2XMQA

Crystal structure of human ndrg2 protein provides insight into its role as a tumor suppressor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
281
structure length
281
Chain Sequence
AKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIENYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN NDRG2
publication title Crystal Structure of Human Ndrg2 Protein Provides Insight Into its Role as a Tumor Suppressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 89
structure length 281
sequence length 281
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03096 Ndr Ndr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xmqA00
2JGFA 3WL8A 1WPRA 3YASA 2QUAA 3AFIA 1QO9A 1SCKA 3LCRA 4Q3LA 3HLKA 4W1QA 3V1LA 3W06A 5AKKA 4BAUA 5DLPA 2BFNA 3WJ1A 1IZ8A 4Q3KA 1BEZA 5BOVA 1UT6A 1ZD5A 2XMSA 3AZQA 5ALJA 3K9BA 3H18A 2OAGA 1QIMA 1XKTA 1XZHA 5ALOA 3A2MA 5AOBA 3D4LA 1GXSA 1T4MA 3R41A 1UK6A 4H77A 4RNCA 5ALWA 5EHQA 1UZAA 3M3DA 4UHHA 1BCRA 3ZI7A 2ROQA 1MNAA 2WTMA 3FWHA 3G02A 4UHCA 2RI6A 2C0QA 3V1NA 4GLBA 1CUIA 4AX4A 3FNBA 4BB0A 4B83A 5ALLA 3EF3A 3QBJA 3JWEA 3C6XA 2VSQA 4ZV7A 1LBSA 3DNMA 3R3UA 3WWOA 4HS9A 5JD5A 1CUXA 3G0GA 4WFJA 2WTNA 2GZSA 1JU3A 3G0BA 4JNCA 5HF6A 5ALPA 3K6KA 1MAHA 2ES4A 3A2NA 5CW2A 1QIFA 4OB8A 5EHNA 3C70A 1AZWA 5JANA 4RE6A 1CUUA 4JEIA 1IZ7A 3PF9A 3WQHA 5C8VA 5ALSA 1ZD3A 3PUHA 1LBTA 4BCBA 2PSDA 3AIMA 4V2IA 3AIKA 1AQLA 5ALFA 2O7RA 5AM4A 2DSNA 1ZIXA 1XZEA 4U2EA 1CPYA 4B0PA 4DYHA 4XWGA 4CIAA 5YASA 2X8BA 2XMRA 2XUAA 3KWFA 5JAUA 1M33A 4DSZA 1XZCA 2O2HA 3FLBA 3QMVA 5A7HA 4AQDA 5E4TA 4NMWA 1KU6A 1XZKA 5EFZA 1E66A 1TAHA 5AKGA 2Z8ZA 4GEGA 3L1IA 3FCYA 3GA7A 3V1MA 1XZFA 4Q82A 1ZGBA 4LXIA 3KDAA 1XZBA 2WILA 3HEAA 1ODCA 4ZXFA 2J4FA 2HHAA 1E8MA 1CUWA 3I2FA 1UFOA 5CRIA 4IHAA 3CN7A 4FFVA 1GKKA 1XRRA 4ZRDA 4MJ3A 1PFQA 1XFDA 2FX5A 5FV4A 2HA4A 1N5RA 1LPNA 2CJPA 4CIBA 5KWJA 5AM1A 4DMFA 2GBGA 5EHZA 3WK8A 3WI7A 2DR0A 3B3QA 3D59A 5T4HA 2QMQA 1RWQA 3ZLTA 1UWCA 3GELA 4MYDA 5HFAA 3QVMA 3FYUC 2VAXA 3R3WA 5ALZA 2ZJ7A 1BROA 5ALDA 1HBJA 1AUOA 1EK1A 2XUKA 4FHZA 5AKXA 2WIKA 1BU8A 3ZPXA 5HQ3A 5FLKA 1N8SA 2Y2UA 2QJRA 1FSSA 2ONCA 5JAHA 5JZBA 2C5GA 3NUZA 1QIGA 3UUEA 4X6UA 4BTVA 1P0PA 2C7BA 3ESAA 3AILA 4OB7A 2Q0XA 1HL7A 3X3HA 2PSHA 4AO8A 4O08A 1BEEA 1XZGA 2JBWA 3BF7A 1GZ7A 1DX4A 3OC0A 3WA7A 3O9MA 3JYHA 4BDTA 1UK7A 4N8DA 5J3JA 4W63A 3RLIA 4IH1A 2OGTA 3I28A 1ACJA 5ALXA 1KU0A 3DDUA 4Y2QA 3WL5A 4B81A 1ZICA 4BVJA 4H0CA 4U2FA 4QNNA 5JAPA 5AM2A 5IVDA 4B80A 2B61A 5LZ9A 4G8DA 4ZI5A 3K2IA 2PSEA 2XQFA 1Q83A 5CT8A 3FLEA 5AOAA 2X76A 5AKIA 2WUGA 4BZZA 4GECA 4DMHA 3QMMA 1HDEA 1CUHA 4YPVA 5ALYA 2C4HA 4FLFA 2CMFA 4OU5A 4UBMA 1LZKA 1X70A 5JARA 2WHPA 4BC0A 3DCNA 1CQZA 3QM1A 3IURA 4H7FA 5AK6A 2OCKA 1MO2A 3DJYA 1S8OA 5A62A 1K63A 4RGYA 3WL7A 4B0OA 3H04A 2V98A 3H17A 2PVSA 1LPBB 4OPMA 5FRDA 2OXEA 1K6EA 4BYMA 4X71A 2JGMA 1QGED 2JIDA 4B85A 1H22A 2AJBA 1DWOA 5JD6A 5AHXA 3ANTA 4Q05A 4FTWA 2WU4A 3QZUA 4ZGBA 4C87A 3E4DA 4NZZA 2Y6VA 2DCMA 5K3FB 2WQZA 3KXPA 3ESBA 2WFLA 2PU5A 3BJRA 2PUJA 3FYUB 2XMZA 3C45A 3OTQA 2WFZA 4GBGA 2HA5A 2G63A 3DOHA 3TRDA 2DHEA 5CTAA 4QEKA 4IH4A 4UUQA 2DHCA 1XQXA 3V1KA 5JAOA 1EK2A 5I7UA 3WK6A 4H18A 1QTIA 2FUKA 2C58A 3G0DA 4J0KA 3VISA 1QTRA 4UBOA 2GYVA 3G0IA 4U2CA 4XX1A 4CG1A 3DEAA 4YX9A 1ZOIA 5CXUA 2D0DA 1BCSA 1QIHA 1XLVA 4NS4A 1Y7IA 2VQ6A 2ZSIA 3D2BA 1MX5A 4MEBA 4ITVA 2VJAA 4L9AA 1MAAA 5AKZA 3CN9A 5HZGA 3DKKA 3QPCA 1JJBA 2OG1A 4BP8A 4C89A 5LYYA 2V96A 2WHRA 1VOTA 3WKAA 5DWDA 1R50A 3PICA 1HQDA 3AJAA 3AIOA 1MT3A 4C6HA 4KE7A 4IO0A 4H7HA 1ISPA 3H2GA 4YK7A 4DIUA 3G9TA 5AIAA 5CMLA 2XLBA 3RKSA 4JYMA 4MXDA 2I3ZA 1YA4A 1F6WA 3IB3A 1G42A 5K3EA 2XMGA 5CT9A 2QXTA 2JEZA 1JFRA 1UK9A 4FNGA 5AJHA 4J0GA 1Y7HA 2V9ZA 3KWJA 2WUEA 4TGLA 3W04A 1UK8A 3CCBA 4G9EA 2VTVA 5AM5A 3NWOA 5ALUA 3WK5A 3FYTA 1YASA 3ED1A 4UFPA 4KE8A 3VVMA 4M0FA 3O4IA 2WSLA 3W9BA 3HYSA 5FOQA 1A8UA 4H35A 1WCYA 5A71A 1G66A 5HFNA 1IMJA 4WDQA 1YB7A 4C01A 4QDUA 4BRSA 4BZWA 4AMZA 1CUCA 4P9NA 3LLCA 4KAAA 1MU0A 3ICWA 4WFKA 4W1RA 3R3VA 1W6RA 1P0QA 3VDXA 4FBLA 3C43A 2HA0A 4UHEA 4Q34A 3A2LA 3WMRA 3H0CA 1CVLA 4FNMA 2I3DA 3I1IA 2HADA 4Y2RA 1LPSA 5FDFA 3F8SA 5CH8A 3QMWA 5C8XA 2XT0A 3R40A 1WM1A 3T52A 5D3ZA 4ARBA 1SCQA 2CEKA 5DTJA 4JUIA 2OCIA 3M83A 1TRHA 2D5LA 1AURA 4UHDA 2Y1KA 3DLTA 3D2CA 4H7IA 3VXKA 1CUBA 3MUNA 2HM7A 4DMKA 1XRPA 1QIKA 4E11A 3ANSA 4B82A 3FOBA 2QOEA 3STTA 4PNZA 1XRLA 5AI0A 3PFCA 4XIIA 2Z8XA 2VEOA 4FMPA 3BF8A 3FBWA 3VJMA 1EI9A 1ZI6A 3HABA 3WJ2A 4HZGA 3Q8WA 4WY5A 4FBMA 1L7AA 1CUFA 5E4JA 5IVHA 1TCAA 2LIPA 5DNVA 1DWPA 3UMJA 5ALVA 4X85A 4AZ0A 1JJFA 3SX4A 3WK7A 5IH7A 2XUHA 3F67A 3M81A 5JD4A 5FPQA 1Q0RA 1XQVA 1EH5A 1A7UA 3WK9A 4Z49A 3V9AA 4G8CA 3PI6A 1EXWA 4DNOA 2CKMA 3STYA 4EY6A 4DMCA 4EY7A 1VE7A 2PL5A 4BATA 1D07A 4AN0A 5SYNA 1WB5A 2VT7A 1LPOA 2GYUA 4PQEA 5CXXA 1W4LA 4FLMA 1THTA 1E8NA 1EVQA 4B84A 1GPLA 3ICVA 4B9AA 5EIHA 2OGZA 5T4FA 2BGNA 5JATA 1QLWA 3STVA 1PV1A 1QIDA 4X97A 3HACA 1J2EA 1GGVA 5AI6A 1VXRA 1ZD4A 4N8SA 1VZ3A 2OQVA 1VE6A 2AJ8A 2J3DA 3HJUA 5C8ZA 3AZOA 4HXEB 1SOMA 3VVLA 2WFMA 5AKJA 3G7NA 3U1TA 5I8PA 2XQJA 5C81A 3DD5A 5DYWA 