2XMQA

Crystal structure of human ndrg2 protein provides insight into its role as a tumor suppressor
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
281
structure length
281
Chain Sequence
AKTHSVETPYGSVTFTVYGTPKPKRPAILTYHDVGLNYKSCFQPLFQFEDMQEIIQNFVRVHVDAPGMEEGAPVFPLGYQYPSLDQLADMIPCVLQYLNFSTIIGVGVGAGAYILARYALNHPDTVEGLVLINIDPNAKGWMDWAAHKLTGLTSSIPEMILGHLFSQEELSGNSELIQKYRNIITHAPNLDNIENYWNSYNNRRDLNFERGGDITLRCPVMLVVGDQAPHEDAVVECNSKLDPTQTSFLKMADSGGQPQLTQPGKLTEAFKYFLQGMGYMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Ndrg2 Protein Provides Insight Into its Role as a Tumor Suppressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords PROTEIN NDRG2
total genus 89
structure length 281
sequence length 281
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2010-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03096 Ndr Ndr family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xmqA00
2WIDA 1XRNA 1F0PA 1THTA 2Y2UA 2GYWA 5DJ5A 1LPSA 2WUGA 1YASA 4KE9A 5D6OA 1JU4A 4I4CA 2VTVA 4OB8A 3NWOA 1NU8A 4DLNA 5AIBA 2C4HA 1XLUA 2WJ6A 1XQXA 4HRYA 4HXFB 2WFLA 5IKXA 1TKRA 1J06A 4YASA 1UK7A 1VZ3A 1XROA 5AI8A 1XFDA 5CH5A 3WIOA 2YASA 3VISA 1MAHA 5CW2A 4AX4A 4KRXA 3QZUA 2QT9A 4I3FA 2QJRA 3WK4A 3F9CA 1EVQA 1LPBB 3FOBA 4EA6A 1QE3A 2OCLA 2ACEA 1N5RA 5ALRA 2WJ3A 2UZ0A 5CMLA 4JUIA 2JGLA 3BDIA 4S0XA 1ISPA 5LZ5A 5LP1A 4K5QA 5CT5A 2V98A 1LPNA 2QJWA 3D3NA 3GFFA 4MQMA 3D0KA 2HDWA 4ZWNA 3T4UA 2R8BA 3WWPA 2O2HA 4X92A 1ZI9A 3R41A 4X00A 2HU7A 2XUFA 4YX9A 5I7UA 2FUKA 3V1MA 1ZIXA 4BC0A 2QR5A 3IURA 1HLGA 3WI7A 2XMDA 1N8SA 3BJRA 4FNGA 4KJXA 6YASA 5ALEA 1ZD5A 1IVYA 4UBKA 1CLEA 4X97A 4G4JA 4QNNA 4FNMA 2WG1A 2HL6A 4J3JA 1CUSA 4UHEA 5FDFA 5FKJA 1CUHA 3C70A 1VE6A 1XRQA 2Z5GA 4MYDA 4QDUA 4DIUA 2XUQA 3LCRA 1EK1A 2WIKA 3KDAA 4KR0A 1HBJA 5SYMA 3V1NA 3OURA 5DTJA 1K63A 4AN0A 5JD5A 2C58A 2JF0A 1DU4A 1XLVA 4WDRA 4RPCA 3L1IA 5K3AA 4KAFA 1QIMA 3C6XA 4FFVA 2PKYX 3FCYA 1Y7IA 3C6ZA 5ALXA 3BF7A 2BGNA 2OCIA 4U2EA 2O2IA 4UBNA 2JGFA 1MX1A 1BE0A 4PNZA 2OGTA 1CUXA 4J7AA 1CEXA 2O7RA 1P0PA 3AILA 2WHRA 2QMQA 2GBFA 4XIIA 3VJLA 2H7YA 4H7DA 1JJIA 4W63A 4GBGA 1GQRA 2OGZA 4KE6A 4GW3A 4B82A 5JADA 4FKBA 1ZI8A 3CXUA 5HF6A 4BTLA 5AKGA 4HXGA 3E0XA 4O08A 4M0EA 5BWCA 5CT4A 5ISMA 3A2MA 5HCUA 1QIFA 1VZ2A 3C87A 2WJ4A 5HKBA 2JGMA 2O7VA 4CFSA 3H1BA 5KREA 5DYYA 2ZSIA 5ALOA 4K6HA 3HSSA 2VJAA 3ESBA 3B5EA 2H7XA 3H2IA 5JZBA 1ZD3A 4M0FA 5ALMA 3D5EA 2XQJA 1XZDA 5AKIA 3WLAA 1DWQA 3E3AA 5E4YA 4BC1A 5AO9A 4Y9SA 3BL8A 5AI0A 3N2ZB 1E3QA 4FBLA 2D0DA 3PUIA 5AK3A 4L72A 5AM5A 3AZPA 2CJPA 4Y2PA 1Q84A 2ZYIA 3SWWA 1CFJA 4WDQA 5AP9A 2QXTA 1DT5A 2XUDA 5JZSA 2WIJA 5HFAA 3WKBA 1TIBA 1UK6A 4J0HA 3AUKA 3WK8A 4A16A 3EIOA 5A7GA 1ZOIA 2IITA 1QJ4A 1XZEA 4BVLA 4H7EA 1XRPA 3HI4A 3TJMA 2WILA 3WWDA 2JGIA 3AIMA 4FFWA 4G9EA 4BDSA 2R11A 4WFKA 3IUQA 2AJCA 2QKYA 4BE4A 1FFBA 5IVIA 5AI5A 3STUA 2OCGA 1GZ7A 1WOMA 1VKHA 4XX1A 5HZGA 5ALNA 4E14A 3I1IA 3G02A 4V2IA 1H2WA 1E8DA 1UOPA 3G0CA 3D2BA 4UFOA 1MNAA 3PDCA 4OCZA 4WY5A 3QITA 3BXPA 1SCIA 5I8PA 3LLCA 1YS1X 5EHQA 4A5SA 1R3DA 4E15A 4Q82A 1ORVA 1A7UA 1MTZA 1A88A 1AMNA 4FLFA 3HLKA 1NU6A 4P93A 2FX5A 1B41A 3BF8A 4DNOA 3Q8WA 5K3FA 3AINA 2WHQA 3W06A 4B84A 3CN9A 4NVRA 1MPXA 2ZJ6A 1IUOA 5DNVA 5HF8A 3UUEA 5LKRA 2WUEA 1R9NA 4G8CA 5LZ2A 5ALZA 1DT3A 1UKCA 2BKLA 5DYTA 1ACLA 4FTWA 5JATA 1YCDA 4B85A 3I6YA 1U2EA 5CURA 1XZJA 2NW6A 2Y6UA 2HA2A 3AIOA 4IH4A 1VA5A 1P0MA 1FSSA 4P9NA 4AMZA 4G8BA 1DX4A 4B7ZA 3F67A 3B3QA 1H2XA 4J0GA 1CUGA 2Z8ZA 3Q0TA 2WIGA 4PF1A 3O4HA 1DWPA 1F8UA 5JAUA 3VDXA 1JMKC 4U2GA 4H7JA 1LZLA 4Y2QA 2J4FA 5T4FA 5FUMA 5AM2A 1SCKA 4AMYA 4KAJA 1W75A 3R3ZA 5JALA 2WU4A 3FSGA 1SC9A 5AOAA 4N8EA 1BN7A 5HF9A 4Q3OA 2HADA 4X93A 1R9MA 5HQ3A 4ZGBA 2XT0A 2EEPA 4KE7A 5D3KA 1YB7A 4E11A 5JZ9A 3IDAA 1XZFA 1DQYA 3WK6A 1AGYA 3BWXA 5EHXA 1YSCA 2XUAA 3I2GA 3VJMA 4J0DA 3WIBA 3MGAA 2BUCA 3DS8A 5IH7A 1UKBA 3ESCA 3WQHA 5A71A 3SX4A 2ZVDA 4W1SA 1X2EA 1P0QA 4DMKA 1E8MA 3JYHA 4BAZA 2Y1KA 5IVKA 5EFZA 2OXEA 4XJVA 4C87A 3WL6A 2B20A 1YA4A 2BAGA 2CEKA 2HA0A 3WL8A 3I2FA 1FFDA 2VJDA 2RAUA 2DQZA 5JAOA 1UZAA 4X85A 2HHAA 1IUNA 2OQVA 2HRQA 1WCYA 3PFCA 3HC7A 1UWCA 4UHBA 1G5FA 4I19A 3SC2A 3TEJA 3M3DA 5AOBA 3QH4A 4MJ3A 4BCCA 1K6EA 1XRMA 2XLBA 2Z3ZA 2I3DA 1UOQA 3WYDA 1ZJ4A 2VAVA 3WKCA 4FLMA 1IZ8A 4KACA 3I2KA 5D7BA 3GROA 4RGYA 5C8ZA 2JEZA 3IUMA 1L7QA 1R88A 3OG9A 3DNMA 1CUWA 1MO2A 2XMCA 3PF8A 1CUVA 4C01A 1QIJA 4DMFA 3AZQA 1AUOA 5AKHA 4DMHA 2XUHA 1ORWA 2XUJA 4Y2XA 1ZD2P 3C8HA 1XZAA 2CMFA 4HS9A 2XQGA 2W22A 1CUDA 3GBSA 4UHHA 1O6FA 2QXUA 4EY5A 4NZZA 3EF3A 2OCKA 2XMQA 1G66A 4LKOA 3R3UA 1QIDA 1MN6A 4MXDA 1E8NA 1JMYA 3MVEA 1KU6A 1UFOA 3IUJA 3CCCA 4LIPD 4OD0A 3E4DA 4H35A 3FLAA 1CQZA 4B9EA 3IVMA 2RI6A 4X95A 2QOEA 3WKAA 2BUBA 1MX9A 4CI9A 1H22A 1T4MA 3E1GA 3DL7A 3F98A 5A7FA 5AM4A 4LXIA 4AO8A 3O9VA 1YA8A 4HTAA 2DSNA 3I2HA 1GGVA 1XRRA 3STWA 3OOSA 2HU8A 1KEZA 2JBWA 2VJCA 3LS2A 5ALGA 2WHPA 3VJKA 1ZD4A 2V9ZA 3DJYA 2QRUA 4DNFA 4BAUA 2WM2A 1QTRA 2HA5A 2IX9A 3K9BA 1O6GA 1FFAA 4GXNA 2VT7A 4EY7A 2PSJA 5LYYA 5LZ8A 2XI4A 5KWIA 1SOMA 2YYSA 1U4NA 4BRSA 4QA9A 5FPPA 4G1FA 2BGRA 3EBLA 4CG2A 4BCBA 5BWBA 4C89A 1FFEA 