2XMQA

Crystal structure of human ndrg2 protein provides insight into its role as a tumor suppressor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
281
structure length
281
Chain Sequence
AKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIENYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Ndrg2 Protein Provides Insight Into its Role as a Tumor Suppressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords PROTEIN NDRG2
total genus 89
structure length 281
sequence length 281
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03096 Ndr Ndr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xmqA00
1MJ5A 4BB0A 1JU4A 3G0CA 1CUCA 4CIAA 5AM4A 2DR0A 2XUHA 3ILSA 2QZPA 4TPKA 4DLNA 5JANA 1GPNA 1XRLA 4X7BA 5JD6A 3AIMA 4X97A 5KWJA 3JW8A 3KXPA 3PFBA 2C5GA 3WWDA 3H1BA 4CG2A 3LP5A 2HU8A 5CMLA 3EQ7A 4YK7A 2RHWA 3PF9A 5DTJA 4N8DA 1WHSA 2C0PA 4UBJA 2ZYIA 3QITA 2VJAA 1XQWA 1Y37A 2XQKA 2NW6A 2XMSA 4BE4A 4KR0A 3NOXA 4Y2TA 3STWA 1JT2A 4DMFA 5EIAA 4QE3A 5JZSA 5JYCA 2HRQA 1Q0RA 3PE6A 5JZBA 4MYSA 1XZHA 4TGLA 5CXXA 4ETWA 4NVRA 2H9YA 4OCZA 2XLCA 5T4EA 3RM3A 4H7KA 4LHEA 3R3VA 1DT5A 4AO8A 3ESAA 1P0MA 3IULA 3WJ2A 2DFPA 1W6RA 4MJ3A 4FLMA 4EY6A 2ZYSA 2V96A 3E3AA 1AGYA 3AILA 5AP9A 2GZSA 4HRXA 2GBFA 4DNPA 4LYEA 1YA4A 2OGSA 1H22A 2WU4A 5AI4A 4BP9A 1W1IA 1WOMA 4MWSA 5BWCA 3HLKA 2JEZA 5KREA 1DWQA 5FOQA 1A8SA 1CUHA 1XQVA 3F98A 2QTBA 2VAXA 3G9XA 1B41A 3ANSA 5K5EA 4C4ZA 2XE4A 3WMRA 3HSSA 1BROA 3H18A 1EXWA 1R88A 3AZQA 3HJUA 1CUDA 1CEXA 2GYUA 2P8SA 2VJBA 4G8DA 4F5ZA 5JASA 5ALDA 3VVMA 1R1DA 2WG0A 3I1YA 3I2JA 5YASA 2WFLB 4UHHA 1HL7A 1P0IA 4JYPA 2QOEA 2HHAA 5ALXA 3ANTA 1XFDA 3L1HA 4FOLA 1HQDA 2RI6A 1CUXA 3WA6A 4UBOA 1WPRA 4UBNA 3D0KA 3H0CA 4C01A 3DL7A 1Q83A 3N2ZB 4DM7A 4DIUA 1XRRA 4JNCA 4KRYA 2XQJA 3H1AA 2YH2A 4A5SA 1QZ3A 1RYYA 4BRZA 3WL7A 3H2KA 4H0CA 2PBLA 3M82A 3UMJA 5EHZA 1TKRA 4PO3X 1JMYA 4P92A 4X00A 4XVCA 3VVLA 3Q8WA 4L0CA 3F8SA 4YASA 1K5PA 4G9EA 1U2EA 3S8YA 4E11A 5A71A 1K8QA 4DNQA 5HK9A 4LXIA 4MQMA 5K3FA 1CR6A 3O4HA 2BKLA 4U2DA 1AUOA 1IUOA 4IH4A 3DYIA 4Y2XA 3G0DA 1LPAB 3D5EA 5FPPA 5EI5A 5EFZA 2OQVA 3V9AA 3WLAA 5FUMA 1MNAA 3EBLA 1AURA 1GKKA 3FSGD 4Y2YA 4FLEA 3ZLUA 2ONCA 1ZI9A 1CIJA 5HKAA 2HIHA 4IH9A 4N5HX 5AKEA 3M83A 4IH1A 5ALZA 1K4YA 3WWPA 5AK6A 1TCCA 2G5TA 5AICA 4ZGBA 1XZDA 5E4YA 3W9UA 4J0KA 1WPXA 3QMMA 4UUQA 4EY8A 4OPMA 5CT8A 2ZSIA 4ZV9A 2VATA 2WIGA 3V1KA 5AO9A 1GQRA 1ZGCA 2JBWA 4LKOA 4Y2QA 3PICA 4WCVA 2HRRA 5DNWA 3IBTA 3OM8A 4OB6A 1LBTA 1MX5A 4QDTA 4QWMA 1OILA 4DSAA 2ACKA 2Z3ZA 2ECFA 3D7RA 2ZSHA 4G5XA 3RLIA 3HZOA 4M0EA 4GHWA 2VJCA 4QDZA 3RARA 2BUAA 2AJBA 4OU5A 2C58A 4DNOA 3WK8A 4AXBA 5LKAA 3H2GA 4J0CA 2D5LA 2RIPA 4N5IX 2HA6A 1YR2A 2HA2A 1BN6A 1XZEA 2Y2UA 2PU7A 4QLAA 3WIOA 1Y7HA 1IVYA 3L1IA 3HEAA 4BTVA 4BRSA 1YB6A 2CZQA 4B0PA 2GBCA 3LS2A 1XZBA 2CUTA 3BJRA 3LIPA 1GZ7A 4QNNA 2PL5A 5ALLA 2V9ZA 4Y2UA 1BCSA 5AK3A 4G1FA 4NMWA 5C8XA 2HL6A 2XUKA 4E14A 4Y2RA 2WTMA 1ZI8A 1E3QA 1JJBA 1MN6A 5HK8A 3LLCA 4FFWA 1MAHA 3E0XA 2WU3A 1LPMA 3DL4A 5LYYA 1G5FA 2H7YA 3LCRA 2XUQA 3KDAA 3FLAA 4W1PA 3H17A 2AXEA 4X6YA 5BV7A 2QKYA 3B12A 2QT9A 1BEEA 1L7RA 3T4UA 3SX4A 1LLFA 1E8DA 3DKRA 4KAJA 3FYTA 2HDWA 3EQ9A 3ESDA 4ROTA 3ED1A 1TRHA 3FNBA 5HKBA 1JJIA 3WL6A 4UFOA 3L1JA 4F60A 1YSCA 3EQ8A 5JAUA 3I2FA 5AI8A 4B81A 2WG1A 4UBIA 7YASA 3M3DA 2Y6UA 3OURA 5K3BA 1UKCA 3SWWA 2JGEA 4G9GA 4H77A 1EX9A 1PFQA 2RHTA 4AX4A 1JMKC 5JD4A 1R50A 1EB8A 3I2IA 5K3EA 5AM5A 1K6EA 1EINA 1CUUA 1YAJA 3EIOA 1ZD5A 4B0OA 2PVSA 3G0GA 4KE6A 3QPCA 1SCQA 1UKAA 4X85A 4DMCA 2K2QB 2GYWA 2XUGA 3AFIA 2XT0A 1DU4A 4BDTA 2QUBA 1LPBB 3MGAA 4PQEA 5EHNA 3WK5A 2B61A 4OB7A 1E8NA 3HI4A 1MTZA 3B3QA 1XZGA 5A6VA 4GI1A 5CW2A 1XZCA 2WFMA 4I4CA 4ZWNA 4HXEB 3KWFA 4Q34A 2RONA 5T4BA 2JGJA 1P0PA 1QIMA 3PUIA 4WFIA 5ALHA 5FLKA 3LIIA 5FDFA 3G02A 4FMPA 1FFCA 3QMWA 3VXKA 2Y1KA 3A2NA 5ALVA 1FJ2A 3PUHA 3GUUA 3K9BA 5CT5A 3HABA 1LNSA 1AQLA 1LZLA 5ALTA 2X8BA 4H7FA 3FAKA 3DOIA 4WFKA 1DINA 1XQYA 4DYHA 2HA7A 5ALUA 1CFJA 4UHBA 4E46A 4FWBA 4DSZA 3A6ZA 4P08A 3W04A 5E4JA 1UK9A 2C7BA 4U2EA 3GZJA 4XIIA 4PF1A 4FNGA 2PSFA 4AQDA 1XKLA 4Y2JA 2HFJA 4MEAA 3DD5A 4G4JA 2PU5A 2XI4A 2QS9A 3PF8A 2ORYA 2GBIA 2HA0A 5HZGA 2OLEA 4B83A 2WSLA 1HPLA 5K3DA 1A8QA 4X6UA 3WWOA 3WK9A 2Z8XA 3R0VA 1ODTC 3DKKA 5DNUA 4XJVA 1QIKA 5IVDA 4Q3OA 1OCEA 4FLFA 2FUKA 1CUJA 3SK0A 2OAEA 4L72A 4ZI5A 2OG1A 3WKAA 5K3AA 4ARBA 1THTA 4YPVA 1Q0ZA 2LIPA 1DWPA 4BP8A 1WHTA 2W22A 2ES4A 1Y7IA 5HFNA 1XRNA 5JZ9A 3D2CA 1XZJA 4XWGA 2OAGA 4M0FA 1WB4A 3HRHA 4X71A 4BC1A 3VISA 3FOBA 1JFRA 2UZ0A 5IVHA 2XB6A 3I2GA 2HFKA 2VAVA 4HVTA 1EDDA 3DOHA 3HACA 5AOCA 3ICVA 2Q0XA 4KE9A 5EGNA 4AZ0A 5E2IA 4B84A 5FXMA 5AIBA 1QJ4A 1ACLA 3IUQA 3DQZA 1K63A 3BF8A 1YB7A 3C8HA 1YASA 5DNVA 3G8YA 2V98A 2PSJA 5AKJA 4UPDA 1LZKA 4GDMA 3NGMA 3H19A 4H7EA 4LXHA 3HC7A 1GGVA 1QIHA 3O4IA 3JWEA 4BE9A 1XZFA 3I6MA 5AKYA 4JYMA 2VT7A 2WQZA 4FFVA 3OTQA 3WKDA 4WJLA 4GEGA 1D07A 3D4LA 2XUIA 2I03A 5J3JA 4MQLA 1MNQA 1LBSA 2HA4A 3S2ZA 4RGYA 1IUPA 1QTIA 1EVEA 1QGED 1QFSA 1W76A 3KWJA 3UUEA 4RE6A 3AZPA 4H18A 5JIBA 3ZWQA 2PSHA 3WKBA 2WUFA 4KJXA 2WUGA 4BVKA 5AM3A 5JATA 3DDUA 