNMA 3JYHA 5CMLA 3C70A 5AKZA 1AKNA 5ISMA 4XVCA 3DNMA 1JKMA 3WK8A 1QIEA 3ZI7A 2JEYA 3FWHA 4PSCA 4BCBA 4U2DA 5ALJA 4JEIA 4K2AA 4WDRA 3WK9A 1DT5A 5AM0A 2HU5A 5C8XA 4X3CA 2XUPA 3H2HA 1QIJA 5DYYA 4AMZA 4N8EA 4Y2UA 1N5RA 5T4HA 4EHBA 3H2JA 3SC2A 1L7RA 1A7UA 1XZGA 2I3DA 1AGYA 1CUGA 5D6OA 3C5VA 3QYJA 2CKMA 4FNGA 4DIUA 1ZIYA 3B3QA 4H35A 1FJ2A 4NVRA 4HS9A 3DKKA 3WZMA 5A6VA 4B6GA 3WWOA 5JANA 4A16A 1DX6A 4CG3A 4DTCA 1LZLA 3QPCA 5FUMA 4BE9A 5DTJA 3VJMA 1AC5A 2O2HA 1QFMA 5E4YA 5AOCA 5JZ9A 1LBTA 3QPAA 2OAEA 5DWDA 2G5TA 2XUAA 5BWBA 4K6HA 5AP9A 3AJAA 5IKXA 4H0CA 3C6ZA 3QH4A 5ALIA 3W9BA 5I8PA 1RP1A 3WKEA 4WY5A 5ALRA 4WFKA 5JZBA 3H1AA 2HA0A 4J0IA 2J4FA 3D2BA 3O4IA 2ZJ6A 2JGJA 2AJBA 4QDOA 4W9RA 2V96A 5AOAA 1A88A 1UKAA 4Q82A 3W04A 1JFRA 4OSEA 1P0PA 4X85A 4JYPA 3R3YA 2C7BA 5K3AA 4G1FA 4BZWA 1ZD2P 2OQVA 2J3QA 2RI6A 3VJKA 1ACLA 4LHEA 1MO2A 6YASA 3GFFA 4ROTA 2ES4A 5HFAA 2WUFA 3DYIA 2ZYRA 1Z68A 2PKYX 3JW8A 2WHQA 1U2EA 1JI3A 1YS2X 1QIDA 1YAHA 1FSSA 4PW0A 4OU5A 4KE9A 3CXUA 4WCVA 2XLBA 4X00A 1IMJA 5AOBA 4WY8A 3PUIA 2JF0A 3STTA 1JU4A 3RK4A 3A2LA 5JADA 1GKKA 1ZI6A 5ALYA 1WCYA 4MWTA 4U2BA 1AX9A 1E8DA 5EHQA 1VA4A 1DWOA 3I1YA 5A7FA 5JALA 1CRLA 4DMFA 2HA2A 2FJ0A 2QJWA 3OURA 2DR0A 4I19A 1VJ5A 4OB8A 4QLOA 5AI9A 1X2EA 3W05A 1W75A 5K5EA 3IIIA 4UBMA 3LLCA 2QKYA 3GBSA 4X92A 1DTEA 4CIBA 5HF8A 3WK5A 2GBIA 4NS4A 2BAGA 1UKCA 1JU3A 1WOMA 2G5PA 2CUTA 4EY5A 5JARA 1ZI8A 4J03A 3O9VA 4Q3KA 4Y2VA 4Y2TA 3BJMA 5ALFA 3WJ1A 1CQZA 2IX9A 1K4YA 1GPNA 3T4UA 2OGZA 2ZVDA 2WG0A 4CG2A 4IO0A 4Y2JA 2PBLA 2WIKA 2QRUA 3Q8WA 2XUFA 4X91A 4H18A 3QVMA 5AKEA 4KRYA 3WIOA 1EK1A 1M33A 4UHFA 3ESAA 1VOTA 2JGEA 5D3KA 3FLBA 3LCRA 1SOMA 2RGUA 3FVRA 2YYSA 3AZQA 2H7XA 5HK8A 1AQLA 1CUCA 3D4LA 3M82A 2WG1A 3IA2A 3DS8A 4Y7DA 3IBTA 2Z5GA 3H04A 2FX5A 1DWPA 5K3CA 1USWA 2PL5A 3WK7A 4EUSA 2JIDA 5E2IA 3M83A 4QWWA 4DSAA 3GZJA 4HXGA 1FFEA 4S0XA 4QA9A 4LYEA 2JGFA 3A70A 5LZ4A 4H7FA 2H9YA 5AKXA 4AZ0A 4KE8A 2YH2A 1BN7A 4J7AA 3WIBA 2I03A 4K6GA 1VZ2A 1EX9A 4FBLA 4MYSA 1HDEA 5SYMA 1EHYA 3KWJA 2H1IA 4JUIA 5JAHA 1A8SA 4HXEB 1X2BA 5ALMA 5ALVA 3KSRA 3VJLA 1XZJA 4AO8A 1GQRA 2GBFA 1BRTA 3AUKA 3P2MA 2VAVA 1GKLA 5AK6A 4GLBA 2PPLA 3G0DA 5D3ZA 3F9CA 4GI1A 1CR6A 5AM2A 5ALGA 1CUHA 4BAZA 4X6YA 4DMHA 2XMBA 4MQLA 5HZGA 4H77A 2D0DA 4N8SA 5A71A 4TGLA 4I4CA 4G5XA 1GZ7A 4UBNA 5ALXA 2XQIA 1W76A 2CJPA 2QMQA 1MX9A 3W9UA 1CPYA 5LZ5A 3OM8A 1TCCA 5FV4A 1LPNA 4BAGA 3O4GA 1SCIA 5FLKA 5C8ZA 5LYYA 2DHDA 5DLPA 1EI9A 3FYUB 2WFZA 1CUVA 2C4HA 1R9MA 5J3JA 5AI8A 3BF7A 4UHBA 1N1MA 1N8SA 3EIOA 1UFOA 3STUA 5K3EA 1YAJA 2GBCA 2AJ8A 1C7JA 3SK0A 4FWBA 3D59A 1THGA 5CXXA 3FYTA 5LZ9A 4FKBA 2BKLA 3HZOA 1QTRA 3WWDA
chains in the Genus database with same CATH superfamily
3GRZA 3L8HA 4H60A 3IPRA 3A1EA 4OP2A 3R7SA 3GJYA 1XU9A 3B2EA 3HI4A 3QBDA 3QVOA 5K0NA 4BNDA 4RV5A 3KQTA 2CXPA 1KR5A 1T2DA 3BULA 3BZWA 3TRKA 3QSGA 1XDBA 2Z3WA 2FWAA 4QO8A 4D0LB 1ZMRA 1MEJA 1C81A 1YJQA 4E94A 4P0PB 3QU5A 1N5MA 1HE8B 2QTCA 3C7TA 4DREA 3B5JA 4PVCA 3CLUC 4QDKA 1KOGA 1H2FA 1E9RA 2Q5HA 2WUEA 1OYOA 1Q1BA 1O9HA 4LN1A 4ZXFA 3W5HA 2A0WA 1ABBA 5AJHA 2HDOA 4HDOB 4FYPA 3OZAA 2LVBA 4KWIA 4NBVA 2G1UA 1XI2A 4FFWA 4XIFA 4LRSB 2ODTX 1UMBB 1VMIA 2CKDA 1SO8A 2DF8A 2O2SA 3OT5A 4J16A 2HW8A 4MGEA 4CQMD 1C41A 1EZZA 1CRQA 2JRLA 4OHWA 3B53X 4US0R 3ZJUA 4M0MA 3OQBA 1ISIA 1QIMA 2JAHA 2W11A 1C7FA 3K1TA 4QG7A 3ZY3A 5F98A 4I4TA 2G04A 3CUWA 4DIMA 1EMDA 3MOGA 3UAZA 5LZ8A 3UFXB 4N5IX 3ZQ4A 4Z4GA 5A6SA 5LOVF 3UMYA 4HQRA 4U7GA 1PJ4A 1B3RA 2OT3B 2YWHA 4C21A 4GBMA 3VBCA 4RTKA 3K5WA 4GX0A 2V6MA 2WTAA 2BLLA 3CPEA 1MVNA 5HJ5A 2Q29A 5EAIA 1B00A 3QKUA 2PZMA 3F8SA 2OOSA 4TVBA 5F3RA 5BNWA 4CCWA 4H17A 4DG5A 3ZVNA 4QOSA 4M1QA 4R84A 5FUQA 3DQZA 4G8DA 2ZSBA 4QSMA 4A8PA 3R3WA 4IX1A 4L08A 1QFZA 3UXYA 2FQQA 2XVXA 4ITRC 1O3YA 3O4RA 2CZQA 3Q85A 4XE5A 1LY1A 4YV7A 5AHOA 2ZUSA 1ZU4A 5KCMA 1T9BA 1JEYB 1FW8A 3MJFA 3DV0B 2F8MA 2GERA 3OP4A 3T9DA 2CK3A 1H9CA 3JQAD 1CDOA 4AZSA 1U1IA 1TT7A 2GCOB 2D2VA 4ODIA 1MW9X 3R40A 1KGSA 4RYLA 3I2FA 1WQ1R 4AZWA 3DD5A 3KXPA 5ENDA 5KTKA 2BM0A 3QWHA 