1DWQA 1CUDA 5HK8A 2WLSA 1HPLA 1YCDA 1U4NA 3D0KA 1Q84A 5ALIA 4EY5A 3SK0A 3H19A 1QE3A 4Q3OA 1LZLA 4H7DA 4PSDA 2B20A 2JGKA 4QZVA 2K2QB 3PFBA 3AZPA 5E4YA 2Z3WA 3R3XA 4Y2XA 1XLUA 1YAJA 2YXPX 2QZPA 3TEJA 5HQ3B 3NOXA 2DHDA 3I6MA 4G1FA 3DL7A 3FSGA 3KD2A 3A6ZA 5LP1A 1Y37A 2WKWA 5AIBA 3QPAA 2R8BA 4G5XA 4ZV9A 4K2AA 1P0MA 5AM3A 5FP0A 1K5PA 1LPMA 2GBFA 3PUIA 2BKLA 4G9GA 1CEXA 4NVRA 1EB8A 3BDVA 3UUFA 3SC2A 1MNQA 4OB6A 5LZ8A 1MPXA 1XKLA 2XDWA 1CUVA 4J0CA 5A7FA 2JGEA 1GPNA 2WJ3A 3I2KA 4FOLA 4G4GA 5AK5A 3C6BA 2ZVDA 4QE3A 4UHFA 2GBIA 4J0IA 2QKYA 2CZQA 5A2GA 4KYVA 1J06A 3LS2A 2PX6A 1XZIA 4H7KA 4P93A 1TCCA 4P08A 2I78A 2XUFA 1F8UA 2OCGA 1VJ5A 3FVRA 3HI4A 1VZ2A 1QIEA 1GPKA 1W52X 2JF0A 4BCDA 4WJLA 4FDMA 2XUJA 1J07A 1CR6A 3WL6A 3IA2A 4L3WA 2I03A 1VXOA 3QH4A 1FFAA 5AKEA 5KBYA 4P92A 1T2NA 2XQKA 4TPKA 1ZI8A 2WHPB 5EI5A 3MVEA 4X3CA 1ZIYA 4ARAA 4BVKA 4QDOA 1C4XA 2ACEA 1JMKC 1U65A 2QRUA 2PSJA 2CBGA 2BGRA 5T4BA 1F0NA 4FWBA 5JZ9A 2XQIA 4BBZA 2ORYA 3E0XA 2QS9A 1ETHA 4BE9A 5AK3A 1PJAA 2XUGA 1EX9A 3AUKA 3FSGD 3C5WP 4UBNA 2YH2A 4GW3A 1DX6A 1CRLA 4AXBA 1CQWA 1EVEA 4Y2TA 1FFEA 1R3DA 1WPXA 1J1IA 5CH3A 2OPHA 6YASA 2WFLB 3DKRA 1UKCA 3ESDA 4BP9A 1GKLA 5DNWA 1IUPA 3E1GA 4PSUA 4X7BA 4IH9A 3R3ZA 2ZJ6A 4G4IA 5EIAA 4I3FA 2O2IA 4QDZA 1VA5A 4MYSA 5DYYA 3ZLUA 1OXMA 4FFWA 4KJXA 4KR0A 1DQZA 2WG1A 5AH0A 2J4CA 5AKLA 4KACA 3WIOA 3WWPA 4X00A 4IQ4A 3D7RA 3WIBA 1A8SA 5DTIA 4F5ZA 4GI1A 2GBCA 2PBLA 5K3DA 1XROA 4DLNA 2G5TA 1CUYA 4CCYA 1AMNA 4BC1A 1I6WA 3OOSA 2HU5A 4LXHA 4Y2YA 4OD0A 3O0DA 4DNQA 3BIWA 1XQWA 1LLFA 4QWMA 4DNFA 4KE6A 4GXNA 1MTZA 1TKRA 2W22A 5ALRA 2IIVA 1CUJA 3WKDA 2OQIA 3GUUA 4S0XA 4PO3X 3O4GA 1E89A 1H23A 4C4XA 5HF9A 1DU4A 3WLAA 2WJ6A 2RAUA 2XMBA 1WB6A 4BTLA 1GQSA 2BUAA 1TCBA 2JGIA 3C6ZA 3SWWA 3G9XA 1CUSA 1X2EA 4X91A 4GHWA 2Y2VA 3IBTA 4KAJA 1G4HA 1HKHA 1NU6A 5DYTA 2PKYX 2WM2A 1ZD2P 1CUZA 5K3CA 4DNPA 1UOQA 2XLCA 4QWWA 2VJDA 1GT6A 4KAFA 2VF2A 5AP9A 5FKJA 4OSEA 1HLGA 2QUBA 3FCXA 4X95A 5ESRA 4G4JA 1K4YA 4X94A 5ISMA 1FJ2A 4B6GA 3A70A 5AKHA 3I2HA 2R11A 4HXGA 4F0JA 1ACLA 5FUMA 5SYMA 5JADA 2VAVA 2QTBA 2H7CA 3EQ7A 4LXGA 4MQMA 4N8EA 4WFIA 3TJMA 1U2EA 2WG0A 2XUQA 2OAEA 4B7ZA 3M82A 5ALKA 4UFOA 3FLAA 1LPPA 1N5MA 2RIPA 5JASA 1ODSA 5AI5A 1ZJ4A 3VKFA 1XZMA 3WKCA 3DL4A 1QZ3A 2YYSA 4X90A 2JGLA 5CT4A 1FFCA 1Z68A 2QXUA 1WB4A 3ESCA 1THGA 2HRQA 2PUHA 4Y9SA 2X5XA 4BE4A 1XZAA 2Z3ZA 1DTEA 5DNUA 3IUJA 1LNSA 2AJCA 1EINA 2Y6UA 1E8DA 2YASA 4FKBA 5D6OA 5LLSA 4TVKA 1BRTA 2HA6A 2XE4A 1ODTC 1UOPA 2WU3A 2RHTA 1TK3A 1L7QA 3QYJA 3C87A 3W2TA 4N5HX 2BAGA 5AM0A 4I19A 1IVYA 3I2GA 1TIBA 1Q0ZA 3QPDA 3B5EA 1MX1A 2ECFA 2WHQA 5C7YA 3C8DA 2XUPA 4EA6A 2H7XA 5IKXA 1XQYA 3L1JA 3BDIA 4PF1A 3BL8A 4W9RA 4G8BA 1UOOA 4I4CA 3LIPA 2AJLI 4HXFB 4CFSA 1EA5A 3IIIA 2ZYIA 4HAIA 3BIXA 3N2ZB 5LZ2A 2RGUA 4AN1A 5H3HA 3KOOA 1QFMA 3WWDA 2P8SA 1AC5A 3H2IA 5D7BA 2H9YA 5AOCA 2VJBA 5CURA 4HRYA 1CFJA 2XI4A 3I1YA 1XRMA 4CG2A 3G9ZA 2AXEA 5LKAA 3L1HA 1R4ZA 3RARA 4OCZA 2HL6A 3PE6A 3O4JA 3LP5A 5AO9A 2HRRA 1R1DA 2G5PA 4H7EA 3S2ZA 2DFPA 1DT5A 1WOMA 4D9JA 4AB1A 1EDEA 3CCCA 1RP1A 3OURA 3H2KA 4CG3A 3D3NA 3G9UA 5K5EA 4BDSA 3IUMA 5HKAA 4QDTA 1AX9A 1GQRA 5AKYA 3C8HA 1FFBA 4PW0A 4J0JA 3W9UA 5BWCA 2HDWA 4A23A 2DQZA 5AI4A 2HA7A 3HRHA 4HRXA 1QONA 1XZJA 2QT9A 4LYDA 2WIGA 4K6HA 4Y2SA 3WZMA 1DINA 4Y2UA 4F21A 3FAKA 2QVBA 1A88A 3RK4A 4RPCA 2PSFA 4AO6A 1ZJ5A 4U2GA 4K5QA 2QM0A 4WCVA 2G4LA 2EDCA 2WIJA 3CXUA 3O4HA 3N0TA 4OYYA 4INZA 3IVMA 2VT6A 3GBSA 2IX9A 3OG9A 2JGJA 5HKBA 3D2AA 1YSCA 2OLEA 3S8YA 3DS8A 4C4ZA 4UPDA 5T4EA 3B12A 1YAHA 1DQYA 4OUKX 1O6FA 1UXOA 3DQZA 3HC7A 3U0VA 5CBKA 1BS9A 5JZSA 2PPLA 2XMQA 5JIBA 5LKRA 1EHYA 5ALHA 1AGYA 3DYIA 1XRNA 4E46A 2GYWA 2J3QA 3H2HA 5ALNA 3NGMA 1CIJA 2GZRA 2ZYSA 2BUCA 4A5SA 5EHXA 5DJ5A 4A16A 4MEAA 3EQ9A 2PU7A 1YS1X 2QJWA 5LZ7A 1MJ5A 1LGYA 5E2IA 4WY8A 2RONA 3VJKA 1JI3A 4UBJA 4DM7A 1QJ4A 3PDCA 2VJCA 5JYCA 3JW8A 2HIHA 5FPPA 2Z5GA 1EDBA 2XUDA 3F97A 3DYVA 5K3BA 1H2YA 3Q0TA 4RE5A 4XJVA 2PM8A 4EHBA 1JU4A 4ROTA 4MWSA 1G5FA 3H1BA 2XB6A 1BN6A 3V48A 2FJ0A 5IVKA 2HFKA 3WKBA 2C0PA 4KRYA 5HF5A 4ZWNA 3WWEA 4C4YA 4AO7A 4UBKA 4WDRA 3MUOA 3R3YA 3F96A 4J03A 4EBBA 5AICA 5ALEA 4BRZA 2NW6A 3W05A 7YASA 4GDMA 2WIFA 3ZV7A 1UKBA 1W76A 2CUTA 1USWA 5CT6A 3OPMA 4AZ3A 1EDDA 3WWCA 4BVLA 4BCCA 2O2GA 3P2MA 4QDXA 4LHEA 4HTAA 5EGNA 4C88A 2H1IA 4UBIA 4X92A 1OILA 5F4ZA 5KREA 3STUA 1WHSA 3T4UA 4EB0A 4Y2JA 4EUSA 3GZJA 2CB9A 4UFNA 4U2DA 3WZLA 1MX9A 1O6GA 1C7JA 2EDAA 1OCEA 4J7AA 1SC9A 4QLOA 1C7IA 1R9NA 2B9VA 4CI9A 2QR5A 1RYYA 1CV2A 1IUOA 4W1PA 3HSSA 4OYLA 2RHWA 1TQHA 2HFJA 3BJMA 4HVTA 3H2JA 4K6GA 4J3JA 4U2BA 4GWLA 3R0VA 5IVIA 1ZI9A 4FLEA 5LZ4A 3PF8A 2W6CX 1YA8A 5HCUA 1X2BA 5BV7A 4MWTA 5K3FA 5ALMA 1NX9A 5LZ5A 3STWA 1DT3A 2WG2A 3FYUA 1QIJA 3WYDA 1XRQA 3STXA 2VA9A 1R9MA 1BN7A 1NU8A 2B4KA 1H2ZA 3HZOA 1R88A 4J0DA 3AINA 3ZWQA 2FJPA 4KEAA 3BXPA 3OM8A 5HF8A 1EB9A 4BAGA 1JT2A 3I2JA 4LKOA 3WYNA 4DTCA 3IDAA 4CCYB 1UKAA 1ZGCA 4M0MA 4X6YA 5AI9A 3QITA 4UHBA 4QA9A 3ZLVA 1N1MA 1MN6A 2ZSHA 3I2IA 4E14A 4Y2PA 1U8EA 1JKMA 1WHTA 4EY4A 4CCWA 4PSCA 1F0PA 1H2XA 2ZJFA 1VLQA 3G0CA 3EQ8A 1B6GA 2WIDA 5KWIA 2E3JA 2OCLA 