2XNAA

Crystal structure of the complex between human t cell receptor and staphylococcal enterotoxin
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
199
structure length
199
Chain Sequence
QLLEQSPQFLSIQEGENLTVYCNSSSVFSSLQWYRQEPGEGPVLLVTVVTGGEVKKLKRLTFQFGDARKDSSLHITAAQPGDTGLYLCAGAGSQGNLIFGKGTKLSVKPNIQNPDPAVYQLRDSKSSDKSVCLFTDFDSQTNVSQSKDSDVYITDKCVLDMRSMDFKSNSAVAWSNKSDFACANAFNNSIIPEDTFFPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords T CELL RECEPTOR ALPHA CHAIN C REGION
publication title The Structure of Superantigen Complexed with Tcr and Mhc Reveals Novel Insights Into Superantigenic T Cell Activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 37
structure length 199
sequence length 199
ec nomenclature
pdb deposition date 2010-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09291 DUF1968 Domain of unknown function (DUF1968)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xnaA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xnaA02
3TO2B 1KV3A 2PYFA 4WI9A 2WWMD 3LH2L 4P4RA 4TUJB 4WGVB 1KCRL 1MRFH 4PRHD 3O81A 1ADQL 3IDYB 1J7VR 2Q7YA 4WI2A 3V6BR 1V5JA 4PGDA 2GHWB 1D6VL 4P3WA 1WWWX 1OAQH 5D2NA 2GCYA 4G6JL 4FQJH 5A2LH 5IMKB 2FB4L 4P2QD 3QFDB 5ITBH 2EXWD 3NH7H 2GJ6B 5JW3H 1KC5L 1CLCA 1W8OA 4LCUB 3D18A 4LKCB 4MDIA 1H3WM 3RX7A 5A16A 2A73A 1ACYH 2ORBL 2HFGH 2OR7A 3VD3A 2GT9A 1TZGL 2HKHL 4JQIH 1J87A 2OL3A 4KZDL 2CKNA 4GW5B 5TPWH 3U1SH 2AEQL 4LEXH 3ZL4H 3MUY1 4PRHB 4FZEH 4PV9B 1KXQE 4R0LC 4GSDH 5M94B 4QCIA 3MZGB 5I8CB 1HHHB 4G42B 4O9HL 4HUMB 2F74B 3NIGE 3REVB 1X3DA 3ULUD 1BZ7A 1F6AA 3RUGF 5C0DB 1T2QH 4BKLB 3LKRA 2JB5L 3O11B 3IU3A 1DBMH 4P2QB 2A6JB 3KLHD 3BISA 3B9KA 1GIGH 5HYEA 5FM4A 2WIIA 1JNNL 2FJHB 3NCJH 1P5VA 1BQLH 2XPGA 4U1GC 3MNZA 2JJVA 5B39A 3K0WA 5DDHB 3STZA 3IJHA 2DLGA 3EOAB 2Q8BL 4KVNH 1UWEH 1C08B 5LG1A 5JHDD 4Z7UA 3OKNA 4UOJA 2R0LL 3D9AL 5TDPA 5KG9A 1MREL 4ZTPH 3S34L 4KV5F 5DMKB 1RMFL 5KVFL 3GEWB 3B2VH 3KYNA 5BRZA 