4JYAB 5IMBA 4YPOA 4ZQCB 2M1ZA 5K05A 4I5EA 1B23P 2P6NA 3IV6A 3KTAA 4GOOD 1U6JA 3V1MA 5IZ4A 1EWRA 1ZJ4A 1SCQA 2CMDA 2W8BB 1G41A 3HG7A 3MSXA 5TARA 1DKNA 5KTSA 1MRSA 4GPD1 4QYMA 1JPVA 2IOQA 1EQ2A 2IOFA 4E30A 5FDFA 3I1IA 3TLCA 2DRIA 2QAGC 3LOQA 5EPOA 1UDAA 2ZJYA 2I3GA 3K0CC 4ARVA 4DJFC 4PN3A 3R9XA 1QV6A 3FWPA 1B93A 3VDRA 5E9JA 2FWMX 3S4YA 4ENSA 4TLEA 2J0QA 1XMVA 3N8DA 3R77A 4U9UA 2NYVA 4J9UE 4L3VA 5JOQA 4I50F 2RCYA 2WPDA 5F4ZA 3X1KA 4Z0NA 3E5MA 3OJCA 1M0WA 3T52A 4CR8A 2ZXUA 1XA4A 2GZSA 3PC2A 2QS9A 5JUWA 1WCIB 1QB8A 1YNSA 3CZQA 3NTVA 5DSZA 1Y98A 3CRZA 5B1HA 4Y2RA 3UWOA 2OBMA 2WIJA 3BD6A 1CT9A 1Q83A 2EXXA 2QX6A 3KQYA 2A9FA 1UAGA 1X87A 3LT5A 4X97A 4CCYB 1OSNA 3CIOA 4H1WA 5HS4A 1HQCA 3DCYA 1PG2A 4PG4A 1CJUC 4WNCA 2C8VA 2CD9A 2ZWAA 4MR9B 1Z45A 2J32A 4Q19A 4RJIA 2PD6A 1ZM4A 1DFHA 3P2YA 3TLBA 3HYNA 2EG9A 4D6YA 2GDZA 3BSFA 1ELOA 4BEVA 4IIDA 3KJHA 1TA4A 2Z98A 1AHPA 4OQDA 5ALKA 3ANLA 1D0SA 2N47A 4C87A 1T25A 1KS9A 2NUTA 3OTGA 5I7FA 1DEOA 5HKKD 5U4QA 3DNFA 1N36B 4BHTA 4IKOA 4URZR 3PG5A 4MWZA 3THRA 3CUKA 1UJ5A 2ZAMA 4P80A 1I3MA 2VDWA 1Y63A 2OM6A 2WA1A 4ZT6A 2JH8A 5H5JA 4XRGA 5YASA 5CEJA 1Z7BA 1NC1A 3E5HA 5DHPA 3VZBA 4ND8B 4TKVB 2V6FA 3BRCA 1JDTA 5KJFA 5LDHA 4DE5A 4OGGA 3B1KA 3MG9A 4S1TA 1MB0A 2QTRA 5AHKA 3HI6A 4BV2A 1JHRA 4S05A 2G7MC 2PS0A 3MCAA 2OBFA 3PDCA 4QIHA 4R2IA 5D5PA 5IBPA 1HM5A 1QGAA 4IXNA 2RH8A 2CXOA 1LW6E 1QQBA 1XSEA 1SUEA 1XJWA 2AS0A 2Q9CA 4HGYA 4WKGA 1RZVA 1X1DA 3MWEA 4Z86A 3HSSA 4W99A 1ZD5A 1EXVA 1UPBA 4KXQA 4ZU3A 3UJ8A 2NVUB 5HQ3A 2FY8A 1TTTA 4R31A 2OP0A 2D2FA 2V74B 4BGDA 3T4PA 2WJPA 4DCGA 3EGDA 2UUBB 1EZ1A 1NJ2A 4O4HF 3BN3A 1SOWA 1C30A 3HWRA 1X3SA 1NVVR 4ZICA 1UZMA 4F91B 3H2ZA 1RWPA 1L8XA 1AUVA 1QCZA 1ZBQA 5DF1A 3ZWVA 1LGYA 4X20B 4FPXA 4B43A 1UR5A 3QMWA 2AN5A 1O77A 3SU8A 4UVIA 4WZAB 1LDYA 1K6EA 2XUIA 2GPTA 2ZIXB 3DF7A 1PD1A 1YZQA 1ZKMA 4FX2A 3B6EA 4X7MA 4E6EA 3ME5A 3NEAA 1XTRA 4GYKA 5JROA 1HTWA 2VZLA 3GP8A 3WL7A 5CYPA 1LV7A 1R74A 2VRCA 2VTDA 4HDKB 4HZUB 4PAOA 3LC2O 4RMGA 3BXGA 2QQFA 3PX7A 2IYUA 1UPUA 2VYNA 2AG5A 3DZIA 3TLKA 2UZ4A 1X86B 2XEXA 4L0DA 2BSAA 5EFZA 5JE8A 2PKWA 3C4JA 1PK8A 3DO6A 4WD3A 4UNRA 2SHKA 3N6XA 1JEDA 2ATVA 1SELA 3JYNA 3PFCA 1RRMA 4MRSA 2IUSA 3P1JA 4R9UC 5ALOA 2XW6A 4Q3AA 5C8YB 5KYXB 4QJBA 4X63A 4EK9A 1JBQA 2WC1A 4IM7A 4EB6B 2BTQA 2PX3A 3AFNA 1R12A 2LE0A 4MB6A 1MGOA 3K0SA 1KI4A 1A8IA 3FSGD 3ZIAA 2F8SA 4DQVA 2ZT6A 4RZIA 3VTKA 1LI4A 1XZCA 1JKJB 1SRRA 3NNNA 4G24A 4HPWA 4XQ9A 3QOXA 3BKWA 3NOOA 2CV0A 1CKEA 4ZARA 5K99A 2D54A 4B3DA 3RVOA 4I7EA 5CA0F 4EW1A 2YS7A 5HILA 1VBMA 2FLKA 3ZXXA 1I51A 2HMYB 3EIFA 3SX0A 4YP0A 1S01A 5B53A 2XT9A 1C5KA 2C4NA 3SF0A 1Q3TA 4ZZIA 1AZSC 4P7JA 1JDBB 2GAFA 2QRZA 4PRYA 4S0ZA 1UDXA 3HB5X 2PN1A 4Y1FA 3U81A 4EP1A 1NPDA 3NU1A 1Q3HA 3GGOA 1ECLA 3F7MA 5IJ0B 1AQJA 1A9OA 2BKXA 2ZVQX 1EUDB 4INPA 3FTDA 1B4DA 1JR2A 2HHHB 1A76A 1JQKA 3O4FA 1RI2A 4EI2A 4BQPA 2BKAA 2JAPA 1G19A 2W5UA 3PPVA 4ND7A 3RS2A 3RYCA 4H4DA 2V1XA 3HZHA 2ZAIA 4RGBA 2OZPA 3BXPA 2ZI6A 2FKAA 1Q7RA 1H3FA 5K6AA 2SCUA 3BILA 1GZDA 3ORFA 5B57C 2FCRA 1XYYA 1ZO8A 1ARZA 1I7NA 2J1LA 3TSOA 1DAOA 2XZTA 4AF8A 1KAHA 1U65A 3L3BA 4QICA 4Z54A 5FWYB 5K9ZA 1K8QA 2ZUVA 2YV5A 1CJTC 1LK7A 3OZEA 5JDCC 5DLDA 3BIXA 4OYLA 3EFOA 1OFIA 1RTKA 2JA1A 3DJYA 3MWJA 2Z5VA 3HYRA 1YDEA 5EHIA 5HM8A 1X15A 2GCIA 3U4HA 1Y42X 2WD8A 3RBXA 3V4OA 3E61A 2OAQ1 3NJ8A 3HO1A 1DKUA 4KO2S 2IIQA 2JZCA 4LXUA 1WBJB 1K7YA 2Q4OA 3C6KA 2VXBA 3MLBA 1UJ6A 5CJJA 4F3CA 3ZDCA 3X3HA 2BJWA 4JH0A 1LS1A 4DMLA 2FFHA 1APBA 5DSXA 1ZS9A 3DVRX 2FPLA 1HE2A 1M34B 1P80A 2D4AA 4CEJB 1LD3A 3EOZA 5FFFA 2OGTA 1VKHA 3U56A 3AIMA 1L5NA 1RFGE 4OMFG 3AGPA 4IHJB 3QBJA 3KDAA 4IHQA 4PYKA 3RJ9A 3TOSA 4X24A 5F7OA 1ZEJA 2B7BA 3IHWA 4FSHA 4UXIA 1QYDA 4Q37A 3W2TA 3OOEA 3S55A 1RRVA 4M1KA 1BJTA 1Y7IA 5JSYA 6PFKA 4YCLA 4I50A 1UWLA 5HF6A 1XA0A 4CM9A 4MQEA 1J90A 3NHPA 3NTQA 4FOSA 2WJJA 1ICEA 4MLDA 4S04A 4DLBA 1MD9A 5EUMA 4YRSA 1SXGA 4M0CA 4IEIA 1MG5A 2P2SA 4TRJA 4Z8YA 2WF6A 3WO1A 1JALA 1AIPA 4KXMA 2EP7A 2GEUA 3A6FA 3I2JA 4OU4A 2Y1LA 4UAUA 2FN9A 2LUOA 