1BE0A 3IUNA 3BE8A 1XZDA 3TGLA 3HXKA 2ZYRA 5D3KA 4JH0A 4N5IX 3GROA 1QOZA 4MQLA 1KEZA 2C5FA 3KSRA 2BJHA 1JMYA 4ETWA 3BWXA 1W75A 4AMYA 3VJLA 4DGQA 3F9CA 4KRXA 4B9EA 2WUDA 4DSAA 4J0HA 1YB6A 3IULA 4Y7DA 4EZIA 2XUIA 5AK4A 4UBLA 1VKHA 4F60A 4BAZA 2ACKA 5EIEA 3DOIA 1AKNA 4M0EA 2WJ4A 1SCIA 1H2WA 3O95A 1K8QA 1QO7A 1P0IA 1VA4A 4ZREA 3FVTA 1XZLA 1E5TA 3G8YA 5ALGA 1LPAB 5A7GA 5CT5A 1CLEA 1QFSA 3D5EA 2EEPA 5I9IA 1YS2X 4KE9A 1QIIA 2XMDA 3H1AA 3O9VA 4E15A 1JJIA 4L72A 5ALQA 3EIOA 1FFDA 4K6KA 3ILSA 2ZYHA 2XQGA 3LIIA 5A6VA 1ORWA 4X6XA 5FXMA 4W1SA 2O7VA 4LYEA 3C5VA 1L7RA 2XMCA 1CUEA 4QLAA 3WKEA 1B41A 2IITA 1CUAA 2V97A 4H7JA 2UZ0A 4X93A 2WUFA 4YASA 3WA6A 4Y2VA 5CH5A 5BWBA 4JYPA 1ORVA 5HK9A 4OU4A 1XLWA 3F98A 3RM3A 2HU7A 2XUOA 3I6YA 3WK4A 4Q1VA 2OGSA 5JALA 1E3QA 2AJDA 5LIPA 5K3AA 1YR2A 5ALTA 3GFFA 2VATA 4PV7A 3IUQA 3I6ZA 4XVCA 2DQYA 2H7YA 2HU8A 4EY8A 3EBLA 3C6YA 2BCEA 3MGAA 1SFRA 4LIPD 1W1IA 1A8QA 5AI8A 4L0CA 2BUBA 2HA2A 1CUGA 1IUNA 2HA3A 2JEYA 3E3AA
chains in the Genus database with same CATH superfamily
3W0LB 1PCXA 3S99A 2QLTA 1PQWA 5CNMA 1GAXA 3ABIA 2B37A 4HQ0A 3RYHB 3EG9A 1VHLA 1RJDA 2JGFA 3BUSA 3ZY3A 2ASVA 4HLUC 1N2ZA 1SCKA 2AQ8A 3TI7A 1YIOA 1ZK4A 2JIBA 2W6MA 1FU4A 3PXXA 4EFNA 3NP7A 4XRRA 1F2TB 4JLOA 4Q3LA 3T6KA 3MBKA 1EESA 2ADOA 1R5OA 4L6AA 1TQ6A 1J2RA 5I4BA 4B17A 1QNFA 1C14A 1DKOA 1Z0IA 2ENWA 2XADA 4YDSA 4X24A 4K9LA 5TQ2A 4DLXA 1N77A 2V7WA 4WFQA 4H16A 3P5BA 1RMQA 1WZNA 2A35A 1V9SA 3G1UA 4MYRA 2IV3A 5BUZA 1TJYA 1VL6A 3QWBA 4QHSA 3WJ1A 1VBFA 1IZ8A 2AN1A 2FEMA 1ZMXA 4FGZA 3TH5A 1BEZA 1LBHA 1UT6A 3AZQA 3TLZA 2W9XA 3BQ9A 4S2EA 4O2BA 3ZHZA 2C4UA 3LUFA 4NZYA 1LK0A 4Q21A 5ALOA 5FFNA 3EZ6A 4KDFA 2IEDA 3C3EA 4IDNA 4TSKA 1TZ2A 1X92A 3KUCA 2HMUA 4FQ5A 3RSCA 1I6KA 2VP2A 2ZREA 3IC5A 3K4QA 3EHEA 2VHVA 1UZAA 1Z4KA 2AZMA 1X6VA 1Z8FA 4M9UA 2ROQA 1MNAA 4PLYA 4MR7B 2FPGB 1V1JA 1A9SA 2O0KA 4QAQA 3FPKA 2IYZA 1Z25A 1TQ2A 1P72A 1ZUIA 1FUKA 1PYDA 3GUCA 4G07A 3RG8A 2FP4A 4KQMA 3AEYA 2OHOA 1EUYA 3L4SO 2SECE 3FNBA 4HB3A 3GMTA 3U7JA 1UADA 1L2TA 2A9KA 3LPMA 3QELA 4RS4A 1IBRA 4BB0A 2WVJA 4JAVC 1UM9B 4B83A 4FZRA 3ZW9A 3NYWA 3KYJB 3OOYA 4P58A 4K87A 5JXIA 3RQSA 1OX6A 3WLPA 3QVUA 4D25A 3R3UA 1Z74A 5JSZA 4IJUA 3WWOA 1Q7TA 1FE8A 1FXWA 1QPGA 1X87A 4WFJA 3RV4A 2XRYA 3L0BA 4KFRA 4PG8A 2O8VA 3R7SA 2O2JA 4FZ3A 5L4NA 5K0ZA 3CLVA 5JNUA 4DL9A 2FSSA 1CB0A 1RVV1 3L1UA 4NYIR 3VU0A 3RGWS 4B2LA 3VZDA 1RS0A 3W6OA 1U2DA 3K6KA 2BGIA 2GZDA 1RAGA 1WDLA 3A2NA 1GTSA 4QPJC 1ZSYA 1UJ5A 2FW6A 3NT2A 3Q7TA 4HRVA 5DI3B 1AZWA 2JD1A 4WOPA 2IEIA 1RPAA 3BWBA 3IBGA 4B09A 5AVVA 1B00A 4YP9A 2HSDA 4JEIA 1RMTA 2W2OA 3MWYW 3Q40A 5GP1A 4Z3DA 4CKEB 2FHPA 4DXDA 4KRFA 3K5HA 4V3BA 3VH1A 3PPVA 1IJKA 3D0QA 2FK8A 3VI4B 1HDRA 2Q27A 2A9RA 2I4OA 3AIMA 4IILA 5IDQA 3IIMA 4D3DA 3LUAA 1FMFA 3AIKA 1AQLA 3HKCB 4JU8A 4L9RA 5ALFA 1K5GA 3BMNA 2VHCA 3UTCA 2O7RA 3EZFA 4X7RA 4YT8A 2R751 4B44A 3QEAZ 2IEGA 2Q4BA 1E3SA 1W5AA 4MWGA 3UT5A 1XZEA 2A5FA 1CPYA 2GCOA 2O50A 1YS6A 4BQFA 2BKUA 2BHRA 5B4UA 2MT9A 2G8NA 2XUAA 3FKSD 3GJ0A 1TKBA 3IAS1 3I64A 4QGHA 1HQYE 1M33A 3MW8A 3RNOA 3V3KA 4DSZA 4J8PA 3K6RA 1U0HC 3GEGA 3GJ7A 4GZ5A 5A7HA 2O3SA 3T3DA 3SLRA 4XUCA 3UQYS 2X86A 4Q4JA 2QAGC 4AQDA 4ZEVA 3CVYA 4LXUA 4UOZA 5JXHA 1HI9A 2FEWB 4J7UA 3U3JA 1WCXA 3HEBA 2XRFA 3WIDA 2IXFA 1XZKA 4NOJA 5F1YA 3D81A 3FZQA 1NTRA 4PG5A 3I61A 2Z8ZA 3RF7A 4KQ9A 4K6MA 4PGAA 3Q0IA 3VPSA 3LYAA 3T9DA 2VCYA 2ENUA 2ZCJA 3FCYA 3HKEA 4S1OA 4CW7A 3V1MA 1ZAYA 3F6BX 2HREA 4X84A 1DARA 2JJMA 2YIVX 3GGSA 5TGTA 3VGJA 5GTDA 4K9MA 4UEJA 3QRWA 1RAAA 3EJWA 5B1IA 4M0UA 3ZDCA 3QU9A 1KDTA 4D57A 3BVPA 4NATA 4LXIA 1ZVKA 4AUKA 1XZBA 4EA8A 3Q8MA 1ODCA 4YQEA 2P9ZA 2R97A 3ESQA 5FA8A 2YC2C 3RV3A 2AOXA 1D5WA 5HIIA 1CJCA 2ZROA 3FTCA 4ZVTA 1SXPA 5CTJA 1OMOA 1DQRA 1N7JA 1VYHA 4AY3A 1IN1A 1ISRA 1SHKA 4D80A 3UN1A 3O6VA 2JFYA 4FYKA 2I29A 2IXBA 2D8MA 3DMPA 5G3ZA 2P0YA 5SV2A 4H6VA 2YVQA 3SJAA 5KQMA 3CUWA 4KO2S 1LPNA 3L8YA 1TU3A 4CIBA 5KWJA 4RC9A 3KQOA 2AZ4A 5FR2A 2H2IA 2XCTB 2A30A 4ZXPA 4DF3A 4DMFA 4ZOLA 4F5DA 2FN3A 2PUTA 2WYUA 4Y9UA 4CKBB 1O7JA 4HDSB 4GBMA 3DBRA 1BC5A 4C2TA 4WE3A 5KAPA 1KGDA 2DY0A 4JXJA 3B6KA 5D7NA 5KJEA 1BJTA 1ETUA 1RWQA 3A7EA 4J4TA 4LYHA 1PQYA 4ZPJA 4NBVA 1IJBA 1GA6A 3D7KA 4ZEOA 4MYDA 3QVMA 3AEQB 1E69A 4Z99A 1NPYA 2QJTA 2A59A 3QEBZ 4HXYA 1JHZA 1L4NA 2VAXA 4M0CA 1EFPA 1BROA 3WLKX 5K99A 4UARA 1PDVA 1HFWA 2PGDA 4EJSC 2G17A 1DKNA 4P3PA 4WBXC 1PL6A 3HA3A 2XUKA 2IWRA 3N0WA 4AI6A 3FWZA 5BWOA 1U2PA 3H5VA 1NOIA 1L1QA 2ZSJA 4M9XA 5HQ3A 2Q2WA 5HM8A 2YWDA 2BGWA 1Z4MA 4R2XA 3MJRA 2WF5A 5FAXA 3LUJA 2ONCA 2O3UA 3HP4A 1E0SA 2WA1A 3RANA 3VBCA 3RTEA 5J2UF 2L82A 4MCJA 2JJ1D 2C2BA 3Q7SA 4YO7A 3GOHA 3GPCA 3ZKAA 1P0PA 2PR2A 3KTFA 2WM3A 5HJEA 4HH1A 2C7BA 2HSZA 3ESAA 4OB7A 1N2CE 4P0PB 1H93A 4N7BA 1RE1A 3MAAC 1HL7A 5J5AA 3OZVA 3HDQA 3KB1A 1GAEO 1KYVA 1VL2A 3MUEA 5FI5A 1NIJA 2B7BA 4BVEA 4E3WA 3TLGA 4CF7A 1C8LA 4AO8A 3ECAA 2C9BA 2H2HA 3A1SA 4IWYA 4YJGA 2Q5FA 1T43A 3TD2A 2ZKLA 2PWPA 1MT0A 3WBFA 3BXZA 3P9RA 3W9YA 2X14A 1V3TA 3TL2A 1EFRD 5IJAA 3AEKB 3ELBA 4P83A 4QHYA 2V7EA 3M33A 3AB7A 1T3GA 1PP4A 3NU1A 4HDNA 5TT0A 2JBWA 3LFHA 3BF7A 2ABWA 