2XMQA

Crystal structure of human ndrg2 protein provides insight into its role as a tumor suppressor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
281
structure length
281
Chain Sequence
AKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIENYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Ndrg2 Protein Provides Insight Into its Role as a Tumor Suppressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords PROTEIN NDRG2
total genus 89
structure length 281
sequence length 281
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03096 Ndr Ndr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xmqA00
1E8MA 4AMYA 4H77A 3F8SA 2G63A 1FFEA 1F0NA 4K2AA 1GZ7A 1E8DA 2VT6A 4OU5A 2XUPA 1UFOA 2HL6A 2WFZA 3ILSA 4AO7A 3D2CA 4DYHA 1ORWA 1ZICA 4GXNA 3U1TA 5FRDA 5KWIA 2FJ0A 2JGIA 1BRTA 4U2FA 3WK6A 4OD0A 2OCGA 4WFKA 3STTA 3FVTA 4P92A 4H7FA 1P0PA 4PF1A 2D5LA 4YASA 1D07A 4X94A 1E5TA 5CT5A 2AJCA 3BDVA 4J03A 1G42A 2CBGA 3V1MA 1ZJ4A 1MN6A 2IX9A 5I8PA 1YB7A 1ZIYA 1DQZA 4J0HA 4Q3KA 5C8VA 2XMCA 1X70A 3T52A 1Q0RA 1X2BA 1CRLA 5A2GA 5DNUA 4KE6A 2ZSHA 5EHNA 5A7FA 4NZZA 1RWQA 1CUBA 1R3DA 1UK9A 3R41A 3BIXA 3AINA 4LXHA 3M81A 2RIPA 2J3QA 1ZIXA 4QDTA 2WHRA 1XLVA 3WIBA 4LXGA 5EGNA 4ZV7A 1XLWA 5E4TA 1A8SA 5D3KA 3V1KA 2WTMA 5LIPA 5K3BA 3BWXA 2XUKA 3AILA 4B9AA 2CJPA 1T4MA 4JEIA 5DYWA 3V1NA 1HBJA 1YA4A 1R4ZA 3DOHA 1ZI9A 2XMRA 2Y6VA 3A2MA 4F21A 1QIKA 2HFKA 3STUA 3CCCA 1MU0A 4O08A 4FHZA 5AM2A 4DGQA 4I19A 3FOBA 5AI6A 1HKHA 2DCMA 4FNMA 3STWA 4UFPA 1Y37A 4DNPA 1AMNA 5AIAA 2YASA 4AO8A 3OM8A 1Q0ZA 4B80A 4PSUA 4J0DA 3KWFA 4C88A 5HZGA 3M3DA 1THGA 5CRIA 1AC5A 3H1BA 4BE4A 4TPKA 3L1IA 4NMWA 4Z49A 3LS2A 3DL4A 1U65A 5A6VA 3UMJA 5JYCA 3T4UA 2OQIA 3GBSA 2BUAA 1ZGCA 3H17A 4LIPD 1WHSA 2GYWA 1QFMA 3BE8A 1EDDA 4U2DA 4H7IA 3STYA 3KOOA 3RKSA 1TCAA 2ZSIA 1LLFA 2HIHA 3FLBA 3SWWA 1ACLA 2QS9A 3C87A 3E4DA 5JAUA 5AI8A 2BUBA 4I3FA 4TGLA 2XQGA 3C5WP 1MPXA 4DMFA 1C4XA 4Y2TA 5LKRA 2PSDA 3V1LA 4QLAA 1MX1A 1HDEA 4A16A 4OSEA 2RHTA 4FOLA 2O2GA 1Q84A 4X97A 1EDEA 3HSSA 1K6EA 1BN6A 2PX6A 3HLKA 2HU5A 1XROA 3LP5A 4QWWA 2Y6UA 1UWCA 4G8DA 4UHFA 2WIGA 1TAHA 3AUKA 3VISA 1M33A 2PVSA 3I28A 5AK5A 1WB5A 2Z8XA 4QDXA 4AB1A 2VJDA 1RYYA 1DU4A 3QZUA 2VEOA 1F6WA 4B85A 2BGNA 2HA4A 4KRXA 2XLCA 4UBOA 2C0PA 1CIJA 2O7VA 4BP8A 4DSAA 2IITA 4W1SA 2GZRA 5JANA 3VVMA 3B3QA 5AM5A 2ECFA 3FLAA 1JU3A 4J3JA 2K2QB 1QGED 2RONA 3DYVA 4FLFA 5DWDA 1ZD5A 2LIPA 4AZ0A 5ALOA 2OGZA 4EY8A 3HABA 1EVEA 2CKMA 3FYTA 4OB6A 2ZJFA 4MQLA 1YASA 2BAGA 5DYTA 1RP1A 2YH2A 3P2MA 2DHCA 4K6KA 5CT9A 1E8NA 4G8CA 1EDBA 1ZI6A 1Y7IA 3WJ2A 3DS8A 3PF8A 4L3WA 2Z3ZA 1IUNA 4WFJA 4B9EA 1XQXA 1MX9A 1QIEA 1ODTC 4J0GA 3WK8A 5ALRA 2B20A 2VQ6A 5DTJA 5ALXA 2PL5A 4DSZA 5AJHA 1U8EA 1XZAA 1MX5A 4AZ3A 3WWPA 3IUNA 3PFBA 3ICVA 5IVKA 3I2IA 2JGLA 5JARA 2B4KA 2XMZA 4LYDA 4X90A 1XRMA 4EY7A 4DLNA 4MYDA 2OAGA 4GDMA 1PFQA 3ICWA 3U0VA 3DYIA 4X7BA 1FFDA 1L7QA 5T4FA 1VXRA 4KAAA 5AK4A 1PV1A 4Y2UA 3PF9A 3O4HA 3O4GA 5A7GA 4G4GA 1F8UA 3C70A 3WZMA 3K2IA 4X3CA 4RE5A 3A70A 3PDCA 1VXOA 3EBLA 1ODCA 1YAJA 1CUYA 4FMPA 4WFIA 2RAUA 5AKKA 3A2LA 2CMFA 1A8QA 1XZBA 5ALYA 4H35A 4Y2SA 2AJ8A 2XUHA 3LIPA 5LZ9A 4WDQA 3W2TA 3NOXA 3WLAA 3AZOA 2XT0A 4BCCA 5JALA 5D6OA 4QLOA 3BF8A 5FUMA 4FTWA 3ZWQA 4N5IX 4M0EA 5HKBA 1SCQA 2GBFA 3BJRA 2Z8ZA 2J4FA 2VATA 5AICA 1AKNA 3WL7A 5AM1A 2X76A 1N1MA 4RE6A 2PSHA 2XMBA 2WUGA 4GECA 2VSQA 3H0CA 1E3QA 2O7RA 1YCDA 3G9ZA 5KWJA 1YS1X 4IH9A 3LIIA 1OILA 2PUJA 1LNSA 4G9GA 3IULA 5JZ9A 4BZWA 5I7UA 2HFJA 5HQ3B 5AM0A 1XZLA 3O4IA 2WFMA 2I78A 4JYMA 3QH4A 3RM3A 5BOVA 2R8BA 3L1HA 1BE0A 4X92A 4H18A 1QJ4A 2I03A 3IURA 2JEZA 2XI4A 1E89A 1R9NA 2V97A 2FUKA 3DNMA 4DMKA 2VAVA 4UBIA 2C5GA 1LPAB 4XIIA 4X6UA 3IUQA 5ALJA 4G4IA 5SYMA 4E46A 1CUCA 2WU4A 2WIJA 4X93A 1LZLA 4UBKA 4IO0A 3DQZA 3GUUA 2X5XA 3HYSA 1AX9A 4Q3OA 1JFRA 4MYSA 1JI3A 4KAFA 1TQHA 4PW0A 3V9AA 3FYUC 3FSGA 5ALKA 1CQWA 5HF9A 2WHPA 2B61A 4C4ZA 2QXUA 3O0DA 4EB0A 4HXEB 4J0KA 2QXTA 4UUQA 5AKIA 2OXEA 2WHQA 3BL8A 1YR2A 2ZYIA 2XUJA 3F97A 3FBWA 3G9UA 1LGYA 3VJKA 2XUFA 3WWOA 2HA0A 4DTCA 4HRYA 5K3FB 2HA5A 3I1YA 5ALSA 4JH0A 1BCSA 1ETHA 4TVKA 2VF2A 4K6GA 1CFJA 2DFPA 1ISPA 2G5PA 3K9BA 4F0JA 5FPQA 3ESAA 2YYSA 4QEKA 4OU4A 3FLEA 1QIFA 5HK9A 3DKRA 4LXIA 5LZ8A 5CXXA 2PSEA 5K3FA 3WK4A 4QNNA 3B12A 4CIAA 2H7XA 1Z68A 3KDAA 4BYMA 3R40A 1FJ2A 3UUFA 1MAAA 5J3JA 3I6MA 1UXOA 1W76A 1XZKA 3DLTA 2WIDA 3QBJA 2O2HA 4BVLA 3D7RA 4X91A 4ETWA 4UHEA 3I6YA 1JJFA 5ALUA 3RARA 4JNCA 1B41A 5CT4A 1GXSA 2OLEA 1YAHA 2WQZA 2PM8A 3FSGD 2VAXA 1CUHA 2WUEA 4DM7A 1TRHA 4H7EA 3HZOA 3F96A 2PSFA 1A7UA 4DNQA 4BC0A 4QDUA 1H2YA 1GPLA 1AURA 1IZ8A 4GBGA 3WYDA 2XMGA 2PU7A 1NU8A 4N8SA 2QUBA 2G4LA 1DQYA 3G8YA 1FFCA 2WUFA 2GYUA 5ALPA 1XZMA 2WHPB 4UFOA 2XUQA 5AKEA 2DQYA 5K5EA 5F4ZA 5CH3A 1WCYA 3FWHA 2ZYHA 3H2GA 3MUNA 1XZIA 5ALTA 2HHAA 2C4HA 2DR0A 1G66A 1OXMA 4EY6A 1SOMA 5E4YA 5JASA 2JF0A 2WFLB 2XUIA 4WY8A 2NW6A 3D3NA 3ANSA 3HACA 1O6GA 1VA5A 1ZD2P 4XVCA 1FFBA 3PUHA 3EQ8A 1LPNA 4UBNA 5K3CA 4CG1A 1XZHA 4DIUA 3EQ9A 1IMJA 5BWBA 1ZD4A 2WG1A 1GT6A 5EIHA 3WK9A 5ALFA 3JWEA 4H7HA 4X95A 1SCKA 5D3ZA 2Y2VA 4Y9SA 2W6CX 3OURA 