5DN9A 6Q21A 1MKYA 4P0QB 2ZSHA 1CWUA 4MUEA 4LXIA 2V98A 4RPJA 2XOEA 2OG2A 4CN9A 5J4KA 1P0CA 1KFEB 3WVNA 2ISCA 1GRCA 5C7OO 3Q15C 4Q3NA 5DX1A 4DQDA 2IS4A 1Y3HA 5FUVA 4FYHA 1N7HA 2NLOA 3HGMA 1H4VB 3BWMA 3Q5DA 1A8HA 3OTIA 4O2RA 2O2YA 4O1MA 3NOVA 4S1NA 5FNVB 4DQ0A 5A2QA 3OICA 1LFAA 4MW4A 1WF6A 5K8VA 3WGVA 4BC1A 3I8XA 1DG3A 3ZHBA 2PH1A 1YFLA 3HR7A 3M1LA 4JUCA 3VO1A 4E3ZA 4ZCRA 4CNQA 1M7BA 5LA6A 3GJXC 4S24A 5HUJA 1W19A 1DAEA 1NW5A 1PR4A 4JDUA 2BF7A 5C52B 4FB4A 2QUJA 1PQPA 2H2WA 1O6FA 1F7UA 1T6YA 1VE9A 4V0SA 1PFUA 5ICSA 3BHIA 3JQBC 2G09A 3M70A 2KS6A 4OOFA 5L3SA 2VBFA 1DQPA 3G89A 4EM6A 2GKGA 2Y68A 4TS4A 2P5YA 4FC7A 4F06A 4LOJA 4B76A 4V1CA 3ZR4B 1MEOA 2I65A 5TRTA 4FD3A 5TQ0A 4X60A 4XVRA 5A9TA 3I9V6 2IDJA 5ERXA 4ZOLF 4CQMA 5J1SB 3E7DA 4Q3BA 3E0XA 4IIEA 4C4RA 4UVHA 1YR1A 2WIFA 4AB1A 3Q7QA 3BL8A 3EQ8A 1G5TA 2IKSA 3VNSA 2ERCA 3KKKA 3KVRA 3Q3CA 2GRAA 1G3MA 4LJ4A 2IELA 2J5XA 3O2SB 3HN7A 5KJCA 2AX4A 1RAAA 3ESYA 4P7FA 1AZTA 1PJSA 3DEHA 1UF9A 5IZCA 3VH1A 4AKHA 5AQEA 2PJDA 5CVCA 3ZVRA 1WZIA 1DL5A 3K9BA 3H8JA 4JJFA 3UENA 1KJIA 4ECAA 1QVRA 3OKAA 5DK4A 1FTYA 2M2IA 4FFPA 2IE8A 3AP1A 3DDCA 1SIWA 1FJGB 3CMCO 5DGIA 4HAXA 3RUHA 4BYMA 4KV9A 4PC1A 3E4DA 1C9EA 4PLFA 4PINA 4D97A 4YMGA 3L7BA 1G2IA 3A6HA 1W4AA 3FUTA 1E7RA 2FZVA 3KUXA 3G8YA 1GA6A 4N82A 4MGHA 2Q0HA 2BGGA 1I4DD 1L5OA 4N49A 2QYTA 3PIIA 4JXJA 1Q1GA 2QE7A 2VP5A 3KOXA 3LBHA 4B3SB 4KRXA 1P1HA 1S8NA 3A4TA 4D9JA 2KW5A 4GMDA 5H70A 4RNDB 5MGNA 1YBVA 1PR0A 4ZV7A 5BNIA 2ZM5A 3KE8A 4R71A 5L6MB 1L4GA 1W96A 1UJMA 1W1UA 3N0TA 4HOYA 5G02A 4AUEA 2CDNA 1N6PA 2JHAA 1GQSA 2IZ5A 1D8TA 1XC7A 1OVGA 1BS2A 2ZJAA 3LP8A 5A3RA 5CFQA 3L40A 1IPFA 3PSAA 5ELMA 1A04A 3PEUA 1F48A 1U7ZA 4U2CA 1G42A 4U2EA 3LBYA 4UUBA 4TMXA 2RHMA 3HKEB 1GFIA 1XALA 2IGBA 4BMZA 2AQIA 5T57A 4KGVA 1QZZA 1Y6QA 3G9TA 4QAQA 2BBTA 3WYBA 2HHLA 2ZJFA 1GUYA 5CU7A 1PL8A 3FMIA 2BT4A 2FSVC 4IQ8A 4W7IA 4QU5A 3VBEA 1GUBA 1TI7A 3E3AA 5CA0A 3TTYA 1MEEA 4JK3A 4BPBA 2YXBA 1NUTA 3ZZTA 4Z2AA 3OM9A 5SZKB 3IQDB 2A6PA 1ETHA 1QC5B 3WMFA 1Q0PA 5DNVA 1RWOA 3UAYA 4BCDA 4BU0A 1L5WA 5JO0A 3INTA 2OXCA 5JCOC 3A9VA 2HSDA 4NS1A 3O90A 4Y9SA 1DIBA 1JJ7A 2B7LA 3OCWA 2EL9A 3IE0A 5FOTA 4D80A 2FU5C 2WE8A 3NHWA 1KYVA 3JQEA 2HCBA 1CQJA 3T94A 1H2ZA 1TMOA 1XHFA 4NCKA 4KVZA 2D0PB 2Z4SA 5ENZA 2SNIE 1JG1A 1OT5A 3JZAA 2B4QA 3LDAA 2FMXA 3OQ6A 3PQDA 2ECKA 3BUSA 3LUDA 4P22A 3A3OA 3F7TA 3ZUGA 3UOGA 3S2SA 1JILA 3Q7SA 1NL3A 4E5MA 3K0AA 1OX5A 3KLPX 4PBTA 4UTZA 4EJ0A 4REMA 1OTXA 2R79A 2WU8A 4YJ3A 4JUDX 4EQZA 3UFBA 1D0IA 3ULKA 5JYEA 1CVRA 4WDQA 4QULA 4BQIA 3M5PA 2BBWA 3ZV6A 1CEXA 4EPXA 4IZHA 5IVKA 3TIVA 1F14A 5C3UA 2EJVA 3ZH9B 1GTJ1 3TTUA 3ZS9A 2ZSDA 3G2LA 5K0FA 2Y1GA 3IAAA 1DEKA 3FOAA 3MCUA 3C3CA 1IHPA 4P4NA 3ZQJA 4NFYA 4L3WA 5JV5A 1Z75A 3RU7A 2WUGA 3V4LA 3QF4B 1AK9A 3THOA 1TFRA 5MN6A 1XDGA 5AKLA 3FDXA 4MTCA 1KA9H 4H7DA 2X2EA 2HYDA 1XWWA 1SHUX 3ENZA 2ARKA 3KZMA 2P79A 2P9YA 3DT9A 1RM3A 3R76A 3CPSA 5LBTA 3RTBA 3LXXA 4JI2B 1U0LA 1PR9A 3NI2A 2W70A 3LQYA 3MXOA 4EUEA 4RVUA 3LHKA 3RVKA 3VPXA 2PX2A 5DHRA 1M6EX 4I3FA 1W6RA 4IDPA 2QGNA 4LOLA 4COKA 1GZSA 2CFRA 2I33A 3GX1A 3R20A 2ZI4A 3AG5A 3OEED 4L73A 1TD1A 4WA8A 2BD0A 1EG2A 1U04A 1UBSB 3OECA 2LNDA 1O95A 5ALHA 3CWQA 3C6QA 4GM1A 2ZG6A 4O0MA 3UTCA 4MA4A 1UKBA 1VRVA 2OV6A 1ISSA 2ZR7A 2O1SA 3KCQA 3SDBA 3WLOA 1QZUA 2I0FA 3USES 5TQ2A 1NVVQ 1IM5A 1MT3A 1Y5RA 5EP2A 2UZIR 4PO1A 4TWJA 4ZEVA 3WBBA 2HJHA 4KBGA 3IX7A 3OZUA 3QLTA 4FS3A 3DPIA 2GJ4A 2CJXA 2FVYA 2P9BA 2ZWPA 3CS3A 3S28A 3TRHA 2UVPA 4H0NA 2P68A 1ZWLA 2D1RA 4YRDA 3W6OA 3BMQB 2P41A 5EZYF 1FEZA 3M6XA 2VWPA 1W85A 3DF9A 3ISVA 4OUKX 3VYUB 3JAWA 2PLNA 3LMKA 2ABWA 2I2BA 1HDCA 4GLJA 5C5IA 1W36C 5NULA 4XWWA 1GPBA 1WUHS 1ZHFA 1N5DA 1R0ZA 3OQIA 1E18A 1ZA1A 1QH1B 1Q7TA 2ZPUA 5FWXB 1AKEA 1P1FA 1G64A 1GY8A 2W6JA 1I0IA 4H1TA 1JAYA 4KAJA 4TLLB 3Q10A 4LF9B 4TV8A 1EFVA 2ONCA 4RV4A 5AJVB 3CO0S 3TPFA 3IUBA 3PNYA 1YI0A 4PZ0A 3UGKA 1KSHA 4TKVA 1DBIA 4NAVA 1SCBA 4OQPA 4Y2YA 1DNPA 1A9RA 4JAVC 3V8MA 4PYJA 1YOBA 3KKLA 1T9GR 2EEZA 3H9CA 1UBCA 4F04A 3TD6A 2I6TA 1O8CA 1XNGA 