3IURA 4NZZA 1WB6A 1CLEA 2ZVDA 5BWBA 4AMYA 4ZXFA 1MAAA 4H7HA 1EDEA 5JARA 5LZ2A 2PSEA 4KE8A 4BCDA 4HXFB 1TCAA 3QZUA 3V1NA 4BBZA 2WTNA 4HTAA 3HXKA 3FVRA 3STTA 2OGTA 4U2CA 1JU3A 2JGFA 5AI6A 1BEZA 1XZMA 1VXRA 5HCUA 5KBYA 3K2IA 4GECA 3H2IA 5D3ZA 1FSSA 2HA5A 2XUPA 4F0JA 3I1IA 3ESBA 3UUFA 2BCEA 1XRPA 1G42A 2BUCA 1TAHA 2H7XA 2ZJ6A 3D3NA 4QDXA 4W1RA 3FCXA 2X76A 3WI7A 1W75A 2BFNA 3AINA 4UBLA 1WB5A 3C45A 2WUDA 3B5EA 1QFMA 1H23A 4X93A 5IKXA 4E15A 1VE7A 2I3DA 4W63A 1ZICA 1NU6A 3FVTA 2CJPA 1IUNA 3I6YA 3STXA 1UWCA 4PSCA 1C7JA 1GKLA 3G9TA 1FFBA 3KOOA 3TEJA 3IUJA 3R41A 3ZLTA 1YAHA 1H2YA 3STUA 4YX9A 4UHEA 5FP0A 4J3JA 1WCYA 2XMQA 1L7QA 4UHFA 1R9NA 2IITA 3OC0A 4AO6A 4GWLA 1ZD4A 1DQYA 2QR5A 1UOOA 4X91A 5AM0A 3WJ1A 1LPNA 1VOTA 4G4IA 2VSQA 1F6WA 5AJHA 2DCMA 4KRXA 5CT4A 1N5RA 5CURA 1F0PA 1NU8A 4IHAA 3F67A 4Q3KA 3FYUB 4B9EA 2ZJ7A 2WM2A 2C4HA 6YASA 2IX9A 1PV1A 4OSEA 5A7HA 1C7IA 4U2FA 1KU6A 3DNMA 3A2MA 3WQHA 2AJCA 4UFNA 5HFAA 1DX6A 1U4NA 4JH0A 4B85A 4AMZA 5DWDA 1E66A 2XQGA 3FWHA 1MPXA 1LGYA 1XZIA 2QXUA 1W52X 1EVQA 3ICWA 1H2XA 1NX9A 5EHQA 1HDEA 3DEAA 4W1QA 3AIKA 1CUYA 2WFLA 3CCCA 5FPQA 2QMQA 4G4GA 4GW3A 4S0XA 5AKGA 4CCYA 2XUAA 3V48A 1UK7A 2VQ6A 2VJDA 4H7IA 5DTIA 4CI9A 5LZ5A 1CQWA 3C6ZA 2RAUA 1JJFA 1QO7A 4HS9A 1CUAA 5D7BA 1UFOA 4Q82A 1VA4A 2WJ6A 3O9MA 3X3HA 3EF3A 3DJYA 4CG1A 1MX9A 4WY5A 1SOMA 4KE7A 1VZ3A 2WIDA 4MEBA 4J7AA 4UBKA 1QIIA 5ALRA 3FYUC 4BATA 4J03A 1O6FA 5AK4A 5AOBA 3F9CA 4EB0A 4Y2VA 2G4LA 1ZD2P 4WDQA 5LKRA 2PUHA 1XKTA 1Q84A 1RWQA 5AI9A 3SC2A 3G9ZA 4DMHA 3YASA 2AJ8A 5HF6A 2ROQA 3FSGA 3C6BA 3PFCA 3IA2A 1HBJA 2CMFA 4IQ4A 4W1SA 3BXPA 2QJRA 4K6HA 4G8CA 1U8EA 1ZGBA 3K6KA 5ISMA 1ZOIA 4CFSA 5LP1A 3C5VA 1LPSA 1GPKA 4FHZA 4GXNA 4C87A 5JAOA 2O2HA 5ALOA 4ZRDA 2DQYA 2J3DA 1EDBA 2JIDA 5CT6A 1YA8A 1T2NA 1UOPA 3MUNA 5AI5A 1QO9A 5AOAA 4CCWA 4FKBA 2BUBA 1BS9A 4K6KA 4OYLA 2I78A 5KWIA 1ISPA 3RK4A 1P0QA 4QEKA 1CUEA 3U1TA 1UK6A 1JKMA 1VJ5A 1VXOA 3BIWA 1GXSA 3I2KA 3CXUA 4JUIA 4I3FA 3BF7A 3QPDA 1QLWA 2DSNA 3WK7A 1BU8A 2BGRA 2B20A 4P93A 5IVIA 3W06A 5ALMA 1AZWA 1O6GA 5CRIA 4Y2SA 1VLQA 1GQSA 3WIBA 5ALJA 3G0IA 2VEOA 2XMBA 4EZIA 3R3UA 1VE6A 3NWOA 1OXMA 1ODCA 3DS8A 1A8UA 1XRQA 3QVMA 4L3WA 5LIPA 2HU7A 2JGIA 3G9UA 2O7VA 2XMGA 1XQXA 3WYNA 5EIEA 3FBWA 1EB9A 4CCYB 1UT6A 1H2WA 1FFEA 2OCIA 4C88A 4X92A 5DLPA 1XRMA 3H2HA 1DX4A 4QDUA 4BVLA 3NUZA 5ALWA 5A7GA 1XROA 2VF2A 2H1IA 2D0DA 4X95A 3R3XA 4FNMA 1J07A 1T4MA 3HYSA 3R3YA 2JF0A 1HLGA 4I19A 2WLSA 3G0BA 4EY4A 1VZ2A 5DYTA 4C4YA 1CUSA 2FJPA 1J2EA 4ARAA 1YS2X 1CUWA 5AKIA 2WHRA 3G7NA 4J0GA 3O4GA 1ODSA 4PW0A 4ZREA 3JYHA 3V1LA 5D6OA 2V97A 3MUOA 3GFFA 5CH5A 2J4FA 4PNZA 2EDAA 2OCKA 1E8MA 1AMNA 4FBLA 1CUFA 5AKLA 2I3ZA 4RNCA 5HF5A 4EHBA 3FCYA 2EEPA 3WA7A 4OB8A 5JADA 3F97A 4Q1VA 3WWCA 2GZRA 1MT3A 4H7DA 5E4TA 4XX1A 3ZV7A 3WZLA 1ORVA 2BJHA 2Y6VA 4HXGA 4BZWA 2WKWA 4BAUA 5DYYA 3CN7A 5JAHA 1THGA 3AJAA 3Q0TA 1UKBA 5ALSA 1SCIA 4B6GA 2WG2A 1EI9A 2JGLA 3FYUA 3STYA 1IZ7A 1AKNA 3OPMA 1XLVA 2YXPX 2PSDA 4H35A 3WKCA 5K3FB 1R3DA 2QUAA 2WIJA 3BL8A 3ESCA 4RE5A 1UK8A 2XUJA 1M33A 2Z5GA 3IUNA 3C6YA 3E4DA 3D59A 2WILA 3R40A 1ZIXA 3WWEA 1AC5A 5SYNA 3A2LA 5ALYA 3CCBA 1BN7A 4N8SA 5T4FA 1SFRA 3ZI7A 2OXEA 3MVEA 4FTWA 5I9IA 2WHPB 4BAZA 4X90A 1F8UA 5HQ3A 5C81A 1XZAA 4JEIA 1ZD3A 2ZJFA 4AB1A 2W6CX 2RGUA 4H7JA 5ALKA 5C8VA 3VJKA 3C87A 4BC0A 1VKHA 4OD0A 1ETHA 1TCBA 5AHXA 3TGLA 3V1MA 2XLBA 2DHCA 2BAGA 1QIGA 2VA9A 3IVMA 2PKYX 3QM1A 4LYDA 1CUZA 5D3KA 3O9VA 2R8BA 2XMCA 2VTVA 3O0DA 2QXTA 5CTAA 1A88A 5CXUA 3IUMA 3C5WP 1CV2A 1J1IA 1U65A 5ALPA 1LPOA 5A7FA 4DNFA 2XMRA 3W2TA 2ZYHA 5A62A 3VJLA 4NS4A 1QIDA 3AUKA 1EH5A 3WYDA 5FKJA 5CT9A 2B9VA 3TRDA 1G4HA 4L9AA 4K5QA 2WIFA 4X3CA 5T4HA 3T52A 1QIJA 1UXOA 4KACA 4AO7A 1H2ZA 3QBJA 3KSRA 3VDXA 1RP1A 4N8EA 2HU5A 3M81A 4C89A 2WJ3A 3F96A 1L7AA 4AN0A 3IIIA 3WL5A 1UOQA 4MWTA 1SCKA 4DMKA 2OPHA 4OUKX 4AZ3A 4HZGA 1EA5A 1FFAA 5SYMA 2O2GA 2WJ4A 4C4XA 2XUOA 3RKSA 2IIVA 1EK1A 4OYYA 3TJMA 1PJAA 1ZJ5A 1KU0A 1I6WA 4QA9A 5HF9A 2JGKA 2WHQA 1VA5A 2GYVA 1ORWA 5C8ZA 2QVBA 3WK4A 1TK3A 1TQHA 3A70A 4Y9SA 3QPAA 2BGNA 3BDIA 2XMZA 2Y2VA 2OCGA 5CH8A 4J0IA 1CRLA 2AJLI 4GBGA 2C5FA 2FX5A 3VJMA 2PUJA 2WHPA 3OG9A 4W9RA 4EA6A 5AH0A 2E3JA 2XDWA 4FBMA 1ZI6A 2R11A 4KAFA 3WKEA 5CH3A 1CQZA 5K3CA 1CVLA 3PDCA 3CN9A 3C6XA 5AKZA 4DTCA 2H7CA 4B80A 5AKKA 1IZ8A 3R3ZA 5ALIA 2QJWA 3AIOA 4Q3LA 5HQ3B 4BDSA 1USWA 1X2EA 2JEYA 3I28A 1F0NA 2DHDA 1MO2A 4MXDA 3BJMA 3KD2A 5ALQA 1B6GA 4LIPD 2ZYRA 3GELA 5LZ4A 4BYMA 3IB3A 4CIBA 5I7UA 5H3HA 5DYWA 4B82A 4BZZA 1QIEA 2PM8A 1W4LA 3I6ZA 4OU4A 5JAPA 2CB9A 4U2BA 4EY7A 3I2HA 2JGMA 2C0QA 2OGZA 3GBSA 4A16A 1XLWA 4UHDA 3U0VA 2EDCA 4QZVA 4X6XA 4AN1A 2PX6A 4K2AA 3QH4A 1QOZA 3ZLVA 3DYVA 4O08A 2WFZA 4D9JA 1G66A 1CUBA 3WK6A 4IO0A 5IVKA 1R4ZA 2XUFA 4BCCA 4KEAA 5AIAA 4J0JA 4BCBA 2B4KA 1DTEA 1AX9A 2XMDA 3IDAA 4LXGA 2CBGA 3GROA 2YASA 3QMVA 4Y2PA 5AM2A 2XQIA 1N5MA 1WM1A 4TVKA 4CG3A 1KEZA 3OOSA 4KAAA 5A2GA 2ACEA 3BWXA 4B9AA 3AZOA 2HA3A 3BDVA 3W9BA 5AKHA 1X70A 4RPCA 3C70A 1E5TA 4WY8A 3N0TA 1QTRA 3FLEA 1A7UA 5ALFA 2PPLA 1ZJ4A 2AJDA 3H04A 5AK5A 4QDOA 3D2AA 2WUEA 3O4JA 2FJ0A 4BTLA 1BCRA 4BVJA 