1EH5A 4XX1A 2AXEA 1XLUA 5CH8A 1XRQA 4BAZA 1R1DA 3F98A 4E15A 2Y2UA 3E3AA 1J07A 3MVEA 2PUHA 1NX9A 2AJDA 4RPCA 3WK7A 1OCEA 1EB8A 4E14A 4IH4A 1QLWA 5AP9A 1VE7A 1DT5A 1JJBA 3DDUA 4BCBA 1W52X 2WFLA 1GKKA 3AZQA 3IUMA 2W22A 4UFNA 3QMWA 1XZFA 4MJ3A 3D4LA 4X85A 5CXUA 3I2KA 3QPAA 3VJMA 4A5SA 4JYPA 3FVRA 4FBMA 1CUDA 4KAJA 4OYLA 1XZDA 2R11A 5YASA 3EF3A 1P0QA 3PFCA 3STXA 2XMSA 1H2ZA 1WB4A 1GQRA 1K5PA 4UHHA 2PKYX 4AX4A 1EK1A 1ODSA 1MAHA 2OCIA 5FLKA 4BVJA 4QE3A 4AO6A 3HJUA 4N8EA 3I1IA 3OPMA 1DWOA 1C7IA 1Q83A 2HA2A 3CN9A 2QOEA 4W1PA 4CCYB 4PSCA 1PJAA 4WCVA 1X2EA 1UK6A 5HK8A 3F9CA 1LPMA 3R3ZA 4AN0A 5KBYA 3CCBA 2HA3A 5HF5A 5AHXA 5DLPA 3WWEA 3O95A 5CT8A 3M83A 2RHWA 3R0VA 4OUKX 4YK7A 1H23A 2CB9A 2I3ZA 2ORYA 2WJ3A 4GLBA 3ZV7A 1DX4A 3PE6A 4F60A 5LKAA 2HRQA 1TKRA 1QZ3A 4KEAA 1GPKA 4C4YA 5HQ3A 1BEZA 3WWDA 5FV4A 1IVYA 2BJHA 4MQMA 3VVLA 3WKCA 1CUIA 4HTAA 1XQWA 2PPLA 4H7JA 7YASA 1W4LA 4FLEA 5H3HA 2J3DA 2JEYA 1HPLA 5ALMA 3G9XA 5ALNA 4LHEA 3DL7A 5CMLA 4BBZA 1QIDA 2XUOA 4AMZA 1QIMA 4KRYA 4J0JA 4KR0A 5BWCA 4GWLA 4UBJA 2WU3A 4N8DA 3SC2A 5AOBA 5IVHA 5ALVA 2JGJA 4U2BA 3TEJA 3I2GA 1TCCA 4W9RA 1QIJA 1CUJA 4PO3X 2OGTA 1CUZA 4B84A 4NVRA 1LPSA 4Q3LA 4Q82A 1ZOIA 1CPYA 4OPMA 5CT6A 2C58A 2PSJA 3ZLVA 4E11A 1CUVA 2WIFA 4DMHA 3RK4A 2EDAA 1QIGA 3HC7A 1JMYA 4F5ZA 4UHDA 4U2GA 4MEAA 1EI9A 2J4CA 4X71A 3OTQA 3WL6A 1CV2A 1TCBA 3WI7A 2VJCA 5CW2A 2QUAA 5ALLA 3IUJA 4FLMA 2XUDA 4KYVA 5IVDA 4FDMA 4INZA 1ZI8A 2H9YA 5AI0A 4CFSA 5AI9A 3N2ZB 3RLIA 2GBCA 3ZLUA 3S2ZA 3LLCA 4EY5A 2BCEA 5ISMA 1UK7A 2QTBA 4J0CA 3DOIA 1FFAA 3EIOA 1IUPA 4YX9A 2CZQA 3W04A 4OB7A 3WZLA 1N5MA 3D2AA 4ZWNA 4X00A 5A71A 4BDSA 5AIBA 3NGMA 3D5EA 1J06A 4Y2XA 1QOZA 4LKOA 4BAUA 2V96A 2BKLA 1L7AA 3G02A 1QTRA 1XKTA 5IH7A 4FFVA 2JBWA 4L0CA 3IIIA 4MEBA 4CG3A 3FAKA 4KE9A 2QT9A 3H04A 2ZYRA 5JATA 1B6GA 1WHTA 3HI4A 3C6BA 1USWA 3VXKA 1NU6A 4M0FA 1CUFA 1T2NA 1AZWA 1L7RA 4HAIA 1EK2A 3WMRA 4G8BA 1P0MA 3M82A 3NWOA 3ANTA 5AKGA 2DHEA 2WIKA 1J2EA 5LLSA 2OGSA 4C89A 1VLQA 3FYUA 2QVBA 1VJ5A 1CUEA 1JU4A 1QTIA 3G7NA 4IH1A 1TK3A 3D2BA 3FCXA 2C0QA 2VJBA 1HQDA 2ACKA 4Y2JA 5ALQA 4U2EA 3B5EA 3A6ZA 2HU7A 2JGMA 3GFFA 2QR5A 3EQ7A 5EHXA 2OQVA 5DJ5A 3WKEA 2IIVA 1CQZA 1QIIA 1R9MA 1MNAA 4OB8A 5T4EA 2OCLA 2HU8A 1KEZA 4PQEA 4J0IA 3ZPXA 3PI6A 1H2XA 4P93A 3JW8A 3BXPA 5AH0A 5A62A 4CCYA 5EHQA 4HRXA 5C81A 2QJWA 3WKDA 3H2JA 3IVMA 1DX6A 1BROA 1MJ5A 1QFSA 5CH5A 4ZXFA 2PBLA 1XQVA 5C8XA 1WOMA 1GPNA 3IA2A 5FXMA 4H7DA 2WM2A 3KD2A 5HFAA 2EEPA 4BDTA 4CI9A 2WLSA 2XLBA 4IHAA 4QZVA 4S0XA 3S8YA 4GI1A 4FNGA 1A88A 5LZ7A 1G5FA 3H2IA 1HL7A 4BB0A 5T4HA 5IVIA 3FYUB 1K4YA 2HA6A 4HXGA 5LZ5A 1JT2A 5DNWA 1VOTA 1CUAA 4OCZA 3I2FA 4DNOA 3C45A 3C8DA 5ALHA 5K3EA 2DSNA 2WTNA 3DCNA 3FNBA 3R3XA 2XUAA 4AXBA 4QDZA 4UHBA 3ZI7A 3VKFA 4BZZA 4RGYA 3WQHA 3IDAA 4Q34A 1XRLA 5CURA 2Y1KA 4KE8A 3K6KA 3AIKA 4B0OA 2OPHA 4EA6A 1EVQA 4G1FA 4X6YA 2GBGA 3WWCA 4XJVA 2VT7A 1IUOA 1MT3A 4OYYA 4GW3A 1UT6A 3F67A 3H1AA 2FX5A 1C7JA 3O4JA 4BP9A 2V9ZA 1EXWA 4CIBA 1DWQA 1IZ7A 1XFDA 1G4HA 2P8SA 2EDCA 1XKLA 5FOQA 1S8OA 3AFIA 4ITVA 5EFZA 5ESRA 4W1QA 1XZGA 5EHZA 1E66A 4KACA 5AOAA 5EI5A 2GBIA 1VE6A 2I3DA 1UKAA 4WJLA 5SYNA 1AGYA 4A23A 3ESCA 1KU6A 4H7KA 5ALIA 4Q05A 4QA9A 4P9NA 1I6WA 3L1JA 2XMDA 1EA5A 1K63A 3I2JA 4Y7DA 2AJBA 3WJ1A 4IQ4A 1CR6A 3DKKA 5AM4A 1FSSA 1CVLA 4C6HA 2H1IA 4C87A 1J1IA 4Y2QA 3HEAA 3SK0A 1P0IA 3BF7A 5HCUA 2Q0XA 3GA7A 4BTVA 5JD4A 5AKXA 4UBMA 4BRSA 4DNFA 3DEAA 4B83A 1JMKC 3G0DA 3WL5A 3ZLTA 4HZGA 4PV7A 1XRNA 3IB3A 1QO7A 1XRPA 4G4JA 1N8SA 4ARAA 4UPDA 3QMVA 5JD6A 3G0IA 2BUCA 2CUTA 3C8HA 3H19A 2OAEA 5LYYA 3R3WA 1BS9A 1W75A 2QZPA 4C4XA 4KE7A 3WK5A 1SFRA 4HVTA 4BAGA 5CBKA 4ARBA 3R3YA 4D9JA 3AIOA 4XWGA 1TIBA 4WDRA 4N5HX 5AM3A 3G0CA 2Z5GA 5I9IA 2JGFA 5HFNA 2WILA 1LPOA 1XRRA 5IKXA 2O2IA 4P08A 4G5XA 2H7CA 4Y2RA 2QRUA 2XQIA 1YSCA 4UHCA 3WKBA 2ONCA 5FKJA 3ESDA 4MXDA 3A2NA 5EIAA 5JIBA 4Y2VA 5EIEA 1UOOA 3OOSA 2E3JA 4U2CA 4B81A 1CEXA 1ORVA 4PSDA 4Q1VA 2YXPX 1U2EA 1ZJ5A 2Z3WA 5ALDA 5FP0A 3H18A 4UBLA 2ZVDA 4Y2PA 3DD5A 1CUWA 5T4BA 1YA8A 3FCYA 4X6XA 1DINA 2QKYA 1EX9A 3C6ZA 4K6HA 2GZSA 4HXFB 5LZ2A 5HKAA 1GQSA 5AO9A 5K3DA 2FJPA 1ZD3A 1BEEA 2ES4A 3I2HA 4ROTA 1DWPA 3H2HA 4GEGA 3Q0TA 3O9MA 1UZAA 3AZPA 1W6RA 3GROA 3UUEA 4YPVA 1JJIA 3HXKA 5E4JA 1LZKA 2G5TA 4ZV9A 2CEKA 3ESBA 4KJXA 2H7YA 2JIDA 3V48A 2JGEA 4EUSA 5AKJA 2HRRA 5ALWA 5A7HA 4LYEA 5DNVA 3WA6A 1MTZA 3GELA 3BJMA 4B0PA 3C6YA 4BRZA 3AIMA 2HDWA 2XE4A 3IBTA 1XZCA 1Y7HA 5AK6A 1WPRA 3I6ZA 1AQLA 3CN7A 1WPXA 3WKAA 2ROQA 5AKLA 1H2WA 2JGKA 4AQDA 5JZBA 5LZ4A 5AI5A 3SX4A 2VA9A 3GZJA 5AK3A 4QDOA 4EBBA 2AJLI 5ALGA 1VZ3A 2XDWA 3WYNA 1U4NA 2C7BA 3QYJA 3C6XA 4W63A 5ALZA 3X3HA 4ZRDA 1EINA 3MGAA 5JAHA 4AN1A 5AKZA 1XQYA 2VTVA 5C7YA 4BTLA 4C01A 2XQKA 1HLGA 1BU8A 2QJRA 3HRHA 3QITA 1A8UA 4CG2A 3YASA 4W1RA 1THTA 2DQZA 3CXUA 5C8ZA 4V2IA 5JAOA 1GGVA 1O6FA 1N5RA 2QM0A 3R3VA 1CLEA 3C5VA 2UZ0A 3N0TA 3OG9A 3PUIA 4BC1A 2GYVA 4FFWA 1DTEA 3G9TA 4BCDA 3KXPA 1VA4A 4HS9A 4Y2YA 3D0KA 3QM1A 3PICA 2RGUA 3OC0A 3C43A 1SCIA 3QPCA 4EZIA 1BCRA 1EB9A 4RNCA 3MUOA 2WG2A 4EY4A 1UOQA 5JAPA 5KREA 4MWSA 2B9VA 4L72A 4ZI5A 4MWTA 3G0BA 1UKCA 