1IAKB 5IMMB 4NRYA 2UUDH 4S10A 4J7RA 2EO1A 3T0VA 5C9JA 4OLZL 4CW1A 4EBQL 3WJLC 1J18A 1YYMH 3OGOE 4UTBH 1OW0C 1NUGA 3EO1B 3LPFA 2EDWA 3IDUA 5C7XL 2E9BA 3NFSL 3WFCL 5IBLD 5CZKA 2GAZA 1FYTD 2ARJA 4NN5B 1BMGA 1T0NB 5JHDB 4LCYB 3GSUA 3IFLH 4PJXE 1RJCA 4Z7VA 3LN4B 1F11A 5F6HI 1FVEA 3CZFB 4XCNB 4YNYA 1FE8H 3HHRB 2FD6L 1YY8A 3JTSB 1RZKC 2VDOH 3BDBA 3R1GH 5D2LE 4G8FB 3ARZA 4GG6A 2VLRD 3V6OA 4DGIL 4K3JH 4OZ4A 1A22B 2OXGA 4XH2B 4OZIA 1L0YA 2XZAH 4PRPD 4K7PY 2D7TH 4LOUD 4CN6A 3C6LD 2VDNL 2IBGA 4NKOA 1FLRH 1VADA 3LIZL 1PSKH 4APQA 2YR3A 3I84A 1FYTB 2RIKA 4PPTA 1EPFA 5BQ7A 2W65A 4LLDA 4U4BA 2VZUA 1RZ8A 3ARUA 3UDWC 5BJTA 2FHBA 1V7NL 3MX0A 5I1GH 5JDJA 1A7QH 3IJYB 4HIIB 5E2UH 1ZEAH 2VLRB 1MJJA 1CE1L 3DV6B 3FB5B 1WCBA 3ARFD 4GKNA 4LQFH 1M6OA 5CLWA 1UM6H 1F4WH 4PRPB 5E56A 5IK3B 4JFPB 5IB3B 4BELD 2EDDA 4F7EB 4KY1L 1RZ7H 3KNBB 2VDRH 1AXTL 5IW6A 4NPYB 5DJDA 3C6LB 3FO9B 5F7UA 1F5WA 2KZ1B 1HH9A 2FLBT 5EA0H 2DM3A 2B4CH 1AO7A 3WXVL 4G5ZH 1T20B 1YPZE 2BNUA 1OAUH 5DR5L 2W9EH 3VXTA 3QHFH 3EOYG 3LPWA 2VXUL 1FV1A 3IGAB 4QXGH 1Y6KR 1QYGH 2O26U 2A83B 1T80A 4PP2A 1TQBB 5FFLA 1MQ8A 2APFA 5D1QC 1A6WL 3SDXE 3SE3C 1E4KA 1JYWA 5D93C 3IDNA 3AUVA 3CFCH 3ARFB 4QHUA 3QO0B 3FQTB 4MJIA 3WFBH 3N9GL 5HDLA 4O2FB 3KWWB 4YFLF 4D94A 1S7QA 5HYJD 3IAPA 1MLBA 3O4LD 5TQ0L 1WFUA 3GMRB 4OV5A 2NY1D 5C0CD 2E9WA 5ICYA 2AJZB 5B38B 1CDCA 1I1YA 2KDGA 3ULSB 1LO2H 3B5GA 3Q2CA 3R06A 3BX7C 1KJ3H 3O4OB 1NBZB 3PDGA 4X8JA 5FUZL 4K3DL 4U0QB 3LS5L 4KAQH 4UB0H 5F1IA 3U46A 2APBA 1SJHA 3D2UD 2Q86A 1F42A 2EIZB 4X7TB 5CHNB 1T5XB 5GGVH 5H35A 5D9SB 4PJBF 5EBLA 5B8CB 1NCCL 5B39G 3FT4A 3MJ7B 1EJ6A 3DIFA 4M7KL 3LRSB 5D8JL 5HYJB 5ENWA 5HHOD 1ZA3A 4JZNB 3WKNA 2QL1A 3O4LB 2R4RL 2JK5A 5HXMA 2VLMD 5C0CB 4RGNE 1AI1H 5I1IH 2Y7QB 2CRIA 1OWWA 4AEIL 5IQ9B 3ZYZA 1MI5A 3EJZC 3CMOL 1RAMA 5DEFB 1FZKA 3RZCD 1G7IA 4LF3B 4YLQT 2FATL 2EYSB 5T1KB 3CMGA 1FGNH 4ZYKB 5D1ZA 1BLNA 3D2UB 3KPLA 2GTZA 1MRDL 3L9RA 4UV4H 3E6HA 4XMPL 1YYLL 4GAGH 1ZGLB 