5EKSA 4PC1A 1E4OA 4K26A 1BVYF 1T3ZA 5EG5A 3WR5A 3FNGA 3P9XA 3ELWA 1SC1A 5JCZA 4UU8A 1KC1A 1S96A 2PQ2A 4FWIB 4QECA 2ZIXB 2DH6A 1Y5IA 3C0KA 3NTOA 3NONA 3OKAA 4PICA 4IINA 5J3JA 1SQFA 3S1AB 1OAKA 3GGOA 5TVKA 2CCGA 4V0KA 4JBHA 4C0JA 5E3HA 4DV6B 1C80A 3OJLA 3LU1A 2GM9A 1U1IA 3K7EA 4EL5A 5D5PA 4BFVA 1ACJA 4ZI3A 5JS6A 1GKYA 1U9ZA 4BGEA 5B7GA 5AVUA 1W59A 4NAUA 2IY9A 4RL6A 4BVJA 1VPVA 4ID3A 1Z7YA 4H0CA 4MV1A 5J2UB 3ICQB 3ISJA 3OFND 3TDMA 4A4DA 5JAPA 2CE7A 4I1YA 3KKKA 4K9KA 1WD5A 3E8XA 3AY0A 3R7WA 4US0R 2P40A 2YS6A 3ZU6A 1GZ4A 1U5AA 2OZKA 4RA9B 4B80A 4WZAA 3BCUA 3VO8A 2BI8A 5BR1A 1V3QE 5LA6A 1KJ9A 5EKDA 1PX2A 4AZ3B 2X5NA 2VRNA 2FVYA 3I0NA 5JE8A 2QE7D 4R5HA 3QWHA 4TTIA 2R1ZA 1JTEA 4JI2B 1JEJA 2PSEA 5ENDA 4YRSA 1HMYA 5J1TB 1EA7A 5CT8A 3PD1A 2Q1YA 2WLTA 3FLEA 2GF9A 5KJCA 2B8JA 4AQYB 1WNFA 4LEIA 1EQUA 3HL4A 3ZN2A 1YBMA 3N05A 1W2HA 4FZVA 2WB2A 5IS2A 3B1YA 3DV9A 5JV5A 4DMHA 3RW9A 3LGSA 1XTKA 4MR8B 1B1CA 2C42A 4GYWA 3FOAA 2I9KA 5HZHA 3OAAD 3P0FA 2X0FA 5ALYA 3M49A 1YDEA 2BP7B 4CEHB 1XLTA 1TEVA 2Q2QA 1ORDA 4OU5A 4P81A 5LMUB 1SY7A 2KI5A 4UBMA 4FFMA 3RSQA 3AEZA 4GAEA 4WHMA 5EJEA 4LJ7A 4N3NA 5FTLA 4I9FA 4BBAA 4A1OA 4TWBA 3O8QB 4GU5A 1NN3A 3BMQA 4YCAA 4PLZA 5KSWB 2HNBA 1YZKA 2RCYA 4GQBA 3R5JA 1P18A 1U63A 3MCAA 1FFXA 4BWFB 1VGQA 4YUZA 2PTGA 1NNLA 5FOTA 3AOEC 4YONB 1E2HA 3GFQA 2O4CA 3LT2A 1MGPA 3DJYA 1AIPA 3PHCA 3L92A 4MUNA 5DGHA 5A62A 2IEAA 4DBVO 4QT0A 2OXIA 3WLHA 4E5NA 2PXHA 5J4VA 2PRIA 1JE1A 3RC2A 4DCMA 3I73A 2DULA 1MC4A 4WEQA 2QP4A 5GVSA 2VHZA 3H17A 1XHFA 2ZI6A 3DBHA 4LDNA 1PGOA 2X2FA 2YXDA 1AV7A 1PIWA 4PPFA 2FVXA 1JXOA 3DHYA 3LVBA 3DHVA 3IE1A 1QS0A 5FRDA 4RBNA 3KQLA 2CVOA 1K6EA 3IRVA 4X71A 5EMLA 2JIDA 4B85A 3OKFA 1QYCA 4J16A 5TPZA 3A6HA 2VBFA 2PUEA 3HMQA 4IIBA 4DJEC 3BA6A 1JQ5A 4Q05A 1NP7A 3D1JA 1L7MA 5C2JB 2WMDA 1XDWA 3B1FA 4LF8B 3PSAA 3U5TA 2AFHB 3VQTA 1ZWKA 2PFSA 4HDRB 5BSVA 3LOUA 3AL3A 3HWWA 2PMEA 2XD9A 1OA0A 1VCNA 1EGMB 2CUNA 3M6WA 4IMIB 4TM7A 1Y42X 1XYVA 1F14A 1FSGA 3OQ1A 1MVNA 4YJ3F 3QFSA 4CF6A 3QJ5A 3ZXYA 3WGZA 1X7WB 5KSPA 3GUZA 2AEMA 2RGBA 4LGCA 1W7AA 4RACA 3LQ1A 4EW3A 1HLDA 4OJNA 1JZTA 1VKJA 3KXPA 4KH1A 3IEVA 2QVYX 2ZSUA 2PU5A 3ACDA 3BJRA 3BC1A 1R6UA 3AERB 3UA3A 1SCUA 4J1SA 3WP1B 4CLEA 2BEVA 2VJPA 4MQUA 3TB6A 3N86A 4WESA 1YFJA 1U3FA 3DUFB 4TTSA 1X19A 4GBGA 1OWLA 4Y8VA 3H11B 4YUYA 4RKWA 2DHEA 3L7MA 3CURA 4IQ8A 2QXYA 1EFVA 1QZTA 1V48A 3PC7A 4K9NA 4QEKA 3WNVA 4RVUA 3ROTA 1QJCA 1UM8A 1D9ZA 3WLMA 4IH4A 4J29A 4HSGA 1KY4A 3O3NB 2EXXA 2Z9DA 3B2QA 4ZOCA 4LNAA 1J09A 2GKOA 4M7WA 1XQXA 2IXDA 3KVYA 4ZO6A 5CLQA 5FCDA 3OZWA 1Y9EA 4U0JA 1AHIA 3EUWA 2XZPA 3AUXA 2W2PA 3WK6A 5I7UA 4E1AA 1G3UA 4W82A 4H18A 4L8FA 4YRMA 1KOGA 1BWRA 3PXDA 1OQAA 4WNAA 1JVBA 1QTIA 4HFJA 1HDGO 1U3TA 3H5TA 4HWKA 3S6JA 4GX0A 3P9SA 4OXIA 3TL6A 3WLFA 4E5KA 4F4DA 5THQA 3G0DA 3E9CA 4J0KA 2ZQYA 3LY7A 3SKXA 3L4EA 5KX5A 3MMZA 1DKLA 2VTBB 4KPYA 1SR8A 4MITA 3VOBA 3O84A 3V00A 3ECSA 3HZZA 2FZEA 2GZ1A 3J81A 2GXUA 2IS4A 2C94A 2Z04A 4CMBA 1UXJA 1E2QA 3EQZA 2IYPA 4ARZB 5BUCA 2RH9B 4BMPB 1CRPA 5CXUA 1M5RA 2D0DA 2DHRA 1KEVA 3ZWMA 1WHTB 4H6PA 4TQUS 3WBJA 4BV3A 1QIHA 4G23A 4KK4A 3LLUA 5KNCA 5E9JA 5TGDA 3NHMA 1J9GA 1XLVA 5KOIA 3T1NA 1Y7IA 3MT8A 5HJ7A 2YNMA 1XWWA 4REQA 3DDOA 2Y05A 2ZRBA 4MEBA 1Q74A 4GPD1 4ITVA 4NV0A 2NWQA 2R1TB 4A6EA 1GT91 1VIAA 3TLEA 3MINB 4ETNA 3ABQB 2ZXEA 2I4IA 3NIGB 4LRWA 1YI1A 2Q29A 5K0CA 1W0KA 4LRSB 1O8BA 3KQPA 4KOEC 4DDUA 3P9IA 5LYYA 3IA7A 3LD9A 1UJ2A 1EVIA 1D0VA 1FDWA 1QFYA 3WADA 2WHRA 5FB3A 1R50A 2GB4A 2QTWB 3PICA 4YRLA 1L8AA 2Q6IA 1LC0A 2ZIVB 1LVUA 3NDRA 4AURA 2MIIA 3AIOA 4BO5A 1MT3A 2BFBA 5A5FA 4DMMA 3BT7A 4KE7A 3WHIA 3T94A 1TFUA 4H7HA 2QMEA 2X1VA 5IAAA 5ICGA 1H1LA 2XNJA 2PANA 3COPA 4FSDA 3AI7A 4LDAA 4RH0A 5B7PA 3A6DA 4I50A 4L15A 3H2GA 4JBXA 4X6LA 3T7TA 2EARA 1T2CA 1W1UA 2HK7A 3BH0A 3G3EA 5IRCD 3NHYA 3SAJA 1XQ6A 3JQGA 1LI7A 3KKOA 3FOFC 2H4WA 5CMLA 4IDQA 1NMZA 1A5TA 5H3CA 3GNQA 4AZVA 3FOZA 4O33A 1Z7BA 1NJ8A 1WABA 1P9LA 2X19A 3RKSA 1XO1A 1XTVA 2EYUA 3DHEA 3OZAA 2F3PA 4ZVOA 3DGEC 3PE4A 1IJFA 2J6CA 4JYMA 1D8AA 4EABA 3C85A 2Z6AA 2WB4A 3U6KA 1CU1A 1R7RA 1T9CA 5BNWA 4L2IA 5K3EA 2QM8A 4PO8A 2QI9F 2ZU0C 1T0PA 1CFZA 4FN4A 2OXCA 2AL7A 4FFLA 2DEUA 1ZRHA 1P17A 2LV8A 1SH7A 5SICE 4UTXA 2JEZA 3BXEA 4FNGA 1Z7GA 3EVFA 3LL4A 3T3OA 4KXFB 2XH8A 4J0GA 1MRZA 2GERA 2V9ZA 3KWJA 4RFVA 4RV5A 3ZJ4A 4ENWA 1PWHA 4XLZA 5HQJA 4TGLA 1GTVA 2OHGA 1Y4UA 4HEQA 1I7NA 1IXRC 1OOEA 2GBPA 2QK4A 3AUJB 5FYDA 5COQA 4EI2A 3O47A 2VRCA 1R16A 3CR7A 3QE9Y 2IHNA 3TMYA 2JFGA 4HC4A 2BHTA 4EHHA 1FJHA 1M1NB 5E7QA 3MRVA 3IELA 5DW0A 3NWOA 3WGJA 1ECPA 2HRZA 2VDWB 3M3PA 4EFLA 1E6LA 3FYTA 3DP9A 4YJ2F 2YHBA 4YYZA 3RJ5A 1HX7A 4KE8A 3VVMA 1DX9A 3EYAA 4M0FA 5I7SA 2BI7A 4DB4A 4P84A 1NFRA 1U0TA 1JTFA 3D4NA 1E9EA 2HJRA 4H1WA 2QRGA 2WWWA 5FWXB 2A6PA 3BH7A 4MAAA 4QYWA 3TYXA 1NJSA 2RH5A 1A8UA 5A71A 3IE2A 3U3OA 3V6LA 4BP1A 2DUMA 3P97A 3KWLA 1MC5A 1NQXA 4I0WB 4N47A 1G66A 1BIFA 1E63A 1NSYA 2GX6A 2RHRA 4GKAA 2ZP1A 2A67A 2DQ4A 2HQSA 1GTRA 3FNEA 3H8JA 2AC2A 1KVSA 3IR6A 3L7OA 1U11A 2FQ1A 3EVEA 3R6WA 4MTLA 5CM8B 3U4GA 1B8UA 1WW2A 4QDUA 4BRSA 2M1XA 3PLRA 4RA6A 4R7ZA 