3TJMA 3LCRA 5AI4A 4BATA 1VZ2A 2QMQA 5E2IA 4CCWA 3BIWA 6YASA 1LPPA 1VKHA 4WY5A 1CUUA 1YB6A 2WSLA 1XZJA 1LPBB 1LBSA 4B6GA 3WL8A 1EHYA 1CUGA 2OCKA 5AKHA 4FKBA 5JADA 2XUGA 4ZGBA 1JKMA 2BFNA 3QVMA 1QO9A 2XQJA 4I4CA 5HF8A 2WG0A 2BGRA 1QE3A 5JD5A 3W06A 4BVKA 2ACEA 4BE9A 5AOCA 5BV7A 1AUOA 2X8BA 4M0MA 1KU0A 2WJ4A 3W05A 1XZEA 4JUIA 5LP1A 5HF6A 3TGLA 4PNZA 3G0GA 2HADA 2DHDA 3O9VA 4J7AA 2ZJ7A 4NS4A 5AKYA 3QMMA 2RI6A 3R3UA 4L9AA 1UK8A 2XQFA 3JYHA 1QONA 1F0PA 1R50A 3WIOA 1CUSA 1BN7A 3KSRA 1DT3A 3H2KA 3KWJA 3DJYA 4QWMA 3E0XA 2C5FA 1ZGBA 2WKWA 4B7ZA 5JZSA 1H22A 2XMQA 1QIHA 3QPDA 2V98A 1UOPA 2ZYSA 3W9UA 5DYYA 5DTIA 4GHWA 1WM1A 3VJLA 1W1IA 2WJ6A 4DMCA 5FDFA 4H0CA 5D7BA 3BDIA 3Q8WA 2HA7A 1WB6A 2D0DA 3VDXA 3E1GA 4EHBA 3TRDA 3AJAA 2OG1A 4K5QA 1YS2X 5ALEA 1ACJA 3W9BA 5CTAA 1UKBA 5FPPA 2PU5A 1CUXA 3WA7A 1MO2A 4G9EA 1R88A 2XB6A 4FWBA 4ZREA 1GKLA 1SC9A 4FBLA 2WUDA 2VJAA 3NUZA 2ZJ6A 3ED1A 2HM7A 5K3AA 4B82A 1K8QA 1MNQA 3D59A 3STVA 1LBTA
chains in the Genus database with same CATH superfamily
2X23A 4MVXA 2HQOA 2V59A 4NBUA 3L9XA 1P1CA 3FGZA 3IAAA 4H77A 4HQOA 1XMPA 4PLWA 4U7JA 5ELMA 4BBJA 2ISCA 5EJ4A 5FUVA 4NZYA 2DKOA 1ZRNA 1ZGGA 2FRVA 3I8XA 1RXIA 1UMDB 2ZK7A 2QI9C 5IMBA 1FSPA 4EJMA 4LC0A 2D13A 4NHEA 2PD6A 3EG5A 2WFZA 4A36A 3ILSA 4K1LA 4EGCB 3NP9A 5KYUB 4PPQA 4MR7B 3N8KA 2AGVA 3I0ZA 3CZQA 3LO8A 1ZICA 1DVRA 4DYHA 2H8GA 2OYRA 4GXNA 2VZ0A 3KHSA 5AUPB 3F49S 3TQHA 4U8GA 4JGBA 4LMAA 1BRTA 3ICCA 1E7YA 1GPUA 3DWGA 2ATIA 1KY4A 4DUGA 3A3YA 3PIDA 4WFKA 3S5JA 4OXXA 2OLKA 2R0QC 1DIAA 4GG1A 2E18A 1GDDA 3TDKA 5EJ8A 1HKUA 2PVPA 1FU7A 3IC5A 2X0KA 4S1OA 5JI2E 4TVBA 1D07A 5CT5A 3BDVA 4J03A 2FQXA 5M04A 3V1MA 3FD8A 3WBJA 2VBFA 1MB0A 2VK2A 2C7VA 3H4IA 4JAVC 4KFTA 1H2BA 2WAXA 4D9MA 1YB7A 2EZ4A 3HUDA 4IKEA 4ND6A 1HDOA 3PKIA 1JT9A 5GOTA 5LQUA 2J0QA 2V6FA 3G7SA 5TEVA 4CDMA 4NY1A 1BMFD 2G72A 2WM9B 4UZEA 4C22A 4RTNA 4GR4A 5C8VA 2BT4A 3HMKA 1BG6A 2XYRA 2WWHA 2ZE6A 2ZIXB 3L7MA 3QVJA 5EJAA 3TCNA 3VR3D 4DXDA 3AHHA 1X70A 1SUEA 1U9IA 3JD0A 1S96A 3MT9A 3WYEA 4BFCA 3COWA 3HVIA 3MYRA 3PUXA 4GL2A 4O0LA 3AM3A 4C0AC 2BI8A 1VPEA 2J08A 2BHSA 2J3EA 4FCVA 3WRYA 4COOA 5JYDA 1M67A 4ZARA 4C14A 4B17A 2DFLA 1PR2A 4FHDA 4UNPA 4M6WA 2ZSHA 3U17A 3IT3A 4V0QA 5G40A 1Z2AA 1X92A 4XB6B 1U63A 1NRWA 4XLZA 3F78A 4M54A 5H16A 1D9ZA 1Y1PA 2I54A 1MJGM 4IWXA 2C54A 1FE8A 3PX3A 3R41A 4KUEA 3TG8A 4X84A 1RRPA 2DPYA 1TO6A 4AD8A 2ARKA 3FOAA 4LXHA 1XJ5A 2RIPA 3UMFA 4E2ZA 2GFHA 4ZO8A 3CJTA 1CVIA 4YPOA 1NDHA 2Y8EA 1Y9AA 4Z4CA 5TQ2A 4DPLA 4M87A 4Y1EA 2ZUDA 3TZLA 1XLVA 3KIPA 3HLTA 3O91A 4R1UA 4D8XA 1XEFA 1WOYA 5J4LA 3PQ7A 1VG0B 4FI3F 5EGNA 1QHGA 3REQA 1XLWA 1IHYA 4PBSA 5E4TA 1A8SA 2HWKA 1DAPA 2XRMA 3VC7A 4UTOA 3TSWA 1OBHA 4YAIA 5KQMA 3FZQA 5LIPA 3PPWA 5K3BA 1U7ZA 5LXTA 3BWXA 5F3WB 3AILA 1CQPA 1TUGA 2F90A 3HBJA 1I2CA 3LQYA 2R1TB 1F2TA 3FNFA 3D64A 5DYWA 3ETJA 1DRKA 1MCZA 5JWHA 4EDHA 2J5XA 3DOHA 5SYAA 3QI2A 1GV1A 2XMRA 4X1IA 2C9YA 3RSOA 1KP9A 1ULZA 3DE7X 5G0WA 3BGWA 2AE1A 3CCCA 3ZWPA 1DL5A 1L5HA 4WESA 3UJ6A 3ZBUA 4GPD1 1C7FA 4TLCA 5AM2A 2OILA 2WDZA 1SUIA 1NIPA 2PZFA 5HX7A 2F43B 3RHZA 1US8A 5AI6A 4U3JA 1U3VA 2O5VA 1EEXB 4UFPA 2A9VA 3AGPA 5LQMA 4RA9B 4M3NA 3O84A 3TPCA 2QZZA 2YWFA 5A5FA 3O26A 2XTMA 3C3JA 3HXPA 5LNK1 1QWSA 3KFLA 3ADPA 2W8BB 3D81A 3HU1A 1Q3TA 2C59A 3OM8A 4JQCA 4L75A 4M6WB 1LA2A 3IJ5A 4UVDA 1KI6B 1FS6A 2OC4A 3KHKA 1AM4D 4NWIA 3UK2A 3U19A 4Z4QA 3DE1X 2MYPA 5MGNA 1IWBB 1L5WA 3HBNA 3TQIA 2PO5A 2DY0A 2VH5R 3D8BA 3MXTA 5HZGA 2P68A 4TMFA 3RJZA 2P4EA 1XA0A 4QYIA 4KR7A 1CLUA 1THGA 1Z73A 2W2LD 1UBFA 2IF2A 1JALA 1JUDA 2FLKA 5CRIA 4EYQA 4A27A 2WR8A 2O5EA 5JLAA 3SEQA 1YNSA 3S70A 3CZ9A 1ILWA 2IODA 1HYGA 1ZITA 2O4CA 3OA0A 1CDDA 1R8XA 3N39C 4HNSA 4LC9A 2F62A 4Y67A 5IBPA 5B6JA 4WN9B 2VDPB 4V0MA 1B23P 3OTGA 5L7WA 4BX8A 4D4GA 3SZMA 4Z5XA 3KYCB 3T4UA 4XVUA 3GBSA 2BUAA 4KFRA 4PAQA 1CR0A 3H9EO 2ZUBA 4LIPD 3FDXA 4QUJA 1QH0A 3RJMA 2IHZA 2ODAA 4N0MA 3RKSA 1M2KA 1TCAA 4DBVO 4JEHA 1PR6A 2OZKA 1U0FA 1EESA 4JBHA 4FNOA 1MVLA 1W9MA 4KHPB 3EXHA 1RHRA 2YR0A 4MO2A 4WJZA 3KR2A 3EPLA 2ZIXA 3AYZB 2FEWB 4MRPA 5BQOA 2AC7A 1EUCB 1MPXA 4IIFA 4KDEA 1C4XA 3VH1A 5JMOA 3HGTA 2PSDA 1KSHA 3UKDA 3RAFC 2X14A 1ULSA 4TTIA 4GKJB 4XTCS 1HDEA 5I9TA 2PRYA 5EIOA 2I91A 3CUWA 4QBIA 4BB9A 2EBFX 1D04A 3IGFA 4H3HB 3CTMA 4FCTA 4X8MA 1GT91 3QEOA 4FOLA 1FTGA 3SZGA 2HREA 2Z8YA 3HUTA 5TMDA 3WMEA 4O4JB 3HSSA 4DV1B 1G9XA 4MQ6A 4OREX 1V1RA 1QYRA 2GO7A 1PVVA 1ZH4A 3BA1A 1EE9A 2ZT6A 1F3LA 1QFYA 3AM4A 3D8HA 3GT4A 3HLKA 4CR7A 5LP6B 1WS6A 4NS1A 4IDHA 3LP5A 4UU8A 3EXG1 3R5KA 2B83A 2IXBA 4KQWA 3A4MA 2OM6A 2QRVB 4OGWA 3OP1A 4URYR 1V25A 1Z08A 5FJIA 3SU8A 3WWYA 3AF0A 3B20A 1HO3A 1TAHA 2FCRA 2LKCA 3LCMA 2P3SA 2W0SA 4OFXA 5TPZD 3WICA 3VISA 1P1HA 2PJUA 3L8FA 4RSGA 3ZH9B 1V9CA 4UASA 5ITWA 3RS7A 3I28A 3NVAA 1IONA 1RMYA 4E5SA 4NESA 2VDOB 4Z0PA 1YNOA 4BKRA 1X7ZB 4QDXA 4CKXA 1XCBA 3N53A 2X7JA 1ML4A 1CULC 2JIBA 4IGFA 3VZSA 1DU4A 4G9BA 4KO4S 3H7IA 1O0SA 5LQJA 3QZUA 1ZNYA 2GGSA 2IHVA 2NUAA 2BGNA 2DWPA 3VC3A 2CK3A 4UBOA 5IJXA 1FDOA 3OC6A 2OV4A 3PIIA 5HKKD 1NYQA 3U13A 5K6AC 4DV0B 4M60A 1SVOA 1GL3A 2O7VA 2W2KB 3G8AA 4QXRA 4JX8A 