1KXTB 2C4FU 3ULVC 1E6OL 1UM4H 2B2XH 4XP9H 5CMAA 2Y06L 4HCRL 4M8VA 3LKNB 1HE7A 4I5BA 3KPRA 4WHTB 4HKBB 1CFNA 4X5XB 4YUEH 3WFEH 2NW2A 2DJUA 5L88H 3OX8B 1RUPH 4HH9A 4X99B 1I3GH 4JFYB 2AJYL 5LKNA 1NJ9B 3RZCB 1UVQA 1FPTL 4QRQA 5CJ8A 3RL2A 4HBCL 2G60L 1FAKT 4DKFL 5F7FA 4N0FB 4ERSH 2WNGA 4CN4A 1Q9KA 1DANU 5ESAB 2DB8A 4K9EH 4WW2F 3MV7A 3QNXB 3BOVA 3HG1D 2MCPH 4KJQC 1I3UA 3I50L 2I07B 4ODSH 4PGCA 2DYPD 3LN5B 4N0CC 5J57B 4JFXB 1J5OH 3V2AR 3BH8B 3HRPA 3DROB 3FFCD 3G6DH 4L4VD 2DQDH 1RFDH 3VXOA 1Q72L 2G9HA 3QAZC 3RAJL 1JGVL 3DURA 3P4NB 5J12C 4U1NA 2ZCHH 3UTSD 5HYQB 2IANA 5CEZH 1T1YA 4NM4H 4X6CA 4JHWH 5KAQG 2CLVB 4OKVB 2FEEL 4G9FA 5C0EA 1J1OL 1QRKA 4QYOA 1FC1A 1T0PB 3VG0H 3KPOB 3GI9L 3MLXL 1LO5A 5FV1L 2F5AH 3HG1B 5FA4B 2VZVA 2HJLB 2ZCLL 2DYPB 4NJ9H 2CLZA 3IDXL 5C0AA 3PV6A 2R15A 2XXCB 2CJUL 1JGUH 3FFCB 3BXNA 1MCEA 4L4VB 4ZODA 5C0RL 4HPYL 3T4YA 1KCSH 1QBAA 1KENL 5FGCB 5JIHA 3X14B 3UTSB 2H6PB 3GO1H 3K1DA 5D7LD 3SQOH 4YX2L 3S7GA 4N0YH 2E7BA 4FABH 2FWOB 1EHLL 1CXLA 1A6AA 1CE6B 4PD4K 1PX4A 1X5YA 1INDH 5E9DA 3VFPB 5ANMB 4DZBB 1RU9H 4GS7B 4BZ1L 5J4MA 3U4BH 9CGTA 2LQRA 3V8CA 4WWID 4MHHG 3BPLC 2PTTA 4YBHA 5F9AC 3TZVA 4DGVH 4Q7DA 3KPNA 4FQ2H 1N64H 5BVPH 1V05A 3SDAD 4O5LL 3MUJA 1JBJA 2HKFH 2MMXA 4M02A 1JHTA 5D7LB 1H15B 2EDHA 1H0DA 3H9YA 1VFAB 4JKPL 1E4JA 1EV2E 3BGFB 4LSVH 1F3DJ 5IB5B 3GMPA 3U7WH 4NBXB 3PL6A 3QO1A 2PYEE 3VDBA 3B8YA 1QFHA 1WC7A 3MUHL 1F4XL 1ZMYA 3ULUL 5EC1A 5HDOA 5BV7B 3GMQB 1HQ4A 1HHGB 2ZOLA 3CC5A 4KFZC 2C3XA 1UM5H 5KJRH 2VLKB 1KFAL 1D5IL 1J0HA 3ZDXF 1MEXH 2IMNA 4CADA 5FUOL 4OZGA 3SDAB 1EZVX 1YNLL 4RMVA 3MTRA 5EPMA 3RVUD 1GZPA 1IGIH 3NCMA 3QISA 3RWFB 5MEOB 4ZFFB 5T1DH 3HLAA 4JFHE 4K71B 5EZIL 1T83C 4NDMB 4LDLB 4XPBH 4NQCE 4U6YA 3DVGA 5SWZA 5GS0H 4N1CA 2QKIB 4HX1B 3MLPA 4NZTL 1B6UA 4L3EA 1T22B 4GBXA 3MRHA 1ZGLP 3IDMA 4MA8L 4A6YH 1NCWH 1MFAH 3MA7B 2R1WA 5JXED 2WW8A 5E00B 1RZFL 1U3HC 4AK1A 1B6DA 1YECH 5DRWA 4PG9A 5EBWB 2OZ4L 4BK5A 2BVUA 4S1DD 4KI1A 5LGJA 