4EBBA 1EK2A 4PSDA 4FDMA 1IMJA 4PSUA 2HADA 3ZPXA 5ALEA 4QLOA 5CBKA 1MU0A 4A23A 4X94A 1MX1A 5JALA 2OCLA 2QRUA 4ZV7A 4UHCA 4DGQA 2X5XA 4V2IA 1CUIA 1CUVA 4Z49A 2O2IA 5F4ZA 3E1GA 4Q05A 4WDRA 4UFPA 1TIBA 1XZKA 2OQIA 3PI6A 3R3WA 3DLTA 5LZ7A 1R9MA 2G5PA 1BRTA 4M0MA 1EHYA 4G8BA 3WZMA 1XZLA 1GT6A 1DT3A 3C8DA 3O95A 1Z68A 2J4CA 1S8OA 3FLBA 1ZIYA 1DQZA 1FFDA 4J0DA 5I8PA 2Z3WA 5DJ5A 3D2BA 1DWOA 3DCNA 2CEKA 5FRDA 5LLSA 4KYVA 5ALNA 4K6GA 5FV4A 5BOVA 1CUGA 4J0HA 5JD5A 2DQZA 1N1MA 2J3QA 5HF8A 3STVA 3BE8A 4QWWA 4C6HA 5LZ8A 1J06A 4UBMA 3QYJA 4EY5A 1JI3A 2HM7A 5AI0A 5IH7A 4HAIA 2CKMA 1E89A 1BE0A 4F21A 1YCDA 1SC9A 3P2MA 4INZA 5AM1A 1YS1X 5C7YA 4P9NA 1N8SA 3WL8A 2XUDA 4U2GA 4WFJA 2QM0A 1CPYA 4ITVA 5AKXA 1LPPA 3W05A 1QONA 2VT6A 1HKHA 1C4XA 2XQFA 5ESRA 1UZAA 5EHXA 4BAGA 2YYSA 4GLBA 4B7ZA 1X2BA 5EIHA 2GBGA 2Z8ZA 1GPLA 2DHEA 2G63A 2WIKA 3H2JA 1ACJA 1XLUA 4Y7DA 5ALGA 4MYDA 4PV7A 1QIFA 5LZ9A 1QE3A 4HRYA 3C43A 3VKFA 2O7RA 3GA7A 4EUSA 3BIXA
chains in the Genus database with same CATH superfamily
3H4VA 2XD9A 3TLBA 2RK4A 3A7DA 2E37A 3K0FA 3AVUA 1UMDB 1SQ0A 1I3CA 1F7VA 3ELWA 3R5KA 5HQJA 1MX3A 2G9QA 4HNUA 2UUBB 1G3QA 1DRVA 1ZJYA 4EMUA 1BNCA 4CEHA 1LBHA 4YY3B 1ATIA 3DF7A 3ILSA 4XJSA 2FI1A 2LD4A 3IQZA 3WIUA 4W5HA 1VSUA 2C7QA 3TIVA 3X1MA 1GPNA 3BM5A 4JVLA 3UH1A 2CLHB 3V9PA 5IF9A 3F9IA 3SQDA 2PBFA 1PZFA 3AIMA 2WAMA 1AK1A 3EUAA 2RK6A 1A8HA 3SIWA 4A1FA 1DVRA 4C2BA 5F1PA 4ETMA 5FHRA 5BYBA 2J5QA 5AW3A 4CIYA 4N3GA 5I7VA 1XMXA 3VHRA 4ENPA 4IUYA 3I05A 3R7NA 1Z5OA 3HKCA 2Z08A 4NCXA 1F7UA 3ETHA 3H1BA 3IDSA 3NV7A 1WCWA 2P6UA 2ZTHA 2C1XA 4MAMA 2MYNA 5A4MS 3DOEA 3EQ7A 1Z4PX 2RH4A 4K6CA 1QCYA 3R3SA 3PF9A 3A05A 4FZ3A 4QULA 3ZLBA 1NJ5A 5KYXB 3QY0A 2C0PA 1WUTA 1M34E 2D6FA 1KQ3A 1T29A 2G4CA 2GK6A 1C0LA 1IY9A 2IJGX 4PBRA 4BNLA 4GRAA 5JNSA 3IP3A 3K96A 1UBUS 4NLLA 3S3TA 3CX3A 5G0SA 1Z39A 3N6RA 5CBPA 3C3CA 3K9HA 1OJLA 1F9AA 2XMSA 3EDYA 2Z2XA 1D0VA 2K2WA 3L7BA 2G0NA 1ISSA 1O87A 2L0XA 3NOXA 4Y2TA 4AKSA 5DHTA 1R6UA 2Q4BA 4RJLA 3CZAA 4F91B 2CJYA 1KZGB 5JZSA 2V7QA 1PS8A 3FHJA 4IDPA 4V0MA 3ZE7A 3M6MD 4P5EA 1WLYA 1LI5A 2UKDA 3EFOA 4N7MA 3TSYA 4ENSA 3KPJA 4ZO8A 1EA7A 3IELA 4HB4A 4TGLA 1NATA 4Q4CA 3QE2A 1QRUA 4LZAA 3LAWA 4NVRA 4UULA 4YHBA 1BDBA 5JXWA 5DYGA 5FI0B 1NZDA 2EGUA 4Y1RB 1NBHA 4YP6A 4YJ2A 2BFEB 2VNSA 4OCZA 2HRDA 4BMDA 1NC1A 2F8MA 4M98A 3R7LA 4D3SA 2Y1XA 2FWIA 3OZDA 4Q7LA 1UFVA 5BN1A 1VMAA 3JYOA 4CM9A 4Y6QA 2QB5A 3RM3A 1K1EA 3FNEA 5KQGA 3LKVA 3DE6X 2ZM5A 4F3CA 1KE2A 2VPWA 1IBCA 1DCKA 1MB9A 5TMEA 4XSGA 3PHJA 1I7PA 1FQOA 4FE4A 3LO5A 1N0IA 3IULA 2QL7A 2UZ1B 1UPFA 1QSGA 2Y1GA 4ZAVA 1F5NA 4MJ3A 2C3OA 4EY6A 1SOUA 2XGGA 4IO1A 5GJWC 5I9MA 3GLGA 1OLUA 1DFGA 3PQ7A 5HUQA 2FPIB 4AFNA 2P2SA 2H1VA 4MR8A 4HH0A 1AGYA 4DG9A 2RHJA 5G0TA 4R8RA 1CY1A 3KQPA 2R4UA 2WZBA 4P98A 2HDOA 4AVYA 5A5VA 3DGFC 3CUWA 5FUVA 1U98A 2REQB 3GCXA 4QYXA 3GIDA 2VDMB 2JZCA 1R6AA 4OX9Y 3HXPA 2OGSA 1HYEA 4DJ5X 1NUSA 3TZKA 3DTVD 3UTCA 1KOLA 3JQ8A 2B4TO 4BP9A 2PGJA 4MUNA 1WZEA 3FVQA 4LJ4A 3UWDA 1UAAA 5J2UF 2IS1A 2Q9AA 1PL6A 2D54A 2PEZA 4CMCA 3MPUA 1GWNA 1Y48E 1Y7TA 4KIWA 1S8AA 1A8SA 1O08A 5C8YA 3LSTA 5K4AA 4C78A 3BZBA 1X8XA 2PZBA 3F98A 1SKYB 1IY8A 2Q6LA 5KB3A 1T5HX 2A9RA 1V4BA 4OLJA 4J94A 4B6QA 3LHSA 2CXQA 1KYIA 3ZGVA 3GLRA 3NOQA 3LOUA 3IUEA 2HJ9A 4R81A 1KAQA 1SVWA 3TX2A 3WMRA 3HSSA 3ZNPA 5HRAA 1RPJA 1KH3A 3DMHA 4HQLA 1R88A 4CLEA 1SVLA 4X1OA 1XL0A 1UIRA 3AZQA 2FPPB 3VNSA 3G49A 4JJZA 1CEXA 3JQBA 5SICE 3ER8A 2HMYB 1PSDA 2VJBA 3ZWMA 4RX1A 4GUDA 3I6QA 1QAQA 2BZ0A 3ESZA 1T10A 1AF4A 2WG0A 5F35A 5YASA 4ZYYA 2WFLB 2HSJA 4N54A 1R6DA 3S70A 1TUEA 5K3OA 2F8TA 1OT5A 3M34A 4V39A 3DBRA 4LKRA 3WMFA 3SXJA 1P0IA 2DRIA 2IYQA 2OZVA 3C3KA 1OGJA 2QG4A 2BMFA 4L2IA 3ANTA 1XFDA 1NQ5A 3P0JA 2UUPA 1U9IA 2XITA 2RI6A 2WB4A 1LW6E 1WMFA 3RYTC 4XCQA 1WPRA 1ZM2A 3A1VA 2GT1A 4PQRA 4UBNA 3WBBA 3EE6A 2ILVA 4M1TA 1YACA 2GEBA 3T7JA 1FFXA 2VYQA 1CIPA 1U0TA 2XVMA 4AROA 1QRTA 2JJQA 2WNHA 1MIOB 1Q83A 2C20A 3DL7A 2AFRA 1U8FO 4ILEA 1I32A 2OYCA 4ZEMA 1G20B 4BLQA 3WXBA 3DHWC 3GN2A 2REOA 2CHEA 1LA2A 4GBMA 1SH7A 1N3YA 4YP1A 1KPIA 3DXXA 4IEIA 8GPBA 1GGJA 1KDZA 1XWIA 1FNDA 5CFNA 1P6XA 5F9HA 3F47A 5K0SA 1W2HA 4OO3A 4IIJF 2ZJ8A 5G1OA 3UMMA 1TTTA 2XQJA 2LVBA 3H1AA 4V1CI 2YH2A 2TMKA 4TS4A 5D5PA 4A5SA 4BMSA 5HJEA 1E2NA 1QZ3A 4BRZA 1DS6A 1DELA 2NZYA 1EFRA 5EZYF 3GU3A 4NBLA 1GTRA 3MBOA 5HMMA 1USUA 4G56A 1SC1A 3PG5A 4RVFA 3RKRA 3UMJA 2X23A 2PCJA 3GFTA 3PA8A 3AUAA 2PR7A 4L4SA 3TQHA 9LDBA 3EUFA 3KR2A 2ZWAA 2VI5A 1EEXB 1T1JA 2G1JA 4QPJC 1WCXA 1CULC 3BREA 1SBIA 2B78A 4ESOA 5KOJA 3AVPA 4MWDA 1E9FA 2BF7A 2OCYC 2WOOA 3VVLA 3I8OA 2PUVA 3TNFA 3HGTA 4CDRA 1YRYE 3RYFB 1JE1A 2HMSA 1PT8A 4DLBA 1JKJB 1WDTA 2ETXA 3SYNA 1WZIA 2IUTA 2C96A 4IJ5A 3KQLA 4QUGA 5EMHA 1YZUA 1V1MA 5LWHA 3EZNA 3CB4A 1R8YA 3V55A 1KK1A 1V2HE 5A71A 3UJ7A 4BMZA 1J1ZA 1NASA 4JEHA 1T6ZA 3D3WA 5TVKA 4ZCIA 5K0LA 5K3FA 4YDHB 1DPFA 4BJ5A 3KUKA 4ZAYA 3DLCA 1KSJA 4RFSB 5LJLA 3TRJA 4EUEA 2EF0A 3C39A 3O4HA 5JCJD 3PEYA 3EUEA 3O84A 1DC4A 3FHLA 4PHGA 4ZI7A 3M5DA 4RF2A 1L5OA 1TLLA 1IUOA 3DKVA 3E7FA 2I65A 4U2DA 1XALA 2OTCA 3IAUA 3L7IA 1GRCA 4PZLA 1U0EA 4O0MA 2O2XA 