4ZEMA 2I7DA 4TKVB 1EUCB 3S40A 5C8DA 3LQRA 3OOHA 5ESDA 1FDVA 4P9NA 3VSCA 3ZQ4A 5EJ6A 4QO7A 3FETA 1OB5A 2YUIA 4BUZA 1MV8A 2HK9A 4WFKA 3AVYA 5FL7A 3RC8A 2ZATA 3LWNA 1AHHA 1I13A 1LSJA 1C9MA 2CUZA 4N7RA 1DQSA 5F7JA 4MVWA 3H1FA 5JCOA 1H3NA 2WAXA 4IMPA 4DXHA 1OPXA 2ILTA 4EDHA 2RHDA 2XDAA 1F2DA 5TSDA 3VDXA 3KBOA 3THWB 1ZJYA 2HO4A 2X13A 4H17A 1BXKA 3KT0A 4JYCA 2OPBA 4O2AF 3JXEA 3NXKA 4R40A 3C43A 4C1BA 5L45A 4UHEA 3WNQA 2KMLA 4ZCLA 1P2FA 4KREA 3L07A 3UG7A 4M53A 4C0QC 2CV0A 4XM2A 5JBNA 3A2LA 4A36A 1SXGA 5DV9A 3WMRA 3MGGA 4QTUB 1W46A 4KXYA 3ABZA 4YJ2B 4FNMA 4TLAA 4DKJA 4D81A 4JUBA 1HDCA 2C2WA 1WOYA 3RUFA 3GEBA 3ABOB 1S2MA 2I2BA 3S55A 4ARSA 4D3ZA 3OEHA 4Y2RA 1F8YA 5IUNC 2QSZA 2G6BA 2QRVA 3QE3A 1PUIA 3MCZA 1XC7A 4ENPA 4DDKA 2I7VA 2OZLB 4GI5A 3GWZA 4FZJA 4MUMA 4P4UA 1E64A 2PRJA 3IQXA 2XT0A 1BQ4A 2REQB 3R40A 4FFDA 4DDHA 3C7KA 3FDIA 5KYWA 4DR3B 4ZRMA 4B45A 4ARBA 1XEXA 3A1CA 3PSHA 5KQGA 4URVR 2CEKA 3QNUA 4UUOA 4JASB 4JT9A 3DV2A 4XYMA 5DTJA 1SG0A 1G6KA 2AC4A 2QMUA 3LBHA 4JUIA 1FVOA 3SS8A 1D7AA 3ZEAA 3ZV6A 1EXNA 3KQVA 4BMXA 1J33A 3M83A 1TRHA 3L6OO 4TMFA 3HYCA 5LBTA 3T3PB 4AJLA 4ZYVA 5KU1A 2JHAA 3DLTA 3D2CA 3OIWA 4IGIA 4MUAA 2IL1A 1P80A 3VXKA 4P0QB 2QIPA 4TTVA 4D3YA 1PT9A 1XRPA 4JOCA 1AKQA 1XDGA 3LDFA 4V0NA 1R6TA 4E11A 3A4MA 3ZJVA 2GS9A 3FNHA 4WVFA 3ILHA 3OUUA 3B6MA 5IYZF 4ER5A 1YHYA 4JLBA 2O1SA 4RIHA 1GA4A 5AI0A 2FQQA 1L5SA 3CR3C 3WYEA 1G9TA 3ZWNA 4FMCF 5DXAA 4U2KA 4XJSA 3VU8A 3OMWA 1DC3A 4X45A 4OIFA 4GL2A 3IX7A 4EX7A 4ABYA 2YYZA 1KAOA 2OLJA 1DXYA 4KOAA 1BCRB 3KB8A 1EI9A 2ZUSA 3AU8A 2A9FA 4DG8A 1ORIA 1YHNA 2YW9A 3ASVA 4XLLA 3GPLA 3JARB 3N58A 4GLFA 4URFA 1NDQA 5EC8A 4UTRA 2R6ZA 3IRUA 3OX2A 5LIRA 2QG9A 3SC3A 2BCGY 4JOSA 4LQDA 1ONOA 5IVHA 1TCAA 2W6PA 4MARA 4DQLA 2VWQA 4EJ6A 1DWPA 1P5RA 5HM6A 4L3VA 3LOPA 4WA7A 1MIOA 4NC9A 1ZFNA 2IEBA 1T6BY 1OXSC 3LXXA 1HYBA 4MUIA 1OJ7A 4CHGA 4ZAVA 3WK7A 3K16A 2ZJ1A 3ZTWA 4YQZA 4H1TA 1CZKA 3U26A 4Q7QA 4RD0A 1CP3A 3SYTA 1APBA 1YMVA 2R48A 3M81A 4F3CA 4EUNA 2OD9A 1NJ6A 5JD4A 1Y3AA 1NOJA 2CBZA 1I32A 1Q0RA 1CY4A 4IDDA 1LV7A 1W581 3NALA 4J1QA 4WXEA 3U9TA 1D1PA 4D8XA 1W30A 5J47A 2PLAA 3PPXA 3OJFA 3DB1A 4KGZA 4KX3A 4PSVA 3TX6A 1EXWA 4JU9A 2JIPA 1TM7E 1XXHB 5IYZB 4G67A 2HW8A 5GJBA 2RK3A 1V9CA 2P3LA 2ZJ0A 3QTTA 5DNDA 4N0DA 5JFOA 3RYFB 3STYA 3HDHA 5IH3A 3GNTA 3KEQA 3V80A 4FMCB 4NP6A 4V2UA 4EY7A 1VE7A 2CGEA 3K0FB 1GNLA 1QRDA 1ZU4A 2YVLA 3VSEA 2J67A 4BATA 1KDVA 1CWUA 3UKJA 3GLIE 2XZLA 5SYNA 3BIFA 1Z0SA 4P7KA 3HTXA 2AKAB 1TK2A 5H0IA 2C2YA 4YDRA 4FYJA 5C7IO 1EK6A 1XL1A 4A6DA 1FLDA 4J7XA 4CMJA 5L3QB 1T9BA 4QATA 1BHO1 3T61A 2Y3IA 1KR5A 4PQEA 3DZHA 3JZAA 3MFQA 4JXZA 4DR7B 4B7UA 1UBRS 1Q91A 1TM1E 3REGA 1ZQ1A 1I33A 1KWGA 1JKJA 1THTA 3L05A 2ONJA 4X8LA 2O8FB 5IJ9B 3E8MA 3GH3A 4MRVA 3MCVA 5CX1A 1GPLA 2WSYB 4ZOEA 5J4KA 2R6GA 2X15A 3PTAA 2NU9B 1PG0A 1TZBA 3IP5A 4F1WA 4WVLA 5TQ0B 1ENYA 2DBRA 1ADGA 1OA1A 3MGBA 4I8XA 5ECYA 5SZIA 4RTMA 1KFEB 5GM1A 3GD5A 1YBHA 4DIFA 4HEJA 1I5RA 3RS3A 1L5RA 3HACA 3ZYCA 4ZCMA 4S1VA 2QX6A 4I6EA 1MLDA 5CG1A 1TLLA 4IS3A 1GGVA 1GU0A 3C6QA 1OLSB 1SG6A 4QTYA 3E4CA 2P2DA 3ESZA 3ZGZA 1ZW1A 1UZNA 1VZ3A 4HPJB 2NU8B 1HT3A 2HCJB 4GE0A 1VC2A 1J97A 1PFGA 2J3DA 3HJUA 1GNPA 3MRSA 2OBBA 1HK7A 5FX2A 5AFSA 1D2HA 3INRA 4CQMD 3PVZA 4KW7A 2WKPA 3L7BA 2QD4A 1FF9A 4DWOA 3JASA 2QRJA 1GDTA 1SOMA 3LVQE 4DIBA 3RH0A 2JI4A 2WFMA 1G16A 4MPPA 4TL6A 4R4JA 4A2PA 3PZBA 3U1TA 2W93A 5DHUA 4EG1A 4P98A 1S8NA 2OOSA 3AEUB 2Y1WA 1L5KA 4JI0B 3WGNA 5MN6A 2GPWA 2YUTA 1BDMA 4RFSA 4RD4A 5DYWA 1DWQA 1T9AA 2LPMA 2XQVA 4D46A 2QVLA 1BWSA 4QASA 3ZHUA 5LLTA 2XNKA 4JQZA 4CL8A 3OX3A 4MYCA 1GTMA 2XECA 1CYDA 1U4NA 3BD9A 2IPXA 2AG0A 3LGXA 1HG0A 1KAMA 1XMXA 1LNZA 2IPAB 2JFPA 4EY5A 4UTPA 3AKDA 3H05A 4URUR 3SK0A 5A4DA 3CCFA 3O8OA 4GYKA 1KFKB 3L1VA 3MJ4A 4RMHA 1L5GB 5JECA 3A4VA 3N8GA 2IV7A 4W5QA 1KI8A 1V37A 3DBLA 3A4NA 5T3YA 1OPRA 1DC7A 2VHQA 3LMKA 1JB1A 1LLCA 3EX7C 2XBMA 2REOA 3EBPA 4MDFA 1L3BA 1N6PA 2JGKA 3S8MA 1KI3A 1V5IA 3LKDA 3P2EA 3SEAA 1YCHA 1JI0A 3NETA 4F86A 1OH7A 3UNXA 1R4NA 4LY9A 3FJOA 2C8KA 5LQCA 3JZFA 3AL0C 1Q7EA 2Z3WA 3R3XA 1DTWA 4TMWA 4D0LB 2VDRB 4DPMA 2A88A 2VJOA 4HAYA 2QUZA 1RQXA 2YXPX 1BS2A 4MGIR 4MRSA 2HF2A 4EKNB 4BFUA 3UWSA 3NOXA 3HVKA 2YIJA 1W25A 4JLAA 2QTHA 1A7KA 3BGSA 1XZQA 4ZZ0A 4Q66C 5AIBA 2FUCA 2FSFA 2R6DA 4RNDB 5K1ZA 1C0LA 5HIKA 3M4JA 3WGMA 1IBCA 2J32A 4G5XA 5PNTA 2JL1A 2ZSEA 3DSRA 3PGJA 4DQVA 4HGZA 3HBMA 4RU1A 4MS3A 1KZ4A 3KETA 4RD2A 1PEAA 5IT0A 2CV1A 1V16A 4XQ0A 1K5PA 1LPMA 4CVNA 2GBFA 1J0BA 1JPJA 3PUIA 5CA0A 1VKRA 3VZSA 5CBPA 2DPLA 2O59A 1RWBA 3VOSA 5FBVB 1SBIA 2UYYA 2YOFA 4HATA 1F3LA 1MNQA 1RRKA 3PHGA 4HWSA 5GIOE 4C3UA 2QV0A 4DM3A 3QG5A 1Y1TA 2JZOA 4FYHA 1FMCA 3LM8A 1CUVA 3O2QB 1OT3A 1FVFA 2J87A 3CLRD 2ZDHA 3IPXA 1GPNA 2ZYAA 3L84A 1Q1QA 3S2FA 3QOXA 1W5SA 1ZNWA 3E9ZA 3LFUA 4MS4B 3I5YA 1N5JA 3OBBA 4M7OA 3LWBA 4B3FX 3OUZA 1P2DA 5AK5A 1IQRA 3NHWA 2XB8A 1P9WA 3X2FA 3C6BA 1XSEA 2PIDA 4QPPA 4XSHA 1M0EA 2GXSA 3DXYA 7REQA 4IBOA 2VYVA 4F6CA 1JIJA 1OXUA 2RJ3A 1N6LA 1T6ZA 2QKYA 5CR9A 2GWHA 4R84A 2YIDA 3CUVA 3HYLA 5K8UA 3TRJA 1RPZA 3LS2A 4D4LA 4S12A 3S1SA 4P7GA 1TNDA 3HVJA 