2XNAA

Crystal structure of the complex between human t cell receptor and staphylococcal enterotoxin
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
199
structure length
199
Chain Sequence
b'QLLEQSPQFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEGPVLLVTVVTGGEVKKLKRLTFQFGDARKDSSLHITAAQPGDTGLYLCAGAGSQGNLIFGKGTKLSVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords T CELL RECEPTOR ALPHA CHAIN C REGION
publication title The Structure of Superantigen Complexed with Tcr and Mhc Reveals Novel Insights Into Superantigenic T Cell Activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 37
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2010-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xnaA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xnaA02
1MFBL 2AEQL 2YN3A 4XHQA 1C5CH 3EDEA 4MQ7B 1R6VA 5JZ7D 3RTQD 4P2QB 1U93A 1XF2A 2NXZD 1VKXA 2NNAA 4NNYB 4Y89A 4U1IA 5EU7E 4CU6A 4M61A 3H3PL 1HWGB 5I1GL 3LKQB 4JRXA 3V7MA 5E94B 5F7YC 2AXJA 4PJBB 4Z78B 3X3GH 1HI6A 5E8EA 3EO9H 1G7PA 3RIAK 3MLTB 2Z4QB 2CO6B 2Y5EA 4ZO6A 1J9CT 2PN5A 1VFBA 4HWZB 5IEHB 1AY1L 3BISA 5D7JB 5KVFH 1SY6L 5C8JA 4OGZA 3QIBB 3PWJB 4L3CB 4DFHA 3ILPB 1T2QL 1D5IL 1LEGA 4Q9QH 2X4SA 3LMJH 4L9LC 1UQSB 4HC1H 4RBPH 4DGYH 4JKPH 1P7HL 4X9GA 4E42B 2VISB 5GJSL 1FL6A 2X5PA 4YHLL 5E2TH 4LLWA 4UIKH 1V5JA 3QNYA 1UM4H 1FO0A 4PJDB 3MV8B 1H3GA 1ZA3A 2AEPL 5A3ID 1YDPB 1EH9A 1QSFE 4P3WA 2E8ZA 1QG3A 1K8DB 1K4CA 2DQEH 4LHQB 4PJGE 3D0VB 4FQJL 1U91A 3DBXA 5HY9A 2FSEA 4H8WC 2VXQH 3MO1B 4P99A 3ARWA 3PDOB 3TC9A 4PJIB 4X4ME 3BQUD 4G80B 1ZLVK 2D7MA 2AJSL 3UTQA 4F15B 5EULV 4IOIA 1N6VA 3QISA 3K1DA 4RAUB 1LEIA 2FHCA 2EDJA 5B3JF 4U6HB 4P4KC 5HXMA 2R8SH 1F45A 4HKXA 1CE1L 3PWPE 4ZQKA 2E7LC 3I9GL 5IVZA 4MS8C 1BJ1H 4PR5B 35C8L 4R4ND 1Z5LA 3O3AB 3V5KA 1IAMA 3CFEB 2X4OA 2VL4A 1R0AH 3D18A 1VFAB 4ODUA 2HH0H 4X6CF 1WC7B 2VDKL 2BMKA 2EO9A 2ZPKH 4G6ML 3GMOA 4EUPG 4DUVA 1JN6A 1J1OL 1U95A 3FN9A 1DANU 3LB6D 1Z3GL 4XNQB 2C3HA 3T09A 1HILA 4PJ8D 3VXUA 3NBNA 4GXUN 4BZ2L 1YQVL 5TQ2H 3RI5F 5E70A 3FOMA 1D9KB 4GSDH 4TSCL 3RZCB 1UM5H 3FB6A 2PYEA 4GO6B 1RVFH 5HI3C 3RRQA 4KMTH 4PRDA 3O3EB 1N2RB 5DZNA 4UT7H 1QRNE 5DRXB 1U8IB 1IARB 3WFEL 4FQCL 3L5XH 2PO6A 1U8JB 4EI5A 3CDCA 1XF3A 3O6FD 4IMLA 1UA6H 5CKGA 1N5AA 2FL5A 4M43L 2FB4L 3W5MA 1N4XL 4Y19B 5H8DA 2XICA 4N90E 4QRPB 4LSQH 3FQWA 1GZQA 2BZDA 4HW6A 4JEGB 4QCIB 5EU4A 1MHCA 3TN0D 3ECBA 2KPNA 4NRYA 1U8KA 1NMCB 3M8OH 4OZIB 2NY6C 4P2RA 1FG2B 2CKBB 4O4YL 4RIRB 3ABZA 3MZTA 4YEEA 4K94C 4YHNB 1KGCE 4YBLC 1BQHG 4Z7WF 2VLMD 1L7TH 3MOBL 1A7NL 3PL6B 4HMEA 1ORSA 4C83A 3BH8A 3NIFE 2YZ8A 2GAZB 4FQQB 2VDOL 4HPYH 3T4YA 4K7FB 1VDGA 5JLZB 2FIKB 1ZMYA 1KPVA 3O6MH 2R69L 5EUOA 2W60A 3LEVH 1K4DB 5ESVB 3B8SA 1NC4A 3SGEH 3IYLW 3S36H 4UB0L 1MCOL 4U1KB 2WQ8A 3C5ZA 4MNHB 4U7KA 3E6HA 4LSPH 2CUMA 5D2LB 5DXWA 2FJGB 5IEKA 2V5SA 4X80H 2ZKHH 2ATPA 1KJVB 4WW2F 1S9KC 4UINL 4APQB 4XH2B 3JV4B 1YNTA 4K2UL 3A67L 4TULH 3HE7B 5GGVH 3OV6A 4NRZB 1KB9J 2CRZA 4BFIB 5CCKH 1H3UA 3CDFA 1JZ7A 1DANT 3D39B 3FT4B 4JVPA 3MRFA 3MJ9L 4UQ3A 4XCCL 1F4XL 1IZJA 3MV9A 4X5XA 1MELA 3O6LL 3KXFD 1CICD 1MIMH 3PHQA 2H1PL 3WUWB 4FTVA 1RHHB 3MLWH 5DS8A 4G7VL 4AK1A 1C7TA 4OV5B 1Z2KA 4CW1A 1KULA 1AQKL 3CAFA 5T5FL 2MOVA 1Q9LA 1FGVL 5SWSD 4HG4J 3MGTA 4KJPD 3SKNA 3D5OF 2A77H 1DBKL 1A2YB 2PXYC 3FB5B 1RHFA 1S7WA 4FQPA 3WLBA 1NDGA 4JDZA 2F8OA 2JK5A 3QUZB 4KQ3L 4LRNH 5D7IE 3HR6A 2GUOB 3QPQC 5GSVA 3V5HB 1NMAL 3E2HB 3I75A 3IRPX 3L9RB 5JXAL 4Y16A 2BVTA 1BQUA 4WVRA 3GMLB 4YHZL 4OFVA 4F7TB 4D9RD 1LEKB 4H8WL 3CSGA 5BXFB 5ID0B 4RMWA 3ZMRA 3FMGL 4WWKD 1V3LA 5C0BD 2J8UB 4P3CL 1ZT4A 1MCPH 3MRGA 1BGXH 3ULUL 4FQXB 4QHUA 3OB0K 5EC2B 4JR9H 5C71A 4I3RL 5J06A 4TRPL 4X7TA 3OKLA 1FLTX 4ZS6D 3MROB 4NKIH 1BMGA 2FHBA 3OKNB 1E6JH 5DO2D 4X4ZA 1A0QL 3V0VA 4BQ9A 1X4YA 1BIIA 5ITBH 1IAOB 4GKSB 5K9QI 3R0MA 3ZLQC 4TUOB 5F89B 1I9RL 4LHUB 1DLFL 5BS0A 1A4JB 1QRKA 4JRYD 2FH8A 4NO2B 1JGUL 1NSNH 2QSCL 2I07A 3SKUD 3DV4B 1G6VK 1JF1B 1JRHI 4MA3A 4A6YL 3P9MA 4MAYC 1FN4B 2VLRE 4U3XA 3ZE2F 1QO3B 4LCWA 4DN3H 3U9UA 5DUMH 2BVUA 3GKWH 3GI9L 4LAQH 1IBGH 5I1KL 4FZ8L 2GTWB 4PP1C 1FAKT 1CLOL 4OB5H 4YC2B 5GS1A 5K9OB 3C6LA 5EU7C 2Y07H 1G7JB 3KYOA 4FMFA 2WIIB 4NJAL 4WEMB 1Q8MA 1MHPH 1Z9LA 4R7DA 5DJAB 4JY6B 3BEWB 2EYTB 2QQLH 3SKMB 3UTSD 2DL2A 1ORQA 4KDTA 4FQ1H 3MV9E 2CRYA 3NABH 4DVRL 3ARED 4LEXL 4XVSH 5E5RB 3LQAL 4PJFB 2NX5B 4HIXH 1GSMA 5IHZA 1UWEL 4FTVE 1DN0A 5FYKH 5I1HH 2NW3B 4BH8A 4OTXL 3QUYA 5L8JB 4YUEL 4M7LL 5MEPB 1I7TA 4LASH 1AXSA 1GVIA 2C7UA 4J12A 1WICA 5FO8B 2OQJA 3EYSH 1AGBB 4W70A 4LQFH 1FQ9C 2I26N 3BP7A 4D8PA 1F58H 1E27B 4L5FH 4QWWD 2UZYB 5J89A 2XKNB 2IANA 3W39B 3LZFL 4GKOA 3TVMA 3P3YA 1OAUH 5EBLB 3GHEH 1MCFA 4AEFA 1SY6A 1T0NB 4HCRH 5C09D 1T21A 4QRRB 4Y4KC 2A1WH 3CX2A 4ELMA 2XT1B 3VD9A 1AKJB 4X8XA 3U6RB 1NBYA 5IBUG 3QXTA 3VFSB 5ISZE 1SMAA 4Y5VB 1DVFB 1U6AL 3ARBC 1PKOA 1YEIH 4IIQB 4U6VH 5J1AB 3O2VH 5CHNB 3FN3A 4PGCA 3TV3L 3Q6FB 15C8L 4P2QE 3S35L 3FO2A 4LOUC 5EZIH 1NCAH 1QPPA 3FFCB 2YMXH 3JXAA 1CF8H 5IF0B 4G42A 1H3PH 4Z7NF 1UFUA 4PFEA 4RDQG 5F9JA 3HZKB 5E95B 2OP4L 1I1RA 4WHCA 3ARDA 3SCMC 3ULUD 4PJ9D 