4XWTA 3KO8A 4S1PA 3WYGA 2IITA 3OIUA 3AP1A 1X77A 3L7JA 3B3QA 4QM6A 5GQSA 1GSIA 1T2FA 2ECFA 1ODKA 1CK4A 4O4JA 1JJAA 2J3MA 4K6CA 3FLAA 2I4TA 1DXOA 3G8DA 4WNYA 3UCXA 3ER8A 2ZR0A 1BHQ1 4CODB 1MMFB 4OXNA 1QB8A 1UT5A 3KWLA 5HFJA 4EATA 2GCIA 1QGED 4EHHA 1Z28A 3V8EA 1ISIA 1NOKA 1N0VC 4NIMA 5JQGA 4KYUA 2VYVD 2CSXA 1EFLA 1SOUA 4F46A 4GT1A 2AOWA 1ZD5A 2LIPA 4BNKA 2IYVA 3DH0A 3GUZA 2AEEA 3QPVA 5AVTA 2BC9A 1I33A 3H8VA 4ITUA 2HMYB 3UKOA 1DNPA 3CE6A 3JY6A 4YRGA 5CDSA 4R71A 4GMFA 5EHIA 2RH8A 4XKJA 4ARZA 2ORVA 4ZI7A 2FSVC 4G0QA 1CF9A 1D2NA 1L1EA 2CKMA 2W6ID 3FYTA 1MDFA 1OPXA 3O8CA 5AHOA 4V39A 4IRMA 3QUBA 5HZKA 3LX8A 5C5CA 4Y6RA 2M32A 4LHWA 4BB5A 2B3DA 3QOXA 3GRUA 1KPHA 2BAGA 4NMLA 2CVPA 5K99A 2PFSA 1MJFA 2XW6A 3OBIA 4Q9NA 5GPBA 1NP6A 5IEJA 3EVFA 4G8CA 3IOEA 3MCWA 3UFXB 3ZHVA 1UQRA 2NP6A 3DMTA 1IM8A 3ZDDA 4A92A 1WLSA 4U5XA 3V8NA 2XNDD 1CB0A 3JPWA 4X61A 3A37A 3EXG2 3JZIA 1IUNA 4WFJA 3HVUA 2I3GA 2R8YA 4AXXA 3T7KA 4GX0A 4COKA 1X19A 2E4WA 3HA2A 4IFTA 1MIOB 3WGIA 4DUYB 1V8PA 4WACA 1JH8A 1P72A 3EH1A 2MYNA 1QXSA 3EQZA 3IPAA 2B35A 3AHDA 4WHMA 4GGMX 2VQ6A 2QTFA 2KWIA 4RPHA 1QOPB 2XEXA 2I67A 4ARUA 2VEDA 2B2CA 1F14A 4QPJC 3UEOA 2XZDA 3ONDA 4ZVKA 4IVRA 1YDFA 2PL5A 4GO1A 3URMA 3ZE8A 1LXCA 2C5HA 1O4WA 3BCRA 1I2ZA 1S4MA 4W9MC 1XZAA 1MB3A 1KNXA 3IAS6 1UZMA 4JVLA 4RIHA 2AQ8A 3EODA 1O97C 2FP4B 3FZEA 2EZ8A 2PKEA 3GCDA 3KDPA 1E4EA 1N0UA 4FFOA 4U3JB 2IDJA 3C4QA 3DUFA 3KBOA 3PXUA 2RHMA 4RXUA 1QRSA 2GSWA 3I2IA 2JGLA 1J0CA 1YQXA 3EWSA 5DKFA 4EYEA 5GIOE 2PBZA 2WI8A 2PG3A 4S1TA 3HCOA 1DIBA 5IYZA 3DHYA 1QVWA 2NU7A 1W9HA 3K05A 1XRMA 3IT0A 1EM6A 5DVZA 4RPIA 4AG3A 2E2WA 3VSBA 1R4NA 2OWDA 2NO7A 4DLUA 3ICOA 3IQEA 1C7ZA 5ICCA 1U0EA 1V4VA 1PFQA 2OCAA 6LDHA 2AZTA 2BEUB 2GN6A 3TLKA 2O52A 2PBRA 2FX3A 1JE1A 3K9WA 3EZ6A 1FFDA 4IRXA 3CX7A 3KU1A 4UNQA 4ALJA 3PJRA 2AV6A 2HIGA 4Y2UA 5G41A 2G0TA 1CHNA 3O4GA 5BN5A 1IWPB 2VP0A 4EFNA 1OI2A 1JZSA 2WMDA 2ZB4A 1A50B 4OGFA 3ZU2A 1P5RA 2JHGA 5GMOA 5TX7A 2QI9F 2ZS9A 5CVCA 1XTJA 2IPOA 4Q1DA 1I4DD 2HO5A 4RDCA 4DHWA 3PA6A 5E38A 1IWOA 1UP4A 4IDBA 2QTGA 4FMDB 5A9RA 3HKCA 3EBLA 4OXRA 2X2FA 5EINA 1YAJA 1P4JA 3B9QA 1SK9A 3RUCA 1GJRA 4NFYA 2JFVA 3HEBA 5AKKA 4G0ZA 4YJFA 4M9SA 2NVWA 1U5BA 4XX0A 5KVQA 4EG6A 3BXEA 3GF4A 3DKVA 4H1UA 5ALYA 1TU0A 2Z1MA 4IINA 1MG5A 1YR7A 4H35A 2RHCA 1PFKA 1XGKA 4JASB 4M7RA 4Y2SA 3UK1A 3ND6A 3LE8A 1GNQA 1X6VA 2ET6A 4WDQA 5DHSA 2JIPA 5BR8B 1E2EA 4M0KA 4YMSA 4C6SA 4B2IA 1NNEA 3CZPA 2BMEA 2FJUA 1VLMA 4WK0B 3UB3A 3PT9A 3KBBA 4JBIA 5KYTA 1EP3B 3PUKA 4YS6A 5BPHA 1E18A 4ZA2A 1MW8X 3VOBA 4NKRA 4R2JA 5TS3A 3T0GA 4KDRA 2CZCA 4JYAB 2QG4A 1E3MA 2AC4A 1EFPB 3O3MB 4UTRA 3MRTA 2ZRFA 1K98A 3KNZA 4ZIRA 3MGBA 4EABA 4E13A 1A95A 4CWAA 1FW6A 3QF7A 4FX5A 1UOEA 3B6IA 3AU8A 3BF8A 3BH0A 3CH4B 3HKBB 4RETA 2P40A 4GPEA 1CU1A 1TW2A 4Q4AA 4C3VA 3LPDA 3GLFA 4Q4JB 4TKVA 2WE8A 4FR5A 4ON9A 1RI5A 1NVDA 1PZXA 2RDMA 2X22A 3KAQA 4XE5A 4F2GA 5AFSA 2R3SA 3GOHA 1OASA 2FSGA 3L0IB 4HR7A 4C7VA 1NSYA 2HMAA 1TUIA 4K88A 4NG4A 5LUBA 4NDNE 3VHXB 1EFUA 4NK5A 2H92A 2J4FA 3EDMA 4J91A 5GAJA 2WV9A 4YR7A 3ZV3A 2QYHA 4U9IS 3D0OA 1DC3A 3UVEA 3VYSB 3NEPX 2NUTB 1FFXA 3WRXC 4DCSA 4RIFA 4ALIA 2FWIA 3PQDA 1GYRA 4FZ3A 2WJWA 1NX6A 4GZLA 2PUWA 1T1EA 1KDPA 3NZEA 2FN8A 4B3RB 3FAZA 4MCAA 2R6R1 2WUGA 1EG2A 4B6SA 5DULA 3L0PA 4PG6A 4F6RA 5FBKA 1CWUA 2O8DA 1DKNA 3L79A 3EY4A 4D41A 4H3KB 2Q6VA 3LHFA 2JLCA 5IMSA 3GT7A 4JBLA 4QFDA 2RH9B 1TPYA 3AR3A 3D4NA 2ZPUA 1P0CA 4IMIB 4ZVSA 3JQDA 1DZ3A 4IH9A 3LIIA 4LHXA 1OILA 2B7LA 3OT1B 4BX0A 3WOHA 3ZVKA 2AWNA 1LBQA 1C0KA 3ZHTA 2CLHB 1RLUA 1ONPA 4HN2A 3UMVA 1M6WA 1QRAA 1FYFA 1Z2OX 3C3EA 5JZ9A 1BDIA 1UBGA 2ZDGA 2YTZA 4FZRA 5ERXA 1G7TA 3K0CA 2O9JA 4TS4A 1IN6A 3KQSA 1KEVA 1SBTA 4GXRA 1D2RA 4IMJB 4KKXB 4RVGA 1VL6A 2ZXEA 3BRQA 1KE1A 4BGEA 1KI8A 5ICMA 1KGSA 2C29D 2BDUA 2NNWB 3E35A 3TBFA 1TZBA 2R5FA 1D0SA 5BOVA 5A1TA 1Z0KA 2OL4A 4AZWA 4HG2A 4A6DA 4M7OA 3N2GA 5T3UA 1ZDMA 5AVOA 4OLAA 1GL6A 1LI7A 1N2BA 1WKBA 2HQRA 2FWJA 1RWWA 1QJ4A 2C5AA 2YBEA 3BFJA 3H86A 2H4JA 3QXJA 1Z4KA 1KYXA 5BOSA 1Q92A 2OD2A 3IBFA 1C4OA 3DBRA 1E2MA 1E89A 1QVAA 2GZDA 3N2NA 4PVCA 2F3TA 2XZLA 3AOEA 2O8CA 2R1ZA 3AQIA 3TQRA 1RKUA 4HLUA 4PIMA 3GI1A 1AT1A 1I80A 4AUEA 3X1KA 1XTPA 4M0PA 4E1AA 1XEAA 3AB7A 3ODGA 4AAYA 4YUZA 5C53B 4OM8A 4HI0E 3AKZA 3WBFA 5DV9A 3DNMA 4GLLA 4B3DA 5G1OA 1S2IA 4WVFA 4Z54A 2W2NA 1UC4B 3N87A 3PX7A 1IJKA 4DZRA 1T13A 4MUYA 3VTFA 4R0NA 2JLZA 5KSYA 3MTAA 2RGEA 3TSAA 4EKYA 1UXKA 1K7FB 2YHAA 4LE0A 4G4IA 3IVRA 3MWDB 4FR0A 1V2GA 3EC1A 1VPVA 2QRPA 3P2IA 3PXXA 4QG7A 2QJTA 5SYMA 1X7WA 3LLMA 4XVHA 2YN0A 3PR1A 3ZWWA 1XDUA 3O4RA 1GPDG 4X93A 4KR9A 2ZM5A 3AEQA 4OG2A 2H51A 5JSUA 3KQPA 3OOYA 3RSLA 2EKDA 2G7MC 3G13A 4IO0A 1N33B 2ZS8A 3PD1A 1OH5A 4Q3OA 1QTQA 3ZWMA 5KTKA 2XXAA 5F52A 1B93A 1EGAA 1KGDA 3M8KA 1Y4DE 3MWEB 4U7PB 4IDEA 4EMSA 4CL0A 1JYSA 1WSAA 1QNLA 3WRWA 4D57A 3NBAA 2IV7A 4TT3D 3ILHA 1LQUA 1QNFA 3L2OB 4N9WA 5ALKA 3VBCA 3LDGA 4RHYA 4BFZA 1HZZC 1ZH2A 1DBRA 3DZDA 3N75A 2DZDA 3W90A 3PIRA 4DA9A 2WHPA 3TQOA 4NENA 4V03A 2EBUA 2YIMA 2GK3A 2GD6A 3CB2A 1BGXT 4TWZA 2CYAA 5DRTA 4C03A 5CB4A 4DJ5X 2F4VB 1O2DA 1G6Q1 1RLMA 