2DXIA 3PLNA 5T67A 2Q49A 1L1FA 1EZZA 1J97A 3OFSA 5KINB 1XCMA 2Q6TA 3K0HA 4N3NA 5FPPA 4NWIA 2BISA 1THMA 4CL0A 3G2HA 3U4QB 2Q4DA 3QW4B 4G0XA 1RQ2A 3O1HB 3TL6A 1X8KA 4C0XA 3OTIA 4KPGA 3PEVA 1L1QA 1NVVR 5FUMA 2OBLA 3G5MA 2VBIA 2P0EA 2XVXA 4I14A 5E95A 4ZCQA 3FSGD 1GKKA 1X9GA 2AFHA 2D3TA 2IPXA 1IVSA 4H2DA 4E09A 1ZI9A 2V03A 3EZXA 4Q4JA 3NTUA 3K9WA 1CRQA 4IH9A 4JI3B 3M83A 3A0UA 4E3WA 3OZRA 1NZJA 2HXSA 2VJMA 3PUWA 5FAXA 3VR6H 4M60A 4X44A 1WMDA 4MGIR 1DDOA 2XE6A 1PR4A 4AMGA 4AJEA 3WWPA 1FUYB 5K20A 2XA9A 4LXQA 3ZCRA 2ZRAA 2PXXA 1SXJA 1SKUA 1YVEI 2E48A 5E4YA 3W9UA 1K2WA 3GJRA 3QUTA 2GESA 4HMPA 4G2NA 2XYVA 3WLNA 1P9NA 4EY8A 1KEWA 2JCXA 3DDOA 4HH3C 3CEHA 3WE7A 1QPGA 3LG2A 3JQFA 1JIIA 1HG1A 4W7HA 4X3PA 3RIYA 1X7ZB 5HX7A 1DG9A 3L8CA 4NULA 1RIFA 3UHOA 4R05A 2VRCA 1WCIB 2MWMA 4XDZA 1X74A 2EKZA 4J2HA 3OQHA 1YZKA 1Z2PX 1DO0A 2XAAA 1GOTA 5CLHA 1EJ2A 2VR1A 3CRZA 4Y2QA 3RS3A 3ZHYA 2Q5IA 4ZCPA 4X54A 4ZJUA 3FOEC 1PZXA 3AWIA 5DTRA 5FB3A 5ICCA 3TAHA 4LGMA 1HQCA 2OV3A 3IBTA 3HHEA 3M1IA 1NDHA 4OB6A 2WJJA 4MRMA 2ZTVA 4OQEA 5CGZA 8MHTA 221PA 1GPWB 2JL1A 5B3LA 3K0SA 3E7PA 4YHHB 1JFFB 3DNFA 1UPTA 3IP6A 5A3JA 3I5YA 1IBSA 2ACKA 1FYDA 2Z3ZA 1YMUA 3VR4D 2GHQA 3L8FA 2D1TA 4K3UA 2YBDA 4MVJM 5DEIA 4UNNA 4JI6B 1FYXA 4H60A 3BK2A 4C7KA 3HNPA 3HZOA 4QIHA 4CR8A 4GHWA 2VJCA 1ORHA 1AA6A 3D6UA 1KI9A 2YNMC 4YJKA 3RARA 1MZVA 1ZKDA 2IE0A 3F3SA 2A5LA 3AWDA 4ER0A 2IWRA 1E79A 2WWIA 4Q9AA 3FTCA 3KAQA 3WMWA 2O3JA 3OCZA 4BFUA 5KSZA 2NVWA 3ZV6A 4HDCA 1EWKA 3W5BA 2WP8J 2C58A 1ZCJA 4KQ1A 2PJDA 4N3AA 3FPSA 1XA4A 1G5QA 3IX7A 1NXQA 4ZMBA 5DOVA 3WK8A 1VLJA 3T7SA 4KHZA 3H2GA 3CPSA 1T2UA 2O3SA 2A9QA 2LBPA 2V4ZA 4AJ1A 3SXUA 3IP5A 3L84A 2O2SA 2C88A 3TSAA 1L1EA 2ZP1A 1YC2A 2CW5A 1DQSA 3NWJA 4RQTA 3GP8A 3CO5A 1H42A 2BOVA 3PFHA 4Q7JB 4DYDA 3T1OA 2HA2A 1HQKA 3CZCA 4N03A 4QVIA 2GRUA 1VYUA 3JPYA 5IJXA 1V16B 2FHPA 2FHSA 3Q5EA 4JLMA 4B3FX 1AG9A 2EW8A 4RPIA 2I4IA 2C57A 2Q5JA 4PAGA 4EG5A 1Y6FA 3L1IA 3RJMA 4JXJA 1WBBA 1T8PA 4BTVA 1W87A 4N47A 3HYLA 3HU2A 3CYFA 3RS5A 1OGYA 4B0PA 2F6RA 2BGGA 3LS2A 1XWWA 1XZBA 4PQGA 4QXOA 1Y81A 3K2QA 1GZ7A 2QYSA 4RV4A 3O03A 4BX3A 5EUMA 3QVLA 3KKPA 2H51A 4KP7A 4O2RA 4EUNA 4HDQB 5FJIA 3GJTA 1KFCB 3LPAA 4HZIA 4L95C 2XBUA 4IYJA 5EA2A 5ALLA 4DLWA 2QPTA 3S5JA 4AWXA 5BUZA 2EBFX 2SKDA 1BCSA 1N2OA 4UD6A 2CFTA 1II0A 2AGVA 4J6FA 1DOZA 3KLPX 4QICA 4L75A 4M7PA 2HL6A 2FUNB 3ENWA 4EOGA 1P19A 1JXQA 1WU8A 3BTVA 3QWHA 2Q0SA 4RIEA 1D9XA 1BG6A 3PL5A 3TI7A 3V2HA 4KL8S 4R2LA 1MN6A 4PXYA 3OIWA 3Q9LA 3G3EA 1A71A 1MAHA 2XECA 3HPRA 4X1YB 4ZEVA 1FP4B 3UG6A 1YZGA 1FSPA 4HPWA 2JAQA 1B42A 4CKZA 4F3KA 3EIUA 4B34A 4R84A 3WBJA 4DXDA 2ZQZA 3ILYA 4QPZA 4CM4B 2O3TA 3LCRA 3BHNA 3O82A 4DJTA 3MMXA 4ZYZA 1N9GA 2JJ2D 1EGAA 5LP6F 4IOLA 2WJVA 5LR6A 2QVLA 1KE1A 4RJTA 2F00A 5ARCA 1K75A 3JQBC 5JJCA 1AM4D 1XHFA 4LJ5A 1HGXA 2YRFA 2XNDD 4UAJA 2ZBQA 3ZDFA 3O7MA 2QKYA 3WL4A 1QX3A 3ZY2A 4B4KA 3EVZA 5F1KA 2WMNB 3K0AB 3E82A 4Z8XA 2HQ1A 3T4UA 4CN9A 3OEHA 3DT8A 1UJBA 3OPQA 3A6EA 5FA8A 3MHPA 4RZSA 5EJ5A 1KO1A 3Q85A 2WJPA 5DNEA 3ZE0B 4U02A 1Z07A 2IUFA 2OFPA 1GPBA 4GD3Q 3FYTA 4UVHA 2PFKA 1Q21A 1KH2A 1S2DA 3ESDA 3KQSA 3ZY5A 4OQQA 3MJVA 2IOHA 4ROTA 5A4FS 2H59A 2YW9A 3E0QA 3EA0A 4UZSA 3FNBA 1EM8A 5HKBA 2RH9B 2IH5A 2HGZA 1YFLA 3H5NA 1L1RA 4WACA 3QF4B 1KARA 2OYSA 4MQEB 4QVKA 4UFOA 3L1JA 2A5DA 5IM5A 7GPBA 3EQ8A 3SOPA 5J2UA 1WP4A 1I1QB 2QQ0A 3I2FA 4RVUA 2DOKA 3SYMA 2WG1A 5JFGA 1TLTA 2MR6A 3Q5DA 3QHQA 1H0RA 1LVHA 2VZ0A 4RSRA 4C08A 4MGKR 5CVTA 1KKLA 3KSZO 3AR2A 1E2PA 1MVLA 3I8XA 1C0EA 3DBLA 1SIBE 2J87A 2Y6UA 1I4EB 3Q6NA 1XXHB 5DULA 5E6UB 3PIDA 4ZP1A 1LEHA 1ATZA 1RM0A 3SWWA 4GAEA 4HAVA 2O2JA 4RABA 1Y3HA 1D1QA 2JGEA 4H77A 4EHKA 3QYAA 1DBIA 1VB5A 1E1CA 1XQ1A 3RVSA 3GLIA 3ADPA 3SYRA 2PRJA 3HKDA 1P1BA 1R4AA 2V65A 3SHWA 4CKEA 2EW2A 4IINA 5HRCA 4BMNA 3A6GA 3KPYA 3UGTA 1OWLA 1IOWA 4QGAA 1KQGA 2R8ZA 1NUAA 3I37X 4MW7A 5DSZA 1G21A 1K6EA 3OY2A 3LI2A 5AM5A 5F1OA 4BN0A 4YIHA 1CRZA 3UPUA 1L7DA 1OASA 3EIOA 1IEQA 4RZQA 3UK1A 2CJWA 1QBKC 2NT3A 2PVSA 4LS3A 1I0LA 1DNPA 4M9SA 2CKDA 3RWOA 3V4SA 2Z43A 3G0GA 4ZT2A 1TKAA 1X7XA 2O1EA 1VSTA 3HYNA 5JPDA 1SCQA 2FV8A 2G3YA 4HTFA 4PFQA 4X85A 4MRMB 1WG8A 1T9AA 3PFKA 1DO2A 1OC2A 3NBAA 3E6AA 3OFNA 3HKBA 4GR5A 4XFJA 1EFHA 5IBPA 1KIFA 4YRGA 1IM2A 2Y05A 1DU4A 3CMCO 1ZISA 3WGOA 4BDTA 4E94A 1U2GC 4WL0A 1RCTE 3B38A 3NP7A 3HMQA 1JSRA 2FEMA 4MCJA 3ZNNA 3FUCA 4L4YA 3RHSA 2BCJQ 3R6DA 4Y6OA 2GN0A 5JJKA 2F3QA 5LQJA 1OX5A 4LOHA 3HVRA 4EK9A 3MNFA 4CGZA 4U9IS 5SY9A 3DLBA 4KIJA 3WYCA 2GHIA 3GPDG 2QD1A 3AO0B 3B3QA 4KWTA 1XZGA 1YS6A 5HKLA 3ZW7A 3VU9B 2VPQA 5CW2A 1XZCA 2WFMA 1E6CA 1Q1BA 4KNWA 1N3IA 1J2JA 3OLYA 3K7EA 4WZAE 2HMWA 1XVAA 3KWFA 1Z0IA 5E7JA 5D00A 2FVXA 3TH5A 4JYZA 4MRSA 5LQMA 2PT5A 3LLUA 1OX4A 1PZGA 4FSXA 4RMJA 1GG8A 2B4RO 1JR4A 3LW8A 4YFVA 3CINA 2FSSA 1AUVA 2YHBA 3EXG1 4LCBA 1D2HA 4L7VA 5HOQA 3PUIA 4Z0PA 1KNXA 3BTOA 4GPZA 3KOXA 3R1IA 1OY1A 4O6VA 1HI9A 3L7LA 3LIIA 4L4UA 2QZJA 1XTRA 1Z22A 1FFCA 3G02A 4FMPA 4KWIA 5EIWA 5J63A 4P54A 1NF3A 2WSMA 3OE7A 2XNSA 2X7XA 3FNFA 4BNFA 2VIIA 5LQDA 2LCIA 1FJ2A 1JLMA 3OD5A 3PUHA 5DCWA 3RK1A 4D8UA 1OIVA 2X6RA 