4PJBE 5L9DH 4M6NH 4JFFD 4GMSL 4LSUH 3S5LB 1MUJA 2CK0L 4OFPA 4CMHC 1NJ9A 1OP3K 1A7RL 4LCWE 4P4KD 1QA9A 1N7MH 2DLHA 4QXGH 4QXUH 5F7FA 1BOGB 4U3HA 3P73A 3ZTNL 4FXKA 3QA3A 1FGNH 3BKCH 5HD8D 1U41A 1MRFL 3AMLA 1ODAA 4HAFA 2GJZB 1MVFA 2W91A 3KPRD 5AZEL 1KCUH 1SHMA 4HZLB 2VAAB 3MV8E 5E8NB 3T4AA 1NPUA 4F58H 1IQDB 4O02L 1CD1B 1Q9OA 4M6AA 4QTIL 4V1DD 5C3TA 1B88A 3D85B 4M7KH 2W9EH 4LPYA 3PQYB 1ZSDA 1FVDB 3LHPL 2NTFB 1ACYH 4BSVB 4LP4A 1FNEB 1VERA 3WD5L 4PJ5B 5EBWA 4LSRL 5HI3D 1WCBA 4PJIE 5KSBB 2BNQD 5HPMB 2K7PA 4OZFA 3MMEB 1YQ2A 5IIEB 5IMLA 1UB5A 3S97C 2VLKB 1NAMB 5I74C 1KIPA 3I6KB 1R3JA 4PRPB 5DJ0B 3QNXA 4ZUVA 3RVTC 2G75A 4KKLC 4FXGA 3WIIH 4NWUH 4DN4H 5JHDD 3ES6A 3TFKD 3UJTL 3EO1A 3MLRH 3LN5B 4X98B 5DUBB 2DBJA 4WUUA 4MD4B 3IDJB 3W9EB 1ZT7B 4IOSD 3VFWB 3IU4H 4JDVB 4ONHA 2ERJB 4MNGB 4NM8H 3CMOL 3ARFB 2VSCA 3MLXL 2RFXA 3D3VD 4M48L 3SJVB 5BVPH 1CD9B 1WQVT 1DUZA 4LGPB 4JGJA 4LARH 3PWVA 5F7NC 5I15H 1VESA 1XIWA 1S5IL 2BDNL 5D70L 2EXYC 2R4SH 3BWAA 1ZAGA 4D0CB 1KFAL 1AXTL 1R3HB 1UM6L 2FD6L 5T3ZH 4RNRB 1UJTA 4JKLA 4PJDF 5D93C 4CU8A 1CZ8L 1UT9A 5LBSL 1WWCA 3R8QA 1TVBA 5DJZA 5FB8B 3IS1X 4UZGA 3MOAL 4YQXH 2D0GA 2MPAH 5E1HB 4G9FA 2EDRA 2X70A 4LLQB 1IC5H 4NRXA 3RDTC 4OCWL 3EJYD 1B90A 1J05A 2W9LA 1MRDL 4LCUB 4Y19E 1CFTA 1JHLL 4HGWB 2H26B 4QRPE 4QRUB 2HMIC 2V7NB 3C9NA 3LN4A 3JWDC 2GK2A 3V5DB 4P3DB 4G43B 1AO7A 3ARSA 5FGBA 3TBVB 3UTSA 1RUQL 5E99H 1SM3L 1W0WB 3AREA 4OZIE 3MLSH 3WXWH 3QUXC 1VSCA 5KSAD 4AL8L 4NDMB 3RAJH 1FAIL 3PGFL 3NAAH 4XAKD 4IRJD 2VKXA 2PO6C 1NGXA 1RJCA 3QEQA 4MHHG 5I66A 5D5MB 5J9PA 4KZEL 5IVNA 1UZ8B 5AUMB 1RJLA 3L3JA 2KL6A 4HLJA 2MCPH 5FK9B 2ZSVA 1H8OA 1IE5A 3PIQB 3X17A 2CLVA 4JHWH 5EO1B 5C6TH 5JOFB 2D03H 2X9WA 3HG1A 4HFWB 1U8OB 2VDMH 4U7MA 1J5OL 3GGWA 4YDIH 3OAYK 3RQ3A 2MWCA 3RGVB 1C1EH 2E6PA 2VQTA 3BE1L 2DRUA 2ZJSH 5DJ6B 3VG9B 2EE3A 5FGSA 1C8PA 1NDMA 2PXYD 2P8MA 1LE9B 5HVGB 5JW4R 3VXRD 2R0LL 1JI1A 3QPQD 2D0FA 3D0LB 2D7PA 3ESUF 5FHBH 3BPNC 1S9VB 3SGDI 3I84A 5C2BH 1NAMH 1EA9C 4JGUA 4K07A 1QHOA 4S1SL 4JQVC 5I8CB 4GAYB 4JRWA 2FJFB 4MXWH 1F13A 4NBZB 1TQBB 5EZJA 4QHLB 3D39E 5CJOH 3TCXA 3MCG1 3QYCA 3O2DL 3VW3H 2YKLL 3BGFC 2HJKA 3PV6A 2XTJD 5IGXH 2GK0B 4WHTA 1JTOA 4KK5D 4LEOA 3BDYL 1YECH 3DSFL 2F5BH 4N5ED 1FVEA 3R8BB 5ELIA 3U1SL 3UJIH 4ZPTA 4M6OH 1T04A 4JO1H 4K7PY 4Z5RA 3T2NL 3EYUH 2P45B 4PG2A 2N7AA 3MQIA 5HHPB 2GSGB 4OIIL 1P2CB 4G9FE 2LV4A 4MAYD 5J12B 1QFHA 1A4KA 1P69B 5DC0A 4RA0C 4G6KL 5DRWB 4GW1B 1B9ZA 1X5KA 3EFDL 1T5XB 4NQXA 2ZG3A 4XNUH 3MGOA 4MNQB 3RWCA 1AO7E 1TPXC 3GSQB 1AXIB 4PRHD 7CGTA 3ZE0F 4FP8H 1OGTA 1NFIA 4YDVA 1QVOA 4ZTOH 7FABH 5I1LA 4P57B 2J8UE 3SDXA 5D2LF 4BZYA 1QLRA 3FN0L 3LKNA 2YWZA 4G8EA 3VH8A 4P2OD 3E8UL 3QEQE 3BESR 1P7KB 1EXUA 5C2UB 4L3EB 5D96C 1TFHA 3HMWH 5FYJE 4H20H 3OJVC 3T0DA 2BOBA 1ZLUH 5BW7A 4TPRH 2Y06L 3BXNB 5I6XC 2XWBB 3BRGC 4Y5YA 1F6AB 3HG1E 1JZ8A 4G3YL 1IILE 5HGDB 1VCAA 5E9DB 2AK4B 3I2CL 4JPIA 1N8ZA 4PJXA 3BH9B 4U1GC 4EJ1C 1IGJB 3RHWF 4M6ML 3D87B 5EOTB 2FGWH 4RMSA 3DX9B 4HBCL 2IPUK 1U8MB 1YEFL 2Y7QB 3VWJD 1RFDL 5IHLB 4KHTH 5C07B 3ZT6A 5IQ7H 1PKQB 3RWHB 4ZS7L 4Q9BA 3DECA 4CAGA 3V52H 3HS0A 2WLYA 3G6AB 3G5XA 1J8KA 2MSPA 1S9WA 4XMKL 3QIUD 4OZHF 2FECL 5DMIL 4C57C 4OF8A 2XWTA 4PLJC 3TIDA 5F1NA 3MLVH 3MRJB 3I85A 5C9JB 5FM8A 4PJFE 3WFCH 2NX5E 3N1QC 4JCMA 3ARBD 1S8DB 3HLAB 2CDGA 4KKBC 1ES0A 3G5YB 5DVMA 3VXSD 4P2CG 5F96H 1RK0A 3BKJH 3BAEH 2FYYB 3SE3C 3QXAA 1HHIB 4JHBA 5GS1C 4J1UA 4LLUB 3C6LC 3GRWH 2C3XA 1XCTA 3T2OA 3SCMD 1AD9A 2D7NA 4BQCA 5HHXL 1HH6A 1HCVA 1X5IA 2EDQA 5GISL 3QO1B 5INCB 4OCMC 2QSTA 5T1LA 3CLEL 4KDTC 5FA3B 2Q7YB 4Z0XB 3VRLE 5IFJA 2A6DB 1NFDB 2P48B 5DLMH 2PKDA 3MA7A 5EO0A 4KTDL 5A16B 4ETQA 2WW8A 3R0NA 4AT6A 1QKZH 3L95B 3BRFA 3VFTA 4ZUSB 5CIPA 5T3ZE 1C5CL 4XB8A 1QRND 3NCEB 1J8HB 3PJSB 1LHZA 1TZHA 3AY4A 1JL8A 4X99B 2Q3ZA 3MRDA 1ZVYA 3L5WA 2EEBA 4CU7A 2EXWC 4N90D 5E6ID 5HJ3B 4CRPA 4XBGA 3FFCE 4WI4A 3TVMC 1EEYA 5KVFL 3G5ZA 3H9HB 2DWDA 1AGFB 3O8XB 2IQ9H 4M5ZH 4Q9QL 5CSZB 3LMJL 1T4KA 4HC1L 2DIBA 4J2XA 4DGYL 4JKPL 4U1HA 3VE0A 1AD0B 3IDMA 5E2TL 5EA0H 2DJ4A 4UIKL 1Z6JT 1UM4L 1QFPA 3DTXB 5FKPA 2AJYH 3QDHA 2PYFB 3MXWH 3GMPA 1DZBA 1TQCB 5MEOA 1ZXQA 1RPQA 3J8F7 2ORBL 5CZXD 2B7DT 3TBSB 2CKNA 2DTMH 2VXQL 1HQRB 1BLNB 4UDUA 3O3DA 5ICYB 1C08B 1R3LB 3VRLF 4HH8A 2J12B 2YA0A 3GSNB 4P46B 2C26A 4LLVA 3PQYE 5GRVL 2YEZA 3UMTA 2X4PA 5T1MA 4PJ5E 3H0TA 1DTUA 5KSBE 2BSSA 2V9QA 5H2BA 4MCZA 4D3CH 3ZYOA 1Y18A 3QWRD 1WZLA 1WBYA 3BDBA 1H15A 3CPLA 2MQCA 4FQIH 2VLKE 3GSRB 1AGEA 1ZVSB 3GJEA 3NCJH 5DR5H 3TA3A 1R0AL 3H8NA 5DTFB 4HF5H 2HH0L 2HJLA 3GKZA 2UV3A 4U6XA 3LKRA 5CMAB 4PRHA 2ZPKL 1TVHA 5ABDE 2VE6B 2YOCA 2HTKD 1I1CA 2XY1A 3DLQR 5GGUB 5F9DC 2VTFA 4U2YA 2BY0A 1NC2A 3PL6C 3CSYA 5A43C 2HT4C 3RY6C 5LGJB 3RU8H 3AXLB 1YY9C 4GSDL 4YPGA 4RDQF 1UM5L 4I3GA 4MNGE 3HAEG 1LO5B 1RVFL 4HIEA 3QUXD 3MRPB 4KMTL 4P49A 4ISVB 4BK4A 5C0IA 5J11B 3SJVE 4HK3J 4OT1L 4UT7L 5IMMA 3HAEB 5B39G 5F3BB 1UYWL 1SYSA 3L5XL 2VDQL 3IFPA 4X4XB 2DM3A 4FFWD 3VWKB 3OAZK 2VQ1B 3HHRB 2FEDC 4CL7A 2ZCHH 4K8RC 2JCCF 1JGVH 3RNKB 4UUJA 4APQC 3VGDA 3K74B 3KPSB 3DSNA 4LSQL 1C5DB 2OSLA 5CINH 3CFIC 4KK9D 5B8CB 3ZE1E 4UT6H 