2Y99A 3O0DA 2R8EA 1K0UA 4NYJR 4YP1A 2PS0A 4BFXA 5AKIA 1TPZA 5ED4A 1XR3A 4BIIA 1XKXA 2A58A 4M98A 2WHQA 3CWCA 3BL8A 2VZ8A 1YR2A 3L0CA 5AVXA 3MLEA 2FEMA 1U02A 4JXKA 2XUJA 3QEMA 5K0NA 3ZNQA 2BRUC 4K86A 1ZUHA 3ZI0A 4CLOA 1TD1A 2GZ1A 5LD2B 3VJKA 4DW8A 1V1JA 3LWBA 1BH2A 1W2HA 2XUFA 3RRXA 5A0TA 1NKVA 3QYPA 3IIMA 4L5AA 2C2YA 5TQ0B 2AK2A 1XVVA 2CKDA 1QBKC 3CE9A 4HRYA 2HA5A 3QTLA 2OM2A 1Z47A 5ALSA 4EARA 2QXYA 4JH0A 5BW8A 4ESVA 5JU6A 5J2UA 3OCYA 2AI3A 1DP4A 1C30A 4HNHA 2AX3A 1ETHA 1GGHA 3UJCA 2O14A 3OD5A 1SZDA 2VJYA 3GDGA 3D3WB 2Z56A 1B73A 2N46A 3K2EA 1E4YA 3LSYA 1SA0A 4JELA 3UJ7A 5HYVA 1SPBS 1HYQA 1R6BX 1K6IA 1YK0A 1U2DC 4OU4A 3VTZA 2VHVA 3OY2A 1O6BA 4IDOA 5HK9A 4EPWA 1SRRA 4MUJA 2A0KA 4BLSA 1PCXA 3G82C 4O2AA 1WF6A 3H9UA 1SZPA 4G36A 3K1TA 2PSEA 2FE1A 3JYPA 3WK4A 4GPZA 1PJ2A 3AI7A 1G60A 4RH1A 3W3AD 1E0JA 2ADMA 2GAFA 3KDAA 1N36B 2GN2A 2PYZA 5KOIA 2WPDA 1RYEA 1EJBA 5HRCA 2C98A 3NBQA 4QKQA 2FPXA 1N1EA 1MAAA 5FL7D 2JFQA 4PC3A 5FV7A 2QN3A 2XTJA 4O0MA 5CFQA 3COJA 5IDWA 2J7PA 4TROA 4A2CA 1V96A 1PZMA 1JJVA 4ND8B 4O4JF 3QBJA 5C1PA 5KCZA 4BVLA 5CVUA 3NANA 3JASA 1NMYA 2F9MA 4LRTB 4AJ1A 3RS3A 3AW8A 4RM3A 5LWQA 4JC5A 1FBTA 3GBVA 2EWVA 1U28C 4DJAA 1C7QA 3GXOA 1Z4QA 1ANKA 5IXSA 1JJFA 2O2YA 3NC0C 2ZZMA 1HDRA 1SG6A 2BE9A 2FHPA 2WZBA 1VLHA 3HL4A 1PX2A 2PT9A 3H9QA 3TZHA 1N2CB 4R40A 4D3DA 3M6MD 1GXSA 3E23A 3SS8A 2JCBA 2JFOA 2ODPA 3NV7A 3C5HA 1Z4OA 1O96B 3V4VB 1KP3A 4NCAA 1YI8A 5C51B 3QNUA 4MI3A 3RIXA 2ONZA 3ZWOA 2PM8A 1XYGA 4MUNA 4IMRA 4JI3B 1JTVA 2JVJA 2VYNA 4Z0HO 2IDZA 2WUEA 1JBKA 1X8XA 1K9VF 4UMFA 3S1AA 1RKBA 2QPLA 1PWHA 3TLMA 1VJCA 5BRJA 4H7EA 2MSDB 1EXNA 3IXMA 5H9VA 3P9XA 3HZOA 1XMXA 1QYDA 3EEBA 1QKJA 4MAFA 1IN5A 4HF7A 4NV1A 3SYMA 4KR2A 3SJCA 5IKPA 2PR2A 1HUQA 4G26A 2J32A 1ADCA 3FWZA 4G37A 3GMSA 1PHRA 1O7JA 4WKBA 3UWKA 3TUZC 3N2EA 3P9SA 1DJNA 3TVTA 2IIQA 2ZPAA 5ECDA 1JDTA 1KBOA 1VHJA 2AKYA 3F3SA 3W8NA 3AFMA 2X1HA 1L5QA 2QUBA 1C7EA 3AOEC 4MRMB 3FSRA 1NNUA 3RVKA 1F6BA 1SQFA 4TWAA 4HGQA 3DPSA 1VI6A 3O47A 1H4SA 1H0SA 1E9RA 5DBOA 5LA6F 4H7PA 2YIDA 3ZJVA 2A9KA 1ISMA 3OFND 3ISJA 2AFHE 4YBRA 3RFXA 1LVHA 3X2EA 1P7CA 2Q5HA 3UA3A 4MQFB 3HDTA 1KK0A 4CKBB 1XZMA 4ND1A 2VDUE 2WHPB 3IBGA 3IAS1 5CCXA 1JR4A 3VAZA 1R0ZA 1A5TA 1WABA 1XD2A 2DQYA 3EVEA 3GAZA 5CA0F 5K5EA 4MB0A 5HJ7A 3DBIA 5CH3A 3I76A 1KO1A 1WCYA 1H05A 2XKJE 3Q1KA 4C7JA 1F12A 1U3UA 1Z16A 2BIFA 4PO1A 4E6EA 2PK3A 4M0UA 2CL7X 1ITZA 2OENG 4OOFA 2QUZA 4TN5A 3A1TA 3TFOA 4UEKA 3TQQA 5BN4A 3A4NA 3UPDA 3AFHA 1JHYA 1XZIA 2PWZA 1PT5A 3KZXA 3SF8A 4CEJA 2Q4DA 5KI6A 1X1TA 3VPDA 2C4HA 1GADO 1F2UA 1NVFA 5AHWA 2QTHA 3P9CA 1QDLB 4OFBA 4EKIA 5BN3B 1QU2A 4TKLA 3EZYA 4EX6A 4DPMA 2YYAA 1T24A 2JF0A 3P4YA 2VG8A 2Z6AA 4DCTA 3K09A 4D45A 4WY8A 2EAUA 1H1DA 3UY4A 3OLQA 1BA2A 2NW6A 2FMFA 1NONA 2YRWA 4A0QA 3QV2A 1L7VC 2QMEA 2P1RA 2HNKA 4HZIA 3OE7D 4ENUA 3IDOA 3FKSA 4P3NA 1EFRD 1C2TA 2BISA 2LRHA 3L1UA 3NV9A 1LLUA 2WWIA 4J07A 2OLJA 1ZK3A 3K6JA 4GMGA 3RAJA 4BNJA 1FFBA 2W43A 4OQXA 4R1NA 4XVCA 1TYAE 1QHXA 3KXIA 3FCAA 3ENWA 5JYEA 5KX5F 5FWXA 3UXMA 3KSUA 2ZUUA 1KAEA 2NTEA 2A3RA 3A6EA 3PUZA 3UPTA 1Z0IA 1LPNA 3V8RA 3GLIB 1YRLA 4RHUA 3JSAA 4MHSA 4UBNA 4WOKA 5K3CA 2A8YA 4WMLA 3UJ9A 1KTVA 1E6MA 3UXEA 1GA6A 2UV8A 1B8OA 2R6AA 2R97A 3I4LA 3C1AA 4PICA 4QHSA 1P1FA 3EQ9A 4MKIA 1K3FA 3GWZA 1ZD4A 2PZBA 1NUQA 2JAOA 1IZ0A 2WG1A 1FDRA 2XSZA 1G20A 2Q3MA 2Y9MB 1YQTA 4HPXB 4PYRA 4OQZA 1M2OA 1DG9A 3GJZA 4TZKA 1J7KA 4F4CA 5CPBA 2VAMA 2P9QA 5KWSA 2PXXA 3C1TA 4EG7A 5ALFA 2VPZA 4Q6BA 3JWEA 2BZSA 2CLCX 4QYIB 4X95A 2OXIA 1SCKA 2XKAA 3DTVD 5D3ZA 5ANRB 2W6CX 3BH7A 2C03A 3KQVA 4XX1A 4EL0A 2VZ9A 5B7QA 5KEIA 4AKIA 1XLUA 1DHTA 1T3LA 1LK7A 2QZJA 1J0EA 3EC2A 4LDQA 4BAZA 3FNIA 1MO5A 1VE3A 4E5YA 2I6GA 5KWEA 3OQ6A 1JHUA 1PL6A 2FDXA 3DW1X 2JK1A 3F98A 4YNBA 4MKGA 3IP8A 3ZWBA 5E0KB 4N47A 4BNNA 4BNYA 4EHIA 5HBGA 4MEJA 4JBNA 2JFXA 2QDKA 3HKEB 2YN4A 2ADFA 1J4AA 1ZBQA 3H2BA 3LBYA 4JKOA 1KJYA 1ZXXA 4YB8A 1JFVA 4J8PA 1H0HA 2W6ZA 3E03A 3L84A 2HO4A 1L7MA 1G9SA 4NEHB 3E3AA 3EG9A 2XE8A 3E22B 1HL3A 2Q3LA 2ZYVX 3NLLA 2R4QA 2QTVA 4IY1A 1RAEA 5IC6A 3VI4B 5H4GA 3PVCA 4NSNA 5A1JA 3C41J 2PUHA 2PZKA 3TG2A 3PKZA 3WK7A 5EIXA 4LFAB 4E14A 1NJFA 1FW8A 1GNVA 1T4BA 2O5CA 4ZAFA 1J7JA 4QUHA 4DWJA 3NKVA 1QLWA 2GZMA 1IVNA 3HJFA 4I4NA 3C7KA 1P4RA 3QKRB 5EIBC 1O3YA 2GRAA 4TXLA 2A5DA 1MQ8B 1SB9A 1I01A 3ZVMA 3FMOB 3KPYA 1EGMB 2XCOA 1WKCA 4RTLA 1JTFA 1ORIA 2RGNA 3BJZA 4YHBA 2YQZA 4R2KA 1B15A 3EVBA 3QFHA 1IJFA 1MO6A 1PJSA 3EDYA 3FFXA 3JZMA 1EVKA 3K5HA 3GMDA 1RZVA 3SNKA 2Q3EA 3SSMA 4QX6A 4AM8A 2IV3A 1EQUA 4FP9A 3SHQA 5CDHA 2VQSA 2C97A 2WFLA 3KVOA 4G0OA 2C2HA 5KNDD 2HOQA 2SKEA 3GIDA 4TXNA 4YDHB 1DADA 2CFTA 3HVKA 3CWZA 1ZL2A 4KQFA 2IS4A 4FGUA 3EIHA 1XZFA 1FJHA 1D3AA 2IZ7A 4LYYA 5JCJA 2R6JA 3ODPA 4C7MA 4ZVQA 3T0FA 5EWLA 3GJYA 4MJ3A 4ZQGA 1WR8A 2P79A 1M6HA 3AF1A 3FPEA 4F6RB 4X85A 4HB3A 3U5ZB 5DLEA 3G89A 1IVSA 2C95A 2IEYA 4UDOA 3FHJA 1UFKA 4K9SA 4BFWA 2HDHA 4OAQA 5EXTA 1RJWA 3VPXA 2OECA 4F5YA 1OXVA 2ZRNA 4HNRA 4JD5A 4ZICA 1MABB 2EX1A 3OI7A 3VYWA 4JYPA 4YCCA 1YS6A 5BSFA 3L6OO 3NATA 1NNLA 1SEVA 1CUDA 3WNDA 4YMHA 2CV1A 3OEWA 4G1CA 4KAJA 5IKEA 