5CRIA 3STVA 5D3ZA 4B9AA 3IIIA 7YASA 4QWWA 1Y7HA 4J03A 5ALYA 1XKLA 1MAAA 4EUSA 3WWCA 5AH0A 4NS4A 1CVLA 1RYYA 3W9BA 2Z3WA 3BIXA 4C88A 4DYHA 4B0PA 4KEAA 1W76A 4FWBA 3EQ8A 1OXMA 4TPKA 3L1JA 5HF5A 2WG0A 4IH1A 2ZJFA 1D07A 4DNPA 2XMGA 4ZREA 4BRZA 5JANA 1QIHA 3DYIA 3ZWQA 5I9IA 4LYDA 4X6XA 2XUIA 2HA7A 5JYCA 3G9UA 3GUUA 2OAGA 2WFZA 4Z49A 3R0VA 3IA2A 2HFJA 4QLAA 4AB1A 5AOCA 2PUJA 5AKEA 3I1YA 2JGEA 1WM1A 3WA6A 5AM1A 4HZGA 5CH3A 3S8YA 2B4KA 3WKEA 4L0CA 4U2DA 4IHAA 4B0OA 1I6WA 3O4JA 3EQ7A 3ESDA 4WCVA 3I2JA 4CIAA 2JEYA 2JIDA 2QTBA 2V96A 1XZIA 3F96A 3FYUC 5ALKA 1A8SA 5EIAA 5CBKA 4BVJA 2BCEA 1GPKA 5AKZA 1YS2X 4CG3A 3QBJA 4QEKA 2ZSHA 3G0IA 5DTIA 2QS9A 4LXGA 1S8OA 1XZGA 1QIKA 2OQIA 5LZ9A 2DHEA 3NGMA 3O4IA 1JU3A 1DWOA 3D2CA 3PICA 1BEZA 4X94A 1ZJ5A 1EI9A 2WUFA 4H18A 4P08A 5DYWA 2WUDA 3DEAA 4B81A 3F8SA 4WY8A 1TCAA 1AZWA 2CBGA 4B6GA 1VE7A 1VA4A 2ONCA 4QDZA 2LIPA 1U65A 4OU4A 1E89A 3R3WA 5K3FB 1ETHA 2GBIA 2FJ0A 2QM0A 5HFNA 4DM7A 5HK9A 1TCBA 1LZKA 3OM8A 4INZA 4YPVA 4AXBA 5JARA 3F97A 5FXMA 2B61A 2GYVA 3MUNA 2QZPA 2G4LA 4EBBA 5ALDA 5C7YA 5IVDA 4OB6A 1CUFA 2QUBA 3QM1A 3RM3A 3NUZA 1ODTC 1XQYA 4BDTA 2PU5A 3OTQA 3T52A 4D9JA 1QFSA 3D7RA 3G8YA 4IH9A 4TVKA 3A2NA 4WJLA 3DKRA 1JI3A 4NMWA 1WB5A 1R50A 4U2CA 3ZPXA 1QLWA 5JASA 2PM8A 3IULA 3WMRA 1EH5A 5EIHA 3TGLA 3PE6A 3ANSA 1MU0A 5ALHA 5JIBA 4Q34A 5K5EA 1W6RA 4ITVA 1KU0A 4H7KA 4QDXA 3VVMA 1IZ7A 4FHZA 1HKHA 1AQLA 1RP1A 4Q3LA 2O2GA 4M0MA 4UHCA 4G4IA 4ZI5A 1WPXA 4EY6A 2Q0XA 1QIIA 4BYMA 2GZSA 1F6WA 4BZWA 4C4XA 2C5GA 3JWEA 2VA9A 3QMWA 3D59A 5EHNA 2C0QA 4L9AA 3EQ9A 5K3BA 4AZ0A 4F60A 1BN6A 2AJ8A 1JKMA 2PL5A 3PUHA 4N5HX 3I2IA 2WTMA 4FBMA 1G42A 2I78A 5ESRA 3WK9A 4Q3KA 2ACKA 4X3CA 4BZZA 2X8BA 3PI6A 2AJLI 1EDBA 3DOIA 1K8QA 3X3HA 2Y6VA 4L3WA 2G5PA 1DTEA 5AJHA 3L1HA 4DSZA 3O95A 5LKAA 1UT6A 2BFNA 3S2ZA 3WZLA 3ICWA 4X6UA 1MJ5A 5DWDA 4QZVA 4Q1VA 2AXEA 5BOVA 1LPPA 3QMVA 4F21A 4N5IX 2PSFA 1GPNA 1UK9A 4EZIA 3C43A 4UHFA 1DINA 1CUYA 4UFPA 3FLBA 2HA3A 2XQFA 5A62A 3QVMA 1MX5A 4BTVA 4BVKA 3H2HA 1XKTA 3WA7A 3I6MA 1T2NA 4X7BA 2C7BA 3LP5A 3FVRA 1TCCA 2VF2A 4X71A 5AK4A 4QDOA 4H7HA 2VATA 3G0GA 1CUIA 1ZGCA 2PPLA 3OC0A 4K2AA 3WYNA 2XUPA 4AQDA 4PQEA 4LHEA 1QO9A 1J2EA 2WU3A 2ZYRA 1AX9A 3MUOA 3DOHA 1DQZA 5ALVA 5CT9A 5EIEA 4UBLA 2FJPA 3VVLA 1VXRA 4FMPA 4CCYA 4EB0A 1LBSA 3P2MA 2XE4A 4W1RA 1TQHA 3M81A 2C0PA 4GLBA 3FYUA 5YASA 1LNSA 2ZJ7A 2X5XA 3FYTA 3DL4A 1IUPA 1G4HA 4ZXFA 1JT2A 4EY4A 5F4ZA 4GWLA 1VXOA 2PSDA 2G63A 3G9TA 1VLQA 2CB9A 4KAAA 5C8VA 3W9UA 3WWEA 4N8DA 2JGKA 3JW8A 4J0CA 4DNQA 3DKKA 2XUOA 1WB6A 3FAKA 1EINA 3K2IA 2Y2VA 3PFBA 4BAGA 2BJHA 3HABA 2OAEA 3SK0A 1XZKA 4J0KA 1PJAA 1ZIYA 5DLPA 1QO7A 2GBCA 1JJBA 1CUJA 2DFPA 5K3EA 3W2TA 2GBGA 5ALIA 3ANTA 3QYJA 4U2FA 1CUCA 5CH8A 3AJAA 4B83A 4CCWA 4BB0A 1E5TA 4CG1A 5BV7A 3U0VA 3RLIA 5AK6A 1EVEA 4Y2UA 3GA7A 1Q83A 4QDTA 5AK5A 4F0JA 5KWJA 4G4GA 3WK5A 4BBZA 3M83A 4IO0A 3A6ZA 4Y7DA 3STXA 1XRLA 1TRHA 2XUKA 3G0DA 5C8XA 1PV1A 4UBMA 2DCMA 2ES4A 5AICA 2E3JA 3O0DA 1CUAA 5AI6A 3BDVA 3I6ZA 3H04A 2XMBA 4QWMA 1UK8A 1AURA 2ECFA 4H7IA 3V9AA 4Y2TA 1GQSA 4JYPA 4X91A 3H18A 3WWOA 4CCYB 2EDAA 2WKWA 3ZLVA 4C6HA 1UXOA 2PX6A 3GELA 3WZMA 3DYVA 4DGQA 1YR2A 5AI4A 4W1QA 3A2LA 2DQYA 1GXSA 2VSQA 1WHTA 4OYYA 3R40A 4H0CA 4EY8A 1UOOA 5AM0A 1DX6A 2AJDA 2WG2A 1XQVA 1AKNA 5ALLA 1XZLA 2WSLA 2ZYHA 3K6KA 1YAJA 5AI9A 5E2IA 2XUGA 5FLKA 3FWHA 2WQZA 1C7JA 2RONA 4PV7A 3C8DA 2VT6A 3FNBA 5T4BA 4OU5A 3H17A 5IVHA 5LIPA 5SYNA 5ALSA 4G9GA 5ALTA 2XMZA 3R3VA 4GDMA 1N5MA 4DTCA 1U8EA 1ZI6A 1Q0ZA 4OB7A 1LPOA 2WTNA 1HDEA 5AKKA 2BUAA 4MEAA 1BCRA 4FLEA 1HQDA 3AZOA 4A23A 4BATA 2WFLB 2VAXA 5E4JA 3BIWA 1QOZA 3ILSA 2W6CX 4UBIA 2J4CA 2ZYSA 4H77A 4FDMA 1SCQA 2C5FA 3C6BA 2HIHA 4TGLA 5LLSA 3H19A 3ZLTA 5K3DA 3H1AA 4ETWA 2D5LA 4B80A 2HA4A 2DHDA 5CXXA 1FJ2A 5LZ4A 5E4TA 5EGNA 2HFKA 2QVBA 3RKSA 1K4YA 5ALQA 3H0CA 3WK7A 1C7IA 1CQWA 1L7AA 1P0IA 3G9ZA 5EHZA 3R3YA 4HXEB 2HRRA 3KWJA 1QZ3A 1X2BA 3FLEA 1B6GA 1Z68A 3HXKA 4KE8A 1EHYA 1BROA 3O4GA 4UBJA 4P92A 4UPDA 5J3JA 3FSGD 4PO3X 4E46A 1PFQA 5FP0A 4JH0A 1N1MA 1XLWA 4QLOA 1QFMA 1EDEA 1CUEA 3G9XA 5FRDA 3BE8A 2ORYA 4JNCA 4K6KA 4UUQA 3HZOA 3OPMA 1LGYA 2OPHA 4MWSA 4Y2SA 3HJUA 4WFIA 2DHCA 2CZQA 5AKXA 4JYMA 3PF9A 3V48A 5C81A 4CIBA 3ZI7A 5AM3A 4OUKX 3H2KA 1K5PA 1X70A 1ACJA 2J3DA 3IUNA 1F0NA 1H23A 2RHWA 4MQLA 4G8DA 2RHTA 1A8QA 1EA5A 3CN7A 2WHPB 5JAHA 1QIEA 3UUFA 4HAIA 4BP9A 5ALWA 2JGJA 3D2AA 5AIAA 1JFRA 1HPLA 1LLFA 3DDUA 4C4YA 4BE9A 2WIFA 5JAPA 4OYLA 5T4HA 4Y2RA 1BCSA 1TAHA 1RWQA 3B12A 5ALFA 3STTA 2VEOA 5HK8A 2K2QB 3QPDA 3WL5A 5CT6A 2YXPX 1R1DA 4QE3A 3N0TA 4DMCA 2Z8XA 3DD5A 4AO6A 2H7CA 2XQKA 5DNWA 5AHXA 4PSDA 3STYA 4N8SA 3ICVA 4DSAA 5HKAA 1YB6A 1W4LA 2J3QA 4IQ4A 4J0JA 4OPMA 1THGA 1Y37A 5H3HA 2PSEA 3DQZA 5AKLA 3RK4A 4ROTA 5ALUA 4MEBA 3R3XA 1JJFA 2XDWA 2PVSA 5CTAA 1TK3A 3DCNA 3VXKA 5CXUA 3A70A 4PSCA 3RARA 4J0IA 3FCXA 2RIPA 1VOTA 3UMJA 3NOXA 4JEIA 4KYVA 2P8SA 3QPAA 1CV2A 1QONA 2VJBA 4RE6A 5ALJA 2WFMA 4GEGA 2OG1A 3G7NA 1J07A 1Q0RA 3IBTA 4BCDA 1XQWA 4Y2YA 2PBLA 3C5VA 1QTIA 4K6GA 1EB9A 4GI1A 4WFJA 3WJ1A 3KXPA 4UHDA 5CT8A 3C45A 3WL7A 2H1IA 1YAHA 5JD4A 3M82A 1OILA 5ALPA 2V97A 3V1LA 2AJBA 1HL7A 2I03A 