1QPBA 4LDJA 3VAZA 5U9CA 1GY8A 3ZHVA 1L4NA 5FBRB 3BTSA 1QH1B 1PR3A 1RI3A 2PJZA 1E5QA 3A7EA 2J3HA 1UMDA 3QYFA 1UBKS 2WWTA 1NIJA 2WBLC 3AHJA 3TLCA 4B17A 4H3KB 1ZNXA 4PYLA 1A7JA 5HS6A 2IHKA 3COWA 3I0NA 2KW5A 1UP4A 3ELBA 3IS3A 1BQEA 2P41A 2R66A 3MTIA 3LECA 4DYHA 4JLDA 4B3TB 1KC1A 2HA7A 3FKSD 3WGUA 2FWNA 5FR2A 4XTCS 2YJNA 2JZOA 1H5UA 1HOTA 5G2OA 3PBKA 4GGOA 1FTQA 1Z5WA 4C7BA 1ZN8A 2RBKA 4Z53A 4Z51A 1NXTA 1FU7A 2GD1O 2PWZA 3A6ZA 5T41A 4P08A 3UWKA 4BFWA 5E4JA 1QB8A 3MMSA 1TF7A 1BH6A 1UK9A 4R0NA 4ETNA 2BEWB 2F67A 5TVGA 4TTRA 4Z0TA 1Q0QA 3D3WB 3HJHA 3RYCB 2D1QA 3OM0A 1Z7YA 1OV6A 2O05A 3UK7A 5KWVA 1DC5A 4EB6A 2ZI9A 3BILA 1ZGHA 3DUWA 4MEAA 4G4JA 2BLLA 2XQVA 1L5SA 3CO0S 3WGKA 4EPYA 5TGDA 2QTCA 3PR3A 3I09A 3KYBA 5FBZA 1PT6A 4JOBA 4ZVTA 2VP0A 3JQQA 2JLWA 4O8CA 4AG6A 3R9WA 2GBIA 3OUZA 5HZGA 2B36A 2WJGA 5E3IA 4KK3A 4JU8A 4YRNA 2PGAA 3JQAA 2WSLA 3OM1A 2R85A 3VNBA 3WGGA 2GSDA 4XOUA 4ETIA 2QX7A 5K3DA 3GUCA 3ZHUA 3LXXA 1ZH4A 4F4HA 3FHOA 1YK1A 2B2CA 3EG9B 3VKUA 3WK9A 1PU2A 2QMZA 4CLRA 5AVRA 2VPTA 2NZWA 2ONYA 2QWXA 1ODTC 1GGHA 1ZZEA 2XYRA 1VCNA 5EE1A 3M4ZA 2ZRQA 5DNUA 4O4HB 3VBEA 4KREA 3WNZA 4UOZA 4ZD6A 1QYCA 5IVDA 4J16C 1UZNA 3TXAA 2WWYA 3ZWVA 1O9HA 4Q1DA 1CUJA 2P62A 1QGUA 4NECA 4WZBB 1QRDA 2PO7A 3DCJA 3TBFA 1KTVA 4LMAA 4PFKA 4CIWA 1A98A 1QS0B 3MJCA 3UN1A 1NVFA 3C85A 3EQ2A 1Q3TA 1BW9B 1F12A 1TM7E 2O2EA 2A86A 3FDZA 3OBIA 2ZWOA 4FI3C 3WS7A 5IHPA 3ZHOA 1S7GA 4FHFA 4K9RA 3OJFA 3V7YA 3O94A 5C46F 4HNHA 1W4AA 3IUBA 3GW8A 3QPBA 1VGQA 3W5SA 1RC0A 3WKAA 2JBAA 2YJ3A 4GZ6A 2ZSAA 4HFNA 4IF6A 1THTA 3IT0A 1FUUA 2B35A 3OX2A 4PYRA 5E1OA 4EGSA 4YPVA 2FDXA 3OX3A 2QHXA 4RLQA 2LIPA 2QGFA 3V8EA 1ICEA 2DT8A 1S2LA 1XQ9A 3EC1A 5IBRA 3MWDB 1B1CA 4JLPA 5BP7A 1NWCA 3AIIA 4C3OB 1NP3A 5JZ9A 2NTYC 4Z7JA 5DX8A 2REQA 1Y3AA 3TQOA 1BS2A 5F5NA 4RAQA 2UXDB 3WDSA 2OAGA 3NHPA 4E0BA 1L7BA 2QX9A 4RNDB 4BNDA 4DMHA 1R15A 4EYSA 1PV4A 1A04A 1REQB 1U5BA 2P90A 4BC1A 1HE8B 3C16C 4L8VA 1NI4B 1M8PA 3OE5A 4EITA 2QTTA 3DPUA 4PG8A 3QBVA 3ZGZA 4AKIA 4BGVA 1R0LA 2QBYB 2GILA 2J9GA 1XA0A 3D6MA 3U7QB 1J20A 2O1XA 3QLUA 3VR6A 1E1DA 1W0KA 2DTXA 5B30A 3KXIA 2HFKA 1P2SA 5K6AC 3EMBA 2ZOSA 4LY0A 1EDDA 4QJ3A 4IGIA 3DOHA 3K0CC 1VIDA 3ICVA 4FYJA 5JJBA 1NKSA 5CYPA 3L8ZA 1Y6JA 5DBGA 4KQHA 1ISHA 2QRJA 3N2GB 3ZZNA 1PR9A 2B3DA 1V11B 4YRDA 5ICMA 4W7IA 1I1OA 1V95A 4IL5A 4MWBA 1ZZGA 1ACLA 3HP7A 3TR0A 2FEWB 4QD3A 1C1XA 3DQZA 3FNRA 4IJ6A 4KN5A 3BF8A 1YB7A 1QH0A 5AJWA 2YYZA 1L5WA 2BP7A 1YASA 4QPDA 4M8IA 1P2TA 1Q3KA 3GDOA 3IA7A 4P7JA 5DNVA 4BQRA 4JL5A 3T34A 3NBUA 3QLUC 4R7TA 3R75A 2R79A 4G5GA 1D4ZA 1H05A 5EJ9A 3P96A 2IU6A 4GDMA 2BM9A 3MILA 4AX8A 3AUXA 4G5RA 2PTHA 1AZLA 3OKAA 1J00A 1EK0A 3ZCVA 5F2NA 4RTKA 1Q7RA 3UPDA 2JFGA 5JD3A 5HXAA 3HC7A 1JECA 3OTHA 3EZ6A 1IK6A 1JHRA 1ZOPA 3GB9A 1WCIA 4BNZA 3V80A 1VJRA 2BDEA 2LKDA 4DR5B 3R7WB 1CQPA 3CR3C 2J3LA 4DV3B 3KDPA 3V46A 4JYMA 1RWPA 2VT7A 3Q1KA 4I55A 2IXAA 1K68A 2WQZA 5ULLA 3WAKA 1HNXB 1U0SY 1G3IA 3NGXA 5M7EA 1RI5A 1PQUA 3QBEA 3RTAA 1EK5A 1UM9A 2XSZA 4UDNA 3ZE2B 1WUKS 1G5RA 4L28A 1B8VA 1JIKA 1HETA 1PI3A 3B7GA 1R0SA 4QJBA 1BMFA 4GEGA 4L3VA 1S3GA 3LQ4A 2A5YB 5LMNB 5M29A 1U9IC 4R3UC 2BSAA 4TLAA 1QVVA 1Y5NA 3PHIA 2YXDA 1L8QA 1QNFA 2HMTA 2XUIA 3D4LA 3CVXA 3JPWA 4MI3A 5I7FA 1JDPA 4FZVA 1TM4E 4BOYA 1T5DX 2BEVB 4HEJA 2I7TA 3OPNA 3H9BA 2OUIA 1QTIA 1QHGA 1NR7A 5E9AA 5IJAA 4Q19A 5IWAB 1AS3A 3INTA 4YDSA 2M9MA 2ZBVA 4K9MA 2RHRA 2HK7A 4TV9F 2R1UA 3U9SA 2PXHA 3UUEA 2C2WA 3VR3A 5JVDF 4JJ6A 4GDFA 1SXHA 5DLEA 5JIBA 1WPGA 5FF9A 2FOLA 4JC5A 2FUG1 4IFTA 4UC0A 4C76A 4DWWA 1NBMD 2D13A 4WBNF 4IJQA 4ZT4A 3FNGA 1W7AA 3L6OO 1S2IA 2WUGA 1HT0A 3D8RA 4UARA 4BVKA 3P9QA 3T3HA 3BJZA 3LQKA 2RD2A 3JWHA 1FTNA 3NM5A 2D5CA 2MSKA 3GCDA 3NKFA 4NZZA 4D80A 1TPYA 4NPCA 1WB6A 3T0GA 1T43A 4MWEA 2B8TA 3P32A 2BTQA 2RGRA 2DWOA 2ZVDA 3BMNB 3U81A 3BGVA 3IE1A 3GJ5A 3M70A 3CRVA 3OZFA 3OLXA 4IV8A 1GAEO 4AMYA 2YVKA 4ZXFA 2WWHA 421PA 1VIMA 3JAMA 3MG9A 4ZJYA 3L8GA 4BXOB 5JARA 3SICE 3THXB 3CNEA 4HDNB 2PSEA 1MDBA 1NVKA 3I62A 3OZSA 1YKGA 2PWYA 2BFCB 2CLEB 2Q9BA 4G1VA 2I2AA 1FP7A 4PZZA 4M46A 4LE1A 3KSMA 3JATA 2LRHA 4C0QC 1AXGA 2NACA 4I5IA 1Q7EA 3PXXA 4IX1A 1MW8X 1EVZA 4DUPA 3ZXXA 4OXYA 2PUBA 2A58A 2WTNA 2X4IA 4PWYA 2RAPA 2WJYA 1G2QA 4PNEA 3UHJA 2A1TS 1HFEL 1EWVA 4JODA 3LRTA 1Q1NA 1GPYA 5J4VA 3W5DA 1A9RA 3TAUA 3DV9A 1GPUA 5HIMA 2JGFA 3TM5A 1I4LD 1B00A 1F1BA 2XWJI 3O2SB 1X7YB 3EW9A 1BEZA 2Q5LA 1XZMA 1U7PA 2Z2ZA 3JQ9A 4J90A 4JT4A 2B9EA 3ELUA 3GJYA 4QHSA 5HCUA 3ZWKA 4BIIA 3K70D 3GV0A 3DULA 4JI4B 4GECA 4Z9XA 1FSSA 2J7PA 5BQ5A 1THZA 3VHQA 3PHLA 1K0UA 2OE2A 3DMDA 4HK4A 3LVBA 5H3CA 4BMPB 4C05A 2RE8A 4GPIB 1ODLA 2AKEA 3S2UA 3IPYA 5TPZD 3VSBA 3ESBA 3E9ZA 3F49S 3GYBA 1FXWF 1SBTA 3DAHA 2B21A 5KYYA 2AUNA 3JQGA 4LZLA 3WLKX 2BKVA 1JB1A 2IBMA 3AR7A 3MIIA 1XRPA 3B6ZA 1L8AA 4FD2A 4UM9D 5IFLA 4NPHA 3TRFA 3H3JA 3O8CA 1TAHA 1XD9A 5KAMA 2R00A 1J8FA 4TTJA 3O1IC 3ETJA 4IIDA 5BYKA 4NBWA 1PK8A 1WKCA 3VX4A 1N5KA 4BO3A 1AQIA 5CXQA 6LDHA 3I64A 1MDFA 1OX6A 4CT5A 2X76A 3BL6A 1QWSA 5TQ0A 3JQAD 1X80A 2ZRPA 3DD1A 1XN1A 2UUAB 2WM8A 1IN1A 4TLLB 3SMVA 1ZRSA 2EP5A 2BFNA 2ID9A 3AINA 2GCNA 4B8WA 