8OHMA 2ZIZA 1FVXA 3D4PA 4BJ5A 4P3YA 5AVSA 2ZRMA 4H3VA 1H4QA 3HHEA 1AS2A 1TK9A 4FS8A 3U4CA 1QRRA 1T2CA 4NCIA 4HY3A 1QPBA 3T7RA 5DGXA 2VNSA 4A0FA 4BNZA 4R1SA 5GV7A 2YWDA 4QOEA 1E1RD 5CK5A 3VR4H 1G8HA 4B8ZA 3PX2A 3FPHA 4F9EA 4DQXA 1GAXA 2E89A 3CZRA 3WGOA 4MI1A 3AV3A 4LDJA 1EUYA 4TTJA 3DE3X 4HLQB 1EK1A 1ODSA 3WJAA 5FUXA 4EENA 3JS5A 4XWYA 3TMKA 3IHKA 3HJUA 1E1RA 1MJNA 5FPSA 3FB1A 3IOBA 4JWKA 4IZ6A 4LGYA 2A78A 2H4YA 4DV2B 3KDSE 4N8EA 1SBYA 1ID8A 1BXGA 2C3PA 1LF5A 2HMVA 1QK3A 4GX1A 4LRUA 1DARA 3K1AA 4FXPA 2H2FA 1EFCA 4XFDA 5HIIA 1Z5GA 1KBQA 2QOEA 4BVAA 2VSXA 2LXNA 3EUFA 3GW8A 5FO0A 3GUHA 2AZMA 1T1GA 4WGFA 1EWTA 5C8YF 1V7PC 4NAVA 1YR8A 2BONA 4MRVA 3MJCA 2VCEA 1UK6A 2QPTA 2VHJA 3BORA 3HGQA 3GPDG 1CJUC 1LPMA 3TR0A 3H84A 3JYQA 3O90A 3ZBQA 1U8TA 4ID9A 2PLNA 4L4XA 3ZLBA 5KBYA 3RKUA 3G88A 2HA3A 3GFTA 3JZAA 3BB4A 3IR7A 3KJFA 2W2PA 4MVJF 5FJJA 4ZYWA 3TNDA 1IQRA 4RZ2A 4EL5A 5CT8A 1HLDA 4FHEA 5B1YA 4Q3EA 3W7VA 3SZOA 4EEKA 3JYLA 2RHWA 4KGVA 5GVSA 1G3RA 1NT2A 3LVBA 4J2HA 2PL1A 5L9AA 4M9ZA 4GXTA 3CZMA 2H59A 3LYAA 5LU8A 2W2MA 1E6WA 2VTEA 4HK4A 5EWJB 3D6MA 3M6WA 2HPAA 3U2QA 1DOAA 4MJXA 3BG5A 2HCFA 3VTKA 1WUIS 5H82A 4GLBA 2D7DA 1E2KA 3CC8A 4HV4A 3OX1A 2HGZA 2ERCA 5EZ5A 3NYWA 4EELA 1GDTA 2DCUA 2GN4A 4ZKDA 1E4OA 2NXWA 2VT3A 3B6EA 4EDFA 4J0EA 1YRWA 2HK9A 2GM3A 1JTEA 1BD4A 1B4DA 3DAPA 1GGJA 4PZLA 1GNTA 5A4FS 3NDIA 5I4BA 1SD1A 2CMHA 4PY2A 5FV4A 5JAMA 2AD1A 1OAKA 2PWPA 2O2EA 3NRBA 4I3HA 2VBCA 3ADDA 2X5OA 3F7MA 3NHSA 3EIWA 4BMPB 3THXA 1YBFA 1QK4A 2ZDQA 1NXXA 5F1OA 1X8KA 2VJQA 3GLHE 4HS4A 1YDGA 2DECA 2OYCA 3WKCA 1FX1A 4TLMB 1ZJZA 4DIOA 1XCMA 3AJ8A 2PPLA 7YASA 1NJ2A 1W4LA 3AVOA 4RKRA 3NIDB 1VJDA 2AN3A 3H75A 4FLEA 4ODIA 4Y9UA 3THSA 1NV9A 4P83A 4TWRA 2HSWA 4K05A 4LHEA 4QOJA 3EGDB 1N92A 1Q12A 3LPCA 5CMLA 2XUOA 3GEEA 2HWUA 1CERA 4MDHA 5EKXA 3IODA 4AMZA 1I2AA 1QIMA 5IK2D 1E3EA 1KH3A 4AY4A 5U1PA 4QODA 2F4NA 3D02A 5T67A 1NHWA 3ZW8A 1MAVA 3AWDA 4UBJA 4WOJA 4KUGA 2WU3A 4FQ7A 3P9KA 5DN9A 3PNBA 1MABA 3TIVA 5CDGA 4GC9A 2H2AA 1JLLB 1NMSA 2B2XA 5TY0A 3HB1A 2WF8A 6REQB 4YONB 2X2EA 5DW0A 5TNXA 3K8OE 3DMHA 3W34A 4JL6A 2RH5A 3A6KA 1ZLXA 3LF2A 1I1OA 4JOBA 4U2BA 3TEJA 2QRNA 4AKTA 4E0BA 4ZP1A 4I1VA 2OK8A 4OX9Y 2J3LA 1VCNA 1T2UA 3U0BA 4K6MA 4IDFA 1ISJA 4YC7A 2OA0A 1RKXA 3EZ2A 3MJEA 1K6XA 3PRKE 221PA 5B1DA 1NBWB 3AJDA 3VU3A 2D3WA 3ZD8A 2KLHA 4XRGA 1KEEA 1JR6A 2I6XA 2LW7A 5CLGA 2NSDA 1RWPA 2AQHA 4Q82A 1NLZA 1CPYA 2Z8YM 3DPIA 4YO8A 3ZNPA 1RBZA 1WUTA 4DV7B 1BH6A 2OZPA 1VL2A 3CNQS 4ZDWA 3ZLVA 2YN2A 4F71A 5G2OA 4BRUA 1B0ZA 4QO7A 4RBNA 4E32A 2VNKA 5CD1A 1DEXA 1P6QA 4C3OB 1ECBA 4IJVA 1IZYA 3AESB 2HYDA 2FF5A 4PO9A 5EKDA 5KHAA 2LCQA 3UWDA 1JSCA 4G0VA 3VOSA 4CTKA 4PGHA 2OO7A 4ZVTA 4AJ4A 3GPLA 4IS2A 2MR6A 3N86A 3QVGA 4IZHA 4X71A 4L5CA 1TD9A 1CV2A 1TCBA 1XMJA 4NZ9A 2X9QA 5E2BA 3RF7A 4B2PA 4DUPA 2O8CB 1RJFA 3CX6A 3MGKA 5JNRA 5ALLA 5LIRA 1ECJA 2UYHA 4FLMA 2XUDA 2I3AA 2P91A 5IVDA 4Q15A 1Z0DA 1XEXB 3HRKA 1T4CB 4MRNA 4XDYA 3W2IA 4INZA 2VXCA 4M38A 2H9YA 4KI0A 3I5YA 1LJ8A 1YBVA 2ILVA 3WOVA 4MINA 3B85A 3OBBA 3IVGA 2XIJA 4O4HA 2PIDA 3SE0A 3L8DA 3WGVA 1A9ZA 1NN0A 1PR5A 4EQZA 3RLIA 1SEPA 3HZZA 3M6VA 1Z8DA 4UJ3A 2V65A 2IP2A 2VRNA 1DPGA 1T5LA 3QVXA 4KWHA 4N3NA 3ZLUA 3GIWA 3LLCA 3LBNA 1ZISA 3W6NA 4BV2A 3Q98A 4EY5A 2CXHA 4I4TB 4GF5A 2V1UA 4ZHQF 2QTBA 4H59A 4LX8A 4J0CA 4RVSA 4UD2A 2Q4BA 3KKMA 4UNNA 3DOIA 2H65A 2PKXA 1KMHB 1QFZA 3RYHB 3B1KA 3ZCRA 1IUPA 3RUDA 2HWWA 3LH5A 3TLBA 4YX9A 2CZQA 5CD9A 1ES9A 1U0OC 1C3OA 3WZLA 4WH0A 3D2AA 3M1LA 1PEKE 1AUXA 3AUXA 3UGKA 1BXZA 4GI7A 4FYIA 4GZMA 3ZZ0A 2IHNA 1NVVQ 1LSOA 4FT2A 4ZTZB 4XWKA 5L53A 5K03A 1GZ3A 1UKVY 1MVNA 5DP1A 3JALB 3ELUA 4YP0A 3NORA 1H8ED 1QOZA 4CV3A 4GLOA 3EFHA 2Z09A 2MYTA 3QP9A 2WWTA 5GV8A 2QA5A 2IOFA 3R09A 2V96A 5LJLA 2BMVA 1NG9A 2RJNA 4BV8A 5FBLB 2VRCA 3AGQA 2FR8A 1ZAYA 3JR7A 3DZJA 2YCBA 1QTRA 2JFNA 2FKAA 3DXYA 2EWMA 2FPOA 1XKTA 4WZBE 2IUTA 4MVJH 4MWBA 5IH7A 4ND3A 1CEYA 3E7PA 3TCKA 4L57A 4L0CA 1JEEA 1P8JA 4B46A 5U9CA 1HT0A 1QP7A 2G5GX 4CG3A 5EJ9A 1MAWA 2JLAA 1Y8QA 2B6HA 2CJWB 3N2YA 1E92A 3IE1A 3TMAA 1ZQ9A 3VR5H 3IOCA 1BVUA 1TJ5A 4XEUA 2GLTA 2D62A 1COZA 4EUFA 3AVTA 3C6BA 4DKJA 4FGKA 1GUAA 1ZN8A 1FRVA 4F06A 2C04A 1ZL0A 1L8AA 2AMFA 2XVXA 4Q7LA 4M0FA 1CUFA 1T2NA 3OJ0A 4HAIA 1EK2A 3VI3B 5J4KA 3VDRA 3CKYA 1KI9A 3MTIA 4G07A 1P0MA 5DSTA 4A03A 5K0JA 3DMYA 1TYEB 2EKLA 3TOZA 3DDZX 3VU9B 3ANTA 1LU9A 3FDIA 1PT6A 1KKMA 4G0MA 4WADA 5AKGA 5EIBD 1T4GA 4G1UC 2NPIA 1E1MA 4I46A 4LDNA 2BELA 1SXJB 1LNQA 3VSAA 4J1TC 4C89A 4JR2A 4ISCA 4S12A 3K0FB 1SM4A 3FYUA 4CIWA 2F3QA 3LUGA 4QYWA 4CETA 3N0VA 1GQFA 3CBGA 3ZHCA 1YGPA 4EGSA 1VJ5A 1NASA 1QAQA 5CFMA 1FUYB 1U7WA 1QTIA 4BO7A 4BZPA 2ZOSA 3E2IA 4IH1A 3TF5A 1BE1A 2EF1A 3H5WA 3DLAA 4GXQA 4PZDA 4UDXX 3PFIA 4UARA 1J22A 1DDIA 1UWLA 5COAA 3ZE9A 4JSYA 2PIAA 4I36A 4RZQA 5JEDA 1ZSVA 5E6SB 1YZUA 1OUMA 1QDUA 1DLIA 2A1UB 3OCWA 1V4NA 5LQSA 5ALQA 2FFRA 1OB2A 4IIEA 2GCNA 1Q20A 4RC9A 3G0OA 5LU9A 3DUWA 5DH9A 1CNEA 2I71A 1DAGA 2GNPA 3T1NA 4HAXA 5AUOB 1U0BB 2PH1A 3WFIA 5EHXA 3PEUA 2MR5A 4YP5A 4FDVA 3OTHA 1OOEA 1Z7WA 4D9NA 1BTOA 3RC2A 3UJAA 1GRQA 4F5DA 4JLUA 1MNAA 1TGVA 