4FU0A 4P08A 2I78A 1BWPA 4KPGA 4P93A 2OXTA 4PC7A 1CRWG 1BA2A 3JR3A 4FC6A 2D5IA 2W2VA 1QE5A 1F8UA 1I94B 2ZRQA 2OCGA 1VLZA 3G2NA 2H18A 2Z98A 1TUEA 1UH5A 3E9MA 3HI4A 3HVUA 1S3GA 3QE0A 3R0JA 2ASEA 4HWGA 4JB0A 3TVDA 5C1OA 4WBSA 2W6JD 3WXMA 4QU5A 5FUWA 2EVWX 2V4ZA 2KBFA 1CDDA 2LXNA 5FQNA 1QIEA 3TRFA 3LT1A 1GPKA 2HN9A 3R44A 5DASA 3SF8B 2Q07A 1ZH6A 3GHYA 1KJ8A 4QBFA 4FDMA 5FUYA 2PDAA 1J07A 5DBFA 3WL6A 4H27A 4KGVA 5KHAA 2DFDA 3R3SA 4Y9RA 3ICOA 3NPMA 4JJFA 721PA 3GFRA 1SVNA 1SIBE 3EA4A 3X1YA 1FP2A 3DAFA 1UT5A 2W2LA 4BWVA 3PYLA 2PGJA 5AKEA 1KJQA 5KBYA 1PEDA 2WIAA 5FTNA 1T2NA 3EGCA 3T7IA 3WNZA 5DBOA 1NQTA 3GH1A 5BQ5A 1N7GA 2RCNA 2ZR0A 4MGHA 4KLZA 3UJAA 2WHPB 5ECDA 2JLSA 4R8LA 3VUFA 3ZCSA 2UUOA 5FV4A 3V8MA 4EP1A 2QSJA 3EFOA 4NEHB 1UC5B 4EAAA 2V7TA 2ILVA 4HH3C 5JD3A 4EARA 4EG6A 2ORWA 4HGOA 5I9TA 3HV2A 1MKYA 1E1YA 2ZRHA 4BVKA 4D9MA 1GPMA 4HBZA 2J3HA 2Z30A 5E8JA 5FOSA 3PX7A 4KKVA 2CBGA 3DMGA 1H4TA 3W3ZB 2A4MA 2HEGA 5T4BA 3ANXA 4HFNA 2NSHA 4V1CA 1AZSC 1P45A 4FWBA 1E1CB 4OH1A 2XQIA 1SUFA 4BBZA 2H3EA 4U5QA 4B3IA 2UYOA 1D3AA 3F1LA 4TVSA 4XTCS 5LDHA 4HOYA 1Z12A 3EARA 2Z2ZA 3NP9A 5AK3A 1ZYUA 3I5MA 1Y1SA 2ZTSA 3QU2A 2OBLA 1QDUA 1UBNA 4B2IA 1G21B 2Q4TA 3B6JA 5HS4A 2RJNA 3H9GA 5ES4B 3DLPX 3N3AC 1Z38A 4JNKA 1HL3A 4L7QA 5K6RA 2YH2A 3M4ZA 4HH4A 5BT8A 4GW3A 5JY1A 4EX6A 2YRXA 3D7MA 2XF2A 2MOKA 4XB2A 2GR9A 1P7PA 1HR0B 3VNBA 1PK8A 3REOA 1EJBA 1PQ4A 3HBNA 3A9VA 1S3IA 3SVZA 1R3DA 4L51A 1BKYA 1EXVA 2GRJA 5CP8A 4M8SA 1J1IA 3A6GA 4QD3A 1GN9A 3RUCA 5AT1A 3LKBA 4GBJA 3D3WA 2PZMA 5ERXA 6YASA 3BWMA 3HU5A 2OB1A 2WFLB 1UDRA 4DUGA 5H81A 3ESDA 3H99A 3JALB 5DNWA 4U1RA 3E1GA 1WKVA 4V1CI 2QM3A 3T54A 1V4BA 4TMKA 1SHJA 2QSYA 4FMDF 5EZSA 4X7BA 4IH9A 1WMSA 2AOTB 2FLWA 2QAJA 2V7QA 3I5AA 3K0BA 4KQEA 5K8VA 4CLRA 4KP7A 4TXMA 3JS5A 2GKGA 2PRKA 4MGZR 3JQEA 1R12A 1YQEA 4GPZA 5EE9A 1PVVA 3OQIA 1MF7A 1MR3F 5MN5A 2OCXA 4BWYA 3DFKA 3M4XA 3LCVB 4BXOA 2AD1A 4LOLA 3VC3A 2G8LA 2P5TB 4MYSA 3FAZA 5AHRA 1OZHA 3SQDA 1GGHA 3ENVA 3ZLUA 1T3LA 1P4JA 4KR0A 3PQ4A 2VSFA 3PNVA 5C35A 2WG1A 2R86A 4M1EA 1F48A 1ISJA 3PGLA 2WF8A 2QGFA 1UEJA 2J4CA 3DAYA 1V8PA 4FE3A 2HC9A 4KNVA 1CE8B 4M98A 4MNTA 5G0WA 1SXJC 4OA8A 3WIOA 1X7HA 5IBCA 1ZM9A 3GAFA 4IQ4A 1X39A 4FHCA 4U7JA 1A8SA 3B13B 5COBA 4EHIA 4F5ZA 3STHA 2GBCA 3E9QA 4UQOA 2OQRA 1A9QA 2P9JA 3E84A 3FHCB 5EIFA 3RJZA 1J24A 2FUEA 3JR7A 2O8EB 2BE7A 3NKLA 3Q72A 4EG0A 4Z4IA 2HKIA 1WULS 3WLJA 1BCSB 1VIYA 2DC1A 2H00A 3FTDA 3MB8A 5BYJA 4ZYTA 4BZPA 1PBNA 2H2GA 5DXFA 1MAUA 3VU1A 3EW7A 3GEHA 3I12A 3IL2A 1SURA 2XKJE 3L43A 4BC1A 1I6WA 3NFRA 1KEKA 3K9NA 4OD0A 4FMDB 4X20A 1TIKA 1M74A 3TINA 3HA7A 3FE2A 3SHOA 2X4GA 3AM1A 2W71A 4D9NA 5L3VA 1XQWA 2BF7A 4U7FA 3FZEA 1BA3A 4IDBA 3PUWA 4QWMA 1SA0A 5IN4A 1RC0A 3MT7A 4D8TA 4DNFA 4HUTA 2F1IA 1MTZA 5L4SA 3M1YA 3IEMA 3K5WA 1Z36A 4GWGA 4IDOA 1DNPA 2IIVA 3VHRA 4MCIA 1U0EA 4N4AA 4S0XA 5HIAA 5HCIA 4PO3X 3O4GA 4PO1A 3LYUA 5FOQA 5H9WA 3F5SA 2V3VA 1A04A 4C4XA 3DDCA 3ZEIA 3V4VB 3KSUA 1QORA 3VC1A 1YOVA 3H3XA 4N39A 2ZITA 4YRZA 1W5BA 5IJZA 4O3MA 3DE7X 4KFTA 3RC7A 4F2PA 5CCXA 1AK1A 3ZJYA 3GBPA 3KJIA 3GPBA 1PFVA 5GAJA 3ZHRA 4JVNA 1E4VA 4JC0A 4YJDA 2YJ5A 1C81A 2X9NA 2E6UX 2NXNA 3BULA 3AO0B 3U4HA 2HGZA 2NGRA 4DLZA 2BUAA 1YDMA 2VLBA 4G36A 1GCGA 3CLTC 2YV2A 3T12A 4OP2A 1GA1A 1YQGA 2C84A 3CUKA 1CVRA 1YWGO 2QVZX 2XVMA 2IHVA 3DMTC 3H5RA 3H7IA 4H3KB 4RZQA 1OWMA 1CUSA 2QGNA 4WZZA 3SE7A 3UC5A 3I1FA 3WSTA 4FYWA 4GHWA 2W6ZA 1FK8A 1K5HA 4QEZA 5ETJA 1KAHA 1W2GA 2PKYX 4Q19A 3V2UA 4CMIB 5IUKC 4IX9A 3T3MB 1JL3A 4HGRA 2JGDB 1ZD2P 4WD3A 4WIAA 3PD7A 2H07A 2GA8A 3MCTA 1VMKA 3NB0A 4PRKA 3AR7A 4Z9AA 5EWLB 5K3CA 2UZ1B 4QAJA 3WAKA 1MAVA 1Q77A 2FPPB 4U9UA 3KOYA 5FWDA 1T0HB 3PUXA 4MIKA 4U7TB 3ZCPA 10MHA 2W6ID 3N53A 3HY3A 3OEED 4ARIA 5A9TA 4Z5XA 1A97A 2O2YA 1J4AA 2HWUA 2VYFA 4UQPA 2RHCA 3JQQA 4R83A 2QUBA 1FB5A 3CPHA 3NFYA 1WO8A 2O9JA 2PA0A 1YOBA 1J49A 4JLJA 3E6AA 1EVJA 3S3TA 1I3CA 3UMSA 4UNIA 2QT0A 4OV6B 4ZQHA 2VNHA 3A70A 4BGVA 1YC2A 4HKTA 2E89A 4QDJA 4IV5A 2JH3A 3RRYA 2LKDA 2OLKA 3JQAD 2CLMB 3SXJA 4KR7A 2G82A 5JADA 2REBA 1ADFA 5LVAA 5MGBA 2F2TA 3ZBUA 2QVGA 1FW8A 3TECE 2V3CC 4KQIA 1PDOA 4M9RA 1O5TA 3EQ7A 1TM4E 3O1HB 4LXGA 5GM2A 4LPSA 2LRHA 4N8EA 1NJ1A 2A0FA 4YAEA 4E7PA 1Y3BE 3AJDA 3DKVA 3G9QA 3HCPA 2I6UA 3LCUA 3MWEB 2PGXA 3DMYA 3H4MA 2P41A 4HT3B 3L5OA 1JG7A 3WLNA 2ZEJA 4FGJA 3UJDA 4B74A 5AVYA 4B7ZA 3AY7A 2HGSA 3EPRA 5ALKA 3ROGA 3ELDA 5TRTA 3ZQKA 2G08A 2OXFA 4XFDA 5JVDF 4KG7A 4WXYB 4GSYA 1TO2E 4YS6A 1LPPA 1C1XB 1RPTA 4D9EA 3DUWA 2X9GA 2ZKIA 4MVJG 3DWGA 2JH8A 2EBUA 4DAOA 1L4BA 1ZJ4A 4QOIA 4CQNA 1T1IA 3M1LA 4XARA 4JLNA 4P6VF 4L28A 5ITVA 3GUVA 4P5PA 4FR0A 3NVDA 1I1QB 4P36A 2C97A 4RHEA 4TTJA 4ENTA 5BYBA 1J2UA 3LW7A 2GEFA 3A0UA 5B3JA 1BW9A 2F3SA 2ZRKA 3IKMB 9ATCA 5KWSA 2QP9X 2OMEA 3ESCA 1FYWA 1RJEA 2YV1A 3GMDA 1P5HA 5JNSA 1THGA 2VG8A 1ENOA 4F6RA 8ADHA 4RTOA 2PUHA 4F8YA 2X5XA 3TIIA 4X8HA 3VHLB 4HNUA 1QHFA 2XBLA 2QEQA 1OFUX 2Z3ZA 4MVJD 3WGKA 2WSSA 4B32A 2J0QA 2PT6A 2QQ5A 3WMWA 4QOFA 3I4LA 4MDYA 4R2HA 3W5DA 3NDIA 3EGDB 3FPAA 3CVXA 1W94A 4QELA 4JGIA 1FW6A 1XVAA 5JS2A 1QGZA 3HEMA 2AJCA 4Y2HA 2OCDA 1V5EA 1EINA 1C4OA 