1OXVA 3KZ1E 2NO9A 4U7TB 3UAGA 4ANFA 3CVYA 1J42A 2WUDA 2XB4A 3K9GA 2P4EA 4URUR 3NHJA 5L40A 5AW1A 4KNYA 1QFMA 1RAFA 3WSTA 4YV0A 5L4SA 4FONA 1A96A 4TLMB 5KSWB 1BX1A 1SQSA 3RHFA 4XQEA 3ZLJA 1BGVA 3MGCA 3JZMA 3ZKWB 2TMDA 4UUNA 3ZWXA 2XEDA 2I3DA 3OZVA 3L7CA 1Q17A 2VT2A 3INGA 4NKRA 1MUUA 4RK6A 2I22A 5I3CA 3GX1A 3ML1A 1Y8CA 3PJEA 3DO6A 5TARA 1WKVA 3GA0A 1L4LA 4KQ2A 3ROXA 3IV7A 4NZ9A 3CLUC 3RG2A 1B23P 2R96A 3HWX1 2ZS7A 4GUAA 2ZAYA 1TL7C 1ZEJA 1LQUA 4LV5B 2FLWA 2CJPA 5H9WA 4K9PA 2YOGA 5MN6A 1SQGA 1M83A 5DIFA 3GN1A 2YMLA 4JLJA 2VHWA 3G9TA 5CLGA 3T5BA 1FFBA 1O77A 2NXJA 2QJTA 4GZ3A 4YUVA 4IDHA 5AK0A 3TEJA 4DC9A 4QG7A 3HXOA 2HTFA 4PONA 2IYOA 2P2CA 5EYPB 1N8KA 4HQKA 1Q0TA 4J3JA 3PE3A 2NT4A 2PD6A 3SS7X 1G21B 3BAFA 1WDWB 1H66A 1L7QA 1R9NA 4ZO6A 4REQA 1OW3B 5EJIA 2I2DA 1OF1A 2A3NA 1HYBA 5FPKA 1P2FA 4D82A 5AHWA 3HMKA 2QR5A 2CL5A 2XSZD 5I8ZA 1UDCA 1ND6A 5AM0A 1IDOA 3WJ1A 4EEKA 2O07A 5HSGA 1K8XB 1N9GB 3DWFA 4N3BA 4I4LA 1DJPA 1GSOA 1AN0A 1S3IA 3IAM1 4BFTA 4QYSA 4G0OA 4QJ4A 1EXDA 2PLFA 1T8TA 4I6EA 5T7BA 3EISA 4FFBA 4GL4A 3FUWA 5L6LB 2J3EA 1YMQA 4DDKA 5CR9A 4DCGA 2RGNC 2VSQA 3GNLA 1XJQA 4QUHA 2DCMA 3SJUA 4LF8B 4C4RA 4KRXA 4WN9A 1T2EA 2QW1A 2ZU0C 3H2ZA 4TYYA 4KV9A 2X0IA 5DI3A 1V4VA 2CVHA 4KZKA 1F0PA 1JKJA 2F17A 3DQPA 3GAAA 3EGCA 5E1BA 4WV3A 3WO1A 4C4TA 5CDUA 4O4JB 1BE8A 2ZW9A 3DE0X 1NU8A 4FYIA 4R40A 4L7QA 1HK7A 4HJRA 4PLWA 1H1DA 3BL5A 1YB1A 1D4FA 2DT5A 3FR7A 3K0EA 4EG6A 3UGJA 2AFIA 1BCSB 4GVPA 3DTTA 2CBXA 1ZMRA 2E6KA 4DRYA 1GG9A 3NH6A 3MB8A 3M6IA 4OUDA 4XWAA 4EYEA 3P94A 3RVDA 4EYOA 3BA6A 5CDHA 4KFCA 4FGUA 5FIUA 3UK0A 4IIYA 2QNRA 2C4HA 2NWQA 1J8DA 5EE0A 1DEHA 1OZHA 1YJCA 5THKA 4OSEA 3F5DA 4F4FA 5IDQA 3T5PA 4WEQA 2H2AA 1HDGO 3WGIA 1IHDA 1OV4A 4GSYA 4OHFA 1ZNWA 1H0SA 5ENZA 3N2LA 2ADFA 2HBRA 3WQHA 7REQA 1WUIS 5KJCA 4C04A 1PJCA 2O7NA 2P27A 4WGGA 1BW9A 3HCPA 4CCSA 1U4NA 1G2IA 1CY0A 1J5PA 3CH4B 1F2TA 3ET4A 2IZ6A 1SHTX 4JH0A 621PA 3D7KA 5ELXA 3EG5A 4J0EA 4AMZA 3LF2A 4NATA 1RZVA 2PKXA 2QJOA 1E5LA 3N8GA 1V35A 4RK7A 2FPGB 1SUFA 1E66A 3G2IA 2G9RA 3I34X 2B0CA 3M5PA 4A6EA 3LFUA 4BXOA 2B3TA 2GXAA 4HPJB 2Z5LA 4TTVA 3IVXA 1NUPA 1LGYA 3JD2A 2VPPA 4FT2A 1X9IA 3ISJA 4RK4A 4YXWD 1UM8A 3GAMA 3KJZA 3VDRA 1W52X 4IJUA 1EVQA 3Q3HA 4J49A 1U1GA 4DUGD 3M2TA 3GGJA 4M0CA 3CSDA 2HBYA 3FZQA 4JEMA 4UJ5A 2BEUB 2FSUA 3G2MA 4IDBA 5GV7A 2E5WA 5G3YA 1L5GB 5EHQA 3RWMB 3D6HA 2LTAA 3S2IA 4KDFA 3SBOA 4YMIA 3LUBA 2C2YA 2GEDA 2B99A 2R1VB 5HUHA 4W1QA 1JXOA 2GSWA 1RJFA 1T13A 4TM8A 5ES3A 2EIXA 2CLSA 3E2IA 2XZLA 2UXBB 1P17A 3QU4A 3RJZA 5KTKA 5EAIA 5FOUA 3UG7A 4WLOA 4EF5A 1C1YA 5BMVB 4JV5B 2I2WA 5AKGA 5KYUB 2ZCJA 2GLTA 1F0KA 5A9RA 3WB0A 2VJDA 5EINA 4IJVA 4EH1A 2AZDA 4PSKA 1XK6A 3LRPA 4X0EA 4GMFA 4DG8A 1QHEA 2YS6A 3IIEA 3UT5B 2RHMA 4UVIA 5IP5A 2RAUA 1NFFA 4UXJA 3FR8A 5J5CA 2CUKA 4F8EA 4G0VA 1OOEA 1CUAA 4D25A 2W8BA 3KQOA 1ISRA 4RD0A 4EW6A 3HNRA 1XDZA 1B74A 1JZSA 4YRSA 3LL4A 3IIKA 4FXOA 4ZVKA 1VA4A 3T3PB 2WJ6A 2OR3A 2FZGA 1IIBA 3EF3A 1RHJA 3M6AA 4OP3A 1G1MA 2VUSA 1CD5A 3FUVA 5JSFA 1XEAA 1I2DA 4XM0A 4IF4A 5F76A 1P9OA 1QKIA 4MEBA 4G0YA 3JARB 5PNTA 3LYAA 2V7GA 3LK7A 4J7AA 3S5UA 2P1ZA 4MB2A 4RY0A 2IV7A 2ZG6A 3DFKA 4G0MA 4NDNE 3AL2A 3CZ4A 5AK4A 3DZHA 1KYQA 3QVGA 4JXZA 1PWYE 5F7JA 1AS2A 5J40A 2IPLA 2RHCA 3I23A 5AHRA 2FG5A 1PDOA 1G55A 4ZO4A 4A27A 4PN7A 2R48A 1NA5A 3PCRB 1U4SA 5A3RA 1HMYA 4MV9A 4J2TA 5IDWA 2XCRB 1R18A 2R1TA 4XUCA 4PZAA 2X15A 3NT4A 1V7CA 3ZJVA 5LKRA 4ALIA 4F3RA 4S1NA 1X1QA 1AZTA 1RZRD 4EX7A 2WB2A 3SE7A 4LRXA 4WCFA 3SZMA 4F97A 1FRFS 5JG7A 3DZFA 1KORA 5DIZA 4O63O 3YASA 4MW2A 1EUCB 5HF6A 2PH7A 2ROQA 4B3BA 3FSGA 9LDTA 1PYGA 3GRPA 1QYDA 3IA2A 1N77A 3HDVA 3RBVA 3W6UA 1HBJA 3NIWA 2OZLB 3IOEA 2ODBA 3AOEC 5C9ZA 3ER6A 4QUEA 1P7ZA 1XVIA 3LDAA 4IQ4A 4JJKA 1Q22A 4R01A 3IHKA 3TSZA 3UJBA 3ZHSA 2NMVA 2EBUA 1XVUA 1NYQA 3KEOA 4OGKA 1LLQA 4QX6A 2IP1A 1CJTC 4TSFD 2ZSEA 1PLKA 2QD2A 4U00A 1GPJA 3T7KA 4NOLA 1M2OB 5ILGA 4EHLA 1HURA 4F38A 3D43A 5AUNB 3KIPA 3JQFC 4E7PA 3UBMA 1CF9A 5AVZA 2GA8A 3GLVA 4M9QA 4TL9A 1ZOIA 1Q1QA 2H63A 4DJEC 1L4UA 3BQNB 4I4IA 5HR5A 3C5VA 4M3NA 4RVNA 2ZI3A 3IMEA 5FA6A 2QQGA 1XTPA 1LX6A 1YS7A 3L1VA 3QA3E 1XEXA 2I3AA 3VPGA 5AW4A 5F2EA 1Z12A 5JAOA 2IS6A 2H4WA 5ALOA 3KNZA 1S2MA 1YUBA 2Q1SA 4IUBS 2ZUUA 5EIBD 4MDHA 5L8VA 2CBZA 1R4MA 2W4MA 3V3TA 4IUDS 1TADA 3UA4A 1YA8A 1T2NA 4JLVA 4MLDA 5TQVA 3SDSA 3T3GA 3U2QA 5HM8A 4TVOA 4P22A 5AI5A 1FW6A 3AF5A 3KUXA 3LVQE 4ZU3A 2IEBA 3F4KA 3Q87B 4ME6A 4CCWA 3DEZA 4YR7A 1DIGA 3ZDQA 1ZMBA 2F2TA 3ENNA 4FKBA 5JDCC 4HDRB 1AXEA 1Z63A 5DSTA 5WRFA 1BS9A 2QAGB 1UC9A 3PEUA 4G8JA 1ISPA 4GBJA 4ZXPA 1KP2A 2QV7A 3CONA 4AKGA 4CL8A 1P0QA 3SZOA 1V1RB 1A2OA 1FUIA 2V3WA 1CUEA 4URYR 2Z9CA 4YJFB 3CBQA 2E4WA 2FWRA 5EXEA 5CYOA 4V3CA 1Q15A 3ROQA 1B2LA 3U44B 2ERXA 2PRZA 4BV2A 1JI0A 4BJ6A 3EQ6A 4Q7KA 2J3MA 3W5VA 1AHPA 1QS0A 4YFYA 2GN6A 3I2KA 3KOUA 3CXUA 1G6Q1 3DMGA 3N86A 4IVQA 4JGBA 3ZVKA 5A2QA 1E79D 2H0QA 1JDSA 4WNIA 3C14C 3JSAA 2VKQA 3BF7A 3QPDA 1QLWA 1TUBA 3N59A 2A78A 4IRUB 3IEXA 5JMWA 4WFQA 3FIUA 4DQVA 3DB2A 1R0YA 1O96A 3FUTA 3PVCA 4Z4CA 4ISCA 1BU8A 1BWRA 2NO7A 3IAM6 1WMSA 3L6UA 1P1JA 1BVYF 5FPYA 2BGRA 