4O2FB 2GJ6B 4OF0A 3EDJA 4U4BA 3P4MB 1KTDA 1U92A 4JFXB 3M8OL 4AH2A 2NZ9C 1EIBA 2DDQL 4LDOB 3TF7C 1FV1B 4X6DB 3TJHC 3O4OB 1RZGB 1XIWC 1NCUA 1ZE3C 4CADA 5IBTH 2YRZA 1AQDA 4R26L 3MRCA 1L7TL 3OXRB 4I48A 3IVKB 1RJZB 1OAKH 4MA1B 3QQ4B 1D5BA 1NEZB 2D7OA 1WTLA 3LS5H 1S7RB 4HPYL 4PRBA 1AC6A 3C8DA 1ZHKA 3K4ZA 4OFYD 2DYPB 1RZ8B 2WQRA 4RGNE 3FJTA 3O6ML 3LRGA 4Z7WA 3LEVL 3VXTA 1F8TL 3TT1L 5DSCB 5K9KA 5GGRA 1CDJA 2AVGA 1L7IH 3S36L 4DQOH 4EIGB 3ZZ1A 4X7DC 3E2HC 4LSPL 3ZHKA 4X80L 2ZKHL 1JWMA 2V2XB 4M62H 5FGBC 3PWLB 2GT9B 5EBMB 1JWUA 3TNMB 4NM4H 4M8QB 5DJYB 4TULL 2HFEA 2IALA 2NY5H 5E03A 5HHOA 5GGVL 5HGBA 5CP3H 1RZFL 5CCKL 4N9GB 3ISWA 2XRAH 4GQ9L 2CQVA 2JB6A 5HHQB 4I0CC 1AR1C 4N1CA 4BKLA 3OR7A 1CXKA 2D3VA 1MRCH 5EN2A 1MIML 2PTUA 3BPCB 4JPVH 3MLWL 1F3RB 5HDLA 3GSWA 3H7BB 1P4LB 3QCUH 4CVXA 3G08B 3WJJC 1RIVL 3ROLB 4IRZH 1IGTA 3CVIL 4XBEH 5ICZB 5IB2A 4GBXA 2A77L 2DM4A 5DD5H 4PYHA 3GMNB 5LGHH 2R1XA 3IXTA 3EGSB 4LRNL 3VU2A 5JR1H 1NBZB 5EU5B 4YC2C 1F5WA 1U3JA 3DUUA 3QXWA 4LPUA 5D5MF 3PDGA 3T65B 3GMRB 2DICA 3HAEH 1ED3B 2V17H 2HFGH 1YNKH 1KG0A 2YPLA 1TZIA 3GI8H 1SEBB 4HZAA 5BRZB 2IG2H 4FG6D 3BMWA 4YHMH 4DVBB 5IB1A 2A0LD 5KZCB 1MCPL 3GSUA 3IF1A 1F42A 1BGXL 4P23B 2NY0D 4F7EB 4JR9L 2EH7H 3QIWA 1IT9H 4MNQE 5EO9B 4HKBA 4NKIL 4UQ2A 4OCXH 3HA0A 4P2QD 2AV1A 1E6JL 3L3KA 4FABH 5ITBL 3ZDZF 4ZFOA 3CVHB 1SQ2N 2L0DA 3B43A 4YO0A 1CD8A 4PLJD 3EYOA 1NSNL 1YMHB 2BRRH 3K81A 4NP4H 5J6HA 5FECB 3X13A 2EIZA 4Z9KB 1G6RB 3VGHA 5D7JD 2GITA 1B6UA 2QTEA 3QIBD 4OD2B 4F7MA 4P4RB 4DN3L 5DUML 5E1AA 3GKWL 4LAQL 1IBGL 3VXNA 2KDGA 3NA4A 3RGHA 4FZEH 4B7IA 3MNVB 5E9DE 3OF6A 2AK4E 1FFNA 1EBAA 4MA7H 5E8OA 1E4XI 1N64H 2Y07L 3MV8D 1BQLH 5I8EB 5HHOE 1MHPL 2OMNA 2ZOLA 1F11A 4QKXB 5ANMA 5TGBA 3RWIB 3V4UH 4DGVH 4ZYKB 1A6AA 1IKNA 4PTUB 5C07E 1A14H 2X10A 1M71B 2QQLL 3UPRB 5MI0B 1PFCA 4FQ1L 3NABL 2EIDA 4LLDB 2GCYA 4WI6A 5BW7C 2CLRB 3OAZH 3BIBX 1Q9KA 3IXAA 4HIXL 4TNVK 5GGTH 5I1HL 4Y5YC 5FYKL 3BP6A 4H26A 3M1BA 1T20B 3OJDA 1K2DA 2J3SA 3S4SG 5F72S 4C56B 2X4RA 3ULSA 1HSBA 1OAZH 4OGAC 2IH1A 4MQTB 3D69B 1OW0A 5F70A 2XQBH 1R5IA 4KHXH 3EOTH 1UXSA 4PJEA 1FPTH 3NGBB 3EYSL 2IADB 4KY1H 4LQFL 4RRPG 3ALPA 1WEJH 1XR8A 3C2SA 4L5FL 4W6YB 3OB8A 1KCRH 1XGRB 3VXOB 1L0QA 1T66D 4YHIA 1OAUL 5KJRH 3O45A 3RPIB 3GHEL 4KJWD 2YPLE 3X11A 5BZDA 1K3IA 2ATKB 3FQRA 4HCRL 2FATH 2JKXA 3QDGB 2A1WL 4HC1A 1D9KD 4PGBB 1NFDE 4S11A 2MMXA 2Y6SD 3BUTA 4EEEA 2E7MA 5ESAA 1DEEA 3RZCD 4XBPB 5DQDH 1FC1A 3RJDA 1DCLA 4LVOB 4OFYA 1INDH 4DCQB 1IGYB 4U6VL 1YEIL 1BD2B 4GKZA 3O2VL 4LIQH 1RZKH 1DBBH 3C60A 1YMMA 5EZIL 1NCAL 2X9YA 2XA3A 2YMXL 1CF8L 3MLUL 3MRRB 1IAIL 4MJIB 1H3PL 4O5LH 4X4YB 2IPKB 3MRMA 4N0FA 1U0QA 4V2BA 2YD4A 5L9DL 3HPJA 3GNMH 3BT2H 1QBAA 4LSUL 4M8VA 1P6FA 2O5YH 2ZSWB 1U8HB 3FO9B 1N7ML 4QXGL 2HG5B 2ADIA 3R06B 3TO4B 1J12A 3CVHH 4QXUL 1KTKE 1B0RA 2ERJC 2XKUA 5KS9F 1FGNL 2VZOA 3BKCL 4NN6B 3DX8B 4Z7UA 4U2ZA 3NIDE 3AY4C 1T3FB 4ERSH 1MLCA 4JFDB 3FB8A 3KPQB 3VFOB 1G6RH 2Q3AA 1KCUL 4PGZA 3SKOA 1KJMA 3RBSA 3LSOA 4F58L 4LCYB 4JG1H 5GRUH 1D5ZB 2B5IB 2V2WB 5CZKA 3BD4A 4GW5A 5ECJE 4M7KL 2GHWB 2W9EL 1ZT1A 4RAVA 1YY9D 1ACYL 1CT8A 3LKSB 2MJWA 1EJOH 2C3VB 2HTLC 5EH1A 4HUVB 1LD9A 3ELAT 3TYFB 3V7AE 1A1MB 1FSKB 1I8KB 3ILQD 2R2EB 4PJHB 2BSRA 4P5MA 4ONOA 5BJTB 4WTZA 2OM5A 2XZAH 3WIIL 4NWUL 4DN4L 5D1XA 1QPXA 1AP2A 3MBEB 1L9NA 2NW2B 4X0KA 1NGZB 4APQD 1RD6A 5CEXB 4W81A 5FYKD 5JOPD 3DVIA 5EG6C 3MLRL 3L7EB 5E5MA 4MDJA 4YNYB 2DQDH 3HE7D 3MREA 4GG8A 5JPMA 3LH2L 4JY4B 3W9DA 5L2KB 3IU4L 3B9KA 4RGNC 3D39D 3EFFA 5IW1B 4NM8L 3TBWB 3RKDD 5IFAL 4XC3H 4I4WA 1JV5A 2G9HA 3VRIB 5DVKA 5BVPL 2WANA 4I0PA 4LARL 5KVEH 5D71H 5I15L 2QQQA 5J57B 3C08H 4JLRB 5I8KH 4KJQC 1LO0L 1FH5H 5IB4B 1G9NC 3WO4C 1YMME 5IBLC 1QNZH 1TJHH 2LAAA 5T3ZL 1OTUD 3HB3C 4QHNB 4UV7H 3TA3C 3VG9C 4KROD 5T3XH 3SDAA 2X89A 5H37G 2F19H 4YQXL 4FFYH 2MPAL 2YC1B 3QUZD 4KMQA 5AWNH 4X7SH 1IC5L 4XP5H 4LHJB 4D94A 2AJZA 1DUYB 4QY8B 1INQB 3FQTB 3B5TA 3KPSE 3BN9C 3KPMB 1D5MA 3CFJA 3H6JA 3B8YA 2X41A 2X09A 4S1QH 4AEIH 1KJ2A 1AJ7H 1HXMB 1KF9B 3NCYP 3U30B 4XCEA 5E99L 4CKVX 1BX2A 4FQXD 4YGAB 1TQBC 1A7OH 5DHYB 2RBLA 3MLSL 3WXWL 2V7HB 3BSZH 4GOSA 4CVZB 4JN2A 3BGMB 3RAJL 5CZVH 3DV6B 3NAAL 3UYRL 3KPPA 1ADQH 4F2MB 4F9PC 1RY7B 4LAJH 4MSWB 3S35X 5CD5C 4HPOH 4RQQB 2JF1A 1N3NA 4LHUD 3QQ9C 2DIJA 5A1AA 2MCPL 3FO1B 3OTTA 3KYMB 4F7CA 4Z7OF 3QUKA 1BJ1J 3KVQA 4JHWL 5DQJA 2DF3A 1I1AD 5C6TL 2D03L 1LK3H 2HRLA 3DO7A 4WI9A 5DJDB 2VDML 4GUPB 4YDIL 1PVHA 5SWQA 1C1EL 3MOQA 4PREA 2ZJSL 3KNBB 2I9TA 4LF3B 4Y4FA 4FNLH 1H3VA 1M7IB 2PW2B 4CBPA 3OGOE 2DQJH 3QNZA 2UWEA 5I1CH 4LSVH 4EUPA 2MHAA 4GS7B 3MLYH 1GGBL 5FHBL 4X9IA 4NWTH 2DIAA 4PP2A 2JJWA 1HHJB 3STZB 5C2BL 1NAML 1QR4A 5I71B 5D1ZA 1RV6X 5I17B 1ZGLB 3WN5B 4AY0A 4ZDHB 4MXWL 3DI2B 3FRPG 4D0BA 5CJOL 3EO0B 3O6KH 4GLRI 2NX5D 4NSKA 3AU1A 2VUYA 4HX1B 3VW3L 5IGXL 4ZUUB 5C1MB 4WNQB 3GSOB 5IT2L 3AAZA 1YECL 3H9SB 2F5BL 4EDXA 2QADC 2GSIA 3UJIL 3BVNB 4X6DF 5HGAB 3PP3H 3FHAA 4JO1L 4M6OL 1VGKA 5DJXB 2XN9A 2W0FB 1FZJB 1CK0H 3WEXB 2BHUA 4L4VA 2A83B 2HT2D 2P46B 3IAQA 2DB8A 2BOCB 2YD3A 3NIGE 4XC1H 5IESH 4TNWK 2P7TB 4KRMB 2FBJH 4N1HB 2OX5A 5BV7B 3KPOA 2YXFA 