3F3YA 2X6TA 2YASA 2HCBA 3NJRA 3VPCA 5JS1A 1KDOA 5EZQA 1GNRA 2XE4A 3FRHA 4QYXA 2NP7A 2FKNA 1P5ZB 1A27A 3WTBA 5LYJA 1TK3A 2HTEA 3AKYA 2A2ZA 1PR3A 4J6FA 4WACA 1C3OB 4HB4A 3W2TA 1Z5NA 5SYAA 3UXHA 1ZIDA 1LF0A 4JJAA 5L6LB 3U31A 1I6LA 4UTZA 2A57A 3M6FA 1KZ7B 1CIVA 3H97A 3IQZA 3MBIA 1WDMA 4CTJA 1XNRB 1M2KA 1IVYA 4I55B 4MJ7A 3B38A 1O94A 2A94A 3B70A 1FTWA 3JAKA 1DBIA 1YJCA 2FMFA 4MAMA 5AVTA 2W8BB 4Z9YA 3QPDA 4BEVA 5JJ5A 2M32A 1L5LA 2FMUA 1C29B 1MX1A 1D4OA 4DLBA 3CUEF 1HM5A 4ML3A 3DT6A 4TMTA 5K4GA 4BQPA 5C7YA 3LECA 2O1WA 2ODQA 4F4IA 1KVRA 4JR1A 2R65A 3KOXA 1XQYA 2WJWA 1K7YA 2J7KA 4HMOA 4EGJA 5GOTA 1H05A 3V33A 2CV2A 2ZUEA 3BDIA 1RIFA 1LRKA 3NXSA 1OXXK 3A6JA 2ZIGA 4RZ2A 1GNSA 4M0KA 2C7GA 4BEBA 2V7BA 3HNPA 2DTDA 2IW3A 5EE5B 3SE0A 2CHQA 4UAUA 2H1WA 2YHIA 2Y1LA 1KEEA 2DPMA 1K7CA 3GLUA 3Q8LA 1SBQA 4JSTA 4R8VA 5FPSA 2C7VA 4L16A 3SYMA 1ZMBA 5HBRA 1UOOA 2XXAB 1I6MA 2GM5A 2NXCA 1PI3A 2Y1CA 3U17A 1TF2A 2P27A 2H85A 4BO0A 3SI7A 5KOHB 2X0IA 1IM2A 3QLUA 3EIUA 2NQ8A 4CFSA 3GRVA 3KFXA 2ZSAA 3KEOA 2ZYIA 4HAIA 4WRRA 1ZG3A 5CLHA 5LZ2A 1JQEA 3NDPA 2AEFA 3F3KA 1QG6A 2RGUA 2VJKA 4GSKA 4AN1A 3GFTA 3A28A 3S5JA 5H4GA 4QBTA 3F7OA 1RACA 2JLAA 1ZK3A 1I0ZA 4E4RA 4CUJA 3GJQA 1DOZA 1GU1A 1P9RA 1XD2B 2UDPA 2W4IA 1RM0A 2HBQA 2VTDA 3M0EA 4KQKA 4O2AA 3ROQA 2Q5JA 3WWDA 4U7HA 1PS9A 3FJ1A 1AC5A 2WBLC 4S05A 4AZ0B 1R00A 1V5WA 1NDHA 4PXSA 4B3HA 3EISA 1KY3A 1K88A 1N0IA 2H9YA 2MSCB 4QUJA 1YJ8A 2MWMA 5LNK1 1I4LD 2E7ZA 3G7UA 4GOJA 5CFMA 2RD2A 4R9RA 1MO4A 4OBEA 2X8AA 5HIMA 1CFJA 1RFLA 1ZPDA 3FRJA 2XT6A 4GPEA 3VPXA 4BPBA 4TROA 4MWCA 3DDWA 3ANYB 2AHOA 4TXNA 5IN5A 4DT1B 2UXCB 1XRMA 1RTKA 4DJTA 3F46A 4OIMA 1EPUA 2B30A 3QKUA 5K3SA 3CRZA 2OAP1 2QYSA 3L1HA 1R4ZA 2JKZA 4OCZA 1LDGA 5H59A 1YFLA 1BMTA 3KU4A 3O4JA 4BQSA 4UNRA 1R5BA 3RVQA 4GMXA 5AO9A 1R1DA 3E5HA 2G5PA 1P1KA 4C0BA 3I3OA 3EEQA 3KT6A 4MHTA 5EXEA 1KVUA 4BMNA 4D9JA 3CVVA 4CEJB 4AB1A 4RELA 5JDIA 3CCCA 5EKXA 2PZ8A 1SJ9A 3WGUA 4L08A 1QRAA 3G9UA 2FPLA 1B1AA 4GD3Q 2W2QA 1XUOA 1UFVA 2RGXA 3FZGA 3IUMA 4M8KA 1RWVA 2DT5A 5AMXA 3AESA 3RJMA 5HKAA 1F51E 5AKYA 5IC4A 4HVAA 2J59A 4DCTA 1EZ4A 1IHPA 3RVDA 4PW0A 3UJ3X 5HX7A 2VUSA 4KXLA 2HDWA 4YRBA 5KTPA 4X3PA 3IIEA 3P9YA 3FHJA 4Q7LA 5K05A 2PJRA 4OQFA 2GUGA 5AI4A 3ZTTA 4UU7A 2A9VA 5BURA 5BV8A 1SHUX 4D7AA 4NENB 5ITWA 5DVZA 2NZWA 4HRXA 2AI1A 2G72A 2IIBA 4HDAA 4K6HA 5B55A 1R0BA 1AS3A 1P19A 1S2GA 1G4UR 4TXLA 4UU1A 3K0HA 1SU6A 2IYUA 3U9SA 4C22A 5ICCA 1U2QA 4R68A 2D3TA 1WKBA 1DC5A 5J5CA 3ONFA 2E87A 2GHQA 2IYNA 1OXVA 4RS3A 3RK4A 4EATA 5IAOA 3H1PA 3GV0A 4A15A 5JG7A 4D9BA 3FOWA 1FIUA 1AGRA 3GC6A 3CLHA 2G4LA 1XU4A 1CJSA 2EDCA 3AJ9A 5C8YF 1WXGA 3AR3A 1KQOA 1I24A 3TTUA 2F90A 4M88A 3Q7QA 4QEDA 2AG5A 4LRUA 2VTEA 3WHPA 1N8KA 5E38A 5JY6A 4ZI7B 4FM9A 3N0TA 2PT5A 1RIIA 4OYYA 1GGNA 5DNYB 2BFCB 5DLQC 1G5HA 2QLLA 4MV9A 3THYA 4JJ4A 3EULA 1N2CA 2DFTA 1H69A 1T15A 3KZVA 5MN4A 3NTXA 4YJFA 3QE2A 4NOMA 3C7TA 1IY2A 4L5IA 3PKJA 3GBSA 4TSFD 3OG9A 4NYJQ 3V8PA 4EB3A 4JB8A 4P8RA 1KPIA 5BWLA 1XAJA 3PDHA 2M6RA 2J30A 4Q37A 4OO3A 1G5TA 2JHGA 4I08A 2OBMA 5LL6P 4FEYA 1WMDA 2IEYA 2OLEA 4LDJA 1U3DA 4C4ZA 3GVPA 3PEVA 3B12A 1QUFA 1RJWA 4B4OA 1DQYA 1O6FA 1P44A 2Q4DA 3IP8A 4AKSA 4OBXA 4CM9A 1SKMA 1T0BA 3UFXB 2PVCA 1TU4A 4F56A 1QG2A 5L3SA 2FJUA 4JCCA 1VJRA 1JR2A 5DLEA 1Y8QB 1H4QA 1E6EA 5SZJA 3LDGA 3MTDA 1RBMA 1ZW6A 2JGNA 1Z7WA 5TT1A 3F7MA 2D7JA 2X77A 5DX1A 4H31A 5DWVA 2GYWA 1T2FA 5BNFA 2CMKA 5B64A 4M36A 2QVCA 4ZVUA 4YV1A 3PEFA 3RKUA 5HYVA 3LPAA 4KMRA 5ALNA 1BQEA 1JEEA 1YI8A 3OY7A 3UOWA 3A3YA 1A5BB 2D54A 1IK4A 4MTCA 3DTVD 1XMVA 4OI2A 2ZYSA 4O4HB 4XD7A 2OORA 1QF6A 3RRNA 5TB5A 3JQFA 1PR0A 4ENSA 4QUAA 1G3RA 1MQ8B 2JAQA 5BSRA 3R7AA 5A3RA 3U3XA 2MINA 1YS1X 1SD5A 3VH2A 3BZUA 4HYEA 4JITA 2VS1A 1U1GA 4KGDA 5LZ7A 4EF5A 4AY6A 4YAFA 1U4SA 1DAKA 2BGLA 3C3BA 3UIEA 4Z4FA 3UJ8A 1B6RA 3QJGA 5JNWA 2FPSA 1J8QA 1A98A 3GZNB 1XG5A 3OF5A 5E2IA 3UGQA 1ISSA 2FPMA 2XE8A 1Z34A 1L3CA 2I8AA 2RONA 3X1DA 5BXQC 3H13A 1D4ZA 1XDUA 5DM4A 3IMGA 1JLSA 2J3KA 3RT9A 3HO1A 5CA1B 3QVLA 4BMOB 3AW9A 2VAMA 3SQMA 3QF7A 4IVRA 1GD1O 3QOYA 1OX4A 1NUQA 2VJCA 3PDCA 4AJPA 1PJZA 3UAZA 1G41A 2LDBA 1M34B 3R6LA 1T36A 2H7VA 1D2GA 3KQMA 3JW8A 2IKSA 1R18A 2C4VA 2HIHA 4UCQA 1Z18A 1JUDA 1E1MA 3HDJA 3EF1A 3K1AB 3M2TA 3MYRA 4Q9DA 1HT2E 4XIYA 4LF7B 2F9LA 2XUDA 1Z5UA 1NX6A 1PT7A 1U3VA 2HPHA 3DYVA 3K30A 4I1UA 4K6OA 1LDYA 1RBYA 3Q0TA 3TQIA 4AM8A 4BLSA 2DBZA 4X64B 2FN8A 3SNHA 5MFPA 1FTNA 4BNYA 4AKIA 1IYZA 3TCXB 1YZTA 2BPOA 2VK4A 4TWJA 5DHTA 4ETMA 2H11A 3ZWCA 3QBEA 3AF6A 4MWSA 4UVHA 2I66A 4PZPA 1LK5A 4Q3DA 4YWHA 4FVTA 3BB4A 3Q2IA 5DPMA 2QRZA 4PANA 4BFWA 1RXEA 4YBRA 4YJKA 4RVCA 2EEZA 3OQMA 1P7YA 2J6BA 2XAUA 3RADC 1XPOA 2O3RA 4PCVA 1CKEA 3NNDA 4NBKA 3BBPA 4OQPA 3WXBA 5IVKA 4FC7A 1A96A 4EMTA 1RXUA 1C30B 1XA3A 4KRYA 5EMKA 5JT1A 2GXAA 4ZWNA 1GAJA 2G6TA 1NP3A 4LXQA 1HNZB 1BHJA 1M72A 2NAPA 4L9WA 2Y76A 3DPSA 3SSMA 4MR9A 3AV0B 5D84A 4LC1A 2RAVA 5KYYA 1O9GA 1UBMS 4YRCA 2RH4A 5FNVA 4HJRA 4ZPXA 2JVIA 1Y4DE 3Q12A 1Z15A 3NHJA 4RJTA 1E2IA 1YTUA 1RWNA 3LPLA 3ZDAA 3MUOA 3R3YA 3WL3A 2COKA 1KI6B 2O8DA 4ZJUA 4UHJA 2B35A 5GJVC 3HP1A 3GLKA 5AICA 4ZHSA 