4IRXA 3AFIA 2ZUBA 2QIOA 3M5DA 1IIBA 4XAQA 2BFFB 1VMKA 1OTYA 4IGEA 4LCJA 4ZVRA 4LXYA 3BDVA 4ZP1A 4PRLA 1ZVQA 1D2MA 3AHFA 3G49A 4OK5A 4UNQA 3RS8A 2IP1A 3H0CA 3EMBA 2DWPA 1T8TA 1GITA 4HKTA 1EWTA 1DARA 1SVNA 4UM9D 5JS2A 3I05A 5C2JB 4ZOLA 2I6UA 2V4MA 3DFIA 3A9WA 2XNKA 3MWDB 4M0PA 4UHCA 1H5UA 4RSMA 5EXSA 4QUBA 1N78A 1VE6A 4EWLA 4AJJA 3HV2A 3E8XA 4M9RA 3IJEB 4F6CA 4FGWA 1ZD1A 3EXG2 4R9SA 2Q7XA 3QYAA 4YB8A 4OM8A 1TMGE 1KDOA 3DHWC 4BX8A 4DLRA 2WTXA 4NYJQ 5F2NA 1PL6A 1AA6A 4QAJA 3DEKA 3NALA 4OHUA 3A6DA 2O0JA 1NC3A 3S3TA 1WABA 4G8BA 3NMUF 3U5TA 4DGQA 1EP2B 1XAJA 5HBRA 4FSXA 4DIFA 5HK9A 1KE2A 2V3VA 3P2EA 3NT5A 3BMOB 4EG8A 2WJGA 2W2NA 1P19A 3K6SA 4MHSA 4ESOA 2Z3ZA 2IEDA 3FBWA 4D3SA 1JHUA 3IPAA 3I9NA 1B2LA 3DGEC 4PZAA 3F9RA 5HUHA 4D9NA 2I3ZA 4UD6A 4H9GA 5EEHA 4DSTA 4HH4A 2JHPA 2CYBA 1NVMB 3DBVO 5EE9A 2CNBA 5PGMA 4A1FA 2FE4A 2JLAA 4N5LA 3CX4A 5JT1A 4LPKA 4ZVNA 1EUCB 4GZMA 2WV9A 1YVUA 1VSUA 3KT3A 4P4GA 3SHOA 2QAGB 5HCNA 1NMZA 4F12A 3T99A 2WAOA 4UUOA 1J9ZA 1TK3A 3CCCA 1IH8A 4FHDA 1LS6A 2PMWB 2RMKA 3A6ZA 3NWEA 5L9AA 4DQXA 3ODPA 5HF9A 3Q3IA 1KQOA 2HWWA 2QF7A 4MKGA 4O1HA 4AROA 1QPZA 1SZPA 4LVCA 1PV1A 3O9MA 2GEFA 4KH1A 4CL0A 4ARBA 1XEXA 1ND5A 1QIKA 4TN5A 5KKAA 1CR0A 3AI1A 2PNJA 3L4KA 4WV3A 3DDHA 2KLHA 4MUJA 4E32A 1D04A 2IZ1A 3ZE8A 3L49A 1SC1A 2NXWA 3OWXA 4DNQA 5FRDA 3GHYA 2AJLI 3DR5A 1XWFA 4INOA 1R9NA 1ZJ6A 4QXPA 3U2QA 4E5UA 3B1FA 1I6MA 4R3NA 4JUFA 4YJGB 2JIOA 2V5AA 2IYVA 2YIVX 2V3CC 2RG7A 1P1KA 3KS9A 1Z35A 4IQGA 5DM70 5A1JA 3TS1A 1B7GO 2YASA 4JVLA 4JGBA 2ZIAA 5AESA 3NT4A 4IJKA 2GD0A 4JD5A 1JG3A 5GZ6A 1FDUA 3TXXA 4YRNA 4NNPA 3N58A 4U2FA 3DBRB 4EZEA 2HJGA 1PI3A 2IU3A 1RWMA 2BM8A 1AMNA 4QUHA 4DCJA 1KMQA 2GZ2A 2V6BA 4Y2XA 3CRNA 3NBMA 5DH9A 3W3ZB 4CQLB 1V5GA 2NW6A 3V6LA 5J63A 4KOEC 3UK2A 4QEKA 3SKXA 4AM8A 1YOVB 2XMSA 2X5NA 3AFMA 4GPZA 4CKBA 2WU0A 3NXSA 5CDYA 1LSJA 5IAAA 1E7YA 1YVRA 2NVOA 2R3SA 3QIAA 4Z7JA 1GCAA 4FMBB 5KWVA 3F4LA 2ZW9A 4TQ9A 2Q8QA 1D1TA 2I7VA 4I4NA 3FAKA 4QBIA 2DERA 5DV9A 1UBRS 5B6PA 4TS1A 2WJWA 3HB0A 1U2RA 2OCXA 2PMFA 4LXQA 1CR1A 3SD7A 4NWIA 2YJ5A 3ZDEA 4UAVA 2HBRA 2WUVA 4XX0B 1BKDR 1UKVY 2CXHA 3DHEA 5E1DA 5TR9A 1TKBA 4BNGA 2W6NA 3HGTA 4AX8A 1P72A 4MLZA 2VP6A 3D1LA 1SU4A 4AIRA 1XMXA 3JYPA 4YRLA 1BA3A 3TMYA 4RAOA 3O82A 1E6WA 4HUQB 3GD7A 3N2EA 4BYGA 4ENWA 3W78A 5EN4A 4XTCS 4J6FA 5JXHA 1J42A 5KAMA 3GROA 3AQIA 4BATA 3KK0A 2ZB2A 2P8SA 4CMBA 1PTJA 4BMNA 1XRNA 2NU8A 1Q0QA 4FLEA 1GD1O 5D2CA 3UMVA 3FKSA 4DAOA 1QG2A 2A0YA 1KAMA 3EWNA 3KSAC 1FFYA 3SMQA 1NI5A 2GD1O 3HEBA 3H2KA 4FE4A 2VHYA 1RAIA 2E3JA 5D7BA 3KQVA 3BIWA 2W00A 2HIHA 1OLXB 2XWJI 3B3JA 3JCZA 2QTVB 5DNWA 5EQFA 4RDHA 2PD4A 4NZYA 2WSSA 4MV9A 3ZVMA 4LECA 3FB1A 3EWIA 1YQGA 2DFVA 1CUEA 1PDVA 2QUHA 2QW1A 4I5FA 4LJAA 2J3LA 3C7AA 2GA9A 3MJCA 1GDHA 4QARA 2HK6A 7YASA 2WWYA 2Q1YA 1MO3A 3CA8A 1W1IA 4YEDA 2ZYSA 3CZ5A 2A9RA 5AVJA 3K8ZA 4UBIA 2EBWA 1J8VA 2V9PA 4Q3LA 3ZS8A 1KI2A 4KWCA 1JG7A 2X14A 1P7WA 3B3FA 1Z3IX 1ESDA 4RDCA 1RI3A 3GCGA 3SE7A 4EAQA 3A1NA 3QEAZ 1F5SA 5H16A 2ANBA 1JDNA 1MORA 3TQHA 5DYGA 4EF5A 3KUUA 1YVPA 2DUUA 2EKBA 2GZMA 2QLNA 1T1JA 2XTNA 3R5KA 4GWKA 1U28A 3NGMA 4HAIA 1I7SB 1FQWA 5EZYA 4F8YA 1OB2A 5ETJA 3WKBA 1FXUA 1IG3A 1E2PA 3WMEA 4EFKA 1LVHA 2X58A 4UJ5A 1CJVC 4JGGA 2UZ3A 3PFIA 3FB4A 4WVLA 3TWOA 4GM0A 2X6TA 2WA2A 1JIVA 4WT7A 5GONB 1L3IA 1EXWA 1NWCA 4UUAA 1PNTA 4KMSA 4BAUA 1S2IA 5TLSA 2ZK7A 4W82A 4C05A 1IUOA 4K81B 5KBYA 1HC7A 1PVVA 2BW0A 3LY7A 2Y1KA 3PDIA 4QUAA 2NU7A 2Y76A 1BVRA 1JIQA 1T4DA 1VL8A 3BGVA 5A5GA 4X8LA 2VUSA 1H2WA 1CF9A 4NJOA 4ZCTA 3ESDA 4FYVA 1XYGA 1A5TA 2ODAA 2XB6A 2RK3A 2XQVA 4MW9A 4BC0A 4L16A 4W5HA 3VH4A 1RBZA 4MRMB 5KYKA 3B9PA 1KO5A 1F0PA 1I3LA 3VISA 1OBOA 1XDZA 1YKSA 1ZNXA 3BX1A 3B9RA 3KR9A 4XB6B 1NATA 2DPGA 2L82A 1YZKA 1L4FA 2E4AA 1PSDA 2G7ZA 3EA5A 3GPLA 1F2UA 5CT4A 3HCAA 3CSDA 4NFSA 1NF8A 1WULS 1TA0A 3FNHA 2VHTA 4L8WB 4BQOA 4RKYA 4JJ8A 3QVXA 2OHIA 3ZUPA 3UPUA 2E6UX 5EEGA 3DBLA 5F1OA 3NKVA 5KOHB 2W22A 4EAAA 4K9QA 1K27A 2A9KA 3X1YA 1JMKC 3EUEA 4QRHA 2OWEA 3UG7A 3QOYA 4ZYVA 5LVAA 1QR6A 