4KRYA 3TRDA 1GKKA 1VJ5A 3D4LA 2DR0A 1BS9A 3LIIA 2VQ6A 1EB8A 3AIKA 1J1IA 3I28A 5AKYA 3HEAA 5DNUA 1USWA 5KBYA 2EDCA 4G5XA 2IIVA 1CRLA 2XLCA 3G0BA 4MYSA 3VKFA 4MWTA 3C5WP 4OSEA 1CUUA 1WHSA 1BRTA 3ESAA 4HRXA 1XZHA 3KWFA 1XZBA 4LXHA 3H2JA 1BU8A 5JD6A 1C4XA 2XMRA 3C6YA 4C4ZA 4ZRDA 1ODSA 4AN1A 2RGUA 3WKDA 1CIJA 2PUHA 1OCEA 3HACA 3KSRA 2GYUA 5FOQA 1CR6A 1NX9A 1IMJA 3FVTA 3LIPA 1BEEA 5AKJA 4Y2JA 1W1IA 2OLEA 3W04A 4X6YA 3U1TA 1QGED 3QMMA 2CUTA 5LZ7A 2HM7A 1LPAB 3WJ2A 4RNCA 5FPQA 2XMSA 2ROQA 4ZV9A 2I3ZA 4X90A 4BP8A 1QIGA 3V1KA 3GZJA 4ARBA 3CCBA 1UKAA 3IB3A 4H7FA 4PSUA 4Q05A 2XB6A 4XVCA 1CUZA 1EK2A 2GZRA 4PW0A 4YK7A 4LYEA 5K3CA 4GHWA 5A6VA 2YH2A 3BJMA 3QPCA 1A8UA 1WB4A 1MT3A 4XWGA 1GT6A 1ZICA 1W52X 3DLTA 3KOOA 4W9RA 2WLSA 3ZV7A 4AO7A 2CKMA 1EXWA 5A2GA 5T4EA 4AZ3A 3H2GA 1CUBA 1CPYA 1H2ZA 4GECA 4UBOA 1EX9A 1L7RA 4UFNA 3HRHA 4FOLA 1WPRA 4HVTA 1SFRA 3W05A 3HYSA 4Y2VA 2HA6A 4ARAA 1ODCA 2OGSA 5A7HA 1AC5A 1XZCA 1LBTA 1GKLA 2X76A 5EI5A 1M33A 2XQIA 1GPLA 3ZLUA 4F5ZA 3FYUB 3AFIA 1XZMA 1FFCA 1MNQA 3O9MA 5FV4A 3ED1A 1H2YA 1LPMA 1EDDA 2HU5A 2B9VA 1ZGBA 1E66A 2PU7A 5HQ3B 2PSHA 2H9YA 3FBWA 2G5TA 4RE5A 4ZV7A 2QUAA 1R4ZA 3YASA 4EHBA 3KD2A 4U2BA 4W1PA
chains in the Genus database with same CATH superfamily
1M3SA 1XRNA 1M76A 3PP8A 2BMDA 3CA8A 2XNJA 3GVXA 1AQNA 1JHQA 2CZCA 4RMGA 3EHDA 1LPSA 3LOUA 3JR3A 3T0IA 4BNZA 3T0GA 1BXZA 3GRAA 4R41A 3DBIA 1J8FA 4OB8A 2CYBA 3QWAA 5K2OA 2BFFB 2PQ2A 4Z7NB 3FTFA 4R4JA 4B6EA 4HZUB 2CCGA 3FVQA 4OX9B 2XKJE 5AIBA 2C4HA 2CYCA 2GCEA 3OP1A 1G3UA 1U0EA 2WJ6A 1XQXA 2YW2A 1NMYA 4OHUA 3R8CA 1NPDA 5K6TA 4YBZA 1M6WA 2OP0A 1ZOPA 2WFLA 5TMEA 1KRWA 4Z1OA 3OIVA 1DAMA 1TKRA 1UXJA 2NYUA 2OCPA 4Q9AA 3MWJA 5KYXA 1OXKB 2AD5A 1LS1A 2IE0A 5B12A 1YU9A 3VR2A 1NXOA 2Q3EA 4B44A 1OI4A 3QQPA 3D31A 3CY6A 4O4IF 4C78A 2I33A 4ER7A 1YZHA 2YASA 1NVXQ 1UJCA 4RM3A 3VISA 5HIMA 4Q4AA 4CTMA 5JXWA 3MWEA 1ZVVA 1JAYA 4BMZA 5IRCD 1VCHA 1YL6A 3K1TA 4JP3A 1X1RA 2QJRA 5I7FA 1WOYA 3BQMB 3ND5A 4EF6A 3L92A 2VFAA 3LBFA 2UYGA 3FOBA 3O7MA 2Q3LA 4UMFA 5GONA 3EDYA 4PM4A 3TVTA 3UMMA 5JAIA 4DV2B 3DEJA 1IM2A 3VOSA 3BD6A 1RZUA 1E2UA 3L7CA 3ZIDA 1G8PA 3BOSA 5LQUA 1E20A 3ADCA 1UQUA 5ALRA 1G19A 2UZ0A 2J46A 3PPWA 1GRQA 5K4GA 4M53A 1JG6A 1LDGA 1NN1A 2XSZA 2Y0PA 1E7QA 1HE4A 4FN5A 3BWYA 2EW2A 4TXHA 1ZD1A 3O7WA 2I8CA 4R0VA 4MP8A 2RGWA 1YDWA 4WESB 5CT5A 2VNKA 4QPDA 2CXUA 5CAEA 3RPEA 5LSAA 5ELLA 1ONNA 2QYHA 5JQWA 1GCIA 2QJWA 3D3NA 3GFFA 3SQMA 4N18A 1XP8A 4DMGA 3JQRA 1XLTA 4ZC8A 1CF2O 1GNSA 3D0KA 2XNDA 4Y6LA 3RUFA 2ZPTX 6GPBA 2FW8A 3V1UA 3HDGA 3TNYA 3W8NA 4HAXA 1Z7YA 4ZWNA 1WWKA 3D8RA 3X1YA 4LXXA 4F3NA 3TEFA 3IIJA 4JDPA 3IMFA 3IP7A 3RRMA 3T4UA 1A69A 4N3GA 2O2HA 4X92A 5CIWA 4LBVA 4JELA 2HPVA 1YE8A 3R41A 4P3XA 4UDYX 4X00A 3HP7A 2HU7A 2XUFA 5T3YA 1E9CA 5I7UA 1JILA 3N2YA 4RH1A 3PPXA 3IXQA 4M9RA 4Q3DA 3V1MA 3ZWCA 2C96A 1CKEA 2ZTMA 3GNSA 5EHGA 2YNMC 5BRNA 4BQPA 2FF7A 8ADHA 2R97A 2QR5A 3HMKA 5IJ0B 1FQWA 4AWAA 1J1UA 1GVNB 5FL7D 4KZPA 2XMDA 1WKCA 1SC4A 2XJ9A 4P4GA 1CG6A 1C2YA 2EFHB 4HMPA 4YP1A 2AFVA 2Y93A 1IN4A 2AEEA 4R1MA 4UEWA 1CFZA 4WZBA 1VPLA 1C9JA 2O14A 2NU9B 2C9YA 3ZVRA 4X97A 4FJ0A 4LY0A 1HQYE 1JHYA 4G4JA 2WG1A 2JGRA 3A4LA 1O89A 2E5LB 3QEOA 2C5EA 2POQX 2H0AA 2HL6A 5F9MA 4OSPA 1CUSA 4UHEA 4ROSA 4C0KA 1WNFA 4ZARA 5J2UF 1KDYA 3BIJA 3SXUA 3N07A 5FDFA 3ZDYB 3C70A 1DV1A 3BKXA 3Q4GA 3L0YA 5KCZA 1OH8A 2EF0A 4FM9A 2ZTHA 1EHIA 2QUIA 2ZWOA 4LZLA 3MIZA 5AW4A 1XRQA 4FOOA 3SHQA 3VGJA 5FI1B 4HB2A 1G20E 1MB4A 3LE8A 4LC0A 4UHJA 5JQGF 5HIKA 1P77A 1T0JB 1U7OA 5E9WA 4RJLA 1J21A 1GNLA 4QRIA 4KN5A 3KDAA 4L8GA 1XWFA 1HBJA 4BJ6A 4FJ1A 4BRUA 1W2HA 2I3AA 1JB9A 3QSYA 3LPNA 2ZM6B 5CX1A 3ZZNA 3MUFA 3ZHYA 1Y1KE 3ICCA 4F4UA 1GEGA 1MB3A 1KK0A 3ML1A 5TPWB 4FIZA 2B2CA 3A0RB 1EEHA 4UAJA 4GKVA 1PZGA 4GX1A 4XDYA 1N78A 3EA5A 5BMVB 3DDWA 1YIAA 4MGIR 1S3SA 4AMBA 2GO1A 1OWLA 1MRZA 4L3OA 3N3BC 3HU2A 2Z5LA 4QG7A 1EBBA 2EX0A 2REOA 1QVVA 1V43A 3G7SA 1PZFA 2GHIA 2JCVA 3G68A 3BF7A 1XPJA 2BGNA 2GD0A 1JDTA 2JJ1A 4MV8A 4ZO8A 5GQSA 5CIYA 1XTTA 5HTOA 4JI2B 1XMIA 1Q0LA 1TU3A 1NF8A 4U2EA 5GMOA 1H65A 1IG3A 3OTHA 1MX1A 2J9FA 2Z04A 2MCFA 1DKRA 1RFLA 3ND6A 3Q87B 1CS4C 2WPNA 3RC9A 1F1BA 3SC2B 5KOHB 4ZANA 1KDVA 2PO7A 1XCGB 3GLQA 5SZJA 1BMDA 1JQEA 5K99A 1ENOA 1GZDA 4DQXA 4YS6A 5JJLA 1Z39A 2AZ4A 3OICA 4K3UA 2UXBB 1NVKA 4PSAA 4C0QC 2QMQA 4XIIA 3VJLA 4E03A 4BKQA 1DBSA 2YIJA 2FB9A 3HBFA 3LC2O 1D09A 4JB2A 3BFPA 5JTTA 4K0KB 1T5BA 3OFKA 1UPCA 1A5ZA 1FMTA 2FG7C 1KH2A 2YUIA 1NBMD 3TNJA 3ZWPA 1TVCA 2OGZA 2Z57A 3M9LA 4GW3A 4XX0A 4YIKA 1ZZGA 2F8MA 1NULA 4L16A 1XTVA 2P4UA 3MC1A 3OM0A 1ZI8A 4XD2A 2QTHA 2UUCB 2Z58A 4KH1A 3GFQA 3LWNA 4EA8A 5BUQA 3AR6A 1CEQA 2CDRA 4L2IA 2HF9A 4HXGA 4B1FA 1W7AA 3HV2A 4JASB 2J59A 3O26A 3Q8KA 4ZAYA 1E59A 2X5OA 4ZQGA 4ZI7B 1FJHA 4J1QA 5KNCD 4ZPXA 1Q2XA 1QIFA 3HG7A 3OIDA 3WQQA 7MHTA 4OTZA 1RAAA 2B8JA 2SNIE 5HKBA 5L7TA 2JGMA 5HDQA 2O7VA 3SQNA 4ENVA 3OJOA 4XOIA 5DYYA 4M46A 3L4BA 4YRPA 4A15A 1WSWA 3V7FA 4K6HA 1FRNA 4HWGA 2XZTA 4D9CA 2HSJA 3IELA 3ROPA 1WR8A 1ZH6A 1FP4A 1JEQB 3K1AA 2VQSA 4L6IA 3HGMA 4NCHA 2TMYA 3KVVA 4UU7A 3KQYA 4UDNA 1ZD3A 3RYHB 4KI7A 5AQ1A 3PI7A 2NO6A 5HKKA 5FBWB 4OHZA 1AY0A 1DQNA 