3AM8A 4ZFGH 2OBGA 1JFQH 4WGVB 4DZBA 4XNUL 4LIQE 1FIGH 5T3ZD 4R4BB 1A3QA 3HC4H 4QRRD 1KB5A 3DJ9A 5DD6A 4IRSA 3VFRA 5BRZE 4U7SA 1BJ8A 4FP8L 1E28B 2R2HA 1BQHA 1AKJD 4ZTOL 7FABL 5CWSA 3MRNA 4EIZC 5H37H 4WGWB 4KRLB 2WP3T 1DVFD 2HRPL 3FTGB 2BVQB 3DVGB 4YH6A 1OOAA 2X1QA 5BVJA 4ESKA 2A2QT 1MSPA 2JIXA 3PXHA 4OLYH 3QULA 3DUHA 3HMWL 3FFCD 2ICWI 2IPTH 4H20L 5JMOC 2QLVB 2F74B 1QLEH 3T0AA 4ELKB 3Q5YA 3T8XB 4PGEB 4TPRL 5A2FA 1VADB 1RUAH 3GMQA 4U6YA 3VD7A 4OGAD 2ZUXA 1KTRL 4OD1H 5AG8A 1VACA 4GFTB 4QOKD 5C6WH 1OSPH 5IUSA 1FP5A 2FGWL 1MJJA 1KIRA 4ENED 2Q20A 1KN4H 1ONQB 4G6FB 4DEPB 4URTB 2GTZA 5INDB 3JWOC 2IAMB 4JN1H 3FONA 4KHTL 3CFBB 1QACA 5C08B 5IQ7L 3PUCA 2ESVB 4OKVB 2LU3A 3V52L 5C0FB 4LSTH 5HSFA 1ZWIB 3IDNA 5F88A 5CJ5A 4XWOC 5DK0B 1WCQA 2GY5A 3GJFH 5GGSB 3D85D 5IVXB 2X4TB 1IEHA 1PAMA 5JW3H 3MLVL 4WENB 3PQYD 1WFTA 3N9GH 5CJXA 2A6KA 5EIIA 4PJ5D 2FX8H 3WFCL 2Q86B 3RPKA 5KTEH 3QFDA 3O8XC 2M26A 4OZHA 5F96L 5LGKA 1RIUH 1G7LA 3BKJL 1KNOB 2VLKD 3BAEL 3MCKA 4R90H 4PRPD 1MJ8H 3GRWL 3WNOA 1J7VR 2XN9E 1X5ZA 4ZSOA 1BEYH 2YBRB 3QO0A 2R39A 1EHLH 3ARYA 4LFHG 2AJVL 3MRBA 2AV7B 2AGJH 5F1KC 4XMPH 5SWZB 4NUJB 1UJ3B 5DLML 1T03H 3GBLA 4I13B 1U8LB 2FHFA 3TZVA 3WFHA 4EDWH 4ODWA 1IL1A 1QKZL 4U1LB 3KLAA 4POZC 4X8JB 3ARFD 3V6OA 3BPLC 4MJ2A 1OW0C 3SJVD 3V6FA 1X5HA 3RNQA 3QDGE 4O2CA 4BSJA 4LLMA 5T3XE 4L8CB 2NY5C 3TYGH 3VFMA 3T1WA 4YIQA 3UTTA 2WP3O 4HK3N 5BV7H 1UH2A 1I1AA 5L2JA 3OKMA 2KUTA 1J86A 1BD2E 3RUGB 1GZPB 1FZOB 3TIEA 4YHOH 5TF1H 2W38A 2WWKT 4QXTB 5A2IH 4MJIE 4LMQI 3IJYB 3WE6B 2IQ9L 3G5VA 4GW4B 4M5ZL 2RIKA 3O3BA 4WW1B 2QQNH 1DQLH 3UZEA 4WDIA 2DKMA 1F6FB 2SEBA 4K3EH 4QT5A 5C0GA 1X4XA 4CVUA 1FDLH 3BZ4B 4HBQA 4XCYA 3RX8A 3NN8B 4ZNEE 3O11B 5EA0L 1YYLH 4RFOH 2AJYL 3NFPB 1I1YA 2MQ3A 3MXWL 2OJEB 2E27H 3ALXA 2UZIL 5I2IB 4OFIA 4Y4HB 4PY8I 1AGCB 5J11C 2YXMA 4DKFH 1QR1A 4JFDE 2BFVH 2DTML 4DGIH 1B0GB 3KWWA 5FYLH 3VMNA 5FM4A 2B2XH 3F7YB 3MCLH 3VWKC 1UH4A 4L8DA 3X14A 1MF2H 1HHKB 4IBLT 2NLJB 4DKAA 3WDHA 5FKAB 4QRSA 5DT1H 1A6UH 4M9PA 4XRCA 4YAQB 3BN3B 5GS0H 3RGVD 4D3CL 5DC9B 3MFGB 4UIMB 3HB3D 1KLUA 1I3VA 3ETBF 5EOQH 2QSQA 4FQIL 1MCWM 4AQ1B 1JK8A 3GO1H 3P11H 3LV3B 3NCJL 5DR5L 2V9TA 4PJHE 4HQQH 1CWVA 4HF5L 4JM2A 3O4OC 5MENB 4K23H 2VXTH 3K7UA 4KXZI 2WZPD 3TJEH 1S7XA 3ME0A 1ULVA 5TDNB 3DX7B 3EYQD 3DYOA 1EPFA 1F3DH 2A6JB 2XFXB 1CE6B 1B4RA 3SE8H 1DDHB 1PX4A 1UVQA 1TZGH 5D7KE 5J0BA 1PLGH 3L7FA 5FOBA 3L3OA 4ZD3H 4HXBH 3RIFK 4CJ0A 2K1MA 2HLFC 3Q5TA 2B4CC 4JVUA 2ARJA 5D1XC 2YA2A 2IGFH 5EFIA 1A1NA 1I3GH 1BIHA 3QQ9D 1U8PA 4HUKB 4QOKA 3ZHLA 3P4NB 3QSKB 2ZCHL 2CDEB 1BVKA 1JGVL 2Z92A 5IMKB 5KSUA 3QXDA 4MCYB 3ZDYE 2WWKO 4EOWH 3N1GC 2B0SH 3MJ7A 2Z91B 3U83A 2MCG1 1N5YH 3DMMB 5CINL 4DTGH 3B9KC 3V0AC 4Y2DA 1VEMA 2P5WA 1A6PA 3MJGX 1FZMB 2OR8A 2J88H 2J6EA 2JCCA 3LKPB 5D1QA 3FCTA 2VXSH 5DRZA 4GRWB 4I0PC 4NQDB 4MNQD 5EC1A 4K9EH 3CCHA 4KKNA 4M4PA 4OM1H 5HHMB 5IBTL 1T89C 1JPGB 3X3FH 3FHQA 3JTTB 1MH5A 2CMRH 3WKMH 1OAKL 3BUYB 4GRMA 4EI6A 1CVRA 3LS5L 2BVYA 1RZJC 4L3ED 1ND0B 1R24A 3EHBC 4JZJA 2F9BT 3HZVB 3AS3A 3S37H 2ADGB 5HHNB 2EICA 2C1PA 1D5XA 4Z7VA 3VGEA 3EYFA 3DIFB 3BI9X 1OP9A 1EFXB 1L7IL 1R3KA 4DQOL 4GAGH 2HVJA 1KUMA 4RZCA 4QYOB 4UU9A 1H0DA 5E9DD 1IAKA 5EZLA 2AK4D 1RZKC 1CG9A 2Q76A 3HZMB 4M62L 4HV8B 5E2VH 3MPCA 3MRQB 1E4WH 4ODXB 1T7VA 4HS3A 4IS6B 3VFUB 4G8GA 4NM4L 4P5TA 1C12A 4MVBC 3DRQB 3GSVB 1BVZA 2NY5L 4JHZA 5C07D 2A74B 1XH3B 3FQUA 1KLGA 4L8BA 3FFDB 1IAIM 1S9XB 3VFPB 3Q3GB 1TCRB 1BZ9B 4KK8D 2DKUA 2M2DA 3DGCR 1G7IB 4BH7A 1KTLA 2DM2A 3E0GA 3GUTA 1IM9B 2HN7A 5HGHB 1MRCL 2EH8H 1REIA 3P9LA 4ZPVA 4JPVL 3QDJA 5ALCH 4YDJA 1NCNA 1UWXK 4OZGB 1JNHB 1NFKA 5M7QA 3U9PH 4X5WB 4E41B 3ZKNC 5BZWA 3MUGB 3NA9H 3QCUL 1MCDA 4Y4FC 5CEYB 4PRNA 2EDNA 1RZIA 1MCJA 4IRZL 1KV3A 4O51B 1QQDB 4XBEL 5IG7A 5H35A 4MJ6A 4JZNB 3H9SE 3MV01 5LGHL 1ZS8A 2YPVH 2HLAB 1HWHB 4XP1H 1S7SB 1D6VH 1JYVA 5JR1L 1NGWB 1VEPA 5C0CB 3U82B 2X4UA 1CFQB 2OTUA 3U46B 4MAUH 4S0SD 4Q6IB 4NNXA 4IEFB 3C8KA 5ALBH 1W72H 2JJSC 4Z95H 3CNKA 2D31A 5D1ZC 5JORB 1XGQB 2V17L 4XX1G 9CGTA 2HFGL 2J8OA 1YNKL 2P5WE 3GI8L 5DRNB 4NCDA 2IG2L 4HHAA 4YHML 5MI0C 3HZYA 3QJHA 1CFBA 1OF2B 3P9WB 4HS6B 1Y6NR 1MLBA 1ZHBB 5B38G 2EH7L 5JO5B 1IT9L 1WWWX 4XNXH 1OCWL 5J3HD 5F7WC 3U4AA 1J8HD 4FFVC 4FABL 2NY1B 2OK0H 3HNVH 4M00A 2C9AA 3O4LA 1T2XA 4Z77A 1NCWH 4A2MA 1IFHH 1X7QB 4O2EA 2BRRL 4JJHA 4JZOB 1DQJB 4Z7VE 4NP4L 3G6JB 2V9RA 3FT3B 3JV5A 4L1DA 5IHUH 2W0PA 2OZ4H 3O8XD 3P4OA 2ICWB 4UNTA 4JQXA 4AIZB 4PJ7B 3C6SA 3UAJC 1YEHH 3MV7D 4FZEL 4PV8A 2GEEA 5C0EB 5C86A 4N0CC 3REVB 5EPMB 2DWEA 1WZKA 3SDDA 4MA7L 5IQ9B 3I6LE 4MMZC 1N64L 5E8DL 1BQLL 3QQ3B 1KCVH 5E00B 3V4UL 3OSKA 1WJ3A 2P24B 3DO3A 3IDIB 3BKYL 3FRUA 3QEUA 4Q9CA 1A14L 5C08E 1FL3A 3QDMB 4CN6A 3MUJA 1PSKH 2R2BB 3W11C 4JFYB 1MY7A 5GGTL 4X6EA 3QDJE 4J3OC 1LNUB 2G2RA 5IVXE 1QSVA 5CEZH 4P46D 3S36X 1OAZL 5DURB 3B3IA 3V6ZA 1K85A 3CX5J 4F57H 3MNWA 2XQBL 3RL2A 5GS3A 3RWGA 4HUXB 4KHXL 3EOTL 3T1FA 1P1ZB 3DXAB 1FPTL 1GXEA 3JWNC 2M8XA 2P5EA 3TO4C 5H94B 5FV2A 3VRJB 4KY1L 5DDHA 1NCCH 4E9LA 3V0WH 1WEJL 4NFCA 4BZ1H 4MLSA 4NN6C 1SJEA 1KCRL 5CJ8A 2QBWA 1MVUA 1AE6H 5KJRL 1ITBB 3S6CA 1U8QA 2HFFA 