5A62A 1M8JA 4P1ZA 3TSYA 5KVAA 1NQTA 3SS7X 5F77A 1A7JA 1C4KA 4E5PA 1II9A 2YXPX 4Q1VA 1FYEA 4X54A 4WMLA 4A7PA 3G0IA 2CW5A 1KRXA 2O7NA 4C4OA 2QVLA 1XEWX 3IAS1 4IIJF 4PCUA 3CRVA 1NUQA 3OQHA 4ZGGA 5CJ2A 4OFBA 4MGKR 1NP7A 4J9VA 1YH3A 4S1PA 1B8PA 5DDIP 4ZT7A 5AKKA 5IYZF 2HSWA 1Q7EA 2PKEA 1HLPA 3HACA 3QE9Y 2JD0A 4Q3DA 2QD1A 5LWQA 2PIDA 2HV8A 3A6KA 3ELDA 3B13B 4QL3A 1PHPA 1W4BA 1DI0A 4QHSA 2QN6A 1SD5A 3HRHA 1E3JA 2B99A 3LI2A 2CDCA 3F5DA 2OCYC 3PICA 5IKOA 4EG7A 1E2FA 1TRKA 2B36A 2REXB 4KX5A 2CNDA 3O9ZA 1T26A 5GTDA 2O8FA 2HUPA 2ZRDA 4RMJA 4FHZA 3FWYA 1TZKA 1VIYA 2IODA 3A1TA 3FYUA 4D96A 4V2UA 3O74A 1GTVA 5HDQA 2XI4A 1SB9A 3F6PA 5IJ9B 4QU0A 1KTVA 1RKXA 2DLDA 2BH2A 1Q91A 1T6BY 1ABEA 2DUWA 1J7JA 2V7UA 4LV5B 2CXQA 2YQ5A 1CY4A 1SUDA 4GPTA 5IF9A 1SBHA 4ZVQA 1Z17A 5IVHA 1SQ5A 1KPGA 1E7WA 1HDRA 4PC3A 3GMDA 3OWHA 4NH4A 3RK0A 1LDBA 1F6DA 3I5MA 2QN3A 3RRFA 1DQZA 4Q7EA 2NAFA 3BKXA 1E9DA 3H87A 3IQXA 1F0NA 2DZDA 4MW1A 2QRGA 1NRXA 4CU5A 2IK8A 1R0WA 3G5UA 2FPIA 5L3RA 2XUHA 1PZFA 3VTFA 3AEYA 1DBSA 5B4UA 1O97D 1O96B 3OEEA 3PGXA 1SHLA 1CIVA 1AKWA 2Y0EA 1U1GA 3B5EA 4QQRA 1CDDA 3TVYA 3ZX5A 1SH7A 4BGUA 5AVSA 3TDKA 4HQFA 1C3JA 1I1NA 2I4OA 3PJEA 3QJGA 4HNHA 4PFQA 4RFVA 3ZJ5A 2EJTA 2MINA 3VDQA 1JXOA 3F3MA 1JLRA 2O48X 2CMHA 2QSJA 2YINC 3ACDA 3RM3A 4DDHA 1R4MA 3OCJA 2IF0A 2NMVA 3LPMA 1LSOA 1JJBA 2PSDA 3LHFA 1THMA 4HAOA 4KDFA 2KLBA 5FR1A 3TZKA 3VQTA 3DVAA 4BN4A 3W1WA 5J4YA 4RORA 3JQ8B 5IZCC 1YS4A 5B6IA 2VNAA 3LFHA 2GYYA 1JECA 4HDCA 1E1YA 1HL3A 4XSHA 4DQUA 3GVIA 4V0NA 4J0GA 1E2HA 4JL6A 5AJXA 4CYMA 1TYCA 3K9FC 2QRVA 3OUZA 4MWDA 1T3GA 4D8WA 1E96A 3GELA 2ERYA 1L7MA 1DBVO 3ET5A 1ONBA 2ZQZA 4FXPA 4IPTA 5AKJA 4MYRA 1YC2A 3T3HA 1QFSA 3QUSA 4I1RA 2BFWA 4CCSA 1KRHA 3QKSB 5A06A 5HOQA 4EUHA 1JT9A 4W1SA 1BXGA 5TMEA 1UP6A 3AJRA 3WMXA 3DDUA 5MFZA 3L1JA 3GLGA 2E37A 4HGZA 1ISFA 1Z9BA 2FW8A 1KR2A 2H5IA 1NV9A 3ZWCA 3D54D 4C0QC 1UC9A 5EWMB 3WLNA 2FW6A 1EQAA 5JSZA 3KR1A 2H4FA 5I48A 1VCOA 4Y30A 3GLIB 4GKJB 4K26A 2P3OA 3SX4A 3AONB 3WK6A 1ZNQO 1ORRA 1ULAA 1VHLA 4MOWA 3D3WA 3Q98A 4W1RA 3QFSA 4RTNA 1B8UA 3REQB 3S29A 5K8JB 2X0IA 2R97A 2PT7A 3HVUA 4GQIA 4L0QA 4CN8A 5GADl 3RAEC 3BXOA 3MLEA 3F7NA 3EEIA 2QV0A 3DLTA 3KTOA 1M0TA 5JCXA 1I2DA 2GM5A 4KUGA 4PTZA 3MBKA 1R2QA 2IHUA 5FA5A 4GDMA 3L7YA 5BURA 1KKLA 4AX4A 2EZTA 3PFNA 521PA 4CR6A 2YRXA 4YMTA 3IUYA 3P27A 2HA7A 3AEQA 2PX4A 3W5DA 3KSBC 1VPLA 4F45A 3FUCA 2EGGA 5JXIA 4RTRA 4YJHB 1FDOA 1XZLA 2VPPA 2Q5EA 3I28A 1VHTA 1N2CA 4NR0A 4IHAA 3TM4A 2VJNA 5KQLA 9LDBA 2HMAA 4BKQA 4B0PA 4KK4A 1I6KA 4CM4A 2HHAA 3H2SA 4UDNA 3GLGE 1OFGA 1V47A 3OIYA 2HQSA 4XGNA 5EHNA 2QD2A 2ZRFA 4ESVA 1LLFA 2FX3A 3WSTA 2XB4A 2IPNA 5LLTA 5FQNA 1G66A 3OEHD 3L6BA 5ERYA 2OBLA 3THYA 1L5VA 3GN2A 4LYYA 3FH0A 3K72B 4MS1B 4MVXA 5T8KA 4WECA 2AIRA 2O5EA 4BNNA 2PSFA 3LIIA 3C1TA 1K2VN 3ZV4A 4N0PA 1Z18A 5F64A 1M72A 2EC5A 3MMPA 3TLGA 5JD3A 2YMPA 1DIHA 4I0WB 1XNJA 1SQ6A 5DNYB 4J76A 5J5CA 3NUQA 3HJNA 3ZCVA 3C6YA 4PSAA 5HFJA 2GZHA 2DUJA 1GPDG 1Q2XA 4MS4A 2X1MA 1TU0A 1G8KA 4C14A 2XXBA 1IHYA 1T9HA 4A1OA 3NDPA 2ZWMA 3NR2A 1Y9EA 4IV0A 2AWOA 2F1JA 1N2CE 2O20A 3CX8A 3HUUA 3K15A 4M9QA 3MINA 4M8KA 1OLSB 3TRDA 4BNWA 2V1UA 2Z58A 4I2VA 4IIHA 3FG9A 4FEEA 2PVPA 1U02A 5ITVA 3ADCA 2GOYA 2WJ3A 3UV3A 2BR4A 3FPJA 2O3SA 5E6UA 4LI3X 3KD3A 1UXJA 4ENTA 2GN1A 3CGWA 3RSSA 5C5DA 2IITA 1DGQA 1GAQA 1M0EA 1QIFA 3NOXA 4KMMA 4D1YA 1GNQA 1KP9A 1Z6QA 3EZGA 3PNLA 2IHKA 1VKRA 1WPXA 4TV9B 1DBQA 2HJVA 3A26A 4M87A 4WI1A 2ZI7A 1GFSA 4UU1A 3AIOA 2C0CA 1ZUIA 3DWGA 3OJFA 5F21A 4QQ8A 2H9IA 2NXCA 5AJUA 1F8GA 2EX0A 1K0UA 2P1RA 5DGXA 1L5MA 5EKTA 1YZYA 1TAGA 3N59A 4Y2PA 3FPGA 1XZNA 4OF4A 4BO6A 1O95C 2E5LB 3TB4A 2DBQA 4K3VA 5J2UF 1ULTA 3IRVA 5IAEA 2MCFA 3ICWA 4TUYB 1U3GA 5CYOA 2WJIA 3M6UA 2TSYB 4O4IF 2XB9A 5B37A 1X92A 2BM1A 3RRXA 3WLLA 3WY9A 3SVLA 1F7VA 3KWFA 3NNDA 1AY0A 4C20A 5IYZA 3FNQA 3V7FA 2PUJA 4NMXB 1S6YA 5JFGA 3T9CA 2BI8A 1YRYE 3I64A 3O8BA 4Y1RA 2O8BB 5FB3A 3OFSA 4J8PA 3EAQA 2XNDA 5CBKA 3RC3A 1FA9A 1VTKA 4BFSA 2IXGA 1QDLB 1L5HA 4KITB 2C4WA 1JZTA 1CNMA 1M6NA 2AI3A 