3CVHH 4P5KA 2EDFA 4D0CA 4Z76A 4WY7L 1PQZB 4MQ7B 2QQNL 4KHXL 2B1AL 1MFCL 1JGDB 3BZ4B 3QXUA 1IQWL 1WEJH 3VXQB 5MEND 4EIGB 2OCFD 3A6CH 2X1XR 2BVOA 3RWEB 5EIIB 3HPLA 5JOFA 1IAIH 2IAMD 1BP3B 1CFVH 3T0EC 1ZT7A 3EW3B 5D7JA 5I74C 5KSBE 3WDHA 1Z2KA 2FEEI 3BZFB 1G7HA 1H3VA 4F9LA 4MZ3A 4JLRA 3QUXC 5ALCL 5E6IA 1CWVA 4OI8A 5TE4L 1U92A 4LEOB 5I30H 1I1CA 4S0TD 2VL4A 5KBNC 1X4XA 5DTFB 3KYOB 1T4KB 4QT5B 1JUFA 5E08L 2C26A 1B0RA 1U8PB 1ZVHA 4TRPL 2PETA 3DO7A 2Q6WA 4QXUH 3NA9H 1M71A 5MENB 4LL9A 2AKRA 4KRNA 4LLMB 1NFIA 4FXGB 1FZJA 4ONGH 2IAMB 4LCIH 2MCG1 5ID1A 1WWCA 1MFNA 2WZPD 4E5XB 2XZQL 3WO3B 1WLHA 2CKBB 4LVNB 2BC4B 2ZCKH 3QI9A 3QG6A 5IGXL 3RKPA 1AGFA 5E2VL 1K4DA 3EAKA 1H3XA 4ZS7L 1OP5H 4R4ND 2QR0A 3P4OB 4MNQE 3INUH 4U3XA 3O8XA 2V2WA 5E7BA 4G6KL 1G9EA 4ODWB 1N59B 4OI9A 5CEYA 4QRSB 2C4FT 4ISVB 5AUMA 3QP3A 5T3XH 4PRBA 1MJUH 5DJAB 2Q8AL 1KTDA 1WVZA 1YY9D 1BZQK 3BYTA 4HV8B 2RJMA 5IR1B 1VCAA 4YQXL 1G0YR 3QJFB 4XCCL 5CSBA 1D5XB 4R4FL 4F2MA 3BEVB 3MRLB 2XG4A 4QTIL 5J6HB 3MXWH 4GXUN 2FIKB 3H0TB 3UYRH 4I0PD 2CIIA 3BT2L 4PJGB 5IVXF 1DFBL 2X1QA 4H88L 1FVCB 4ONOA 4LGPB 4ODHH 3GJEB 3ZDZF 3WNMA 1MCPL 3PDDA 1JGEB 2YK1L 4ZDHA 1I9EA 1RZJC 3D0LB 5TE6L 5CJQH 1OSZB 1AGCB 1W72H 2LTQC 3BDYL 4R2GD 1OTUC 4YBQD 3RU8L 3L6FA 4JY6A 1WBZA 3UTZA 5IOPB 3ME0A 2BRRH 1QSFB 1CG9B 4LMQE 3QBTB 5DRZA 5ICXB 1CGWA 1DQQB 2BY1A 3JWDH 3S96A 3F62A 4HIEA 2YPVH 1P84J 5DVNA 4MWFA 1G1CA 1FFPA 4PJXA 4OCMC 4I0PB 4OLXH 4R4BA 1JP5A 2AV7B 4ZXBA 5IFAL 3EDDA 3MYJA 5DHYB 2A38A 4BQ6A 1FBIH 2A6KA 4JM2F 5D2LA 2XICA 1TPXB 3JVGA 4FG6C 5D5ME 3SY0B 3U48A 3BKJL 3BHBA 2HT3D 4P9HC 4X7FC 2VXQH 1BBDH 1AFVH 3QUMB 4LMQI 4QHKJ 4HK3J 2AJ3A 3R0NA 1KTLA 4R2GB 4Z7WF 1LVEA 5C6PB 3PWUB 1DDHA 3RUGB 2JJSC 4JQXC 4RGMC 4D9RD 4ZQKB 2E6PA 5I0ZA 3IJSA 3T1WA 2VH5H 4W4OA 1NBYB 4YXHH 5ACZB 3PWPA 2OL3H 4ZUUB 1ADQA 4OSUL 3RDTC 1PYWA 4WENB 3F7YB 3MACL 15C8L 5F7WC 1LP9B 2W60A 2A77H 3LKPB 5GS1A 1FL5A 3BKMH 3DRTA 2WBJB 4D3CL 4PJFB 1N6VA 1OGAE 1WV7T 3TF7C 