2YD1A 2EEAA 1OGAB 3DROA 4L29A 1FFRA 2FH6A 2B5IC 1ROWA 1WIPA 2FATL 3CFDB 5IB3A 5DJ2A 1MCKA 5CJXC 4YLQT 1C16A 1M1SA 5SWZE 4I5BB 3CIQA 5J1SC 3DETD 5FCUH 5DQDL 3RL1A 3U7WH 1INDL 2A73A 1N0LA 3OKEB 1BFOB 4LIQL 1I8MB 3B5GA 4QF1A 1DBBL 2A9NH 4XPFH 1HSAA 1FSKC 1YN6A 3O4LE 1CL7H 5KG9A 1MEXH 5F6HI 4NZUH 4O5LL 3VWKD 2F15A 4I18B 3HC0B 2AXFA 1XGYH 1R5VB 1BQSA 1CFVH 1RUPH 3MBEC 3SDYH 5MERB 4HIHB 3GNML 3S34H 4WEBH 4JG0H 3BT2L 3KPSD 4JFOA 2PTTA 3RUGE 1MQKH 4OBSA 1MJUL 4RMUA 2O5YL 3HR5B 5I1JH 5JXED 1Q0YH 5E8PB 2ED7A 2GJ6D 5EU6A 3CVHL 4O58H 4CDHA 3HRZB 4NHUB 3T3ME 1CGWA 4WU7B 1QSEB 2IMMA 5IP4A 1QBMH 2UUDK 5ERWA 1A9EA 4XI5C 1JI2A 4ERSL 1I75A 5J6GA 3DGGB 2GY7B 2WBJA 1OB1A 2P8LA 4JG1L 5GRUL 3PHOB 2YZ1A 3FO0H 1MI5A 5KS9A 4BYHA 2D4DA 1GGCH 1J0ZA 2B1HH 2W1NA 4NO0A 3QH3B 3VXPB 5D9SB 4LCCA 3U7AA 1DBMH 2OTWA 1EJOL 1T7ZA 3CGTA 2DYPD 4WO4A 2VLJA 4L4TB 4F7PB 1HYSD 5CP7B 2EDLA 4E0RA 4NQEB 3SEPA 4AEHH 1G7MA 3QCVL 1OD9A 3TBTB 2AKRB 1FJ1B 1T6VN 4YR6B 5EWIL 2XZAL 3MNZA 1MWAB 1EGJH 4RGMC 5TDOA 5HVFB 2CIIA 3L5JA 2R29H 3JTSB 2J4WL 3F7VB 5T1KA 1IC4H 3U30C 2EYSB 4UBDD 2OLDA 3VJ6B 5TE6H 3QWOA 2DQDL 4I2XA 1HDMB 1UB6B 4NBYB 1FZKA 1R3IH 1ZA6A 5FDWB 5GIRA 5MHSE 5MENE 1S7TA 1T22A 3RUGF 1Z9SA 2FRGP 5F44A 1Q72H 1FYTA 3BO8B 4XC3L 3GBNH 5GSRB 5HI5C 5F1IB 5HYJB 1KPRB 4KKAC 5DK2A 5C0AB 3T3MF 3C08L 1IEAA 5HHVH 4XXDB 1FH5L 1YJDC 2YS4A 3HUJA 5F93C 4KI5F 3AGVA 2CJUH 4NQVB 1OM3H 3PWUA 1TJHL 1CI5A 4KK6D 4UV7L 3EHBD 3I02B 5BQ7A 4LU5H 3SGJC 3B2UC 5T3XL 4JM2C 3FOLA 3MV7A 2F19L 3U2SA 4FFYL 2GI7A 1R5WB 1H3XA 5AWNL 4X7SL 4XP5L 1T1YA 5I8OH 4UTBH 1QFUH 3VXQB 1Y6KR 5TE4H 3HCVA 4K94H 3JZ7A 3ULVE 4QNPE 1JWSA 2CUIA 2UVEA 3WUZA 5E7BA 3T04D 5BRZD 1MHHB 4S1QL 4AEIL 5D6DA 1AJ7L 4J6RH 4PLOB 3IFOB 5KZCD 3P0GB 1I8LC 3KS0H 3CU7A 1LK2A 4P23D 1A7OL 3EIFA 1XGPA 3BSZL 1PQZB 4GRWE 4NQDE 4ZOBA 4HUWB 5CZVL 4LKXA 2NR6D 5C0JA 1ADQL 5HHME 3IJHB 1MI5E 4HPOL 2VYRE 1F4YH 1XCQA 4D9QE 4I1NB 4LBEA 3OL2A 1CXLA 3U4EB 4N8VG 1HHGA 4DW2H 1B0WA 2DLEA 1I3UA 1JPFB 4CGTA 2N56A 3FQXB 4RMQA 4KRPD 4OAWB 4M7LT 2Z9TA 1LK3L 4D0DB 3ZKND 2NQCA 3KYNB 3L3GB 1M7DB 3WXVH 1AGDA 2FR4A 1DE4A 4DAGH 3UPCA 2LVEA 2V6HA 5DHVB 3THMH 2BVEA 4FNLL 2YD7A 4U6TA 3M17A 2DQJL 1SYVB 2BSTA 4HWUA 5I1CL 1DQTA 1KC5H 1MCHA 5ACZA 2W07A 3QFJA 3UJJL 5IOPB 4LSVL 3GMMA 3PNWA 3MLYL 1QSFB 4Y1AB 3QZWG 4I2XE 4NWTL 3WCYA 4FMKA 4PRAB 3QP3A 4HKJB 5CEZE 5CD3B 2OI9C 3C5SB 1Y6MR 2VN4A 3QZWB 1FVCA 4U3CA 2DM7A 3DUSA 5IJKA 2DMKA 2P24A 5IB5B 3VXMB 3L3HA 3F12A 3FZUC 3HRPA 3ROOB 4QTHA 1YEDB 4OIBA 3O6KL 1PG7H 1KT2B 3KPNA 1G9MC 4X7EC 1IGFH 4WUKH 4Y4KB 2R1WB 5AD0B 5B39A 4U1SB 1CXIA 3TH2T 4C56D 5HDBE 4YJZL 4OZ4B 3HUJE 2NY3C 4CN4A 5LAXB 1JHTA 1Y0LA 3REWB 4E41E 5I76B 3PWPB 2Q6WA 5JXEA 4P5TC 2UUDH 2Q1EA 1XF4A 4KXZH 2C1OB 1CK0L 4DEPC 3D2UA 4XC1L 5IESL 2R0WH 5F7MC 2FX9H 3OGCB 4PJCB 1ZOXA 2FBJL 1I4FB 3WIHA 3B6SB 1JZ4A 5C0CE 2ARJQ 2H6PA 4ZFGL 1H5BA 1JFQL 5AZ2H 3SY0A 3HC4L 4J3XA 3W0WA 2H9GA 3QDGD 5T3XD 5GZOD 4R96B 1M6OB 4F3FA 3GEWB 4G6AC 1U93B 1XF2B 1VKXB 2NNAB 2O5ZH 4X7FC 1F2XK 4U1IB 1DQQA 3C5JA 2CDFA 2XKSA 4M61B 1A1OA 3NACH 4JRXB 1OP5H 3W11D 1YPZF 1HI6B 1E4KA 5E8EB 3T77A 1G7PB 1QLEL 3G04A 1RUAL 1VFBB 4U1NA 3RY4A 5C8JB 4OD1L 4JFEA 1LEGB 1OTSC 3VGGA 2X4SB 1OSPL 1Z9OA 5C0NC 4OGXL 1HXYA 1CDUA 2C4FT 1UJ3C 3K2MC 3W82A 4HG4K 1I7UA 1KN4L 4PJ7E 1FL6B 4OZGF 4IOFC 4N8CH 3JVGC 4JN1L 4LLWB 4YE4H 2DBLH 1YEKH 3QNYB 1FO0B 3F7PC 4RMRA 1ZA3B 1N6QH 2XQYG 2UYLA 1PY4A 2WWMC 1JJUA 1MAKA 2WUBH 4JFDD 4OLWH 4LSTL 5E56A 1K4CB 3RVUD 3OKOA 4RX4D 5DHVH 1U91B 3M45A 3DBXB 5HY9B 2FSEB 4TTDC 3T0VA 1CR9H 4R3SA 3P4LA 4Q6YA 5JW3L 4PIRF 3OWEA 2WM0A 3N9GL 4PGJA 3QDME 1PYWA 4KDWA 1HH9A 3U36A 3DHMA 2FX8L 3HE6D 3UTQB 3SDCA 5KTEL 3BP5A 4IOIB 4S1DC 5D2NA 3DURA 1LEIB 3Q2CA 1RIUL 5KW9H 1U58A 4ZQKB 4HKXB 4R90L 1S7VA 3OHXA 1YY8A 1MJ8L 2F54A 4WFEE 5IVZB 3SDDC 4YDLB 1Z5LB 3DXAE 1HINL 3V5KB 1GH7A 2EDTA 5DD0H 4POUB 2X4OB 1BEYL 3CH8A 5D93B 1ZANH 1EHLL 2Z35A 3D18B 2PR4H 3K3QA 4ODUB 4WV1A 2BMKB 1RJYA 3GMOB 5D72H 1JN6B 1U95B 2X1OA 4DKEH 2AGJL 4U31A 4Y4HC 3ZTJG 1HILB 4XMPL 5TE7H 3EOBA 3ARZA 3S3PA 3VXUB 1T03L 5D7KD 5L2KD 4XGZA 5LKNA 3OKDA 3ZO0A 2VZSA 4EDWL 1CGSH 2F53A 3G6JF 5K93A 1T7YA 1U3ZA 3FOMB 2Y36H 5C0DA 3KHOA 3FB6B 3V95A 2PYEB 4JJ5A 4R9HA 3TYGL 4PRDB 1A47A 5BV7L 3WNMA 3TT3H 5LCVH 3TGXA 4JO2H 3KG5A 2EDEA 5E2WH 2PO6B 3VCLA 4EI5B 4M1CD 1XF3B 4NN5B 4IMLB 5E24E 1N5AB 2FL5B 2EYRA 3N0PB 4I77H 4ODSH 4YHOL 5FUZH 5TF1L 3VD4A 4MJ5A 4H88H 1KENH 3KLSA 3FQWB 2DQFA 1GZQB 1JUFA 4U0RC 4ORGA 5EU4B 2QQNL 1DQLL 1CGTA 1MHCB 1NGYA 2N4IA 2VJXA 2EKJA 4NGHH 3ECBB 1FDLL 5F9OH 4CNIA 4NRYB 1U8KB 4XPBH 1A6WH 1GIGH 4P2RB 4YHPA 5CBEA 1JPTH 1YYLL 5I19H 4MX7A 1JVKA 4RFOL 3UBXI 5I18H 2E27L 4L4JA 4LMQE 2XV6B 1PBYA 4G9DA 3WLWC 1XF5A 4N5UA 5KVMC 3IGAA 4DKFL 2BFVL 3MLZH 1ORSB 4C83B 3BH8B 4AM0A 4DGIL 5LWYH 5FYLL 2B2XL 3T4YB 3SO3C 3MCLL 2H32H 5I9QC 3S4SA 1MF2L 1KPVB 2ZOKA 2H2PC 2Z31A 5JW5A 5EUOB 1P7QA 1FO0H 2W60B 4EZMA 3ULVC 3ALWA 1A6UL 5DT1L 1NC4B 3DMMC 3C5ZB 4L4TE 4LRIA 5GS0L 3E6HB 4NQEE 5IEKB 5K59E 4JKWA 5FO7A 4RRPA 4MZ3A 5EOQL 1A22B 2ATPB 3PV7A 3GO1L 3P11L 1CDCA 4ONGL 3SBWA 3HNSH 5DYOA 1MCNA 2AI0H 2WBJC 