2IZOA 3ACCA 4HYYA 2OPHA 1QHEA 1HYHA 1GPWB 1A96A 4PPFA 2AC2A 1WMAA 4LCBA 4AN0A 3PX2A 4DMKA 3UJNA 3Q5GA 1BE0A 3P0EA 4LVNA 1HNXB 2YQZA 1Z88A 2QA5A 1J1IA 2GN0A 2ZI3A 2ZPTX 1QH8A 2C2MA 3CJQA 1XDDA 4YLEA 4B6JA 1S2OA 3DT6A 3TDMA 5CT9A 3SI7A 1OXBB 1ZGAA 3P94A 1A69A 3A0RB 4JLPA 5CM9C 4DA7A 3U60B 4IRMA 1K3FA 2R6JA 1GAWA 3EGCA 4MP6A 1G5QA 3DCNA 5E3HA 3QHQA 3GR6A 4GP7A 4J49A 1PJQA 2XOKA 5FOQA 4KJXA 2PH7A 2JJ2D 3RSFA 1R8XA 1GLGA 4EO4A 3PQ6A 3AO0B 3QA9A 1AE1A 1QE3A 2YXNA 3IMKA 4G41A 4I4TB 1QK4A 2H63A 4INZA 4NZPA 4RPHA 4QDZA 4QU9A 4UHKA 3WXBA 3TECE 2FH5B 4H15A 5D6NA 3KV3O 3R41A 4ZOQI 1YMUA 3A3PA 3NXKA 1B26A 4TTJA 5GM1A 4ZEMA 4DY4A 5T6MA 1BXRA 1YB7A 1Z3CA 3T1OA 3K9GA 4R0MA 3HCFA 1AN9A 4GKKB 1U0JA 3A2KA 3E7XA 1RZUA 721PA 2BGMA 1WPRA 3CONA 3G6WA 3GFBA 1CJCA 1DMSA 3G2PA 3A14A 4N03A 3WNZA 4E4TA 2HRBA 1RPAA 1QE0A 4H1HA 2RAPA 2O5VA 3K4QA 3RCBA 4F2GA 4X7PA 1RWWA 3F97A 3N3AC 3Q9UA 4NZOA 4JI5B 1T9DA 1WSBA 2FPRA 4C3ZA 3L1KA 1WUYA 1IB0A 2X2FA 5EP3A 5FJIA 2VJDA 2WIGA 4XWTA 3PENA 4FWIB 3RW9A 4Q47A 5A5FA 4JI7B 4Q00A 1PGNA 2AE1A 1LV8A 3K9QO 5G1PA 5EIEA 3E9NA 4D6XA 5L7TA 3OQMA 1UZAA 3TLXA 3BFXA 1VJ0A 1P74A 2GXSA 2PR7A 4YCJA 4BZQA 3CB2A 3N87A 5BWNA 5ARCA 2A14A 2NM0A 3KTAB 4CIXA 3HB4X 1HV8A 1MC4A 5LP6C 1KHTA 2XT0A 4WTOA 5BR4A 3E22B 3L1VA 4NQRA 4BFXA 3JD0A 2N9UA 2QT1A 2FRDA 2J3JA 3R9XB 1DAHA 2PRSA 3G3EA 5BSRA 4GOMD 1Z0UA 3V8BA 3A2NA 4UVDA 3JATA 5DT9A 2VSXA 3F2IA 3QBVA 5C80A 3ER9A 3CX7A 2HZ7A 3V33A 4BVJA 1BKYA 4UHEA 1VIVA 1D6NA 2Q1XA 3ECAA 3A8TA 4IGKA 1CDZA 2NV2B 4TZ0A 1OBVA 3SC3A 4CM3A 3IUEA 5J59A 4ZU1X 2PQ6A 3QEOA 3T3EA 1B8OA 1YKFA 3BF8A 3E23A 3A7EA 2PUHA 3GA7A 4N5HX 1R8JA 3W77A 4W1PA 2W9XA 4IAOA 3HPRA 1AOXA 2C88A 3QU7A 5CVTA 3IUSA 3LWZA 4L02A 1LBHA 4IQFA 4BQSA 4AW9A 2OO5A 2ZUCA 3FCUB 1EBFA 1QE5A 3H86A 1CETA 4AICA 4Y6SA 4PPYA 1NRWA 2ZBGA 1Q7CA 5KYYA 5KNDH 2WYIA 3DL4A 4ZJZA 2YIDA 2H31A 1JIXA 3T1HB 3HKBA 2OB2A 5HIMA 4MEBA 3FCCA 1E2KA 3K0KA 1G2OA 1GSHA 4FGJA 1S8OA 1V25A 3I39X 5LQCA 5EJ9A 2R00A 5EQJB 3EEOA 1EFRD 3RC9A 2XCIA 1DC8A 2NUTB 1QGUA 3OE4A 4WH0A 2FMIA 4Z9BA 4P5EA 2B37A 2GVNA 3WL3A 1XP5A 5EE5B 1TM2A 4E07A 4NH0A 1K9VF 3D43A 5CG2A 1GZ4A 4N39A 2VDWB 5A2GA 1YFJA 1DCMA 2PVCA 3TL6A 1QF6A 3FVWA 3DQQA 1E3WB 2ZIUB 4QFMA 1KJNA 3C1AA 5CGZA 4EA7A 3G2JA 2YHSA 1XCOA 1QIHA 2XE7A 3C7KA 4RY8A 4QATA 3T7EA 4TROA 1I0LA 3G02A 3IGFA 4AJNA 4B9AA 1MOSA 5DMHA 1NXWA 3N8IA 5ED0A 4V0LA 5ALZA 1R0RE 1UBGA 2RGNA 3KELA 1Z39A 4D26A 4LWOA 4M7OA 1K2WA 1RLMA 2B94A 5CFOA 1OQAA 4QHYA 3MWEB 3LK6A 2PZ8A 4HVAA 1YDGA 1PTJC 3PNOA 5HQ3B 1Z7WA 4WNAA 5C81A 1NTOA 3DL0A 3RS4A 3BSSA 4OD0A 4EQ6A 3EGDB 1YHNA 5AUQA 1IUPA 1EFKA 1T9KA 1P91A 2VSFA 1YRHA 3FVTA 1CZLA 1N5JA 3P4YA 2VQSA 2I55A 3SJCA 3ELWA 4OHPA 3BE8A 2D1SA 4OQXA 4CIAA 1O9BA 1N92A 4B8ZA 3SQNA 3TNYA 2J4CA 3WHPA 4EX6A 4W63A 4PIVA 4P34A 5FTJA 1I10A 3WTCA 1KWKA 1LJ8A 2VP3A 3HDGA 5FD8A 3HWSA 2NO7A 5ECWA 2UYHA 4G4IA 2F67A 2VQ6A 3ETDA 1JHDA 8ATCA 1DFGA 2I2DA 1CUUA 2RAUA 2V7EA 3AW9A 4PF1A 4R7GA 3VZDA 4F86A 3A4IA 5A9RA 1ZJYA 5DNUA 6GPBA 2J09A 3ZOZA 1EFTA 1X8KA 4BBZA 2HOQA 3Q8LA 3U7IA 4N7BA 1U3VA 2R8EA 3JWIA 2NQ8A 4FUTA 5AXAA 4PCVA 2OCPA 3TEJA 1NZJA 2PX8A 2W2QA 3A58B 2BEVA 2PA3A 2RHTA 3WOVA 3ZE0B 4BWVA 2WLTA 4DV0B 3IA7A 4AY2A 1U28C 2QPTA 1SGWA 3C3AA 2UYQA 1WHSA 2ZT7A 4DDMA 2II6A 2YJGA 1X8LA 3PI7A 3L01A 2BTQB 4OH7A 4RZSA 3S40A 3SCZA 1B15A 1O5TA 2RHDA 2ZYUX 4M98A 5KNLA 2QZPA 4LJ6A 6CHYA 4MB2A 4YO8A 4LSZA 1MX1A 1YDMA 2XWQA 3ZU3A 3Q3GE 3BJIC 3OLYA 3R23A 2YVLA 4ILEA 4AL4A 2OXIA 4HDQB 2J0UA 4EY7A 3BXFA 1EDEA 4OHRA 3RODA 2XE6A 2GAIA 5EHGA 2WM9B 3FJYA 5EJ5A 2RIPA 3NH6A 1VLVA 3TAUA 3W3AD 1JSCA 3HXLA 5DP2A 4L7QA 3JWHA 5FA8A 5KI6A 4DCPA 1UOEA 4XPZA 2IRWA 4WLEA 2AHRA 2CBXA 5L8VA 2Q6LA 3FSEA 3SIXA 4DS3A 1TIKA 2BJHA 4OHXA 3WLQA 3M0EA 2ODEA 1PFGA 3P9CA 2FLWA 3MAJA 1F12A 2DG2A 2KSQA 1A1VA 2W6IA 5AKIA 1R5JA 1SKQA 1U4OA 3ZK8A 1T29A 1Y7TA 1LRLA 2COKA 2O7VA 3GGDA 3N5CA 5CA1F 3ORYA 5FL3A 1T3LA 3UJ6A 3OOHA 1KZGB 3PWTA 1SM4A 1PZHA 2IYOA 4KXUA 2CLIB 3DSRA 2FPXA 3K5HA 1GV0A 3LLUA 3OEHA 2NZUG 4RJLA 2GDJA 4X5OA 