1GM5A 1SQFA 3HR8A 2TYSB 2NTNA 4JVNA 2ZIGA 1L7VC 3MJFA 4I46A 3KBOA 2DUJA 5MDHA 3SR0A 3MK31 4JVMA 4MRPA 3RVNA 4EJFA 1FX1A 4CM5A 2OCXA 2JARA 3IKLA 4JBHA 3KJNA 2HGSA 5ALMA 3SBXA 3W4KA 4DM4A 2FW8A 1O6GA 1GYPA 3NHRA 2PUAA 5CRIA 4DB2A 2V5UA 2G82A 2WSIA 1PVOA 3INNA 4HBGA 1B4DA 2VG8A 3NNDA 5ARDA 3DZIA 3A9SA 1VLQA 1GA1A 1I7LA 1PK9A 1V8PA 1Z5UA 3H86A 4YJ3B 5ALJA 3RG8A 1KERA 1QQ5A 1W85B 2ZBPA 2F48A 5CVEA 2XIQA 5AT1A 4CVNA 5MN4A 1G6KA 4ZARA 3U7IA 3D4IA 3NWOA 4HATA 5FQOA 3WICA 1OXMA 3T38A 1SVNA 4ND6A 5CAEB 4WBXC 1I6MA 2H17A 1I24A 3TZQA 3OLZA 2VUHB 5HIAA 6ABPA 2P9FA 2FZ4A 2PX4A 3GARA 4ZU1X 3IVCA 1J9ZA 2JGIA 3O47A 3PYXA 1LF0A 2QI9F 2O7VA 3K5HA 1V41E 4KFRA 3PR1A 3RGGA 4BUZA 4ARIA 1Y1RA 4J16A 5IW8A 3W2IA 4EFDA 1TVCA 2OKGA 3FWZA 1M1YE 2VRCD 3DDCA 3W1VA 3KCNA 4URZR 5LYJA 3ZXYA 1LV7A 4AS2A 5ICGA 4RC9A 1ZD1A 3B70A 3TD6A 3MJSA 3HVUA 4FFPA 4MV3A 2BEKA 4OFZA 2P6PA 3H1FA 4QYWA 3PFWO 3VC1A 4QARA 3LT5A 4V02A 4X92A 1AHNA 3OMWA 4WZAA 3GGDA 3OQ6A 2O9JA 3WOHA 2FMXA 1R9GA 3H2HA 1DKNA 3HKBB 4QDUA 4U63A 1B0PA 2PWBA 3HCNA 5IT4A 1OB2A 3U3KA 4BVLA 5JCPA 2HRCA 3ZKWA 3WP1B 1NAHA 2VF2A 5LUBA 2IS2A 2GH1A 3C7TA 1T3HA 2EFCB 1SB9A 4NS1A 3DTNA 2A1UB 3MYYA 3HZHA 4JT9A 4WKPA 4QG3A 4F9TA 2J6CA 1J07A 1W1WA 1T4MA 2EOAA 3L5OA 1K7SN 2B5OA 3R3YA 4PG6A 1C2YA 4ZCSA 5K99A 5DMHA 1X1TA 3T99A 3JY6A 4P5PA 4M9UA 4BL5A 3MWLA 1Z15A 1TTPB 1QU2A 1T1SA 1VHLA 4C4YA 1CUSA 2FJPA 5FLEX 4UU7A 3IV6A 4YT8A 4JGIA 2GPAA 1E2QA 3KQMA 4DARA 3RAJA 4IOKA 3VTKA 3JV7A 5D84A 3DAOA 3S2GA 1OHHA 4DZZA 3ISTA 1H8EA 2ZJOA 2WHRA 5HIJA 1QQTA 4C2TA 1XNGA 3HGMA 1Z83A 3AFHA 1I4DD 2NTEA 4G81A 5EKTA 5H80A 1Z08A 4RY2A 2IHYA 5LNK1 4CDNA 4NJEA 2RI0A 5E6RB 3LUDA 2EZUA 3Q0EA 1ODSA 1D04A 4G1UC 4PW0A 1UBEA 4BWGA 6GPBA 1SOWA 5LPNA 5JAQA 5SZIA 3I01A 4H27A 3A3KA 5F5XA 1U3GA 3SBEA 4CBVA 5LLTA 3V1LA 4YMGA 2XRFA 2ZUWA 1XB2A 2WU1A 2YC2C 3V4OA 1H1LB 3CGWA 1ECGA 3MAJA 1YBVA 2X6QA 4JJEA 1IE3A 1X0XA 4TL6A 1N36B 1TKBA 2J4FA 2MDTA 2OHJA 2QAGC 2XY4A 5AXAA 2EDAA 3UXHA 1ZK0A 1AIPA 2W2QA 4FSDA 3TWOA 2OCKA 3IV9A 3OQBA 1KDPA 4YP7A 4EECA 1MHTA 4MINA 4B2IA 4E5VA 4ESHA 5CFPA 4BFLA 3W0LB 1CUFA 2SBTA 1KETA 3K1AB 3OX1A 3OZUA 4F93B 2QAJA 1FBNA 5AKLA 2NZUG 1JAIA 4QAQA 4AYWA 1F4LA 4FYYA 2B1JA 3SXUB 2QUKA 1ZRMA 3NEAA 3P9IA 1SPXA 1NM5C 1J21A 2PZKA 1T1EA 4G6ZA 3TJRA 1A9XA 1TECE 2IUEA 2XYQA 4YQYA 3FCYA 4EHBA 1HE4A 2AX4A 2HPHA 1N57A 2ZJ3A 4KK4A 3Q1LA 5IG2A 1VG8A 3F6SA 5JADA 3F97A 3PK0A 1XVTA 1RW4A 1VPTA 2QRNA 3DWEX 4HUQB 3UF0A 5KTOA 1Y8ZA 4PR0A 1SC3A 2A6PA 1Z0AA 5E4TA 1Z33A 5FBWB 1Y9JA 5HCNA 4ZKEA 3WZLA 1GV0A 2FFHA 2IZOA 1UBCA 3S0JA 4W6ZA 3VMFA 5JSZA 1BHO1 3QLEA 4RAOA 1JG6A 3DL0A 1ESMA 3KM0A 4Y1RA 5CTJA 3SQNA 1YR9A 1LRKA 1RACA 1EFLA 4RHEA 1X1AA 5DYYA 2YZ2A 5CIYA 2R84A 2JFXA 3CNNA 3LA6A 3JD3A 2HO5A 2KLHA 4UE2A 3WV4A 4A7PA 1THGA 3EAQA 1Y1PA 3I12A 5ALSA 5EJ2A 5JC8A 2GAIA 2VWPA 2Q6IA 3RFUA 3WMEA 1II8A 1DAIA 3J7AC 5D8DA 3JQAB 2JGLA 3PDJA 3FYUA 1P4JA 3BYZA 1XL1A 2EGHA 1CG6A 4KXQA 1Q1EA 3ANNA 1GQ2A 2NZ2A 2OC9A 2B8JA 2Z1DA 4K86A 1DLJA 1XLVA 4Q16A 3IQIX 4RWZA 2OSVA 1TTHA 1P4SA 4B3IA 4EJ6A 1HH4A 1SR8A 5J23A 2QPLA 4C20A 3ESCA 3HU5A 4XWYA 5F77A 4OI1A 4C0AC 4ND2A 1XRSB 3AL0C 2J0QA 3LGXA 1A5AB 4M36A 4KSBA 5EKDA 1UBHS 2C9MA 5F12A 1X1SA 2ZPTX 1OYWA 3E4DA 3S55A 3D59A 4ZQIA 5A4AA 5C5IA 3QXCA 4OMUA 5LD2B 1CQXA 1PIWA 4FEAA 4GSKA 5L3SB 1DP4A 3CCBA 1H9AA 1YR8A 1E59A 1LJLA 2PRKA 3CZ9A 1BN7A 3M4NA 4TWZA 4Y0AA 2ZZKA 3M2PA 3VU3A 1SFRA 1JAHA 1T4CA 2FR0A 2G7MC 1O8CA 3GEMA 4MKFA 4UOQA 4XCVA 3T0IA 4EBFA 3RKUA 4AJ9A 4CQJA 5I9IA 4FGKA 2GN8A 4X90A 3F74A 2Q4OA 1X7YA 3DBIA 1F8UA 4DLTA 1TA4A 1UKEA 5C1DA 3H1PA 1XZAA 4YBZA 1XZPA 1ZD3A 2AFHB 1KO5A 5JXHA 3OX4A 1Z4OA 3I9NA 4JZYA 1V1MB 2DPMA 3EIHA 2ZJFA 3PQDA 2C00A 4MVWA 3WHIA 3U80A 2CFOA 1QK3A 3FWKA 5DN9A 4ZAWA 1KI1A 4H7JA 4WLNA 4A0GA 2VHVA 2BHTA 3BA1A 1NF9A 1VKHA 5HZHA 1GTL1 2JCSA 4ND1A 3U3OA 3UKOA 1YVUA 1ETHA 1RM3A 2VP5A 4ID9A 4EI2A 3PB3A 3JU3A 4UAUA 1VIYA 1KPGA 3OWHA 1HRDA 4WCFC 3QVWA 5EZ6B 4CM1A 1S2OA 2DHCA 2BAGA 3G59A 2VXOA 4EABA 1QIGA 3JQ9C 1XT6A 3ZNOA 1BSVA 1M0EA 2E5LB 1R5OA 4MWCA 1CJBA 1FYVA 3BD9A 2CYAA 2F1JA 2ZJ5A 3KQUA 3HGQA 4F5WA 5AVSA 1GNLA 4QQKA 4ARCA 2R7KA 4S12A 4C21A 2GPTA 3IP8A 3NANA 1E6EA 5DYIA 3NM6B 4A8HA 1NXWA 2JATA 4AUKA 3T1HB 4I4TF 2BT4A 1JQJC 4PQYA 5DK4A 4YV1A 2D5IA 1KMHB 3G5AA 1UBNA 2VYCA 2WYHA 5ALPA 3D7SA 2D62A 4CKEB 2I4LA 1KMMA 1YIDA 3SHTA 3UAVA 4DNFA 1HR0B 4R2KA 1L5KA 4F1WA 2D5BA 3SR3A 4MUJA 1T9KA 5JO9A 1QG2A 1VYHA 2EJTA 4NU5A 3CZMA 3A6KA 1BC5A 5IYZF 3RYHB 5H4GA 1JDBC 1JLKA 4NBNA 4NS4A 3V6MA 1QIDA 1GYQA 5KNDH 3GFSA 3AUKA 2C5SA 4G0PA 2IWHA 3WQBA 2F43B 5TQ2A 4F5DA 1DKMA 1JQKA 2H3EA 1N0WA 2LNDA 3EH1A 3GZ4A 4K81B 3OIGA 5EESA 1EFAA 1SVIA 4BE7B 4DZRA 2F3UA 4GR9A 1PTJA 4Y0NA 5GONF 2ZYGA 1ODKA 1RI1A 2W98A 4U7HA 2MR5A 3SQXA 2JFPA 5DFAA 3SQOA 3HN2A 3HUFA 2A8YA 2HJSA 4FFRA 4X3CA 5T4HA 4M9RA 4XWKA 4EEXA 5BRAA 3D8NA 2QMOA 4WA8A 2ZBFA 5HJ5A 1ZXLA 6CHYA 4OXIA 1OWNA 4KACA 1C30B 2P75A 3C41J 4OK3A 3VR5D 2OGWA 3VDXA 3VHLB 3OIYA 1L3BA 3T3EA 1FYFA 1QM5A 3C48A 3QGMA 5HCIA 1GYRA 4JKIA 2V3VA 3JAKB 1VLZA 3BRCA 3NPAA 4QYTA 4HR7A 3MXTA 4P3NA 4DCVA 2X4DA 1U8CB 