1EAMA 3GLGB 1NQWA 3KZOA 1XZDA 4K05A 3WLAA 2PUTA 2KLHA 1KDPA 1U3DA 3AHJA 4LYGA 3T7TA 2PUBA 4II2A 4RV5A 1NR5A 2OHOA 2WYWA 2XODA 4HLUC 1QHXA 3DULA 3QNUA 4MW9A 4OFZA 5EC8A 5E1DA 3GRYA 1SEVA 4U39A 5IT0A 5THKA 3T4EA 4JR2A 5C37A 4JUFA 2FV8A 1J09A 4UQPA 3PUIA 3U48A 1FUKA 2VHCA 3BJEA 4H15A 1PI3A 4MIOA 2QQ0A 5EJ2A 4MR7A 1NHWA 1HRDA 4JT2A 2NU6B 5JAQA 1YV9A 3RJ9A 5KYGA 2GM5A 3GLHE 3MXOA 2SKDA 4HFJA 1DJLA 1CFJA 1K68A 1PJ4A 2JZCA 3CG0A 2QMHA 3M9XA 4G1UC 4WDQA 1P4HA 1QZXA 2P4QA 3Q11A 4W5OA 1ESZA 1MG0A 2HNKA 4F9EA 1JMVA 3WADA 3WGOA 5HEKA 3WRXA 2AOUA 1JAHA 1F7VA 1YHNA 4J0HA 1LWOA 3EQ2A 4BO0A 4YT8A 4KLAA 4U0JA 1T4CA 4UJ5A 2J67A 2NZXA 4CYMA 2YZKA 2CKDA 1IMOA 1RCTE 3EIXA 3H5NA 3I76A 4PPGA 5ELMA 5LLDA 1YZTA 1D9XA 3CG4A 5EXDA 3IESA 1N2CB 3P4UA 3NTQA 4U9UA 1NMXA 3FZNA 1CRWG 4ZT3A 4UM7A 5ECWA 4NZYA 4YRJA 3RT1A 3FE2A 5C1PA 1F7UA 4JZKA 2IZZA 4N82A 3VOTA 2P9GA 4QUAA 3X1JA 1O5IA 3HCWA 1N2BA 1SCNE 5F5LA 4KNVA 5IF9A 5FJJA 1XTJA 5HRUA 1PBTA 1XRPA 3QE3A 1Y3DE 3L9WA 3NR2A 5HUHA 5KTRA 3E23A 2VTBB 1IULA 2OFOA 2ZJ3A 2I6UA 1YGPA 1CYDA 3WWDA 2LR0A 2QP9X 3OP4A 2FEOA 2I99A 3AIMA 2BGWA 1I2BA 2WEKA 1GPH1 3OA2A 5I9BA 1PEYA 1QHFA 1C7RA 3RV4A 2V7QD 4TV9A 1G7TA 1W5EA 2FSSA 2BGJA 2GHQA 2Z6UA 4F2HA 1Y8QB 4L4RA 3I64A 5DU2A 1QYIA 3IUQA 1SKYE 2GILA 3AR3A 4EHIA 1T8YA 3KT3A 3EUAA 2YHSA 1U8YA 1FFBA 5IVIA 1VJGA 3QUAA 3V2UA 5KKNB 1P9RA 2ZK7A 4G5FA 1N2IA 2AHOA 2GVDC 4ND7A 1KSJA 1U2TA 4WKCA 4F6CA 3IHKA 4XX0B 4E2WA 3DVSX 5JO9A 4QJ5A 3UW1A 3KK0A 4TKVA 2NSJA 2C2OA 2VYVA 2VA8A 4PYKA 3NWBA 4PO1A 3WP0A 3UJHA 1NXXA 4DJJA 1XZPA 2R79A 4P2BA 3DVRX 4TLBA 1MNAA 4TLAA 1ABBA 1K0UA 2YW9A 3ZKAA 1KZ9A 2QAJA 4MV1A 5H7XA 1TGYA 1PDVA 1E79D 1B3BA 3BXPA 1G7RA 1DJOA 2IPAB 1N25A 2I4IA 3F5DA 4MS1A 1NBEA 3PDIB 1NVBA 1ZUNB 3F5MA 4N5MA 1PR3A 3VYVA 3ZDQA 2I1WA 4F3KA 4XWWA 1HWYA 3CZAA 5EHQA 2YXBA 1K97A 5D2CA 3SNHA 4ARUA 1CP3A 4MS3A 3OOJA 3PSAA 4E15A 2AQIA 2LE0A 1MV8A 3ONNA 3VRHA 1A7UA 3ZE7A 1A88A 1QFJA 3DHNA 3DXXA 1YDGA 4MUFA 3RS2A 1W4ZA 5IAKA 4ERXA 2H1VA 4NX2A 1HTWA 3W2GA 5I8ZA 2BFCB 2Q3FA 1VHDA 1WMAA 2O52A 2VQEB 3WMGA 4KOAA 1L5HB 1N36B 1CTQA 2GETA 3IP5A 4Y18A 1S7GA 4F4HA 2PHZA 4PQYA 2FX5A 1CNEA 4B76A 3G79A 3U1BA 3WE7A 1AS3A 4D1YA 5LMUB 1HA3A 3AKZA 3JY6A 1X1QA 2JATA 1Z74A 2ZREA 4CIWA 1FRVA 4HWPA 2QN1A 5IF3A 3ZJ5A 1WCV1 1QH8A 2WZCA 1X1CA 3A1NA 1R8XA 4E94A 5L3RA 1L5QA 3W2IA 2C9DA 3FVWA 2Q2WA 3T3OA 1Y8AA 2YCLA 4G0MA 4IYJA 4JLKA 1V3TA 1Z2AA 3JQ8A 4G4SP 4LJKA 3OFVA 1DBPA 2E6UX 4MUKA 5IKOA 3I9KA 2GZ1A 4H0FA 4I3HA 3WLQA 4LGVA 4X1IA 2AUNA 2WUEA 4HBZA 1YCFA 4I9GA 5LZ2A 2O7NA 2GUWA 2VBIA 3DHWC 4OA8A 5DGXA 5ALZA 1OXUA 3TKAA 3GIDA 4FDVA 2VUHB 5A5DA 5IBQA 1PX0A 1SUDA 1SH7A 2O6LA 1Q1EA 1LVGA 4MWZA 3ZW8A 2BR5A 3KYBA 5T5QA 1ZINA 2PGJA 3DV0B 4WH0A 1NFFA 1C1XB 1E1QD 1TL7C 3OCXA 4OM8A 1FJXA 2IH4A 1YCDA 2O8FB 2FPSA 1KZGB 3D8BA 1SRQA 1XZJA 4Z3DA 4EL5A 2B8WA 1BGXT 3I12A 4HAUA 3AYXB 1L5WA 4IH4A 4ZMBA 5DTMA 1ZRMA 5GV8A 4AMGA 1BKYA 4HGOA 2O3UA 3A1VA 4YRLA 3NPAA 4G8BA 5K1ZA 2BFBB 3H4TA 5TE9A 5JMOA 3SS9X 2O0LA 2QM3A 4BNGA 3B3QA 4Y1GA 2KW5A 4TWJA 3UENA 3GJTA 3ZHVA 5B4TA 2WM8A 4PZCA 1UXIA 4EPXA 3CZQA 4GH5A 4FWIB 1I2DA 3JD3A 1F8UA 2JANA 2R1UA 2O2DA 3VDXA 3FGNA 2RB5A 2F9FA 4RY2A 2AFIE 1E0JA 4H7JA 4Y2QA 2J9YB 1I3OA 1JR2A 2V8BA 1SCKA 2GNPA 1W75A 1J6UA 3R3ZA 3WVNA 4CMEA 4D5EA 1HX7A 1P5HA 2FRVA 1OHHA 2FW0A 1UZLA 2OGUA 3C41J 4B7UA 4RTPA 1CZUA 3FSGA 1OU4A 4TS9A 5JDIC 3SE0A 5CFZA 4N8EA 1DEAA 3HB1A 5KCMA 5I9LA 4FP9A 4P82A 4WLEA 5C7YA 3GDGA 4LV5B 1U9JA 5HF9A 5A0FA 3O4FA 2QTTA 2J45A 2D06A 1EWVA 1Z3IX 4IDFA 4JUAA 4Q3OA 4HD8A 4D3DA 4H1HA 3ORFA 4V0RA 1HDOA 1X8JA 4ZGBA 2XT0A 1T5HX 3T7SA 5CLIA 5C1BA 1G5TA 3DVQX 3SSAA 3PTAA 2YOGA 5JHGB 1ITZA 2Q6KA 3BXEA 3IDAA 4P36A 2A9VA 3ELBA 1QG2A 1CCWA 2NUTB 3BWXA 3LZDA 4GYYA 5ITVA 3H3FA 4G0WA 4YXFA 1C0LA 2ZIFA 3OKAA 4JJEA 3W0LB 1ZN9A 3FROA 5EHXA 2PD3A 3UA4A 3E58A 2K6GA 5IAJA 4QGBA 5EFOA 3LOQA 1TK9A 4A0GA 4D3XA 1JFFA 3PQDA 3VJMA 2P69A 4MQEB 5KYUB 3MGAA 1G8KA 2PZFA 3R7LA 1XQ6A 1NJGA 1Z83A 1GKUB 4FQ7A 4CMGA 3NWJA 5JXHA 5AVVA 5F64A 3OAAD 1N1EA 1OYYA 1UBUS 1TE2A 2D5IA 3ABIA 3ESCA 3DCJA 3WQHA 2ZVDA 4EDHA 5JS1A 2IGTA 1UKEA 1XDBA 1XDWA 3F4KA 3NHYA 4W1SA 1I2ZA 1NHGA 1P0QA 4DMKA 4GP9A 3JYHA 3ZV4A 4PN7A 1VLZA 5JBNA 4BAZA 2P4HX 3TPCA 3X1XA 5IVKA 3K1AB 1NTOA 4BUJA 3PQEA 4FOSA 4JC4A 3PEUA 1ZL2A 1P7VA 4LC9A 1O54A 2B20A 3M89A 1I24A 2P9HA 3QWIA 1FYDA 2CEKA 4K81B 2HA0A 5DP2A 5E6UB 4LXTA 4BMDA 1ADGA 3H9BA 3TF5A 4DLUA 4JQOA 4RD4A 4Q1DA 2VJDA 4RGQA 2RAUA 5CW1A 2KHZA 3A1SA 1Q3KA 4KIUA 4HNTA 1GSIA 1PWZA 1DAEA 1I9CA 3AY3A 3ELUA 4GGMX 2X6RA 1Q1GA 4LYAA 5CJJA 5E95A 4MJ7A 2I0FA 4AY3A 4RTLA 1NR1A 3HB4X 3CVWA 4RPJA 2ZUBA 4C1BA 4CT5A 3LNCA 3KZKA 2C77A 2FKAA 3IQDB 1X19A 1PVVA 3CLSC 3CVJA 3S1LA 4FWTA 4QOJA 2ODTX 1Y1TA 2DBQA 3C4JA 4PSVA 1NC3A 3U7EB 3M6UA 4JIGA 1N0IA 1J8QA 4JODA 3N70A 1GTG1 4JSYA 5EL0A 5F73A 2WWIA 2QR3A 4XUDA 4JD5A 2JFPA 1HTBA 3TEJA 1KEVA 1EVJA 4QYXA 2VXBA 3EYWA 5DHAA 4IF6A 2QMYA 3B6KA 4KHPB 4IDDA 4YN3A 1ZLYA 2PRKA 2JH3A 3UJ9A 4ER6A 3ZVMA 4KX3A 1TZKA 3TYXA 1E1YA 1GA6A 3RYTC 1Y6FA 1TW2A 1CR2A 3V8RA 4DS3A 5GWXA 4FK8A 1EFKA 2PQMA 3PHBE 2IOFA 4M2LA 2OYCA 3ECAA 4AM8A 1Q91A 3DZHA 3RJMA 