1ENOA 4ZZ1A 1I1QB 2WFLA 3EDOA 1NW3A 1P2UA 3ABIA 1UBUS 3LFTA 3VR6A 1OAOC 1YGPA 3R09A 1YB6A 4X8OA 2ACEA 2FETA 3WJAA 4DLUA 1V37A 1C7RA 1PGQA 3D8RA 3WLAA 4TWAA 2A9QA 3C85A 3SHQA 1JPUA 1S4QA 3EFOB 1V48A 3K4HA 1AK1A 4FONA 3TE6A 2WVAA 2ZJ3A 2HDWA 4EG6A 5E1OA 4K6MA 3EEQA 1GZ5A 4BNLA 1G8HA 2D3WA 3K9CA 1PJCA 3TE7A 3WYDA 1A8UA 2XKKA 5JC1A 1FUEA 2MT9A 5TMBA 2QR2A 1R0KA 2R7AA 1V71A 2NVWA 1L7OA 3GJSA 5F51A 4FDLA 2H7CA 1TC1A 2VQ3A 4JCCA 3PQEA 4XIGS 1CEYA 3ZHOA 3U7HB 1UBHS 4A5SA 1NAIA 2PDAA 4X8MA 1M1UA 4CRWB 1XTVA 3VU3A 2QX4A 4YONB 5KC9A 2RHCA 4M1YA 2X8JA 4BNKA 4OHYA 4RLQA 4I9NA 4IF6A 1OBCA 5AUNB 1ISJA 1W94A 4BFZA 1NNUA 4EH1A 2ZUFA 4NBLA 4I50B 1STOA 4L9AA 2ZSEA 1NSYA 4HRXA 5JRZA 2WUDA 5I9IA 1XMQB 1HWYA 1XZDA 2Q2QA 2YN0A 4G2TA 1GYPA 2BGJA 5JHHB 4PN7A 5ECGC 1ZK4A 3MF4A 1SBYA 2J0VA 3KT6A 4R2KA 5I4IA 5CB4F 2XF8A 2Y05A 4LKOA 1NU6A 2HEIA 2XBLA 1ZGCA 1QO7A 5HFNA 2YWJA 3ZBQA 4PYOA 4NATA 3WB2A 3H4IA 3FWZA 1XE3A 1SJ9A 3FA2A 4JNCA 1A9ZA 5GV7A 3GPBA 5E6SB 3DEAA 2Z57A 3SXPA 3QF7A 2XTZA 5FLYA 2QD3A 4ZCLA 1UBMS 3UPDA 4B79A 3ML1A 1MJFA 2QTLA 1IK4A 3LA6A 4AT1A 3TTXA 5FFNA 1BFKA 3R4CA 2YHBA 3EEYA 4M9CA 2QHXA 3TW6A 4DBLE 4O2BA 1Z0JA 1E32A 1PQWA 3BFVA 3FIUA 4MARA 3ZDDA 1CVIA 4S2UA 2DPYA 3FSJX 3S1SA 2YZMA 3DTYA 4Y6PA 4Z9AA 3VZCA 5AVTA 1ZSVA 4RZXA 5HJEA 5DHTA 5LA6B 4G36A 3WGIA 4G81A 5AKZA 1MOPA 3H7IA 1H69A 4CF7A 3I61A 1N32B 3VU1A 1KERA 5FT9A 1VMDA 2YHUA 5L95A 2A0FA 2I4MA 3ZJYA 1HNWB 4Y1EA 3L8MA 4DM4A 5L3SB 3WK8A 2Y0DA 1EE9A 4E2XA 2NPOA 5TPZD 3JQFC 1FK8A 4U6NA 4BCBA 4BQEA 1TM5E 5HKLA 4YAKA 3GRPA 4YCCA 5TQ0B 2O0MA 4LJSA 1M2OA 4LJ7A 2HPHA 4P31A 2MOKA 1JQJC 2AF3C 2QL5A 2V45A 1JDSA 3KJIA 4XVQA 5AW5A 1EE2A 3WK9A 3H9UA 2AN9A 2JJ2A 1MAWA 1TQDA 2FXVA 3CMMA 4TQUS 2XX3A 2AG6A 1QIJA 5LSAA 4EVRA 5IWCA 3Q0EA 1QHFA 2VYCA 1WZUA 2O1XA 1V8ZA 5FX2A 4BNMA 2Y67A 1QRUA 5IKPA 4M1EA 1JF8A 3HRKA 4B7AA 3FRIA 3KKZA 1SOUA 2VDUE 1BE6A 2BY4A 1SY7A 4N8EA 4Y2UA 4OXQA 4PZ9A 1ZR4A 5BQOA 4DIOA 2QPOA 1J99A 5C32A 5HQJA 3I9OA 2PLAA 4YJFA 4CKCB 1PG5A 4NKRA 4CUKA 5M34A 1RXVA 5TQVA 1L7RA 4KP7A 1IG0A 1LXCA 2CJFA 3C5CA 1AGYA 4N3AA 4RD6A 1CUGA 3QJYA 1VLJA 2XJ9A 4JJAA 4LISA 1U7UA 1U7PA 5WRFA 4DIUA 1HFWA 2XZDA 3AM4A 4CM7A 3I4LA 2YWGA 1P7VA 4YP7A 3T4EA 3KR2A 5HCIA 3A3KA 3UXEA 4OJMX 1JFSA 4H35A 3HJTA 3NC1C 1UQTA 4ZEOA 1TYDE 1KSFX 3WYAA 2QP3A 1F9AA 1H66A 4IUBS 4B6GA 4D56A 5L4SA 4A16A 2HNKA 3ONFA 3H6HA 3JPYA 3E53A 4CG3A 2A9OA 4DB4A 1GRNA 2OK8A 3K1AA 5T8KC 4RC9A 1GA1A 2AMLA 3GH3A 4D74A 1VYUA 2C8LA 2VK4A 3GZNA 3NAGA 4N01A 1N4AA 5FUMA 2R0QC 4Y9UA 2Q0QA 3MK31 4AUMA 1DIGA 1VLMA 2F6RA 3BWBA 3FNFA 3R7LA 5CFNA 5LUAA 3ICQB 5AFSA 2RGYA 3JQDA 1U5BA 4KYIB 5SZJA 3ZE7A 4ND4A 4ZC1A 1FVHA 4R7ZA 1D6JA 3CFYA 2O2JA 2PLRA 4DR3B 5JNLA 4MLPA 4KR2A 1EFPB 2KWIA 2G5TA 2Y1DA 2ZYVX 4X7RA 4QXAA 4HUTA 5JYBA 1QZXA 2GHQA 1RI1A 5ICEA 4PO8A 1FDRA 3NLLA 4K6HA 1SIBE 3GCZA 3AUFA 4AMBA 3ENNA 3FR8A 3S6JA 3TSCA 3V00A 1F51E 2P0YA 3GLQA 4GMXA 1P4AA 2V6GA 3CZCA 4P5PA 4JBGA 5JS7A 1VYHA 1JYFA 1SQFA 2PUTA 3LW7A 3QH4A 4L8YA 5ALIA 3AF0A 1KVSA 1DAPA 1T8SA 2BELA 2VNHA 3F6YA 3LZ6A 4X1KA 3TLMA 2UUCB 5CJPA 4JYZA 1KZ9A 1RP1A 1TZ2A 1YNOA 2XD9A 3JZDA 3P2JA 1TK2A 1L4BA 4GMHA 4MLCA 1INLA 1RT9A 4TKLA 5ALRA 4EKDA 4EGAA 4FCVA 3I92A 4DAEA 3GJ6A 2MJLA 1R9GA 2QGFA 3SFZA 3B6IA 1QANA 5JZBA 1ZWKA 1H65A 1DIOB 3H1AA 4OG2A 4DLSA 3MCVA 4KQIA 2GEBA 5CA1A 3FXAA 1JKXA 2FMHA 1MOZA 1L1FA 1GQ2A 4D82A 1QH9A 2ZJ6A 1L8QA 3K0AB 1YHYA 4WLOA 4YJ3B 4FJ1A 2FE1A 4AZ0B 2A5FA 2JGJA 3NGLA 3NV7A 1W29A 4Q93A 4ER5A 3QOFA 1OH8A 1FQKA 4WNYA 1GNRA 2V96A 1J9EA 1T0IA 2IEYA 2O05A 3S1AA 3ZW9A 1M8FA 1E77A 2XVYA 3ZDQA 1UKAA 2Q7DA 2X7HA 3IERA 3CWZA 5EY5B 5BW4A 1JFRA 5KTPA 1IY9A 4BO2A 5DWVA 3AVVA 2OOKA 1TZJA 3QRWA 4H3SA 5HSGA 3E2IA 2L17A 4BVGA 5TSDA 2R65A 4QTUB 4AYTA 3R3YA 5FF9A 4TTAA 3ZU6A 5K3AA 4DDTA 3DXXA 1TMKA 3PD0A 3RFUA 1ZK0A 2CL5A 2O50A 1QF9A 3LFUA 2NPFA 3LYLA 4Q5IA 4RFLA 1JAHA 4HEHA 4RM3A 3NHUA 4UMVA 5KTYA 1VCNA 1TJPB 1FTNA 2XIQA 2YZ2A 4V02A 4ZVPA 5IBQA 4KSYA 3Q8MA 2CHVA 3V8RA 1L9XA 1T3HA 4GYYA 2ZYDA 4WASA 1I2AA 1MO2A 2JDID 