4HQQL 4K23L 3P0VH 5IW6A 1YNTB 1UCBH 5DQ9A 2VXTL 1ZHLA 2VMFA 5DEGA 4EN3A 3TJEL 4M9OA 2VO5A 4N0UA 1TTFA 2NTSP 2H8PA 4LCCC 2OYPA 5I1AA 5T1DL 2DMBA 3MRFB 4UQ3B 4NNPH 1GGIH 3MV9B 3SE8L 4WO4C 1TZGL 3BHBA 1H9VA 4X5XB 1WBXA 4Z7QF 2HVKA 1PLGL 3PHQB 4FTVB 4NQSA 1TPXB 4MD0A 5DS8B 4ZD3L 4F8TA 4HXBL 3MFFA 4CW1B 5EBGA 5D8JH 3QG6A 5C0AE 1Q9LB 5JDSA 3IAGC 3H9SD 1XGUA 3MGTB 4ZFZA 5I0ZA 2IGFL 2CPCA 1A6VH 1I3GL 5ACMA 3SKNB 3L5HA 3JWDH 2G5BA 1QEWA 1S7WB 5E6ZA 5IJVA 3WLBB 4JQIH 1NDGB 4JDZB 2JK5B 4NQCA 5GSVB 4EOWL 2Y25A 2B0SL 1N5YL 1BF2A 4XVTH 2P4AB 2V5YA 3I75B 3GM8A 4DTGL 4Y16B 3EYVA 1SJHA 4GRLA 5KBNC 1FRGH 3T0BA 2J88L 4NC0B 5IROC 5DVNA 3BZFA 1CLCA 2VXSL 5DFVC 1YEGL 3RWDA 4K9EL 1ZT4B 1IRAY 3MRGB 1CLYL 3WFBH 1TVDA 4QHUB 5ADOH 5IVOA 3DVFA 4X7TB 3OKLB 4TVPH 2NY4D 3X3FL 4GG6F 5EUKA 3RBGA 2CMRL 1RK1A 3WKML 2DN7A 4YFLF 4WY7L 2EDKA 3V0VB 1MAMH 1BIIB 3HE6A 3BD3A 3N85H 3QI9A 4P9HC 4GT7A 2OL3L 1I3RA 1DEDA 2XPGA 2EDHA 5BS0B 3FZUD 2GFBA 3S37L 2ZZUT 3BP4B 5DEFA 5CFHA 1HYRC 2I07B 3MJ6A 3CXDH 5B3NA 4F8QA 4MA3B 4R7NA 1UKTA 3I6GA 1T5WA 3P9MB 3O9WD 4GAGL 4TSBL 4Q6IC 1LP9A 1PZ5A 5GXBB 4HT1H 4LCWB 3MRIA 3U9UB 5D6DC 1J1XH 1KPUA 4ONFH 3MZGB 4HDIA 4PJAF 5E2VL 5IMOA 5JPNA 1E4WL 2C4XA 5FYLD 5MP6L 3I6LD 4J4PD 5DD1H 4G6FD 2BVOA 4K3GA 1EVUA 4JE4B 3WSQH 4F37F 2IAMD 3HFMH 5GS1B 4PG9A 2PNDA 3C6LB 3KYOB 1ERNA 1CFSA 2VZ1A 2ESVD 4R7DB 1NMBH 2BJMH 1H3WM 2NY1C 1LO3H 4Y1AE 3ORJA 5GS0D 1B4JL 3FT2A 1ORQB 3QRGH 3WFDL 2K7QA 4ZFFA 2EH8L 4PRIA 5ALCL 2Z93A 5IHZB 2FWOA 1DN0B 3VXME 3JV0A 3U9PL 1XGTA 2VABA 4BH8B 2APWA 3QUYB 3NA9L 4OUOA 4Y0GA 3K0WA 1UXWA 5FUCE 3AS2A 5C0RH 1I7TB 2X7LA 1AXSB 5BOZG 2X4NA 4Z0BH 2C7UB 1A6ZA 3LS4H 3KLHC 2OQJB 2YPVL 2RR3A 4XP1L 1D6VL 4KWUA 3G6DH 4U1JA 3BP7B 4D8PB 2AP2A 4XZUA 4NQCE 4MAUL 4GXVH 4Z95L 5ALBL 1W72L 4JDTH 1GGUA 2IANB 3TVMB 1OTSD 5FA4A 3V4VH 5IJKC 2Y5TA 3MRHA 5C0ND 2BNRA 2EC8A 4PJCE 4LFHD 5SWZD 1KCSH 2D4FA 3QHTC 4K55A 5E4EC 2XTLA 4ODVH 1DSFH 1T21B 2DQCH 4IOFD 4QO1A 2XYCA 4XNYH 3RVVC 4IJ3B 4ELMB 5TDPA 1NBYB 2WWMD 4XNXL 3DHJA 3LEXA 4ZUTA 1W0VA 4HIJA 1LVEA 1NANI 3HNVL 2OK0L 4XB7A 3UDWC 1NCWL 4PGCB 3QHZH 1P53A 3FO2B 1IFHL 2XG4A 5GQBA 3UTZA 1RUKH 3HPLA 4G42B 4KV5E 5F9JB 4JRXE 1X3DA 3ARDB 3GJFA 4PJGF 4XWGH 4NO5A 4Q74A 3WS6A 1VFOA 3OZ9L 5IHUL 32C2A 4NKDA 4S1DD 1U3HA 1LP9E 1J18A 1MUJB 3PF2A 1T1ZA 3O81A 1NJ9B 1VENA 1YEHL 1QA9B 4F80A 3OX8A 3LRSA 5C9KA 5EOCH 4PLNC 4UOW1 3RWFA 3P73B 4KI5D 2DQUH 4FXKB 5ENWA 3QA3B 5F7DA 2Q7NA 1INEH 4MB4A 4ZXBA 1KCVL 4ZUWA 2QEJA 1L0XA 4Y8AA 4PTTA 2R23A 4Y4HD 2IQAA 3T4AB 4HUUA 2W65A 3DVNA 1Q9OB 1WZMA 4NYLA 1E4KC 1EMTH 4YBQC 3FRPA 1PSKL 3TWCH 4B41A 3F5WA 3VA6A 2KQMA 4JO3H 1FORH 1ZSDB 2IEPA 3UC0L 4HJ0D 4JM4H 4I18C 2BY3A 1O7VA 1ZLWH 3RVWD 3PABA 5EBWB 1WCBB 3ARGA 4F57L 4OZFB 1BWMA 5IMLB 1UB5B 1WAAA 1KIPB 1R3JB 1G7HA 4MXQC 3BJ91 3QNXB 4ZUVB 2G75B 3LEYH 1NCCL 4FXGB 5D7LD 3ES6B 1ITCA 3V0WL 4BZ1L 4U49A 5EZOH 4OIAA 3T0EA 4OSUH 3EO1B 5MEND 4KV5F 1S7QA 1AE6L 3DI3B 1TENA 3CD4A 3D9AH 3J7HA 3LVEA 3L3DA 4WUUB 1VEOA 5E5UB 1YEEH 1NUFA 2CR3A 2BNRE 3IETA 2G60L 3MA9H 4ONHB 2APTA 1BBJA 3CU1A 1I85A 5ETUA 2JJTA 3VXUE 3VI3E 2RFXB 3RTQA 1S5HA 3SDCC 3WUWG 1CD0A 5FCUL 5D2NC 1DUZB 3U7WL 5ITFA 3MRKA 3PWVB 3WLWD 1JGDA 2FGZA 1C5BH 1XIWB 5DMJB 2A6IA 2OR7A 1L0YA 5HVHC 4XPFL 2PYEE 1EX0A 3BWAB 4NZDA 1G0XA 1GC1C 1CL7L 3O9WA 1MEXL 5DA0B 4IMKA 4JFQA 5FEBA 4UAOB 1SY6H 4NZUL 2DLTA 4BA8A 5I75B 1XGYL 3L3IA 1CFVL 1RUPL 4L8SA 4EVNA 1TVBB 4KVNH 4HH9A 5DJZB 3SDYL 1S7UA 2H2SC 1PJ9A 3S34L 4WEBL 4HUNB 5DGQA 2LQRA 4JG0L 4G9FB 5SX5K 1F3JA 2X70B 4WTXA 1MQKL 3STLA 4NRXB 1SBBA 5GJSH 1WGOA 1ZHNA 4PY7A 5I1JL 3NIFF 1J05B 3DMMD 1Q0YL 4P2YA 1CFTB 4TVPE 3QWQB 3QHFH 3C9NB 3LN4B 4O58L 2CLZA 2IMNA 3OR6A 5B4MC 3EBAA 4HWBH 1AO7B 4HFUH 4NUGH 4NQDD 1MFNA 5M94B 4XT1C 4UDTA 3VFVA 3UTSB 3HMXL 2J1KA 3AREB 5GGVY 3WL9A 5HHMD 3SQOH 4P2RE 1K3ZA 1ZLVH 2IH3A 1EO7A 4ODTH 4D9QD 5FYKU 1B2WH 12E8H 3FO0L 5IR1A 1NGXB 3QEQB 4R2GC 3BQUA 1GGCL 5I66B 1JZ2A 2B1HL 3WMSA 4LHUG 5J9PB 1DBML 5F7EH 5CGYC 1G9EA 1P84K 1RJLB 3L3JB 5B22A 2APFA 5GPRA 2ZSVB 3NCCB 3H42H 2WINA 2CLVB 3MTRA 4AEHL 1VB9A 5J13C 1HE7A 35C8H 2ED8A 3BP4A 1EFXD 3HG1B 4PV9A 2CKBH 1JPSH 2D9QB 3GGWB 5EUOE 2EKSA 1MFAH 2XZCH 1G7QA 3OMZA 3HKFA 3ZYZA 2YHGA 3KYKH 1EGJL 3EOAA 1YN7A 2R29L 1NDMB 2R9HD 2P8MB 4G8FA 1IC4L 2FDBP 3WHXA 5FF6A 5F7HA 3T0EE 3ZYIA 1MIEH 4MJ4A 5TE6L 5CEZD 2AS5M 4PJ8A 4OZFH 2ZUWA 1R3IL 4PD4J 2WAHA 1JGEA 1U8NA 4TSCH 4HJJH 2VXUH 4BFBD 4LDLB 2AJUH 2GQHA 1Q72L 1IM9D 5D7IF 2Z31C 1QLFA 2FCBA 4MZ2A 3NH7H 5EZJB 5KVGH 5KOMC 1YNLH 4CMMA 5F1OB 4ZAKD 5HHVL 2HJKB 3PV6B 4K8RH 2VR5A 4WFGD 4WHTB 4E41D 2WMPA 4J8RA 2KH2B 4NZRH 3MC0A 2CJUL 2CRMA 4LEOB 2IFFH 2OJZL 1WF5A 1OM3L 3O6FA 1FVEB 3PWNA 1JPST 4ZPTB 2IBBA 4LU5L 1CIUA 2WUCH 1T04B 2DAVA 2IBGA 4Z5RB 4FQLH 5JW4M 4EN3C 2OL3A 3QRFM 4F9LC 1I8IA 5I8OL 4UTBL 1QFUL 3TN0A 1A4KB 1BFVH 4MWFA 5TE4L 4K94L 1NUDA 3RWJA 4O4YH 1S78C 5AAWA 3GK8H 4NQXB 2VR9A 5KANI 3MGOB 4J6RL 1D6EA 3RWCB 3E3QC 1UH3A 4WIQA 3O3UN 4LPCA 1OGTB 2IBZY 1NFIB 4YDVB 1QVOB 1ACZA 5FUCC 3VH8G 5I1LB 1QP1A 3SDXB 1QLRB 1N26A 4NKQB 3LKNB 3BW9A 3QUML 3TO2A 3DWTA 4G8EB 4X83A 4ORZC 3WNKA 2XY2A 2NY1D 