4BLOA 3H9QA 4Q4JB 3Q7QA 1T9BA 1G4AE 1FSPA 2JFGA 4JC5A 2W6JA 1OZGA 1HZZC 1T0UA 1AA6A 1P8JA 1ZJ4A 3OCJA 1MOZA 4HH3C 4WLNA 4RL6A 2VAVA 3COWA 3AR8A 4RESA 3WNDA 3WKCA 1OXSC 3ASVA 1RRMA 1J56A 4N5DA 3I2KA 1WMFA 3ZW7A 4A0SA 5AD1A 5T7BA 2FLKA 2FWAA 2WVJA 1AQJA 4HDCA 2CVQA 3FDJA 1Q1BA 2RCNA 3QEKA 4JQZA 1QK4A 1PYGA 4J9VA 4CODB 3GROA 4D9IA 1JUDA 1WXXA 2X19A 3IB6A 2O8EB 3PLAE 3EXHC 4EMSA 2IEBA 1P3Y1 1HNWB 1N0WA 2R7MA 3IAAA 3MWDA 2YJZA 4XWTA 4W5JA 3RCBA 1R88A 5DWVA 1OIVA 1L8AA 1OGJA 3SKXA 1TA0A 3K8OE 3EXHB 3CNQS 3ZGNA 4LRQA 2BKXA 5H9VA 4C01A 5CCXA 1GQFA 4MKHA 1XAJA 2REQB 5IPFA 5AKHA 5DK6A 4KQEA 4A8TA 1OAOA 4BFCA 3HFGA 2ALJA 1KTIA 2XUHA 4XLZA 4IIJA 5DGTA 4UTVA 4CDRA 1EP2B 2XUJA 1Y89A 3DBHB 3FOCA 2ERXA 5BN3A 1Z7BA 2J0SA 2CMFA 1E6UA 2TSYB 2E5WA 4M37A 1XA4A 1R16A 2YYYA 5FR2A 3U3KA 1F2UB 1N92A 4DUGA 4ZMSA 2WWRA 4NFYA 3WV4A 1XNRB 2VHZA 4PS0A 2QXUA 3VUFA 4CBVA 1G8FA 4XWKA 2H4FA 4YV2A 5JRZA 1WSAA 1ZPDA 5DLQC 3NUGA 3C24A 2PFSA 2CF6A 3FH0A 3AK4A 3HCEA 1GG8A 3MLAA 3QJGA 1DSSG 4NEHB 4PHTA 3NHJA 1UWLA 3IHWA 1OTXA 3ONDA 5HILA 1N2OA 3W7VA 4ZQBA 2JIZD 1E60A 2OCYC 2FGJA 2AQ8A 1VIMA 1KOFA 3LQQA 5P21A 3U61B 1WXIA 4RETA 1T4BA 5I45A 1S5PA 3KVRA 3MVEA 1SO8A 3MF4A 4EYKA 1F20A 1LC3A 1LFAA 3TB4A 1VBKA 1AZLA 4LIPD 1W4CA 3BK7A 4H35A 4PZ9A 2IC5A 2Q6TA 2WNSA 3FLAA 4LSZA 4XPZA 5HUJA 1H69A 1KC1A 4O02B 2Y0EA 4Q7MB 3EZXA 1RI4A 1SC3A 4B9EA 4GI2A 5EJMA 3IVMA 4X95A 4DQKA 2QOEA 3WKAA 2WZQA 5E6RB 1PNTA 3RBAA 4DQDA 1I4DD 4HYYA 1LEHA 4IIYA 4KKXB 5J1TB 4EYSA 1BD4A 2BFEA 3ITDA 3ODGA 4ID3A 4QUHA 5FL7A 3SF8B 2GCOB 3TR5A 4CI9A 5HS6A 3ZHOA 1P39A 2C0CA 3PUYA 3KL4A 1OB2A 4HK4A 4D0GA 1N2JA 5KYWA 3KB1A 1QMPA 1DXYA 2IEDA 4JKIA 4ZOLB 1XRSB 2GWRA 1E64A 2H5LA 3BXZA 1YRAA 3M8KA 4QUKA 5EXEA 5BQFA 3NXKA 3WFIA 4CEIA 5C3MA 1OBOA 3PT9A 1F06A 3OC6A 4HTAA 4N03A 1YZGA 3ND9A 3I3OA 1Z5NA 2QZSA 4IIXA 5JCJD 1XRRA 2I2CA 5KVQA 3TFOA 2XNDD 4EG6A 1KQ3A 2LKDA 1GILA 4ZEXA 1NAIA 1QYRA 3H05A 4MUIA 2JBWA 2VJCA 1TUBA 4PONA 3DC7A 2RK4A 2E4VA 2IBSA 3O4RA 1QO0D 2HWWA 5ALGA 5HGXA 1OD6A 2PH3A 4XTRA 4YJFB 2M98A 4FUQA 5DM0A 3IUSA 1E9VA 4EQ6B 4NRDA 1UMBA 4P34A 4LPKA 4OK5A 2F8SA 4UJ3A 1S96A 5LUAA 1NBHA 2RGEA 1Q7CA 2V9ZA 5JOQA 2VXOA 3EZ7A 5G2OA 1XPOA 3EPHA 3CF0A 1E4EA 4YYZA 1QRDA 1A82A 3E82A 3MRTA 3C97A 3LT4A 4DNFA 3KAPA 1CQPA 1PGOA 2WDPA 3SHOA 2WZBA 1GWNA 9MHTA 3HY3A 2WM2A 1QTRA 1E7YA 1VG8A 4MDHA 3DVLA 2QIOA 1DJQA 4L4YA 1AZSC 1CJVC 2BBSA 5KTNA 4GXNA 1UDWA 2HKIA 3LHKA 1UANA 4GL4A 2X6TA 3RGWS 3KZVA 2VT7A 3RTAA 3REGA 1M7GA 5TPZD 1U0BB 3AP2A 1ESCA 2AT1A 3DV9A 3ETNA 4MZDA 3JZIA 3NTXA 2AZTA 2FPKA 3LX8A 4XDGA 2ORIA 4IS2A 4DCNA 1LV8A 1VYHA 1E2HA 2BMFA 4UEJA 3MGGA 2F17A 1ZHHA 4KTVE 2YYSA 3HGTA 1U1DA 4TZ6A 5KNBA 3HJNA 10MHA 5TPZA 2X4LA 3QUSA 4BRSA 1AMOA 4EARA 5ELXA 1UJ6A 3DZFA 3H5AA 2BGRA 3JPYA 1E2NA 1TO1E 1CETA 1ZBQA 3NP7A 4YMSA 2I22A 4IEIA 2A9OA 5A3QA 1F4VA 1QNLA 2ZP1A 1W0KA 2QWXA 4PLWA 3STVA 1MCZA 3LZCA 4B3CA 1CNFA 3FPLA 4RF3A 2HF2A 2GEJA 4OYRA 3WBBA 3V4ZA 1X7YA 4YT2A 2G9QA 2E21A 1L1FA 1QKJA 2BLLA 3CJTA 3PXGA 2AN3A 3ZZTA 4Y0NA 3BSFA 1E0KA 3QU9A 4RIFA 1NJFA 3F6SA 1Y7HA 3GX1A 3PVCA 1W85B 4D56A 3NBQA 2N9UA 4I55B 3HL4A 1NTRA 3O2SB 3QVKA 4DRZA 4NARA 4EF5A 5KTKA 2AG0A 1PBNA 4FGLA 2IDZA 5B55A 3CS3A 1YVUA 4Y30A 1DO2A 1Q74A 4IGEA 5E1OA 3I1JA 3TOZA 3EOBI 4DCMA 5BR4A 4TN1A 1EFTA 4TV8F 1MA3A 1PEDA 4A7PA 2HMYB 2FEWB 2PGAA 3FHCB 4IHJB 4B2PA 3ZHTA 4EG1A 3AI7A 7AT1A 3LDUA 1YQUA 4C07A 5I7SA 2JLZA 1ECPA 4DA7A 2PL3A 1HF3A 3G1WA 3R6DA 2ZJ0A 1W76A 2F43B 4QJIA 3REQA 3EDMA 4P58A 2IF0A 3CO5A 4L7VA 4NQZA 3D5TA 1IY9A 1DEOA 3HS3A 3L1JA 4B31A 4F86A 1RCFA 1F3OA 3QI2A 4PFQA 4AI6A 2PA0A 1ZGAA 1SUAA 2EWVA 3S8EA 2Z2JA 2PUVA 4JB0A 4RJ2A 2CMHA 3EYAA 3R5SA 4QTZA 4XCQA 2R48A 2YHIB 3H83A 1UWVA 4M86A 5F35A 2AE2A 3MM4A 5CJ2A 4BKMA 4HNQA 5IJWA 5LN1A 2XB2A 3P9IA 2AL7A 2A67A 1NVMB 1IY0A 2GH1A 4CLHA 4DOMA 4XW2A 5JI3E 3K15A 4AP9A 2CJXA 2HA7A 2HJWA 1RXVA 2GPWA 3CB2A 2ETXA 1E3IA 3AF1A 2GX6A 1TJ4A 4S1WA 2WJJA 4F4DA 4EB6A 2CJWB 4KIWA 3NBAA 3TX2A 2YNMD 3IAFA 2CXHA 3PC4A 4RCVA 4X3OA 1BRMA 2DKFA 4AB1A 4EGJA 1WP4A 2CC2A 3SOPA 5MF6A 4PAGA 3O8NA 3DONA 2EZTA 4FDLA 3MN1A 3GZNB 5J59A 2EEZA 1GAJA 3UXYA 3MT9A 4LG1A 3KUDA 3HY6A 3BT7A 5AKEA 3VPSA 3I1YA 4CLOA 1WM1A 3X2FA 1DPGA 1F8FA 1HI9A 5AM1A 4PO8A 3RFUA 5CG1A 4BFXA 2B4KA 1HDCA 2QRJA 1B15A 1O94D 2Y66A 3L06A 3OX1A 5DGIA 1BHQ1 1C50A 5T6MA 4B0OA 4C20A 3QVVA 4PE5B 5TQ2B 4FEYA 2YIVX 3LPAA 4ILKA 4E4TA 1T29A 3EQ7A 4K6MA 1PK8A 1NG9A 4DV1B 1QC5A 3DV2A 2GPSA 1ML4A 2JEYA 1SAYA 4QULA 3ND7A 3PPYA 3O31A 3RUCA 1Q3TA 1JG4A 2LCIA 5TSDA 3UCXA 2CGEA 3CC8A 3CJQA 4HEJA 1LK0A 1OI2A 4B7AA 4GPAA 3ZLJA 1A8SA 3BXXA 3QRWA 3R0JA 2ADMA 2PANA 4ZKDA 3DGEC 1A98A 4CG3A 3ZJUA 4YJGA 3ZHBA 3G0IA 3HM9A 3I9V1 3L4SO 4ZP1A 4MSUA 3D7NA 4DT1B 1JHXA 5E7MA 4HNAA 4MR9B 4U5QA 1UMCA 2QNBA 3DMGA 1OZ0A 3LGXA 4MA4A 4DWOA 5JC8A 4R81A 2DHEA 3G3EA 3PCXA 1FDSA 1KDOA 3TRHA 2D1TA 4LN1A 4REMA 4MQEA 3SFVA 5H02A 3FGZA 1QH9A 5LWQA 3PEFA 3D2CA 3O8DA 4JBWA 1EJ0A 2AW5A 1U0HC 2AKYA 4MKIA 3E9QA 4IV0A 1AG9A 2DUNA 1EI9A 3KJZA 3KTFA 1XDUA 4H18A 3KQNA 2A30A 2AEMA 1R0CA 3EPLA 3NVAA 3CINA 3QQ5A 5ICMA 1ZEMA 4WY8A 3NCHA 1RU3A 2DM6A 4AUMA 3BZWA 1YJ8A 4L5YA 1F12A 