4Y6PA 1K7EB 2UVQA 1X1AA 2VDNB 3F6PA 4KVZA 1YVPA 1FRVA 5LXTB 3N76A 3AVPA 2MSNA 3FGZA 1U7DA 3K70D 1OFUA 4FMBB 3D8HA 3F4LA 1JFFB 2BFFA 3ZVNA 4UJ5A 2CUTA 1IEQA 4B3JA 1QB7A 1HDYA 2YZGA 4DV5B 2PZLA 5FPKA 4QFMA 3WYBA 3GD7A 1OKKD 2D1YA 1E62A 3IP7A 2NM0A 3UJBA 3HJRA 1QYVA 3RAJA 1XPJA 1PEKE 1GLGA 1X7XB 4O0LA 4HO1X 4YREA 3P2MA 4LJSA 3QKSA 1JDVA 5EGNA 5M04A 2PRZA 1K06A 4IFIA 5KNDD 3GQBA 3MEQA 3A9UA 3KL2A 4D0NA 3FCUB 1KYZA 4X92A 3UK7A 5BPHA 4TLCA 4UM8B 1HTBA 2FOXA 3IAM1 3OWHA 2PUFA 1DDOA 2COEA 4Q01A 4BMDA 3U7HB 2PGIA 1GO2A 4MDHA 3KTAA 4FKZA 4HF7A 4MUKA 3OCVA 4XGKA 3HCDA 3U7GA 5CDUA 1MRNA 3DFZA 4G84A 5CVCA 1VLJA 5BN3A 2GOYA 2VYCA 3FH0A 1EBFA 3R3JA 4EB0A 1U0OC 3EE6A 4CCSA 4EUSA 1TT5B 1X7GA 1QH0A 3GZJA 3MRXA 3I34X 4N03A 3IUYA 4PPQA 1XQ1A 4RF2A 4UFNA 4PLWA 2W42A 1O6GA 2EDAA 2Z58A 4YCMA 1WXEA 3R7BA 4FYPA 5E9WA 1Q6ZA 4EO9A 1JLLA 4AY4A 4FCWA 1SC9A 4QLOA 2BM0A 4LFAB 1HTTA 4IOMA 4Y67A 5B6JA 3A7DA 4RK7A 2ZJ4A 4MRMA 4TMVA 1ZD8A 1ZGHA 3CPEA 1U9IA 2HX1A 1AA9A 5C0OE 3F4KA 3RK0A 4XWOA 1W29A 2NNWB 4M8LA 3U4IA 4RVNA 3TXXA 2JFNA 3ROZA 4C76A 2WT9A 2RHWA 3DBOB 3G8BA 4KYIB 3QNMA 4LY3A 2AQKA 2E4ZA 3SDZA 4J3JA 5J40A 4QOJA 4GWLA 2WT4A 4KTVE 1L8XA 4L50A 5EMHA 1M6NA 3BK7A 3ZU5A 1T8TA 4YUVA 1FYEA 2ODAA 5KMGB 2GILA 1SC6A 3OLYA 2Z8YA 3PDIA 4JMPA 3HWSA 4DA6A 5KYXA 5B3JC 1BKDR 4WUTA 3DMNA 3QV1A 2E0IA 3GU3A 4OBWA 5KIAA 5DKFA 1G38A 1TYEB 4GGOA 7GPBA 1PRYA 4UU0A 3PF8A 4PM4A 3R9IA 1CEYA 1IN8A 4ZALA 2B8TA 3V1YA 4JBIA 4C7VA 1YA8A 4ANFA 1POWA 5BN4B 1DHRA 1X2BA 1QF9A 3WS7A 3PGVA 4DIKA 3RFTA 3FMVA 4MWTA 4KO3S 4OLHA 5K3FA 4GI7A 4CV1A 4D9FA 4PFJA 5FJJA 3EVZA 2ODWA 1NVFA 3BGDA 2OQ2A 3A1TA 3V7FA 1NE2A 3BRWA 3RSGA 4XIGS 3ZGOA 1L5MA 3QHQA 2WTEA 2BH9A 3U44B 2CEAA 2GVNA 3JYNA 1R9MA 1UDAA 1Z56C 3VBEA 3VO9A 2CL0X 4FOPA 2WWYA 2VUHB 1R88A 3QYFA 3TSOA 5IAJA 4JIGA 2P9QA 3MTGA 1UJBA 4BNMA 2JNWA 1RQGA 3LCCA 5GV8A 3FI9A 3ENZA 5FUBA 4R1TA 3EA5A 5GGYA 4D98A 1INLA 3CEHA 3O8BA 5HF8A 2NYUA 5ENVA 5FBZA 3V4SA 2YWFA 3U7QB 3COSA 3DXFA 3VDQA 2FW1A 5JI3E 2QD3A 2P7HA 2YWGA 3IR7A 4CM8B 1GYQA 5L7YA 4IXMA 2O2CA 4OHMA 2BBTA 4ENVA 4K0KB 1P1CA 4PONA 4RTJA 1NXVA 3WQBA 1O94C 5LSAA 1YB2A 2H1SA 2NO7A 3WLQA 5DRTA 4ZN6A 1Q20A 1HA3A 4WERA 4DWJA 3R74A 2XWSA 4CCYB 4GQIA 1M83A 2H3HA 4GIBA 4M0MA 4ZAYA 4RTNA 5D6NA 1SRRA 2RC5A 4X6YA 4V0QA 3QITA 5GY7A 2UUCB 3T9CA 2A0YA 3GJRA 4Z2AA 4O1IA 2JFUA 4HG2A 5FWAA 1YI0A 1QGUA 1MN6A 2XGMA 3I2IA 1QC5A 4QREA 3D6FA 3LL7A 1NLZA 4IVPA 3MGCA 3MJFA 4L8LA 3OCXA 4CKZA 4N82A 1D2AA 2QZ9A 1E2KA 2P9HA 3NHRA 3QIAA 4RVGA 1T4CB 3RUPA 4QVGA 1NN1A 2EFHB 3JQ8B 1F0PA 4ZQIA 4C7KA 1L7BA 1O95A 3L7KA 5K0FA 1SM4A 2C7OA 1LQTA 2LGJA 1FP4B 1J8MF 1PLKA 1ZY2A 1DBRA 1UBEA 3Q8XB 4IXWA 4K86A 1B6GA 1I4OA 2XCLA 2WIDA 2CVZA 3FYSA 4FEAA 4UKDA 3NASA 1CR0A 4HEHA 3SPXA 1WY5A 5C7LO 2C54A 4FUQA 5EHIA 4L5JA 4DAEA 3C3MA 4Z4CA 1L4MA 3IUNA 4ODIA 3EGVA 3CIFA 5CLLA 2BISA 1U0BB 2PUWA 1ESNA 3RIGA 1OU0A 1XZDA 3BAFA 1KKLA 3HXKA 4MLZA 1DFHA 5FLYA 5EPUA 1DXOA 3OKPA 4GOMD 4E07A 1T9GS 2QMYA 3E7PA 1V7CA 2GESA 2J41A 4DW8A 3ECCA 1Z45A 3PJFA 3P9QA 1D2CA 4EHLA 4RZXA 2BJHA 2X3FA 3GJZA 3V8QA 2IE0A 1FEZA 1ODFA 4MRPA 2CNKA 2FR0A 2FNAA 4DGQA 4RF4A 3BKWA 4KRXA 3AV3A 2E4YA 1KMQA 4B3TB 2IY8A 3IULA 3FNIA 4N9QA 3WMXA 2Z9BA 1Z2NX 4Y7DA 3KT3A 2XUIA 2GN1A 5KKCA 4QBHA 3B8EA 3EAGA 2G04A 2VZ0A 2J3MA 2WE7A 3O74A 3PHHA 5A0FA 2ZXUA 4P4SA 4XFKA 5A3SA 1L4HA 4M0EA 4IY1A 2WJ4A 1KORA 2XNDA 1E77A 1H2WA 1AO3A 1BXGB 5H70A 1F38A 2HY7A 1J2JA 4Z4GA 1P0IA 1A8HA 1KO8A 4ZREA 1F6BA 1AF7A 1XZLA 1E5TA 1KIMA 1KK0A 3E82A 3FVTA 3R5FA 5LQNA 4MVJE 3D5EA 3C5EA 3HXLA 3N2GB 4PTYA 4PNHA 1S2DA 1HSOA 2N75A 2ZTHA 2GZHA 1LJLA 2I6FA 3A3PA 2BC9A 4IQ0A 1WMEA 3Q3IA 3GMSA 4JL5A 5DIFA 5EQTA 4NPHA 3UAYA 1QV7A 1JIIA 3V8BA 3WO0A 4BGIA 3WNBA 3C5HA 1FSZA 1LBQA 2LD4A 3LQYA 4OXRA 4QGAA 3TMAA 1M6WA 2OV6A 4HH0A 5BYKA 1E2FA 4IIEA 2IUFA 1NPTO 2Q62A 2Y1DA 5ALQA 1D09A 1M1YE 2B6HA 3CVOA 4JLDA 1GDDA 2WINI 4QYMA 5BW8A 3ZLBA 3WRVA 4ITUA 3KR2A 4GR9A 1NY5A 2HYIC 3OOJA 5DSZA 3ILSA 1TAQA 1LS6A 4C03A 1T8PA 4R0VA 2OP1A 1RI5A 4X6XA 1JBKA 2BL4A 5FXMA 1U8AA 3R9XB 1Q0SA 3OT1B 3PUJA 1RXCA 2FZ5A 2ZCUA 3L4KA 4DRZA 1CHDA 5CHEA 4ZGWA 4PYNA 2JDID 3EIFA 3I9KA 2P5YA 5LQUA 2PRSA 2FA9A 1ZS9A 2BDTA 1P5FA 2F62A 2YZMA 3DPUA 4M0LA 2FRDA 3A1NA 3AU9A 3MWFA 5CH5A 1U7TA 3ZY2A 1U90A 4D4GA 1LY1A 4DJ5X 4KUGA 4JP5A 3OHMA 5KJ6A 3DL2A 4DV4B 1EXMA 4UUMA 4OKSA 2H92A 4RADA 1R0WA 5F1OA 4YJHB 5F9FA 3WGLA 1U7ZA 3EWNA 2D2FA 4ZU1X 4BLQA 3TGPA 2OGSA 3K53A 1DPFA 5JALA 3M9XA 1E79D 4UPDA 4LK2A 1TUGA 3AHEA 4DRXA 1TYCA 1UEIA 1TW3A 5K3AA 4RTPA 1JRLA 5ES3A 5ALTA 5BXYA 5KVSA 4PC6A 4PRYA 1K89A 1JIUA 1NNEA 2J4DA 2QN2A 1DEOA 1PT8A 4N0EA 4F4UA 2C77A 4Q3BA 2Q3FA 3ZI4A 2G9QA 4R1MA 5TE9A 4E70A 4PS1A 4XVCA 2A1UB 3DOCA 3N5KA 3QBDA 5ICMA 1TA0A 4NJMB 3E3NA 1VMEA 2HU8A 4R2LA 4G0XA 2H9IA 1TK9A 5AJZA 2BR5A 3FKSA 3G2MA 2HPVA 1AV6A 3DA8A 2DR3A 4CKCA 2TS1A 3AX6A 4LCBA 4CTKA 1DZIA 1BDJA 1GQOA 3EA0A 3FSEA 2HCRA 1T4GA 5IHXA 3AI3A 4XYEA 3TLBA 2NUPB 2RGWA 4LIPD 1IOLA 1WZIA 3Q15C 4M0PA 4M76B 2O2SA 1CUGA 4GC9A 1GL3A 6ADHA 3IMKA 3O73A 4AVYA 1IUNA 2UUBB 1JIKA 4MB0A 4GWKA 1U04A 2CJWA 4DREA 2B7LA 3EOBI 3F47A