3VH8B 1F4YL 1EXUB 2FECI 1F6LL 3INUH 4S2SA 4GQPH 4C54A 1V3MA 4DW2L 2PCPA 2BOBB 3IDGA 4NCC2 2J8HA 2WIMA 1T1XA 5BS0E 1GGTA 5BOPA 3HI6H 1WVZA 4GRLC 4Y5YB 5D7LA 3W81A 3UTPE 3WXVL 3S5LG 1CTOA 2ITCA 4YX2H 4JPIB 5TPWH 3RVXC 1N8ZB 3THML 4PJXB 4DAGL 3ET9F 4HJGA 3HI1A 5FYJH 1F3DJ 1KC5L 4MS8D 5K9JH 2BC4A 3QI9C 5CSGA 1LDSA 3HS0B 3Q0HA 4S1RH 3G5XB 2XXCB 3PG2A 1I1FA 3KXFA 1CICA 1S9WB 1W72A 3F8UB 3QDMD 3EDDA 1NKOA 5GJTH 2XWTB 1AQKH 3RVVD 3TIDB 5F1NB 1PG7L 1TJGH 2APBA 1IGFL 1K5NA 4WUKL 4X6BA 5SWSA 5DURD 3ZSSA 2BVPA 3ARQA 1CIDA 2VLLA 3EJZC 3IS0X 2CDGB 1JIBA 1ES0B 2FEEI 1RK0B 1WBZA 2R2CA 3DXAD 4YK4C 1HIMH 2R1YA 3QXAB 2FZ3A 4J1UB 4OBRA 1QFWI 1XCTB 2H3NA 2I9LA 1AD9B 3S88H 2R0WL 5KN5A 5ICXA 1HH6B 2AABH 1CLZH 2FX9L 4NT6A 2VH5H 3CDGA 3OB0H 2HWZH 5T1LB 5DMGC 4WWKA 5C0BA 5IFJB 2AXGA 2H41A 4NZJA 1OGAD 2IANE 5HYIA 1LMKA 3MA7B 4QHMA 5EO0B 2YWYA 5AZ2L 4ETQB 4PJBF 4AT6B 1JE6A 4GKNA 2ADFL 4XNMA 2Q8AL 3VFTB 1FL5A 1P9MA 4YFDB 5CIPB 5JMRA 1YC8A 1I9RH 2NY6D 3VFNA 4HWEH 5FO9A 4RFNC 4ELME 1IEBA 1TZHB 3DX6A 4P5KA 2LTQB 3MRDB 4JRYA 2W92A 5E4IA 3L5WB 3BD5A 1VPOH 4YDLC 4NKMA 4XBGB 1EEYB 5LXGH 4FZ8H 3G5ZB 3NZHH 2DWDB 2AJ3A 5GRJH 3TP4A 1CFNA 1YPZA 1T4KB 3S96A 3B5HA 5HYQA 4UNUA 1NUNB 3STBA 3OQ3B 2ICCA 4U1HB 5KSVA 2XWJA 3VE0B 4MXQD 4HK0A 4N8CL 4X5LA 1QSED 4XVJL 3IDMB 4PJIF 4YE4L 1JF6A 1YEKL 5FKPB 1N6QL 5GRYA 4AG4H 1NKRA 1EV2E 1T83A 2EZ0C 3GMPB 4OLWL 5L0QC 5MEOB 5T33H 2WLZA 5DMYA 1UWEH 1BZ7A 4R8WH 3RI5K 4ZAKA 4YDKH 3KXFE 2W0KA 2XTJB 1CR9L 2CIKA 5I30H 3P77A 4QRTA 4UDUB 4EI5C 3O3DB 3UBXA 3WS6C 4RGNB 2V2TA 4NN5C 2ICES 3RIAF 5JTWA 5IV2A 4L4TD 4LLVB 4NQED 4P0DA 1CU4H 2YEZB 4MXVE 5SWSE 3CXHK 5F7UA 2X4PB 1EO5A 5T1MB 3H0TB 3MJ9A 5KW9L 2Z8SA 4LNRA 2AQ2A 1Z9MA 2BSSB 3ARUA 5H2BB 2PF6A 3B4NA 4MCZB 1Y18B 5TFSL 4Q7DA 1Q9WA 4RMVA 1WBYB 1H15B 3CPLB 4ZXBC 2VDRL 3BIAX 3WO4B 4QHKI 3OPZH 2YA1A 2H45A 2OR9H 1AGEB 3ESVF 5DD0L 3LQZA 1MJ7H 3GJEB 3TA3B 4BM7A 4YZFE 2PR4L 2HJLB 4L9LA 4EKXA 2AJXH 4U6XB 3CC5A 3LKRB 4D9RE 2Z8WC 4PRHB 3OG4B 1TVHB 5D72L 5TE7L 5C09A 1NC2B 3CSYB 3QEHA 4J3WA 5B38A 1CGSL 2PW1A 4WUUE 1S9YA 5EORH 4PGDA 2Y36L 1OHQA 4AENA 5HYJD 2WK2A 3UX9B 4YPGB 5F6IB 4HIEB 3AS1A 4OF7A 2JELH 2JE8A 4DZ8A 5C0IB 5IMMB 3TT3L 5LCVL 3HMXA 4NKOA 4JO2L 3X12A 3U7YH 3C5ZC 1SYSB 5E2WL 3IFPB 1M05A 5EB9A 2YSSA 5GRZA 4GMSH 1OP3H 4PJ9A 3T0EC 4I77L 4ODSL 4OZIF 4JFFA 1A7RH 4UUJB 1JYWA 4H88L 5CIPH 1KENL 1ZV5A 4P4KA 2OSLB 1T0MA 2E7LA 4LLYA 3IDXH 4QXWA 1I85C 4NGHL 2ITDA 5F9OL 1KTDB 1U92B 4XPBL 5JQ6H 5JZ7C 3RTQC 1A6WL 4AH2B 2NXZC 1J0HA 1GIGL 5I19L 1JPTL 3CFCH 5E2JA 3TPUA 5JW4Q 3KDMA 5FV1L 3KPRA 5I18L 4A6YA 4PP1D 4CADB 5I16A 4TTGA 4Q2ZA 5F21B 1AQDB 3RX5A 3MRCB 4V1DA 3UTSE 3B9DA 4RGOH 2QKIA 4JFPA 4I48B 4IMKC 4YZFF 3MLZL 1D5BB 4LSRH 5LWYL 2A38A 1HEZA 4JAMA 4NPYA 5GHWH 4PRBB 4KTYA 1VHPA 3IT8D 1ZHKB 4R6UA 4JB9H 3RWEA 3WDIA 2BNQA 5K9QG 1FO0L 4Z7WB 3VXTB 3O2WH 1GAFH 5K9KB 2BCKA 5GGRB 3U0TA 4WJ5A 4UTAH 2P47B 4H5SA 3VGAB 4Y16C 1EEZA 1EUUA 5JHDA 1KEML 5A3IC 2VL5A 1K8IA 1JWMB 3HC3H 1HOCA 2QADB 3HNSL 3MYJA 2AI0L 3KPLA 1JWUB 1OAYL 1DQDH 3P0VL 1UCBL 4WI2A 1RULH 2HFEB 2IALB 3BFOA 2D9CA 4E5XA 5HHOB 3QXVA 5J8OA 5IW3A 3F6LA 1QSFD 4Y1AD 2VZVA 5HGBB 1VFMA 1W0YT 2QR0A 1A02N 5L6YH 4J3SA 2FJHA 4H25A 2JB6B 4JGMA 2ADJA 4NNPL 1GGIL 4KH2A 1WK0A 3D3VA 4BKLB 1KJ3H 1G9NH 3OR7B 5EN2B 1U42A 4TQEH 2Y4SA 4JY5L 5LQBL 3ZDXE 4Y4KD 4XVUC 1G0YR 4DWHA 3GSWB 3N1FC 3RY5A 4ODHH 5TH2A 5D8JL 4CVXB 1WFNA 3TM6A 4FQHA 1WSST 2F5AH 4MQXC 4DK6A 4HEPG 1IGTB 1A6VL 3PWPD 5IB2B 2DD8L 4GBXB 3JWDL 3LB6C 3QUMA 4JFFE 3AMKA 2J8UF 4JQIL 2R1XB 4LOUD 3IXTB 3BJLA 3PDDA 5EIQA 1EO8H 4XVTL 5E7FA 4Z76A 3E6FA 3HTLX 1JZ5A 3B9VA 4RWHA 3DUUB 2E9IA 2RB8A 5FIEA 1FRGL 1KG0B 2YPLB 1TZIB 3U0PA 2ICWJ 2IPUG 5IB1B 3H9ZA 3GSUB 3IF1B 1YUHA 5KANG 3WFBL 3CSBA 2YRLA 1FFPA 3IJSA 5L8KB 4OLVH 5KSAA 4WU5A 5ADOL 4TUJA 3S8WA 4UI2A 4IRJA 3QIWB 4H0HB 4TVPL 4BK5A 4HKBB 1H8NA 4UQ2B 5L8LB 1PDKA 3QUYC 2NXYB 2AV1B 2O26U 3L3KB 3N85L 3PGCA 3SDXE 2E9JA 2YUVA 4ZFOB 4JRXD 2Q87A 3OAYH 4IHOA 1TXKA 1FNFA 4YO0B 4N0YH 1WFOA 3EYOB 4JPKH 3AS0A 4GG6A 2BNQE 1A9BA 3BE1H 3OKKA 3CXDL 3TN0C 5J6HB 3X3GL 3X13B 3EO9L 2EIZB 1UKSA 2GITB 4F7MB 4HT1L 1X5AA 5E1AB 3C09B 1J1XL 2PXYA 4ONFL 3VXNB 1MHEA 1F02I 4LPTA 4H1LA 4G8IA 3VXRA 4N1EA 5DD1L 2R0ZH 4PJXE 1FFNB 3L6FA 4PJFF 3WSQL 3HFML 4RBPK 4Z18A 5JIPA 4NN7B 4IJ3C 5E8OB 4KKLD 3RVTD 2FLBT 5FGCB 3FL7A 1T1WA 2ZOLB 1F11B 5ANMB 4PJAA 5TGBB 4ALAH 1KGCD 1A6AB 2VSDA 3NZ8A 4J3UA 1NMBL 2BJML 4KFZC 5DMGD 2XNAA 1LO3L 4JANA 5L88H 4YEFA 2DQEL 4LSSH 2GCYB 4P59H 1OWRM 4OD3H 1PGRB 1ETZA 1XZ0A 3WO3B 1Q9KB 2X44D 3QCTH 3IXAB 5F8RC 3V7AG 3K8KA 3WNNA 3DSFH 3BP6B 2MKWA 3CJJA 4H26B 1JRHH 3M1BB 5HYSA 4M1GH 3OJDB 5AG9A 1K2DB 1Q94A 3ARDC 5C7XH 4F33A 5DJ8A 3PGDA 2X4RB 3ULSB 1HSBB 43C9A 2IH1B 3BPLB 3T2NH 1CDIA 1R5IB 5C0RL 3JBG7 1UXSB 3N1MC 4POYA 4PJEB 3CZFA 4OI7A 1IC7H 4WRLA 4Z0BL 4UILH 2EXYD 2P8PA 1IAII 3BEVA 3LS4L 5GRVK 1KN2H 4J3TA 3A6OA 2R8SL 2CGRH 2CRIA 4MAYA 3G6DL 5I1DA 1XR8B 1BF8A 1BPVA 1NGQH 4X9HA 4GXVL 3C8HA 4JFHE 4XMLH 4JDTL 2DLFH 3KS0J 4MDIA 2ICEA 4YHIB 5DGRA 3V4VL 1CICC 3O45B 4J7RA 2BHZA 3VI4E 1XAUA 3RDTD 3X11B 5BZDB 1KCSL 3VXUD 3FQRB 