2CBGA 1MVOA 4J16C 4MA0A 3TQIA 3AY0A 3NIGB 2P9EA 1G6HA 1ZHOA 2Y92A 4ITUA 1U8UA 3R4VA 1VE7A 3WLMA 1UDRA 3VC2A 2W8BB 4QDZA 1W85A 2JLAA 4OU4A 1Y3AA 3JCZA 4YVFA 1E89A 3R3WA 3TSZA 4ZYXA 3FUWA 1QV9A 4BFSA 2PL9A 2FYTA 3QU5A 2B94A 3E70C 3II6X 3K1JA 1O95C 4JA2A 1OU0A 3NHSA 1XSEA 4IXNA 3TQRA 3TXXA 4LZNA 5KX5A 1D0VA 5EPOA 4CF3A 3F97A 3NNSA 1ABEA 4QFDA 4F71A 5ADHA 2B61A 3I9MA 2G4LA 3Q7EA 4Y1FA 1HM5A 4V0LA 1B3RA 3EB9A 3GVHA 2X77A 1ZA1A 4X7PA 1FYFA 3OPYB 3Q3CA 1T2AA 5FTNA 5IVDA 2JJMA 3N1UA 4NENB 5BVHA 4F85A 3C1OA 2IYSA 1RBQA 1K7XB 4IFEA 5HMMA 3GMIA 1CUFA 2CNBA 4JVNA 3ETCA 3QM1A 4H16A 1K2WA 1D1QA 4Q93A 3MQ4A 1NJ8A 2QTMA 4Q4DA 4TSKA 3GNQA 3OEED 1WXQA 4UTZA 4YIHA 1H4VB 5JQGA 2HAEA 4TRMA 1NM5A 3VQTA 8GPBA 1T4GA 2BP7B 4IH9A 1LWNA 4REQA 5IKEA 4Q4HB 1XD8A 4ND8B 4F1KA 3DAPA 3T7AA 3A9CA 5E6RA 5JPIA 2C88A 1MABA 2CLLB 2VSYA 3R20A 5AQEA 3TIIA 4RD0A 1RC0A 3KYCB 4HDSB 2QRVA 1Q17A 4Z86A 1GPDG 1RM5A 1JYFA 1G1AA 1WB5A 2DAPA 3B51X 2PJRA 4AZTA 2G8LA 1KSHA 3JD2A 3DUWA 5FTMA 3GR6A 4BFUA 1W2WB 4J0QA 1GITA 2GGSA 5JJCA 3RYFB 1VL2A 3GWGA 1EH5A 2CXSA 4MUAA 1OXTA 2XYGA 5EIHA 4ZU6X 2YZNA 2J5RA 1X3LA 3ISTA 4ZT7A 4C7MA 4LRWA 4NYIQ 4ZO7A 4ZCRA 2PEYA 4OH1A 1RLIA 4QQRA 1TF2A 3ROEA 4L75A 2UVPB 2ZXFA 2EIXA 3ND8A 4RKEA 4UU8A 4JEMA 421PA 3CH4B 3O8RA 3L8MA 1XU4A 5BSWA 4ZZ2A 3GJ3A 2XAAA 4LJYA 1T1SA 4ITVA 1KU0A 2GPTA 2IL1A 4OP2A 1OF1A 1GCUA 1YZLA 2BCJQ 2SCUA 2OBNA 1J2UA 1V37A 4LYHA 5HG0A 3SZ3A 2F3PA 4Q3LA 1FU8A 3Q1LA 3PGMA 4HH4A 1BA3A 2P9ZA 1DQSA 3MOSA 3LYUA 2G25A 3B3JA 3GUHA 3RGGA 3L82B 5IWAB 2E4XA 3N2KB 4RFSA 5B7QA 3A28A 3SJZA 2X9NA 3ZWKA 2QMUA 3UMVA 3WOHA 5A06A 1OSNA 1WPXA 4US2R 4GZ3A 4FC6A 3AVYA 4PYRA 1X7XA 3RK1A 3IPXA 3TSAA 1NUSA 1S3IA 5BUZA 1AM4D 3W8EA 5JY1A 2QENA 1F6WA 4DWVA 2QMZA 4A1FA 1SZJG 1SCBA 3FM9A 4YH1A 3TTSA 1RKBA 4DJFC 1ECFA 2DXIA 4BZWA 3L7OA 2FSGA 5JRDS 5AJWA 1KJNA 3NASA 4AZSA 1PWEA 5CB6A 1KZ4A 3BGWA 1P5ZB 4Z2AA 2GUGA 5B4VA 1D4OA 1Z6YA 3EFOA 2XB9A 2IU3A 5A4IS 2CL6X 5JRJA 4MDFA 1ICEA 1GA4A 3B1JA 5DXFA 5IWCA 3CUSA 4GR5A 4F60A 1BN6A 3HJHA 4TTSA 2QD5A 1JKMA 1V2GA 2EARA 2ZJ1A 4NG4A 2FEAA 4D98A 5ICSA 3V8MA 5F4BA 2C59A 5I9SA 4KU4A 2PL5A 3TE6A 4N5HX 5KHOC 1JIKA 2OZEA 1M73E 2WTMA 3OUTA 4FBMA 1GPUA 3OFNA 1HV8A 1G42A 4LDZA 4MRAA 4BE7B 2OORA 3DVAB 1B74A 1G60A 4Q3KA 2ID8A 2O5VA 4INAA 4IJMA 4BZZA 2FP4A 4DBLC 2QW8A 2CVPA 3QVXA 4FYJA 1VKZA 2M6RA 1VKOA 2R1ZA 3BJIC 2H11A 3PWTA 2ZGVA 3TKLA 4EGAA 5KQSA 5LWHA 1EDBA 3DOIA 2W98A 4A8JB 3GRRA 3X3HA 1ZNWA 5IM5A 1IB6A 3O92A 1X7ZB 1NYRA 2PBFA 2YZ2A 4YI5A 2AZMA 2G5PA 2YJGA 4U00A 1XOIA 3SFTA 4DDMA 2AQHA 1SUCA 2ECQA 1NQAO 4QDJA 5ER6A 4E08A 1R4MB 3O95A 4BBJA 1RDFA 4MVCA 4PGHA 2BFNA 1U1FA 2NU8A 2NPOA 2Y76A 1MEJA 3FUUA 1N0HA 3LCUA 4TTPA 2VR1A 4Z5XA 4N40A 3K09C 5K45A 5EPEA 3CCFA 2FRXA 4X6UA 3K5IA 2AGVA 1WZCA 2OTCA 2CUNA 2EGHA 3GI1A 1JJAA 2W0MA 3EK2A 1T3SA 2AXEA 3FR8A 4JLDA 4UUAA 3UAZA 1LNQA 3HDVA 4N5IX 2PSFA 3VHXB 1UK9A 2Q9AA 4RJIA 1JKXA 2VYND 3M34A 3Q5EA 2H16A 2AG1A 3C43A 4O3MA 2ST1A 1JHOA 1AKQA 4QL3A 1DINA 3VTFA 4WFQA 3N6XA 3CMCO 4BJ5A 3CNHA 1KPGA 2R60A 1MO4A 2HGSA 2JBAB 3FLBA 3CUVA 3B53X 3SC3A 3ETJA 3RIEA 3UNXA 4CKZA 5FH9A 4NHEA 2XYPA 2IV2X 1K27A 1NDQA 2HA3A 3P97A 4ZQFA 2XVMA 1CHNA 1Z5PA 3NV7A 3MD9A 1PSWA 1UBMS 1Q7BA 1VQ1A 2P0YA 2PBRA 2IZ0A 1GUFA 4IDBA 5BSGA 4BVKA 4CKXA 5JW6A 1QLHA 5K8TA 3VSCA 4FXOA 3I6MA 3R23A 1T2NA 4G5RA 4XSVA 4DR5B 1AKRA 1MOPA 1FNBA 2IIBA 3L5OA 2CJFA 5SZIA 2C2ZA 3KFXA 4FN4A 4URZR 1AK2A 2Q2OA 3LT1A 5JCZA 3DF9A 2Y1LA 1TCCA 2VF2A 2X42A 4IZ6A 4X71A 2ONJA 1OLSB 1P19A 1BDMA 3I01A 3K0FA 3UJ3X 3L0BA 4TMZA 1KIMA 3D7SA 4ILEA 4B73A 3EVAA 3JAKA 1DS6A 2VCHA 3WLHA 4ABTA 1J97A 2QD2A 2A92A 1G2IA 2NZ2A 2WYOA 2R66A 4K2AA 5HA5A 3UMFA 4JYCA 3ZOZA 2XUPA 5SZHB 5JV5A 1DRUA 3BZBA 3KTAB 2PMFA 1YKGA 2PG3A 4QEDA 4V24A 2Q5OA 2KQUA 4XDZA 4POOA 1WBDA 3O3MB 4LHEA 1QO9A 3MZ0A 3BWCA 4RVSA 1I4WA 4XIFA 3WAJA 2C4TA 1OVGA 1MH9A 1AX9A 5CEJA 1SCDA 4HQRA 1Q1ZA 2FSVC 1I7SB 3T99A 5IZCC 4F84A 3A1FA 4NAUA 3DOHA 1FPMA 3MMNA 1SPBS 4ZCPA 2G80A 4FOTA 1XN1A 1BX3A 1NI4A 3E9CA 4GBMA 1MQSA 3OPYI 3EG9B 4R1NA 1IBRA 3H1PA 3PJEA 1DO8A 5CBPB 5CT9A 2DBZA 3KB2A 1NOIA 4JXJA 5EIEA 4P53A 3RQIA 4E5YA 1H42A 1VSTA 5JVDB 5JVDF 2HB6A 4DUZB 4ZAGA 3R7FA 1PJ3A 2W58A 5IAEA 4UHKA 4CCYA 3IV9A 4W8GA 4CQNA 4KXVA 4Y2HA 3NHFA 4YRTA 3IMEA 3D4OA 2WICA 4K9KA 4EATA 5DN6A 1XF1A 4EF4A 2OFFA 3KLPX 4JQCA 1D5CA 5ICEA 1RS0A 3B13B 2GEBA 4IXWA 4FFSA 1UJ5A 2BTQB 3FUCA 2FWJA 2C0PA 4GLBA 1QKKA 3BILA 4I4TB 4O4LA 1E7MA 3B8HA 3UH0A 3UT5A 4MUYA 2ZJAA 1IH8A 1W0KD 2QSZA 2ZJ7A 3A31A 2W93A 2A7XA 3WLSA 1XHEA 3DL4A 3IC5A 1LVUA 2GZDA 3KKZA 3KTDA 3NNDA 1JT2A 4LECA 4M4SA 5F4ZA 4ENTA 4GSLA 4NK4A 1Z0DA 1VXOA 4GWLA 1VIAA 2GN6A 2QZ9A 4LHYA 2ZJ2A 1NMEA 1DXOA 1NN5A 4LNUB 4CIYA 4QGAA 1RTTA 3T7EA 4FDAA 3AP3A 3JZDA 1TMGE 4TWIA 3WHKA 1IQRA 5KHAA 3B60A 5E6SA 2AXNA 1PV4A 2CB9A 4U7DA 2EG9A 3HU1A 3BK1A 4S35A 5B3LA 2W43A 2RC6A 3W9UA 2XDAA 1GU1A 4RZ2A 3DZIA 1C4OA 2PZLA 4N8DA 3R4CA 3GPBA 3RAFC 2LUOA 2OWEA 1U8XX 3JQ7A 3N05A 4MMYB 3WLNA 3ZI0A 1IZZA 1VMEA 1V3UA 4C0SA 2WB2A 4DDHA 1FLDA 2XUOA 4OQNA 4LJ8A 1Y7PA 5KHLB 1T13A 1CRQA 1J2JA 4OEHA 4BFZA 3PFBA 1WW2A 3D8UA 2BJHA 1YB2A 2OAEA 2DJIA 3FHOA 3MJCA 