4L08A 4RW0A 1VE9A 2CDBA 2JAPA 1FQOA 5I9LA 1VB3A 2FOIA 4JODA 4J0IA 4PQEA 3T5BA 4ZDJA 3MJ4A 1GPBA 1CRQA 3OF3A 2H16A 1GFZA 4GRIA 2YYYA 4P93A 1R0RE 1WBBA 2REQA 4J75A 1A4UA 1ZK2A 4HRVA 1GNLA 3FI0A 4KGDA 4R2IA 2IXEA 3BXPA 1N6IA 2KBFA 4R98A 5EHQA 1QORA 3L4JA 2Q29A 3L40A 2WD8A 4HRXA 4EKNB 1NY5A 4ZDKA 4QJIA 4B3SB 3WKDA 2VJOA 3H2JA 3RFVA 3H0KA 3ESYA 2E4AA 4C87A 5JJCA 3KK0A 4GWKA 3DOEA 2PUBA 5ILGA 1MC5A 4QAJA 5J2UB 1YB2A 2FUG1 2OO3A 3G8BA 1ZM3A 2PTGA 1BROA 1RYZA 1O57A 3JD1A 3ZWYA 4PPNA 4CU2A 3H13A 4IV8A 2A59A 4R8KA 3SBOA 2FVYA 2CNLA 3ZOKA 4A8JA 4EQ6A 5LMNB 1RVDA 1XJ0A 1GCAA 5C8XA 1CRPA 1FMJA 4RTOA 2YY6A 1QC5B 3L4EA 5HP4A 4H7DA 1QRTA 3RK1A 4AUNA 1ZJJA 2DPMA 2FMKA 3SM3A 3TECE 1PUIA 5HFAA 3THOA 2H31A 2GKSA 3GGCA 1GRCA 5BV8A 3GEGA 2BEWB 4YMTA 4QZVA 2MINA 4MVYA 4V3CA 1IYZA 3ROFA 5TQ2B 4GI1A 2WIBA 2BTQB 4RKEA 1F1JA 3GRKA 3X1WA 1XTBA 5LZ7A 2IEGA 3NAGA 1PRYA 2CMDA 3G2OA 5FTNA 1G16A 1F8YA 2J3IA 3S6JA 4U0KA 2PH3A 1H65A 3MRXA 4MGKR 3W2HA 1BMTA 5IJ0B 2AFIA 3I4FA 5BP7A 13PKA 1GGEA 1JKIA 4S1VA 5JZOA 2ZE8A 1M73E 5T57A 2JH9A 5AVJA 3V2UA 4KQKA 2HA6A 1N8TA 2B4TO 1BX3A 4JXZA 3LAWA 4RLSA 1R4MA 1VKNA 1HX7A 4QQ8A 5DM2A 4OCZA 5B58C 5GTDA 1P74A 3A11A 3I2FA 1YQQA 1AF4A 2WEKA 1U8XX 4Y9RA 2ILTA 1OFUX 1IRXA 3C45A 2O7QA 1N6RA 4QU8A 3CIFA 2DJIA 3QVLA 5DHFA 4NJEA 2O59A 4GDFA 1OYOA 1RQ2A 3A3OA 3F9IA 1J33A 4UDNA 2XUAA 3DZKA 1BHO1 5JHGB 1BGWA 3BJEA 4GNKA 2NADA 4UHBA 4WI1A 1ACMA 1YMQA 3C3BA 5EEGA 3MLBA 3GT0A 4Z8YA 5B1HA 3S44A 1G291 1WXHA 4AIIA 3IKLA 3T99A 5JFGA 4BZZA 4A0GA 1J8VA 3QEJA 1RI3A 2GSDA 4O4HF 4P86A 5A3QA 2A5JA 4AUMA 1V1MA 4TLBA 1SR8A 1YJAA 2XBLA 3A10A 5DCLA 5A6SB 4L7VA 1MJGA 2CV2A 1A8PA 4GL4A 3EZXA 4KE8A 3AIKA 4D98A 1Z39A 4N5LA 1YVPA 2OPHA 2HUNA 1THMA 1G6OA 4M49A 5A0VA 3IE0A 4AQ7A 4FYJA 2BBWA 4G1FA 4GFDA 3WIDA 1YS9A 3VTAA 2JLRA 1M1YE 1TLFA 3QXXA 4Q1BA 4OYYA 4GW3A 1TZJA 2Q7XA 4A6PA 2ZRPA 1GPH1 3AUYA 4J7XA 1ZA1A 2MSKA 4XCVA 4G1VA 3U40A 1KAOA 4Q1EA 1DRUA 3MHPA 1FS4A 3PNPA 1NF9A 1UMBA 1AKWA 2QPOA 3O4JA 1MF7A 5F12A 2FK8A 2FMXA 1EXWA 1ZHFA 2QY9A 3NXKA 3TVYA 4CMGA 3AR5A 4IAOA 3GGPA 4IVNA 4H1WA 1DWQA 2IPLA 1IZ7A 3FVWA 2D7JA 2R85A 2YRFA 3SEZA 5FWAA 2P8SA 3DV2A 2EDCA 1XKLA 4P1ZA 3NRCA 3UWOA 4GNRA 1NC3A 5FT9A 1YZQA 4DQVA 2Z2KA 5DSZA 3L1KA 4C06A 3ANYB 4E6PA 3GLQA 4DEXA 3PJEA 3OLZA 5EHZA 4ZOBA 1XTIA 3TRHA 3BYZA 5D00A 3QU4A 4JKIA 3W6PA 4CLOB 3BMNA 3V00A 2F9LA 1IBRA 1FRFS 5SYNA 3GWGA 1T4CA 2NX2A 4A23A 1LKZA 1ZESA 2FW0A 1WEKA 3OZRA 1RMQA 1S3IA 3OKAA 4TZ0A 4RKQA 2UUAB 2AG8A 3DDHA 3QJ5A 4XWWA 1S2LA 4Q05A 3MCVA 5BWOA 4QA9A 1IN7A 2QLJA 1LDBA 1Z0ZA 3K6RA 5K0FA 2EOAA 2B2NA 3EFOA 3GD5A 4IGEA 4KO2S 5ITZA 1N2XA 1DGQA 2FRXA 2GPNA 3HPRA 4FD2A 1QGYA 5CEFA 3L1JA 2HRCA 4M89A 1BKDR 1OIXA 4LWZA 1X80B 4GUDA 3RVLA 2EBHX 7MHTA 1SBNE 1IQUA 3ZTTA 2HMUA 3IDFA 5DBHX 2WT4A 4FOOA 3JQ9C 1HQCA 4FWIB 5BYJA 3WJ1A 1G3MA 4IQ4A 1CR6A 2RI0A 1Z56C 3UW3A 1EGVB 4BVHA 1DAOA 2Z9DA 4MLZA 3VV2A 2RC5A 1V0JA 2OB2A 2ZBGA 2XJ4A 4O2BF 1CVLA 3OO0A 1QP0A 2VBGA 4QG3A 5B58T 2JNWA 2CLLB 2NZWA 4O25A 1CR4A 4MNTA 3ZN2A 4KPEC 1J0BA 1SIOA 3TZ6A 2GRUA 3FYCA 3HEAA 4GUAA 3SK0A 4KAXA 1P0IA 3L0ZA 3H11A 4GP7A 4RADA 4ZHSA 2QLFA 4Z3OA 1I5EA 5FUQA 3NNSA 4R1LA 1N2SA 2G9QA 3MRVA 1TLTA 1UJCA 3R7BA 1KSJA 3HN2A 4NOJA 4B83A 4G1MB 4MRAA 4DADA 3GVPA 3T5PA 1WBDA 1NATA 3G0DA 3LX5A 4N03A 4P4NA 4QTTB 4TUYF 1V2HE 4CLRA 5F7XA 2QZ9A 3PCTA 3QVUA 2VDVE 1J56A 4LJ4A 4W5TA 2ZUEA 3TRJA 2O57A 3RYCA 3IIEA 4DUGD 4FEYA 3ZDZB 3EOZA 1SKUA 1GCOA 1W0CA 3EISA 2JFFA 3EW9A 3O1IC 2Z1NA 1IEWA 2P1ZA 2P2GA 3QFRA 4HYQA 5T3YA 3HXOA 4PV7A 1XRNA 5FB3A 3FHCB 4KBGA 2V3CC 1ADYA 2JLSA 1N8SA 3HDQA 2HRDA 3T5GA 1Z63A 1UFVA 5KZMB 4JV5B 4BTEA 4UHJA 2V0GA 4UPDA 1CZKA 1E9AA 4TMVA 1OU0A 2YFQA 2ZTMA 4QYTA 5AD1A 3MMXA 2PD3A 1CYDA 3QMVA 3TNFA 1O54A 1DLJA 3I01M 4P4GA 3C3KA 4DCOA 5A04A 4N3BA 4ZOCA 1QPGA 4FIZA 1T5HX 4GZ3A 4R7GA 1CJTC 1G4AE 1NF3A 1U7DA 2LDXA 3LUAA 2OAEA 4Q24A 3VR6D 3ETCA 4TTTS 3CINA 5M2QA 4NE7A 1XNRB 4LZWA 3B1ZA 4QNMA 2QUHA 4LQDA 1Y4ZA 4YRIA 5ABPA 1YQDA 3ZHZA 4IDNA 3K6SB 1FUIA 2H1SA 3LCJA 3BM5A 4PZPA 2QM3A 4C4XA 2PMKA 5LCXA 2ZCJA 4YACA 3LFUA 3WK5A 3SSOA 1ADJA 5H68A 3RBVA 4FKZA 2YFHA 3AK4A 5C5DA 1E1NA 2CY0A 2MDTA 1E77A 1KBZA 4BQPA 3DG9A 1N5JA 4LUCA 3UIEA 3AIOA 4XWGA 1A5SB 4K87A 1ZGHA 5BRNA 3NBFA 3OQOA 4XGRA 3ZWVA 4N5HX 3H4TA 3H87A 4MVJE 4C20A 5K8LA 1LQ2A 5GONF 5TVKA 3CNNA 3SLKA 5IM4A 3ORYA 2G08A 2CF6A 3ILXA 4KNYA 3AUAA 4HYEA 1J20A 3I5AA 3IBYA 2WILA 3MPUA 4XUGB 1Z5UA 1WBJB 1CY0A 4UUNA 2Z2YA 1LPOA 3DM9B 1JHXA 3EF1A 3QWHA 1GG2A 2ENWA 2X19A 3OD1A 1FDTA 5AUQA 2IFTA 2O48X 5BRAA 1Z6YA 2C5SA 3P9YA 4P08A 5B53A 5KC9A 5FEMA 2QAIA 3N8DA 4Y2RA 3O4FA 5H3LA 5BR4A 5JPDA 4JUCA 5E8JA 1RXSA 1U80A 4EZBA 3NIFB 2D1FA 3K7EA 4JJZA 4HVAA 4MW9A 3X1XA 4RFLA 1YUNA 1YQ9A 2XNDA 4JOSA 4Y3UA 1OZGA 2GPAA 3IPCA 5FOVA 1I0IA 2QQ0A 4D0NA 4PTZA 1ZWLA 1C8BA 3QWAA 4GMDA 4HEHA 4Y2VA 5EIEA 3VPFA 2V9PA 3OAAA 3OOSA 3C85A 4MYHA 2CL5A 4X64B 1CEXA 4MCIA 2AN9A 3HE3A 4A1OA 1L1RA 1T25A 1YZKA 2YXPX 4Q1VA 1GZUA 2XKBA 4Q37A 1JPJA 2B1GA 3GQBB 4NZMA 3GLRA 4UBLA 3MMZA 3HM2A 1ORRA 3ZE7A 1FLNA 1RPNA 4L0QA 1R0SA 4HKTA 5DLDA 5IULC 2Q6LA 4DRYA 3OLCX 