3I3DA 4ODVL 1DSFL 3I50H 2DQCL 4P9MH 4GJTB 5AYUH 3NFNA 4XNYL 2HMID 1UENA 4XAKE 5ESAB 1DEEB 5TQ2L 3VD5A 4XP4H 2OXHA 2PYED 3SOBH 4X6CA 4P2OA 4GKZB 2PUQT 2Y06H 3C60B 3D25A 4U0QB 1YMMB 4OGYH 4UOW0 1QFOA 1TETH 1KIQA 3QHZL 4N8VA 4NO3A 5MEQA 2PO6D 4EI5D 1RUKL 2HAZA 1U36A 3MRMB 3UZQA 4N0FB 1JF5A 3U0WH 4XWGL 3HPJB 1MNUH 3LDBB 3JWOH 4TVPD 1UA6L 3EOYG 3KHQA 4PY8J 1HQ4A 4X9BA 1OAQH 1RFDH 3GIVA 3NFSH 1X5LA 4KJYA 2ADIB 4Y8DC 5EOCL 3VWJA 1XMWA 1P5VA 4XCNA 3VXRE 4PJGA 1P9MC 4KQ4H 1B0RB 5JW4N 1C7SA 5DO2C 3FB7A 4FFZH 1INEL 5F3HA 4RAHA 4Z7UB 5CBAA 1MLCB 5DK3A 3FB8B 4KUZH 4X4MA 5KSBF 1P5UA 3SKOB 1IJ9A 1KJMB 2DI8A 3QIUA 3LSOB 3T0WA 1AFVH 1EMTL 2ZCLH 3CSPA 1NEZG 4GW5B 3TWCL 3S37X 1ZT1B 4RAVB 2R4RH 4LVHB 4UAOC 1FORL 1CT8B 4JM4L 1HK6A 2XTJE 5I75C 3ARBA 4Y5XA 3VXSA 1CS6A 1LD9B 3WDJA 3BKMH 4MD5A 2VLRD 1QOKA 1B3JA 8FABA 1NBVH 1FFOA 2L7JA 1BHGA 3C5ZD 2BSRB 4P5MB 1X44A 2CSPA 3BPOB 3MRLA 3SCMA 2EDDA 3LEYL 3GIZH 4I9WE 1V7NH 5D1XB 1AP2B 2GW5A 1JZ6A 4X0KB 5EZOL 3O2DA 1T83C 4OSUL 5D7SH 5JOEA 3QAZB 3AREC 3IU3A 3I3EA 4KGJA 3D9AL 5E5MB 4MDJB 4Q0XH 2EC9U 2RGSA 3MREB 4GG8B 5JPMB 1YEEL 3GSNH 3UPAA 2XG5A 3W9DB 5B3JE 4PRHE 3I3BA 4WI5A 3MA9L 3B9KB 3ARXA 3EFFB 3IDYB 1PX3A 3MV9D 4UMGA 1AIFA 4I4WB 4WW2A 1QRNA 1BZQK 1JV5B 2G9HB 2CH8A 4KUCF 4I0PB 2O61A 4FTVD 3ZE1F 1FHGA 1LO2H 3U48A 2ZUTA 5J4MA 1JZ3A 4X6CE 1C5BL 5KVDH 1MCRA 1QFWH 3ARTA 2A9MH 5E6IA 2YPKA 4QWWC 1D7FA 1CDBA 2EIBA 3GM0A 1BWWA 4WCYH 3SDAB 5CLTA 3QPXH 5IK3A 4KVNL 4TOYH 3IKCA 1F90H 1WWAX 3EZJB 1DFBH 2H32A 3DNKA 3LKOA 2AJZB 3GB7A 4Y16D 3QHFL 1MFEH 1D5MB 3CFJB 4K3HA 2DQIH 4FRWA 2VXVH 1P4IH 1AH1A 4HWBL 1CGYA 1KJ2B 4HFUL 4NUGL 4X9FA 2ORBH 4WFHE 3O41A 4XCEB 1BX2B 3V6BR 5HPOA 3SQOL 4JN2B 5ISZD 4ODTL 3KPPB 1UG9A 1B2WL 12E8L 1HKLH 1DLHA 5DMKA 3ULUC 3UYPA 4PJ9C 2K9UA 1BBDH 1N3NB 4MB3A 5BCAA 5EU3A 5F7EL 1J87A 5GRXG 5BS0D 3AROA 4F7CB 2YUZA 3QUKB 4P48A 1FNGA 3H42L 3UTPD 1EAJA 4PG2C 3LCYA 1FYHB 5DQJB 4XVUD 3VXSE 3WS3A 5GS2H 3DO7B 2VIRA 2CKBL 1JPSL 3QWRA 2YD9A 4Z7WE 2BNUA 3O0RH 4HD9A 5HD8C 5SWQB 1MFAL 1CVSC 2F8VA 4PB9H 4MQXD 2XZCL 4LCWD 4PREB 3OXSA 3KYKL 5FGRA 2I9TB 4Y4FB 5ID1A 4KKBD 4TVSa 1J0KA 4B5EA 3B2VH 3QNZB 3RDTA 2UWEB 2HKFH 3K4DA 1XR9A 4LCIH 5DJCA 3SE9H 1MIEL 3KYAA 3QJFA 3DRTA 4EUPB 4AZ8A 1DN2A 2MHAB 3C6LD 1QBLH 3CH1A 4OB5L 4KU1A 4PP2B 2VNCA 4HJJL 2VXUL 2E7CA 1IM3A 3HNTH 2AJUL 2EC9T 5D1ZB 5I1EH 3H3BC 4XP9H 4LKCA 2B4CH 1TTGA 2UVFA 1F00I 3QUXA 3NH7L 4G5ZH 4OT1H 4D0BB 5KVGL 1YNLL 1UYWH 4LPWA 4NSKB 3UYOD 2VDQH 1N59A 3AU1B 4XVSL 4K8RL 1ZVHA 4LVEA 3QUYD 4NZRL 3TNNA 3LQAC 2IFFL 1NL0H 3AAZB 5D7IA 3TFKC 4EQ3A 4EDXB 1EAPA 2GSIB 3SPVA 5GGQH 2WUCL 4LASL 1VGKB 2EDFA 1EFQA 4FQLL 3TBYA 2XN9B 4YXLH 5D6CA 4L4VB 3WIFA 2EXWD 4OUUA 1QSZA 1BFVL 1MCSA 2DDQH 4HKZA 2IAND 3RHWK 3SGDH 3TVMD 1F58L 5DFWH 4JKKA 3KPOB 3MR9A 5IKCA 1OY3B 25C8H 1AHWA 3GK8L 4DZBB 4R26H 2KBGA 5DI8A 4BSWA 4MHHI 4NJ9H 1KB5B 5FM5O 2VITA 4IRSB 5DD6B 3JV6A 3VFRB 5DVOA 3ZKMC 1RZJH 2R2HB 1BQHB 1KOAA 5CWSB 43CAA 3MRNB 4JQVA 4Y2OA 3BZEA 1A21A 1F8TH 3TT1H 4XPGH 5BVJB 2JIXB 5C6PB 3INUL 5IWLA 3QULB 2VLRA 1TCMA 3EJYC 4EBQH 1A6TA 1NUGA 1KJ2H 1FLRH 1ZGLP 5EDXA 2XXMB 3AB0C 3CFKA 1LE5A 2AEWA 4OI9A 3ARDD 3GMQB 3HI6L 1F4WH 4RFEA 3VGFA 4U6YB 4RISH 5SV3A 4YX2L 1RURH 4PUBH 5TPWL 1I7ZA 1VACB 4M6NL 4Y19D 1HHHA 2YRPA 4QRPD 2L7UA 1MJJB 1KIRB 4R0LA 4HIIA 1FIEA 5KSAC 5FYJL 4LVNC 5ESQA 1RZFH 4IRJC 5C3LD 2GTZB 2X4QA 1I7RA 1SJXA 4GQ9H 4ZO8A 1UGNA 3FONB 3S3SA 5K9JL 2D7TH 3MJ8A 4ODBD 4O9HH 4G6JH 1OSZA 2WBKA 3FKUS 1IZKA 4HLZG 3ZE2E 3IDNB 1IGCH 4S1RL 1L4IA 5F88B 1MCBA 5FGCE 2LTQC 5CUSH 5ANME 1FNSH 4WFFE 5GJTL 3CUPA 1TJGL 2G5RA 2J5LB 3PL6D 3FQNA 1J1PH 2HT4D 1RIVH 2WV3A 4EUPH 2A6KB 5EIIB 3CVIH 4KROB 4OKDA 1RQ5A 3QFDB 4KDVA 4KTEH 4OZHB 1TTUA 3TCLA 3TLRA 1G7LB 4XTRC 3BDXA 3MCKB 1HIML 4NC1C 1NFDF 5FCSH 4ZMAT 2HJFA 2IFGA 2OMBA 4U1MA 1NCTA 3GSXA 4PJEE 2X05A 4X6FA 3S88L 4ZSOB 4JREC 1I9IH 3QO0B 3RP1A 2AABL 1CLZL 3R1GH 2FEDD 2VH5L 3BIKA 2AQ3A 2HWZL 2I25N 3MRBB 4K8RD 4WUUD 4ZOCA 1GPOH 2BY1A 2FO4A 4LPVA 1CDGA 5ISZA 5F6HJ 4QRQA 2ZUUA 3H9YA 4M03A 1NGPH 2XTJC 3EJJX 3TZVB 3WFHB 1J0YA 4ODWB 1IL1B 4FQ2H 4YHKH 3KLAB 4KK5C 3SE4A 1IC1A 2BHYA 4MQ7A 2VAJA 4N5EC 4P2QA 2NZ9D 4WHDA 1MFDH 2R56H 2LU7A 4HWEL 4NNYA 3V6FB 3RNQB 4O2CB 2WNGA 4LLMB 3TJHD 3VFMB 4YIQB 3LKQA 1XIWD 4I3SH 5IFHH 3UTTB 5E94A 2YN5A 4PJBA 4Z78A 1I1AB 3NOIA 5L2JB 3OKMB 2E6JA 1JNJA 2R4SL 1M4KA 4NBXB 2VRAA 3MLTA 2UY7A 3NIDF 1VPOL 2Z4QA 1ZK9A 2NYYC 5E08H 3TIEB 4HWZA 1KB5H 5IEHA 4MMXC 5D7JA 3VGBA 3QIBA 4C58B 5LXGL 3PWJA 4L3CA 3ILPA 3NZHL 4G9FD 1UQSA 5GRJL 3G5VB 2RCSH 4IDJH 3SE3A 3O3BB 4E42A 1SBSH 3LPGA 4WDIB 2VISA 2JLLA 2SEBB 4QT5B 4AMKH 5C0GB 4XCYB 4PJDA 3MV8A 4Z7NE 1YEJH 1AO7D 4RGMB 1YDPA 4P2OC 4X7CC 1I1YB 1K8DA 4NC2B 4AG4L 5F6IC 1X5FA 1IGMH 4PJEF 3D0VA 5EIVA 1FC2D 5T33L 4Z7UE 5HYFA 4R8WL 3MO1A 4YDKL 1BFTA 4Q9RH 1QR1B 3PDOA 4PJIA 3QEQD 3KWWB 5I30L 4GH7B 4G80A 5FYJD 6FABH 4L8DB 3X14B 5ILTH 1AR1D 1RI8A 4JVWA 4RAUA 1F97A 1CU4L 3P40A 4U6HA 4QRSB 2Y23A 4XRCB 3HG1D 5FDYA 3VWJC 1UACH 2FBOJ 2E6QA 1E0OB 4PR5A 2DQGH 3HN3A 3O3AA 1KLUB 3CFEA 4HLZH 3OPZL 1JK8B 2OR9L 1VFAA 1MJ7L 4GAFB 3F7QA 1WC7A 2C3GA 2QQKH