4XA8A 3SK0A 2XGOA 4DR7B 1TCUA 2ISCA 2WJWA 3I5YA 4XOUA 3H2BA 5TGZA 1IZ9A 3DZCA 3KUCA 1MJGM 2XHEA 4M0CA 1RXYA 1QO7A 2GTPA 1JHZA 2V54A 4G5QA 1IK6A 4S1PA 1NW9B 2BGKA 2ZRAA 1DO0A 1JIQA 3K1YA 3DR3A 4QECA 3W2TA 1NRXA 3IVXA 1JU9A 3GT4A 2L17A 1M2FA 3D7LA 4ZEOA 2OB1A 4CQLA 5BT8A 1GTJ1 4OIMA 3E22A 4KUHA 1XGKA 2YZ7A 2PGOA 4P0QB 3VNQA 2ZU6A 3OZWA 1CUCA 2JFHA 2VT3A 5CH8A 3AJAA 4V02A 3HH8A 4PZEA 4B83A 4CCWA 5KINB 4BB0A 1AMUA 1E5TA 3SE7A 2OE2A 4Q6WA 2Q3JA 2QYTA 4IOKA 5JZOA 2HCRA 4XIYA 3RVKA 1BXGB 2GARA 1U9ZA 3TQQA 4YUAA 4L9SA 5FCDA 3OTOB 4KQXA 2FN7A 3M6FA 5CLFA 2B6HA 1LXCA 4H9GA 2EBFX 1GTZA 5KNCA 1Q83A 1Z07A 4OOEA 4QUJA 1YRWA 4YTEA 4Z8XA 5AVOA 4F0JA 5LU9A 1HFEL 3D1LA 3PUJA 3M1YA 4BBZA 3JD1A 1ZXLA 2PKCA 3NATA 1Y4SA 3CRZA 3D8NA 5AVRA 5G1NA 4BNJA 4EAQA 1RZVA 1TECE 4LNAA 3ENWA 3JWHA 1WU8A 2Q5HA 4K6FA 4UVHA 1KXJA 4J4HA 3EVBA 4M1OA 4GOXA 2NWQA 3T9BA 3VOBA 2DEUA 1PV1A 2V0CA 1YQEA 1G0NA 3OCVA 2PGXA 4X8HA 3O0DA 1CUAA 3EMDA 4RVDA 3TIFA 4ZJYA 2Q4BA 2DWPA 4ZGWA 4NJMA 4DR4B 1L7MA 4NZOA 2Y9MB 4PYLA 4UW9A 1QU3A 2B3TA 3A1TA 1XU7A 1KEPA 3AKYA 3QBEA 4H7IA 4GD3Q 4G24A 4KI0A 3I9V6 4YRCA 4DZRA 1P0FA 4NU6A 3VR4A 1RMYA 1JZQA 4GPZA 4WUTA 1QGDA 1Y5LA 4KVZA 3HJBA 4QEZA 3PDJA 2JFOA 1BYIA 5EMKA 2XT9A 4CNBA 4WCFC 3WWOA 5IAOA 5LKRA 5KNBH 4HUTA 2QRLA 3OZXA 1H3EA 2H6EA 4MWBA 5AVYA 5KC8A 3EASA 4JBYA 5F7ZA 3IQHX 3N6VA 1H93A 4OFXA 1EFUA 4TL7A 4WEQA 3T5MA 2HBYA 4O5OA 3ZBUA 5C7LO 2VZ0A 4LDRA 4C6HA 1KMQA 1DAHA 2IEYA 2PX6A 3AQ4A 3CZ5A 4L6AA 4K7JA 1A5SB 4NNOA 4R8RA 5K0NA 2BM0A 2P3QA 2CK3D 2PCLA 3R0XA 1H2EA 4TROA 4JOQA 3ABRB 2HNAA 1TT7A 5LDDC 1THZA 4TSRA 2VSQA 3FX2A 5JLJA 4KV7A 2GJ4A 1OYOA 2H4YA 4H0CA 1QMGA 2QRGA 4Q9JA 4EY8A 4YUWA 3PXEA 2E5FA 2ZULA 3MELA 2X9QA 5EP1A 1B76A 1NQOA 4ZODA 1MHTA 2AJDA 4OI4A 4MVJM 3O73A 1FTQA 3DDNA 1HDXA 5FBKA 5ALLA 3SBDA 2NSLA 1I3NA 1L5RA 1UEJA 2Z2XA 2FWNA 3LCVB 4RY0A 1E2JA 5CYFA 4YRMA 2ZYHA 3K6KA 1NT4A 4R8LA 1WDMA 3JQAB 4LHZA 4CMIB 5E2IA 4BN4A 2NXCA 2VYNA 2F3QA 1JT9A 1LRLA 3FWHA 4MV0A 1V5GA 4I14A 4BLSA 2R6FA 1FW8A 1XCJA 4AYWA 4I81A 4KH0A 1M1YA 2XOXA 4EJSB 4X8LA 1R5OA 1MKYA 4PV7A 3RIMA 4M1MA 3KU4A 2PYDA 4J9UE 4UKDA 3PX7A 2W6JD 1H5UA 1QRSA 2IUTA 3HDJA 3N2LA 2VDNB 1ZGGA 2MSKA 2O5RA 1Q16A 4IKEA 1O97C 4LSWA 4QG3A 5IVHA 4QBIA 1DDIA 1YB4A 5MGNA 1IHUA 2FN9A 1UJ2A 3GW8A 3MBKA 3VNBA 1RQXA 2QZJA 4YYEA 4O4JB 3B2EA 3IOMA 2L42A 1ZCZA 5IC4A 2XMZA 2Z1DA 3O38A 2YJ3A 3PD1A 3HA7A 4NZ9A 3E22B 1FYVA 3AOEA 4QPJC 4PY2A 3NJRA 3QPBA 4ZZ0A 1C41A 3LX6A 3LBAA 2A84A 1G98A 4RD1A 1OH7A 1N57A 1ZI6A 3TW4A 2XCTB 4EJ6A 1E92A 1M10A 1LPOA 2G1AA 1KO1A 2PDAA 2ZE7A 4MULA 2D3TA 2I4LA 3CT4A 5AKKA 1NYQA 1P7WA 1XB2A 1E3JA 3LFUA 3WDMA 1V7CA 3CKYA 2OXCA 1AOXA 4G63A 5KYYA 4XM1A 1TUIA 1N5IA 1OLOA 2VAXA 1T2EA 3ILSA 3O8LA 3Q88A 4OBXA 3E15A 2W6CX 5HJ2A 5BQ5A 4DRXB 2J4CA 2QB5A 5M7EA 2B7LA 2CUZA 4FPXA 3OECA 1UINA 5DV9A 4ZYWA 1S2IA 4OV6B 4QPPA 2H18A 1QHIA 1XZNA 4JROA 4KQ2A 2O2SA 4HDNB 2P1ZA 3QTBA 4G0NA 3NTOA 3Q6IA 2J7PD 4KFRA 2XRMA 1P2UA 3JAKB 1F8XA 4TRRA 4JXXA 1W5AA 3M6IA 2DPLA 1E5VA 3HLYA 1N2ZA 3S70A 4B80A 2O8CB 1K8XB 5IYZF 1FS6A 5B36A 1JE1A 4ZMRA 1RWPA 3UWOA 2QTVA 4M83A 5CDYA 4LOIA 4MVJH 4QXQA 5FPYA 3ZK9A 4DIKA 4ZRNA 1IG0A 1JB1A 5ALQA 1C30A 1TU4A 1U98A 2ZRMA 4R5HA 2QE7A 1PKXA 2CJYA 3I42A 3R5TA 4S3MA 1SEPA 2XSZD 5TS2A 3WK7A 2IUYA 1M6EX 2HLPA 3A4MA 2CXTA 3FCAA 4LHWA 1HXHA 4A6XA 3ZDCA 1L3CA 1SXGA 4L4SA 3TGWA 3FPEA 2DPGA 4YQEA 1M72A 5BUSA 2Q4RA 3EGXA 5BN3B 3V5NA 3O21A 3VI3B 1XCOA 2E2WA 4LF7B 4YV0A 2Q5FA 4GLOA 2NYRA 3HVIA 3G9ZA 4BIMA 4HN2A 3W5BA 3G23A 4M1EA 2R25B 2ZR9A 2I66A 3G5AA 4F45A 3CIOA 1I7LA 4YRAA 3EXIA 5HIAA 2EL9A 3DGFC 3MGKA 3LLUA 1QZ3A 1SXJC 3WFJA 1KY4A 2B83A 3CBGA 1KO5A 1BGVA 2ACVA 4HNHA 2O4CA 2Y0CA 2CE7A 3N8GA 4TRNA 2QTNA 5B3KA 3U4CA 2G9RA 3CUEF 1KVUA 4D6PA 1B6GA 4P35A 1DLJA 2VQFB 3HXKA 4KG7A 3L1KA 3R9XA 5EJFA 4AULA 2VYFA 2Y0BA 4RFVA 1T9ZA 4OUDA 3A4IA 5LMCA 1M0EA 4HDQB 1K86A 1VCMA 3RJZA 5K7SA 3R3SA 3VJRA 4P92A 1U3TA 4UPDA 4K9QA 3HB0A 1DP4A 4FYVA 1RJGA 3PUZA 3HK2A 3T34A 3GLUA 3LP8A 3BXOA 2P91A 1BA2A 1R0SA 5TEWA 5EZYA 2C99A 1EFAA 3E2MA 4N49A 5TQ0B 3FJ1A 1QYCA 1E18A 2B3DA 3FUXA 2C5BA 2CHEA 3JWPA 5KYTA 1QFMA 1GUDA 4N3NA 2HJ9A 3B1XA 4US1R 4ZOLF 3RHZA 5KJ1A 1Q1QA 3VPCA 2J3LA 4RSGA 1FDVA 3BE6A 4LVNA 1F5NA 1U2PA 2W5UA 4UUQA 4DG8A 2BW0A 4KN6A 1E6CA 3JQGB 4KPGA 4XUEA 4EP1A 3S44A 1NL3A 2DY1A 2ZIZA 3IR5A 1YHZA 1KDRA 1T1RA 3HZOA 3N8IA 4XPIA 2OPHA 3NGLA 4ND6A 3ZWWA 4R84A 5HHTA 3HJUA 4WFIA 4TLDA 3OMWA 4QIHA 4AY4A 3O47A 5AKXA 5EUQB 1U28A 3ZG6A 2VOEA 5JHHB 4E21A 4EUHA 3VZBA 3BWMA 1F4LA 4CKCA 1S7CA 2JLVA 1UAYA 4JP5A 4REOA 1FSZA 3CT6A 4CKWA 4ONEA 4X9XA 1MAVA 1WF3A 2PUGA 4FKMA 2CY0A 5JNWA 3BKWA 2QTWB 2RGDA 4LZWA 3Q7IA 5TXGA 2O8FA 5DW3A 5BQXA 1X70A 1ACJA 1BDJA 1TJPB 2RHWA 3EEIA 3R1IA 4ZAFA 5ICFA 5LDHA 3GT7A 4G8DA 1UMDA 1ZK3A 2RHTA 5IN5A 2QSJA 3CN7A 1T9CA 5ABPA 2FHPA 3MGCA 3KAJA 3VX4A 4AJEA 1OFUA 2H2DA 1ESMA 3GQBB 3JVVA 3NBZC 4NJEA 4UEOA 5EOVA 1WUHS 3WNQA 1YIOA 1R6DA 1T3LA 4JZYA 2INGX 2FG6C 2BSQA 2H17A 3HXLA 3UUFA 4G0VA 4BP9A 2A0WA 3AHGA 1O94C 5ALWA 1WCIA 3HJTA 1QTQA 2AXQA 2P27A 4KYIB 4D96A 2V4UA 3I53A 2XGJA 2CWDA 3RYFA 3EFBA 3FPKA 3GLHA 1NBIA 4RY9A 4H6WA 2JHCA 