3VR3D 2B1QA 4KXFB 2EWMA 1OFHA 1MMFB 2V58A 2ES4A 2IYAA 4HWRA 5HFAA 5C0OE 3L02A 2VJOA 3PT5A 3R6DA 1W4RA 2IDMA 3IAUA 1C2YA 1DC5A 1H4TA 3H0EA 4TZKA 3SVTA 4D45A 1Z5OA 2DT8A 2C84A 1TDJA 1UANA 2ZYRA 5BSKA 2WWHA 3H2YA 1U2EA 5H9WA 3OUUA 2HWKA 1YAHA 4LF4B 2AT1A 5TQ2B 3C5HA 1NV8A 1KNXA 5JPCA 1P9LA 3BEOA 2XLBA 4EJFA 4GMKA 3GW8A 3LHIA 1P33A 3SEZA 4BWFB 5KWJA 2VPWA 4KDEA 4OH1A 1SXJD 5CB4A 3RDPA 2UVPB 3Q6NA 3FUXA 3IP6A 5LR6A 2NP7A 3INRA 3NBUA 2N46A 4KIUA 1NBAA 3F47A 3JAWB 1N0UA 1IATA 5JBIA 1M6WA 3NAQA 1XAHA 3IB6A 1K0FA 1NBWB 5G4KA 1FPMA 4RENA 3RK4A 4LY6A 1WMSA 4IFEA 4K46A 3OQIB 5JNSA 3QE3A 3W6UA 1GKKA 1AGRA 4W4TA 2NG1A 5B1DA 3T7TA 3AQ4A 2GPSA 2HRDA 4F3KA 5KHOC 2O1WA 2BZ0A 2OUKA 3PTZA 4HNTA 3GLFA 1GAXA 3L7KA 4TV8B 1EFVB 1AX9A 2WTBA 3RWOA 3WBKA 4RVCA 1MB2A 1TUGA 4E1BA 1RKQA 1YUBA 2BBOA 1GQFA 5EHQA 2A58A 3CLTD 3K9LA 2ZRAA 4AMZA 3PFKA 3IP9A 4DC0A 3DNPA 3UK1A 2HGZA 3PJRA 3LHSA 3H0KA 3PK0A 4MCAA 1JB1A 1RWKA 5A7FA 2HLPA 4URHA 1N6IA 1G98A 2B4AA 2CXTA 3WWYA 1A77A 1IM2A 1L4YA 3G5TA 3NIBA 4DC9A 5IT5A 3OO0A 3FX2A 2C5EA 3CUEF 3T7KA 2OHOA 1EM6A 5EIOA 3TUJC 1KDPA 1XQ1A 2QJWA 3L6CA 3OURA 5CBPB 2DR0A 1RIFA 1UWVA 1V6CA 3I6QA 3IVAA 3S44A 1A82A 4TTPA 4LJYA 3W3AA 9MHTA 2PCLA 2FRDC 1GARA 1TQ4A 2CVQA 3HBAA 4ZOLB 1X2EA 2ECQA 5CCDA 4X1YA 5TMDA 1Z06A 1TW3A 1K8YB 1U94A 1NGSA 4OKIA 2SECE 2WRZA 3GLFE 1R10A 1XNHA 1Z5GA 2RI1A 2YJ3A 3AETA 3BCHA 3NX4A 5DN6A 1E6CA 4X92A 5KVQA 4EFNA 1NXQA 2RJOA 3ASZA 2DX7A 1O6ZA 4OA5A 1QVWA 2BKVA 4MCJA 3OPVA 5BWLA 4Q7MB 4C03A 4EHDA 4QGSA 1QU2A 1JSZA 4OHCA 4X8HA 3RVJA 4YIHA 3NC4A 1ORDA 1Z5WA 2VKQA 2ZBPA 4U1RA 1L5KA 1JA9A 3G9QA 3NHRA 4NC9A 5EYPA 3K6SB 2BHNA 4RH1A 4QFBA 3PPYA 1PYOA 4DA8A 1UKCA 2FG5A 4PR0A 5BNZA 3U44A 2G5PA 2CUTA 2YC4C 3M1YA 1EE1A 4QYTA 2J4DA 1VSTA 1WMFA 5JARA 1XGKA 5KHLB 2UXBB 5KNCD 4J03A 4D25A 4QQNA 1FDTA 1LBQA 3TJZA 3X1MA 1RBQA 4LY3A 2I9PA 4Q3KA 1WW3A 1D6MA 1Y7LA 2ETXA 2XCOA 1ZGJA 4Y67A 5ALFA 5IC4A 1NJ1A 3QXHA 1NQXA 3O7MA 4TLCA 3ZK9A 2WMYA 4G0XA 3J81A 3UJBA 2IYPA 4KWHA 4F71A 1GPNA 5K09A 1HE3A 1FFXA 2OGZA 3DE7X 5KYWA 4TKMA 3AEUA 3K09C 3OPQA 3EGXB 1PEKE 1XEXB 3RVMA 2IHJA 3DPSA 1ATZA 1R6XA 2QQGA 3E2PA 1IHXA 1UC5B 4M1ZA 3ZHXA 2XYHA 1XX6A 2A35A 4DBZA 1ZRSA 4A6PA 2EHJA 3TN7A 1MRNA 4D98A 2AKAB 5DHFA 4RIFA 4M7PA 1USIA 1OFVA 1U8FO 4OREX 2WSBA 4KRYA 4P2GA 5AKEA 1EU1A 4Q9HA 3VPAA 1X1CA 2HNAA 2NU6B 3HUFA 1KEPA 2NUAA 3HCOA 1LH0A 1ZXBA 3RVSA 3WGLA 4D9EA 3DMYA 1HG0A 3HBLA 4FZVA 4M0DA 2RGNC 2Y1OA 3FLBA 4MPTA 4BJ6A 1W0KA 1M2VA 2B4TO 1MHTA 1OH6A 3FCAA 4F9GA 4PYIA 2XXJA 4LDZA 3AZQA 1IEWA 2H16A 5HK8A 2CLKB 2CZGA 4JJ7A 4TL8A 3TYXA 1EZ4A 3P32A 2VCHA 4LY9A 3HH8A 2R8RA 2YJNA 4QLBA 4CKBB 4RTJA 1ZOLA 1FDVA 2CLSA 1TD9A 3L7AA 1MTOA 1YUMA 2AYYA 2JKZA 3CV3A 3LECA 4K86A 2HEGA 3NM6B 4MUFA 2OORA 3VR6H 4AP6A 5FI3A 1X1QA 2AR0A 2I99A 5K8LA 4G0ZA 3TSZA 3ASVA 4YQYA 3P9KA 1FUUA 1WG8A 3I4CA 4P6VF 4Y7DA 3GLVA 3DZ8A 3IBTA 2BMFA 1LDGA 4HPXB 4YBZA 2QN2A 3H04A 2QRKA 2I6QA 4TMVA 2FX5A 3DB2A 2G9NA 4Q15A 5H83A 2IDZA 3FGNA 4CIDA 1OD6A 5I5GA 4EUSA 2CNKA 2PGAA 2OLJA 3KZKA 3OIVA 3MJHA 4I1YA 4M1OA 3K5PA 2AOWA 5E38A 5AOVA 1GN9A 1WZ2A 1F0YA 1E0DA 1DQSA 3AFGA 3H6GA 1SBCA 3I9MA 4DV6B 1KK2A 2IYLD 3HCEA 1FFEA 2B1RA 2FK7A 3DD1A 3R3JA 4HXGA 4S0XA 2NU8B 4LJLA 4D81A 3N3BC 3I83A 5TPZA 2QMYA 4XFDA 3OJLA 1NMYA 4H7FA 4F6RB 1NVUQ 1YFZA 1BN7A 4RQAA 2H1SA 2DWQA 5IG2A 2WWIA 1XDSA 4ASUD 3O26A 4NPHA 2O1EA 4ROSA 4B44A 4YV2A 1OC2A 2R44A 4FBLA 1FB5A 4FMDF 4F9TA 4U6SA 4ABTA 1HDEA 3FTPA 3GIWA 3E2MA 1AS0A 1YS6A 3KWJA 4JA0A 2J5QA 3SS9X 4YRAA 2ZZMA 3ETEA 4KPGA 4DCTA 5LQUA 4GLLA 2FWIA 3PNKA 3CU5A 3DE2X 3MMSA 4LWZA 1SKAA 1LK5A 1U3FA 3M4YA 1T1GA 4QXOA 4S1VA 1SK8A 4L85A 5LMUB 1PN3A 1H8ED 5COAA 2BFEB 4OJKA 5K2OA 3QA3E 3GPDG 2YX1A 3SZGA 2G6TA 1NZFA 4AJEA 3I2YX 3UWPA 1L7EA 5EZYB 3RRJA 1KH1A 1NLZA 3PGLA 4XSVA 1W9HA 4AO8A 3KYDA 4ZQBA 1CXZA 1KMNA 2X2OA 2GBFA 2QTWB 3LNTA 4ZV4A 4NYIQ 3SZ3A 5IANA 2YC2C 4RXUA 1UCFA 3HFSA 4CXMA 1IDOA 1FU8A 4Y0VA 3BXHA 3ZBTA 1FYFA 3SHFA 5IAOA 4RH3A 3UT6A 3EXHA 4D4HA 1CQIA 4P4SA 3B5IA 1YDFA 5D3ZA 1QR2A 2BVNA 3L82B