1JLLB 3BB3A 1W8IA 4PTLA 1WZNA 4TV9A 2P9JA 1PTJC 1X14A 4QBGB 2Q27A 4H59A 1SXJE 4PZDA 2WLTA 1UZLA 2D7JA 4DLUA 4QTYA 4UEQA 1L7AA 1QMGA 5DXJA 3TSOA 2PZ8A 4AN0A 4LNUB 5MGNA 3VSDA 5JR3A 1ID8A 3GFGA 2OLJA 2HLDD 1OH8A 4WE3A 1QKJA 1X7WB 1E18A 3H1EA 3WL5A 4XYMA 1IN6A 1RHUA 1RWXA 2X22A 4LRQA 2B69A 5ERYA 4YXWA 5PGMA 4MQBA 3FOAA 4J75A 4GFDA 2PS0A 1U28C 3H6GA 3FY4A 2N1MA 4X41A 1FB5A 4KZPA 4EW1A 2CCJA 3ZHRA 4HZGA 4IFBA 2PMBA 3TNLA 4KXFB 3VOBA 1J09A 1QYVA 1FFAA 4JBNA 3EB9A 5SYMA 3AUFA 3N07A 3OF3A 3R44A 3R7BA 2PRYA 3SYKA 4CQLB 2FW9A 1W0KD 2PLRA 3DHVA 1MZPA 4JFAA 4TOIA 1C7QA 2OVFA 4E2ZA 3IEVA 1H2FA 5JSZB 3E8XA 3D3EA 2HEGA 2XCOA 1PUJA 2UVPB 3Q3JB 2C1ZA 4OYYA 5EP2A 1L7XA 3T7EA 5LM3A 4TT8A 2BLNA 3FRJA 3EEQA 3H0KA 4WKBA 1P8JA 1SD1A 1PJAA 3E5MA 1KU0A 3T9BA 5C1BA 2P8JA 3PLRA 4KXYA 4R8LA 2WT4A 3SDZA 4IIJA 1Z7GA 3ZQUA 1NN1A 3AP1A 4B45A 1ORWA 5E0KB 1YR6A 2VDRB 2IYEA 1ESNA 1GQYA 4OJKA 3UWMA 1TK3A 1UWVA 2ZRLA 2ZVQX 5FOWA 6REQA 5JSHA 1W5TA 2HNAA 2B7LA 4G5FA 2PNJA 3ZXUB 2G5CA 4L4RA 3KVOA 4KCGA 2XNDA 2J0VA 1Y3FE 2YV4A 4CV2A 1JXMA 2OCGA 2ZUBA 3DEYX 4J0IA 2AJLI 4RJJA 3C3XA 4GBGA 3KT8A 4AK9A 3RDPA 5K0EA 3T3OA 1SXQA 1TYCA 3QFFA 1GP2A 4MUYA 3ZZUA 4C6SA 5AH0A 2I9PA 4EW3A 5GGXA 3GVXA 5LBUA 4P6VF 2QORA 2Z1NA 4H6XA 4KSCA 1KDTA 4NCNA 4MVCA 5GOZA 3VNVA 2YHAA 5E9QA 3V8PA 4UDOA 4EA7A 2R11A 2A1IA 2BR5A 5KZMB 4LRYA 4FI3F 4YMWA 5DZSA 3K92A 4MR7A 1Q6YA 3QQ5A 1G3UA 1VL8A 3DMNA 4JJ4A 5JJLA 1ZJZA 2R6DA 2JRCA 3C6XA 2Z6UA 2H7CA 2ZULA 1Q1AA 3FTPA 4Q5IA 3SSNA 4B80A 4MQ4A 4XPIA 3EPLA 4PZPA 3DMTA 5ECWA 3AIOA 1KJQA 1FE8A 3G68A 4Z9FA 2X0EA 1TD1A 1X2EA 4BDSA 3PXUA 4DIDA 2QE7D 5F98A 5ENDA 1OU4A 3NGLA 2H2HA 3NM4A 4OM8A 3TOXA 4BQQA 3LBFA 3STHA 1L5LA 2DHDA 3IBFA 3RS7A 4BO8A 2XAUA 1QHHA 1MO2A 1YTUA 2PVCA 3OMLA 4WIAA 4J8PA 4ADSG 1N6NA 2OBNA 1YGPA 1CZLA 4NE7A 3MCUA 3VZDA 2HYDA 1HOXA 1B6GA 3FMIA 4UTNA 3BT7A 4LIPD 1QP8A 1FOEB 2C07A 4NXMB 2G70A 3HN7A 3W7BA 4FUTA 2CDCA 2ADOA 3RPEA 2VHEA 1BXRA 5AW7A 3M33A 1I6LA 5EC8A 2AXQA 4NU8X 4DSNA 4C0LA 5I7UA 3W8FA 3UC5A 1A9QA 1S01A 4IGAA 4PHFA 3OEED 1OLXB 4DILA 5A02A 4KITB 3L93A 3B3GA 2XT9A 4OBBA 2IYRA 2NXNA 3DVAB 5FTWA 3CX6A 4I9UA 1K5GA 3IAS1 2P4SA 1FRQA 1NFRA 2VDPB 4FCTA 1PV2A 2P79A 4QTXA 1MAVA 2CB9A 2GKOA 1PGOA 1JAZA 3KTFA 2GPNA 2JAOA 4NCJA 3CHYA 2B4AA 2IT1A 5BW6B 4JELA 1MP0A 3NNNA 2ZCUA 2OGZA 4XGNA 1N3BA 2Z2KA 1RQNA 3AW9A 1FRZA 2I4NA 3RHZA 3ZK7A 3BWEA 1ZX1A 4R71A 1DEOA 1A77A 3A4LA 2W00A 3FIJA 2OCPA 1IY2A 5H5JA 4QZVA 3EZGA 3E9EA 1H2RS 3SMQA 1OB5A 4S1PA 3RJTA 2OV4A 2XADA 3AJDA 3LY9A 3NBQA 2LKCA 3OPYI 1QOZA 3ZLVA 4O08A 4XR9A 4AXXA 4PINA 2IHUA 3CKMA 3INRA 4D9JA 2G9ZA 3BORA 4NESA 4E88A 1RTKA 1M67A 3NCTA 3JRWA 2GZDA 2H07A 4PG4A 4CMIB 1N78A 2XRMA 1ECPA 1JHYA 3ZWAA 1DTEA 2HYIC 3CEJA 5JO0A 1V47A 3O75A 2ASEA 2WK1A 3OKCA 1NBAA 1RR6A 3PJRA 2JC3A 3O5AA 2IVFA 1JJ7A 2ZB3A 2G4VA 4RWEA 4B40A 1XCJA 1B6TA 4C3UA 5AM2A 1E98A 3QXSA 4JP5A 1XNRB 4JUDX 4P0PB 3E9DA 5JS6A 4XYEA 1WM1A 1PG2A 2P3SA 2FSFA 4FT4A 4CG3A 3K1AA 4Y9UA 3OOSA 4Q01A 5DM2A 3E22B 4COKA 2C84A 1Y6RA 3BWXA 3BKXA 1GL9B 4WINA 3U39A 1X1DA 4BTEA 4LTMA 3BMCB 3ZD8A 4X8MA 5ARBA 4Z3OA 1H9CA 2AN4A 1Q19A 2EBWA 1X70A 3K4PA 4EGJA 4DL9A 5JEDA 3WBFA 5K8UA 4C7OB 3A6JA 3BHJA 3C7AA 4HFJA 3S1AA 4C5CA 2NVOA 1XV5A 2YNMA 1OR8A 2Z56A 3DT6A 4OLBA 3C70A 1P2DA 3HO6A 1QTRA 3FLEA 4C2UA 3PQFA 3NBXX 1PJ4A 4Z3KA 1ULBA 4KUHA 2QLFA 3FFWA 1JG7A 3A3OA 2ODEA 3D2AA 4QDOA 2JI6A 2HQRA 3V00A 3DMFA 5LMCA 4PX9A 2XCTB 3LPDA 2UZ4A 1ZCZA 4BQFA 1ZXXA 3IMKA 4BTLA 1WD7A 2YWRA 4BVJA 3MD9A 2OL4A 4P3KA 2Q28A 5M34A 3K1ZA 1EK2A 1T35A 1VPLA 5E8JA 1IMJA 1L5VA 5IDYA 5FH9A 1Z29A 3ZY4A 1Y80A 4OQYA 3UXYA 4ZZ3A 5IK2D 2NU7A 5CB4A 3KVVA 4BJHB 4UAGA 2R5NA 4QLOA 1IJKA 2YS7A 3KT6A 3T9CA 3IVRA 1Z6QA 3AR3A 3T7AA 3C3DA 1ULHA 4QT4A 4JHLA 2FSVC 1KKMA 4JT2A 4X94A 1JMVA 2LP4Y 2YWHA 2OXFA 1C8BA 3C1OA 4ZV7A 4DGQA 4PPGA 2FUCA 1A7KA 2PZEA 2QTHA 3I1JA 5H4HA 4DGSA 4Q4HA 2DPYA 3T3MB 2H9IA 4F3TA 4Z49A 1Y9ZA 1BYUA 3QKTA 4IHJA 1M2NA 3AEUB 5HFJA 5HTOA 4JBWA 1NUHA 1OFIA 4YCLA 1NR1A 1TYBE 2W2VA 5CW1A 4ERNA 4QEDA 4MVJI 8LDHA 3KLBA 4C0WA 4CTNA 3HUDA 3KG2A 2QRMA 1AO0A 4GG1A 3FPBA 2ZIXB 2YOHA 1OI3A 3BXHA 3VTAA 3FFBA 1ZH8A 4P58A 2YX1A 4I2NA 4R2HA 5FX2A 2H57A 1NBEA 3W8RA 3OF5A 2HF9A 3I9V1 1DT3A 4ICIA 4IP0A 4E5MA 2F9FA 1F2UA 1QYRA 1SCUA 1E0KA 3TCKA 5JTTA 2HSZA 3W77A 4KMMA 2DETA 1N6OA 1CVIA 2HKIA 3BGWA 3MRTA 3FLBA 3ONVA 2QSJA 1CVRA 1COWD 2AT1A 1FFDA 4D96A 2AMFA 1AUPA 2Z3WA 1VE9A 3HCEA 1WV0A 5DJ5A 3VPBA 3OOEA 3D8UA 1X7DA 3GC6A 5REQB 3EZYA 1UFQA 5F33A 5LLSA 4KYVA 5ALNA 3RYCA 3B6KA 3OFJA 3D8SA 1YI0A 1BKSB 4TS1A 5JSKA 2B1QA 4GI7A 3I0MA 3ZY6A 5EMKA 2XA1A 5FV4A 3KB8A 3KQWA 3PC4A 1XMOB 3KYIB 1H0HA 2ZPAA 3KZVA 3GJZA 1XCGB 1M1YB 1C9EA 4N40A 4RK1A 4D44A 1SHKA 2IHTA 2Q45A 4LWQA 3ZCPA 1CF2O 4YUWA 5IPFA 3TPFA 5LQUA 1LTKA 4UQPA 3FZEA 2RGDA 4M88A 2NTVA 1T4DA 3R6LA 3TXXA 2PHZA 4AUMA 1J8VA 3FA2A 3MELA 4B4WA 4DKXA 1J06A 4DLKA 4KG7A 2GPYA 3E2PA 2NSLA 4KDRA 5LYJB 4NI5A 3RANA 5A5GA 1RZRA 2MCFA 2NUPB 1VHJA 2V58A 4LFBB 4IFIA 1DKLA 4LDQA 2PGNA 3DWGA 2YWBA 4HAIA 2CKMA 1D0SA 2WF6A 3J81A 4D6PA 1YCDA 4CFZA 1KC3A 2G76A 3GDFA 2Q41A 3DTVB 3I42A 3P2MA