4R51A 1LLFA 3WMFA 3IAEA 3DDUA 4RKYA 3O5AA 2X5JO 4MHOA 2I2DA 1CERA 1T8TA 4PIPA 4BUZA 1SUIA 4IRUB 1EKXA 1DAFA 1WJGA 1GFSA 3T9AA 1GTRA 2WBLC 5TJ9A 3B12A 5B3JA 3MJ4A 1OFIA 2CF5A 2BLNA 1YBVA 2BMAA 2L69A 4M76B 2DLCX 4NY1A 2G9VA 2VEOA 5HK8A 1YACA 4GMHA 2HCFA 1JRLA 4CM9A 1E0DA 2BWJA 4DKXA 4EHJA 3H5LA 3CF6R 3C3AA 4ARZA 1WZEA 3G13A 3QPDA 4OAQA 5HIIA 1Z8NA 2MU1A 2NACA 4RQUA 1R1DA 2YRFA 5E6SB 5KOIA 2HMSA 3U9TA 1F17A 2OHJA 3H6KA 3WTCA 1GZUA 1V4VA 2GK7A 4OQMA 2IZOA 3ZH9B 1GAQA 2GQ0A 3DD5A 3QHQA 3TZLA 1R7RA 3L46A 1G2OA 2IOQA 3EIFA 1OBHA 5EZQA 2FPGB 3JQ7B 3ZJVA 3G6WA 4J1TC 1Y4UA 2XQKA 3QK7A 4O2AB 4PLYA 1NGSA 4WLUA 2G6BA 2ENUA 1GPBA 1TYEB 3PQ6A 2XNHA 4KX5A 3M5CA 3DAGA 3MCAA 5EPUA 5TQJA 5LA6A 5HKAA 1IE3A 1RLOA 3B9QA 4IQ4A 5LYJB 1CVRA 4KSCA 1PR5A 5JNTA 5EVCA 1TEVA 4RPKA 1LLCA 3SXUB 1RKXA 4OPMA 5CAEB 1IEVA 2P3LA 2YZMA 3BRSA 3TRIA 4L85A 4R31A 2DUMA 3ZNOA 1G8JA 1J70A 1O4WA 5F1YA 4AKIA 2W71A 5AKLA 4ROTA 1U0FA 4PCAA 3AM4A 3R3XA 3CWZA 3EVZA 4ZHSA 2XDWA 4HB3A 4KYUA 4PCVA 2PVSA 4B3MB 1TK3A 3DCNA 3TPFA 5ULLA 4LHSA 1L4GA 4PSCA 3SZRA 1TJ5A 3QXCA 1B8NA 4DAEA 2WKPA 3BCSA 1ENZA 1I6KA 1TYBE 1GTMA 1ZIOA 2FR0A 2P5UA 1JPNA 4GPD1 5FWDA 3WQBA 5C46F 3KQQA 3C48A 3DP9A 4B4UA 4X8MA 5IKMA 2ZRQA 3C15C 4AJKA 3HCOA 2P8SA 1ECBA 2H3HA 3HMQA 1N7GA 1CV2A 1WW3A 3QPAA 1IQUA 5TIIA 1RNLA 2ID4A 3L01A 4BRWA 1PG2A 1UBSB 3EDRA 1MPTA 2FETA 2BCGY 3DF7A 5KSPA 2LZ0A 4E1VA 2OPBA 3U6KA 3Q3VA 4D9HA 4DA8A 1EVZA 3G7NA 3HNRA 2VSOA 1PU2A 1OKKD 3E03A 4BCDA 3HU5A 4PFSA 3ZXSA 4E5KA 3EVNA 3PUWA 4G84A 1ILWA 4X7MA 3ZU2A 4Q18A 5KYUA 4DJ5X 2ORWA 1OLSA 2Z43A 1JF8A 1OE0A 2Z4SA 5AW2A 2PWYA 1BVHA 1XDSA 2PBLA 4PS1A 3ROFA 4CT4B 4EEZA 1XRJA 3OLCX 3AM3A 3UB2A 5BW5A 1CY7A 5HX7A 1ZH4A 2WIAA 3GRVA 2W2MA 1JE0A 3MXTA 3VO2A 2ZYDA 2YMMA 3LW7A 3M5PA 1V47A 4GI1A 2OOSA 4YCJA 3WJ1A 4DCJA 3TQFA 3ADDA 1T9KA 2W0SA 3GEIA 721PA 4IYRA 2HLDD 1MJFA 2B2XA 2IGBA 3NJ4A 3QFHA 4OREX 2EF1A 2GPNA 3QKTA 2ECOA 5DBEX 3T15A 4MCIA 3OKFA 5K0ZA 2IY7A 2VJOA 4NSNA 1Z2OX 1RWBA 2PZGA 2RC5A 2VJMB 3KOUA 4LJ5A 1RAEA 1PJZA 3FWZA 2JIRA 4RY8A 5FLXA 1OV4A 2IE8A 1KERA 2Q9UA 3NT2A 4FT2A 4UEKA 1J49A 3WDLA 1RYBA 5ALPA 1GPMA 2PWBA 3V1LA 3BSYA 1ZQ1A 4JBIA 3FCUB 2Q5CA 3JZAA 1VJDA 2C7OA 1YMVA 5AR1A 4D9GA 1CQIB 4RV4A 3JALA 1EGAA 1HFKA 3KBOA 1HL7A 4Z3OA 4LDQA 4YCBA 2ZSAA 1ZO8A 1UMCB 2Z9BA 1N5LA 3K9WA 3R5FA 4RSMA 3TRDA 1A3CA 1X8KA 2Q21A 1VJ5A 3EMVA 1QGAA 3AJRA 4L08A 1KQNA 4B3FX 3KU1A 2A14A 2Y99A 3LQ2A 2QJTA 2WOOA 2I8LA 3U3XA 3AIKA 3WGUA 1RYNA 4AZ0B 3Q72A 3NIBA 2BJVA 1I5OA 1EUZA 4DB4A 5AKYA 1ZN8A 4Z0NA 3HEAA 4K9DA 1EG2A 4G5XA 3KQUA 4C0HA 3LT0A 4FU0A 3SQOA 4BV8A 3NBUA 3Q6NA 2WINI 2XWPA 4J2HA 2FH5B 3VR4H 3G0BA 1TB4A 2FQXA 3TD9A 4BNNA 3D3KA 1AQYA 3DTVA 1K6XA 4MWTA 4N0MA 2FE4A 4EYQA 2QLFA 4HAOA 4UPEA 4QD3A 4DUYB 3UJ8A 1GADO 2GMWA 3A1WA 4HRXA 2R6HA 3KWFA 4LXHA 2PV7A 1KP2A 1LRJA 4IWYA 3SKVA 4AN4A 2R7LA 5DN6D 1XCPA 3EGXB 4LQCA 3LUJA 1AKWA 2RBGA 5DRTA 4CM3A 2XMRA 2Z09A 4NI5A 1RWKA 1Z26A 5FI5A 4O29A 4KXMA 3T7IA 4B2LA 3IDZA 2Z95A 4PNEA 4PLPA 5CVDA 3V6MA 4OXXA 1OW3B 3ROQA 2RGUA 3WKDA 3ZKWB 2O3SA 3QLVC 2X0FA 5T8KA 1OCEA 2B4AA 3NOVA 3MJEA 1CE8B 4QUIA 4XUGB 3UJCA 3JTMA 5KJCA 4GE0A 2AVNA 3PXAA 1CJKC 4MRPA 3RVPA 3K9NA 5FOQA 1V8OA 2WP8J 1QPZA 3SHVA 3LIPA 1NM5C 3VYTB 3VZDA 3BD9A 3SF0A 1V1MA 2GERA 2VXYA 3QKRA 4HY3A 4KPUB 2B34A 3AX6A 3O8CA 4TLCA 2IZ5A 2FPOA 3U1TA 3UKDA 4EITA 3VNRA 4A4DA 4L8YA 5ES3A 2ID9A 1BDIA 2FSHA 3VHXA 3H99A 2JARA 5DHFA 5B7GA 1ACMA 2E18A 1ZOSA 3MAGA 1YQWA 3V4RA 3KKKA 2ROQA 4P3PA 4ZV9A 4C03A 4BP8A 1Z16A 1O6BA 4ZRMA 1WRBA 1PFVA 2PIDA 4IQFA 3BWEA 4MCHA 3GJ5A 4OL9A 3RRFA 4S0ZA 2GB4A 2VDJA 2YTZA 3NEAA 3GFPA 3O90A 2MMCA 5FTLA 4FR5A 4FC7A 5A9SA 9ATCA 4IUCS 5B1IA 5ADUS 3UHJA 3H9JA 2HF8A 5E9QA 1N2SA 1GV0A 4OBWA 2XB6A 1SXJA 3FFBA 4Q05A 2ZR8A 4E4YA 4XVCA 3ZD7A 3SYTA 4PW0A 4YUYA 2Q4TA 4AUNA 5LL6P 3K8YA 4NDAA 1QLJA 3HJAA 4NCNA 4FFBB 3LO5A 4AZVA 4CGZA 1B1CA 1FMLA 2XAUA 3BJMA 3TZEA 4BLUA 4RTKA 3FTNA 3THSA 6REQA 2GBLA 3CUUA 2QGFA 1QHNA 3QPCA 4I50A 1A8UA 3IA7A 5B2EA 4OGWA 2JIOA 1MT3A 2YWJA 4JUDX 1QCZA 2HO5A 1OZAA 1GT6A 2OD2A 2JHGA 3QENA 4MR8B 1VJTA 3BCHA 1W49A 1X87A 1BKDR 4DMRA 3PG5A 1W52X 2Y1FA 2WLSA 1IRIA 2YWXA 2P1DA 1RJEA 1BS2A 3O4VA 5IFLA 3QXHA 1KYIA 5JS7A 5CNKA 2GDJA 4M87A 4P7GA 1ZA2A 3WLJA 4AZ3A 4DV5B 5ENVA 3F1LA 4IQ8A 3UA3A 4K46A 1Z8DA 1CPYA 1H2ZA 4Z4EA 1XTBA 1EX1A 2DU8A 4ZI3A 1N7JA 2P6UA 2L18A 2RHLA 4C6SA 3PFFA 1RP7A 2OC9A 3HUFA 4IDCA 4PZZA 4S24A 4ZVVA 3A4TA 5GP1A 2ZTUA 2O8DB 2CXRA 1EX9A 1Z06A 4E1BA 1Z0FA 3HRHA 4IRMA 4QU8A 1H8HD 2B98A 1H0KA 4CF5A 3TSWA 4YY3B 4WXYB 2RH9B 2GK4A 3Q2OA 4MWOA 4N7MA 2JNWA 3TW6A 1J5EB 1SFRA 1E63A 2W48A 2QJOA 4Y2VA 2X23A 5KSYA 2HA6A 4HX9A 4C14A 1SXQA 2W6MA 4IJKA 4RKRA 2ZUSA 3RG2A 1Y6GA 1KYZA 4MVJP 4CM8B 1ZX1A 1T3GA 2DPHA 3THWA 4X5OA 1LBTA 3CZRA 1RJDA 3L7BA 2VRCA 3CLUD 1NF3A 4NCAA 4WT7A 3ISJA 3U1VA 3ZLUA 2XQIA 4PAQA 3NVKI 4F9GA 1BWRA 4RVFA 3FYUB 1L5YA 5DNAA 3O8OA 2ZJ8A 4AP5A 2FMXA 5TRTA 5KC9A 3HYTA 2BFCA 1MNQA 4HJRA 2CMKA 3ICEA 3ED1A 3ED5A 4J1TA 4R7ZA 2VC2B 2V55B 1N8KA 4MLDA 4BGVA 2BZGA 2HU5A 2HQ1A 2JJYA 1ZXXA 2B9VA 1ZGBA 5E0KB 3CHYA 2G7MC 2PU7A 5HVNA 5T6BA 5J2TB 2ZZKA 3G8CA 4WNYA 2C83A 2IYZA 3SDBA