1F4LA 4O4LB 1II0A 4D1YA 2EX0A 3QSYA 3WHPA 4WUTA 3SVLA 1SUPA 3GCWA 3HRIA 2B82A 5EPOA 2VWGA 1BDHA 3KOYA 4K6HA 4LSWA 2ST1A 3DAOA 3OSUA 1Z06A 4M21A 5LZ2A 4KTTE 2HJ9A 2XA1A 5ECYA 1NJ5A 1MHTA 3JQ7A 1SK8A 5EAIA 5F78A 2JZNA 3AEKA 4YROA 3VUEA 2HCRA 2RGBA 4CEIA 3UXHA 2DR2A 4Q9IA 2JIZA 3I2HA 1KTIA 1M8KA 1DWPA 2CSUA 3B6KA 4UMVA 2ON6A 4RK5A 4A9AA 4JUDX 1MZVA 1M2WA 1R5NA 2IOFK 2JVKA 3EJ6A 3GROA 3NETA 4NENB 1RLJA 1OC2A 2O0KA 2B9EA 3KQKA 1U2GC 3OQHA 4H0FA 3A0RB 2YOGA 3ZJYA 5C7IO 2ZVJA 5B4UA 5E4JA 3QY0A 4LSZA 3LK7A 2G5TA 5C46F 4E4RA 5DHPA 3ROKA 3IXLA 3UO8B 3R9XA 4KXFB 3CZAA 1C3JA 3TZBA 3RKRA 2HYIC 2FV8A 5MFPA 1A9RA 1ZAKA 3V48A 1HEUA 2AE2A 4NBLA 4BIMA 1CQIA 1CYEA 2B30A 3WTCA 1OBOA 3MIZA 3OFSA 1S4QA 2AOTB 4JJ7A 4ZYLA 2I7VA 5ECWA 2ZRIA 5CJJA 1VDZA 4LYEA 4MW1A 2GTHA 4CMIA 5I7AA 4BV9A 3RVOA 4BJ6A 2ODBA 3KTFA 1A9TA 3CVJA 3ZHUA 3BJMA 2XB9A 1HORA 2XF8A 2ZYDA 2VJNA 3VMFA 4AJ2A 4ND7A 4RLQA 2W0MA 4KBFA 2HDWA 3ONNA 1U2TA 2GNOA 2J5BA 2BSAA 3IBTA 1LC3A 1OX4A 4LZAA 1M83A 2OE2A 5CBPB 4WXMA 3GCXA 4B6OA 2WINI 2AD5A 2DTDA 3QENA 4QUAA 3HZRA 4F5EA 3CEJA 4P4SB 3RQSA 2A67A 1L0BA 3F7OA 2XIQA 3OZUA 5EP1A 1WDTA 4BE7B 4EG8A 3JAWB 2VL7A 5JTTA 1NFQA 3EW7A 1GQYA 4CPDA 2B4AA 3ZZUA 2JGKA 4KR6A 3SIRA 1XDGA 4AQDA 4ETIA 3UAWA 1TKBA 4RLHA 1XEWY 1RVV1 4CXMA 1JG2A 4R5HA 4ZVRA 1XMIA 2G9UA 1V1RB 3WHKA 3SDZA 4ZI2A 3BULA 5AK3A 4DMMA 7MDHA 5DX8A 3IAUA 2P6OA 3NOQA 5J4VA 4RFVA 2HN9A 4WZBB 5C31A 4FUQA 1GKUB 2YZKA 3AEUB 3DBLB 2B78A 3DKPA 3COVA 3PGVA 4WSOA 2GEKA 4XSHA 2FUG6 4OHMA 1VZ3A 1FQWA 2HF8A 4QEZA 1CJKC 2CCKA 4NARA 4TKMA 4BQNA 2FEKA 5F7OA 3WLNA 4DUZB 1L2TA 1V5IA 4M8NE 4DSOA 3ERCA 4ZVVA 3CXRA 3PGKA 1I4TD 2IHUA 1JPUA 3SF8B 4W63A 2WY2D 5ALZA 4CW7A 1WA5A 4DLLA 1GQQA 4DLPA 2ZSJA 1IULA 2IOQA 1FNMA 2NU8B 4RJLA 4CUKA 3FW1A 5KYWB 1MENA 3KUKA 3HN7A 5TLSA 2Y68A 5C7YA 2CXRA 1HLGA 1Z8HA 2ZZKA 5A4MS 4R2LA 3HRHA 3KZNA 2AQIA 2XCRB 2R25B 1HFKA 2BDEA 4JJ4A 4ZU1X 5KHOC 3EPRA 1DX9A 1VB5A 1WMSA 3F5QA 1V8DA 2WDPA 5CG1A 5L3SB 4P58A 2EQAA 3EXEA 5I7RA 1Q7TA 1YGYA 5BQ5A 3SSAA 1Y34E 5BR7A 5B64A 3Q5GA 5JAOA 3ONFA 2A1TS 4K9PA 4DDHA 1GGVA 1VHDA 1KMIY 1FFYA 3DCYA 1RAHA 2V6MA 4HDMB 2I6SA 2O0MA 3TOSA 1NVGA 3R3VA 4DCNA 4AJLA 4L7QA 4RZSA 1G6KA 4Z7QB 1GCIA 2UZ0A 1J8QA 2O7SA 2VTBA 1X8JA 1LCIA 4U1RA 3D5QA 4ZRMA 3QRWA 1E61A 3RIEA 3CKMA 4RGBA 5LOVA 3QKUA 4BC1A 4BQOA 4ZK6A 5PNTA 4R0VA 1ZFNA 3R7SA 3JQ6A 1Y8QB 1P7VA 4KIGA 1T1SA 2CD9A 2VP2A 2BP7B 3DCJA 3HCNA 1DTEA 1P18A 2FPIB 3NWJA 3G9TA 4ILEA 1CEEA 1GZSA 1NN5A 1VMAA 1Z6GA 2EJBA 1GSHA 2WFAA 3BUSA 4X0EA 1VA4A 5DNCA 3PTAA 4Y2YA 2BOVA 2EJTA 1R74A 2P0YA 2FSHA 3D7NA 3GX1A 5J5VA 3KHUA 2RGUA 3OC0A 2Q5LA 1YOBA 1VSBA 4XEHA 2WYWA 3LY8A 4IDGA 3H5RA 1DO2A 2HH9A 5BXQC 2GS9A 1GZ4A 2AMYA 2IEAA 4YRCA 2YX1A 4L07A 1HE8B 3IMEA 2EFEB 3Q11A 3RC9A 3RRZA 2B8JA 1T36A 3CUEF 4CCSA 1OMOA 2PGJA 1NJ8A 1JNXX 1XTKA 4HQ0A 3MT0A 4MWTA 4ESEA 3RSCA 3CUVA 4GPAA 1JDVA 2ZBQA 4HDAA 3R9KA 1CZNA 2E87A 3N2KA 1GXSB 3HJTA 1TX4B 4WK6A 3TJMA 3EEOA 1C9EA 3E9RA 3BREA 1RBMA 4RD4A 4F4DA 1U7HA 1H94A 3DJFA 3GV0A 2AG6A 3QE2A 2DWOA 1SG0A 2QMQA 1T0HB 5E2IA 3VR1A 1IMOA 4UVHA 3BIWA 3PYMA 1ISGA 1E9CA 2D1TA 2ECQA 4S2UA 3S7ZA 2ZM6B 1IXRC 5AW7A 1VKHA 4WY5A 1E3IA 1KYTA 1Q11A 5HTKA 3W6OA 1H5QA 2WYIA 2QLLA 4NX2A 2CFOA 4O4HB 5FH9A 1SD2A 1J2UA 4ZO4A 1I5OA 1LPBB 1U31A 3AKCA 3Q10A 4PZ9A 2I66A 4GE3A 4HGPA 2Q3CA 5BURA 3OOEA 2H3EA 1EHYA 1V5WA 3PCXA 3O2JA 4CM6A 4CRWB 2J46A 1CUGA 2GNAA 5CYOA 5A5VA 2Q3DA 3DMDA 1FP6A 1UPAA 1VKJA 4PVDA 4AZ3B 5JADA 2IQ5A 1GILA 4ZGBA 3JAMA 2YWBA 3DXFA 1WVIA 1X15A 1MIHA 2ZRGA 3SC6A 3VNRA 4D4MA 1SQ6A 2BFNA 4W82A 1DTWA 4REMA 1NE7A 1PEYA 3VDQA 3KVVA 4JLAA 2XQJA 5LYJA 3GCZA 2QY6A 4RD1A 3RRMA 4J90A 3MT7A 2BGRA 4IUYA 4BO9A 1RKQA 1DFGA 2Z08A 1Z6ZA 3SHFA 3LYUA 4Y18A 5JD5A 4HWRA 4BVKA 3GXBA 3OZGA 3KOZA 2BCJQ 3UMBA 1WTCA 2XMPA 1DUIA 3VOAA 4NEQA 2X8BA 2GJAA 3BSFA 3G1WA 2JASA 3GZTB 3K8ZA 4XUDA 4URXR 4LKRA 4UULA 4DR3B 1MBZA 1W96A 2CUNA 2XZTA 3Q7PA 4W9NA 2ADOA 5BSTA 2OHFA 3KXKA 2DKNA 4WLVA 2LDBA 2DM6A 2YNMC 3LDHA 4TMXA 2NVUB 3OE4A 3S28A 3MWJA 2FEOA 2JLYA 1NM5A 1C81A 1C30B 1USIA 3FX2A 3FUCA 3LLSA 4PAMA 4RHTA 4WZAE 1BC5A 1Y7PA 2RB5A 3BILA 2E7ZA 5BNFA 2C2WA 4GLJA 4ALMA 1HE5A 4PR0A 3R3JA 2HADA 4JUBA 1E2LA 1NRIA 2DHDA 3SQWA 1AKMA 1CY6A 3V2GA 3VZCA 3A26A 3VYTB 1PGNA 5FWNA 5LL6P 1SURA 1Y7TA 5TVGA 4YV0A 2PL3A 2EW8A 5L3QA 3OTOB 1E1QD 4HLUC 4KSYA 1KQNA 3SIWA 5F9HA 1ZU5A 3QMMA 1UUFA 2RI6A 4BO1A 2R1VA 4UTXA 4YUAA 3U3ZA 2EGGA 4OJTA 2Q7DA 5B6IA 3RGWS 3I9OA 1UK8A 3FCEA 3QLVA 2PA3A 5KYYB 1P73A 2OHOA 1SKBA 3JYHA 3FYHA 4XH9B 1OI3A 4RV4A 3IE2A 3GJRA 1R50A 2XYGA 5EQJB 3WIOA 4DLVA 1JLRA 4RQUA 3KR0A 1AJEA 1U3WA 3BHJA 2XB2A 2IU4A 3KSRA 1VCHA 3COYA 3PEEA 2WP0A 1M7HA 4QVIA 4WRRA 2A4KA 4AY3A 1OTXA 4TKUA 4OBBA 2JLVA 3GJTA 1G2PA 3TB4A 1RLIA 4BWFB 4MTLA 3CZCA 2IYXA 1GTJ1 1WSBA 2AEFA 1C0PA 1RI1A 1Z33A 5DXJA 4F4UA 1VL8A 3GP5A 3QPDA 3TKLA 5CG2A 3INGA 2QTLA 4WBNF 1UOPA 2VDLB 4KXNA 3USCS 3D6UA 1JFSA 4EX7A 3A4IA 1X3SA 4JZKA 4RDXA 5HUJA 2P9YA 2TS1A 2DUMA 3IDZA 1QZTA 2Q6TA 1B1AA 4QARA 1W1IA 5KYNA 5DIZA 1QYCA 4DMLA 1Y1TA 3OP4A 3PWKA 2WJ6A 4US1R 4ZIRB 3L4BC 2CHFA 1T0IA 4B85A 1A4RA 3OPYA