1OM3L 5FGRA 2XTLA 1IGFL 3MCG1 4PJ7E 5JQHC 1YPZA 3ILQC 3B2UC 1CGXA 2EEAA 3C5ZD 4HAGA 4LRNH 5F7DB 3LEVL 4U0RC 4QHLB 4GLRH 1T89C 4AG4H 5F21B 4OGAD 1I8LC 5DD5H 4YDVB 4I4WB 1JL8A 5TGBB 2D7QA 4OB5H 5BMFH 2BSTB 1HIML 4JG0L 5T3ZD 4QO1A 4QY8A 1TZIB 4BH8A 1EZVY 3CH1A 4I77H 2F8OA 1UENA 4CVXA 2FX8L 4OFKA 5CSGA 1Y6MR 5ADOH 3GSQB 3NFPA 1N8ZA 3E1F1 4G9DA 3VXRE 5KN5A 1TDQA 3MRMA 3W39B 2VN7A 2P8MB 1GAFH 5L2JB 3HPJA 1NUDA 3SGKA 1Z0NA 5C8JA 3G6JB 2HWZL 3DUSB 3MBEB 3SKNB 3C08H 3QEUA 1NCAH 4RCAA 4N0UE 3C5ZB 4XBPA 1KB5B 5DMIH 3V6FB 3MV8D 4NO0D 3FCTA 3I6GB 1U8IA 2LVEA 4LLVB 1MH5A 3T0BA 3DRQA 1NDMA 3FO0L 5B21A 1AHWA 1C16A 1KNOB 2J5LB 4Z78A 4PJ9D 1JV5A 3SKJL 1IKNA 5D96B 2VC2L 3BH9A 2IADB 1QD0A 4FFVD 5I8OH 3QQ3A 1AR1D 4MJ4A 2AJXL 3QDMD 5F1NA 1FLTX 5EUOB 2BHYA 2FHCA 1XIWD 2O5XH 5GRUL 4RWYL 3T1FB 4HFUH 5KS9F 3MR9B 3MRPA 4MB3A 4Z6AT 2Y9RT 4WNQA 1S8DB 3MV8B 2ZZUT 4GRWB 4NO0B 1MCSA 2HTLC 2LE9A 3TBYA 5ILTH 3MRFA 5BV7L 2NY2C 4R90L 2JKXA 1VFOA 5I8KL 2CK0L 5EBMA 3X3FL 2HLAB 4X9IA 1EGJL 1XF2A 4UQ2B 4KKAC 1ZA6A 2C7UB 4PJ9B 5GXBB 2P1YA 1OY3B 3NACH 4KXZI 5DMJB 5I1EL 1BVKB 5IW1A 3S88H 3IU4H 1S9VB 3C87A 3KDMA 4I3GA 3RZWA 3S9DB 4ZPTB 3OKMA 4HGWB 1NBVH 4V2BA 2FH6A 3QDMB 2X4RA 1EHXA 5JXAH 4HBQA 1XIWB 1WCQA 3T2NH 1WF5A 2NY3D 1D5ZA 3V0VB 4C56E 6CGTA 5IFHL 5CJXC 7FABH 1EEZB 3B6SA 1QPPA 4C83A 3QWRA 1MIMH 2EXWC 3MLWL 2Z8VC 4NM8L 3MJ9L 3KPSD 3PWNB 3MCLL 4LSQH 3DGCR 4L9LA 3QULA 3WLBB 4XWOD 2FL5A 3V79C 4EUPA 4R7NA 4HPOH 1I8MA 4OLWH 3AMKA 5SV3A 1KCLA 4NWUH 4JFQB 4LHUA 1UCBH 4ZD3L 4O2EB 4JZOB 2C1OA 1AJ7L 3TNMA 1OT1A 1KPRA 1MCBA 4X8XA 2AEPH 2NY3B 1PG7L 3HI1A 4XBEL 2IQAA 1R3IH 2JTDA 4OLVH 1MFEL 5JPNA 2QHLA 2IQ9L 32C2A 4NRXB 4Y16A 3KLHC 2JIXD 4FNLH 2DF3A 4PRDA 4C4KO 1IGCH 4KK8D 4MD0B 3KPSB 4UNUA 3TV3H 4PJBB 1YEEH 3WCYA 3FQWA 2MJWA 1UA6H 5C2BL 3QEGL 4IMLA 4RA0C 4K3EH 1NMAH 4J23A 4MD4B 2H3NB 4RWHA 1Q38A 3QFJE 4L8SA 4KMLB 2P8PB 1FNLA 1A6VL 4DZ8B 4NUGL 1OAZL 4H26A 1IM3A 2JIXB 1BFVH 4ZNCD 3ZLQC 4YHOL 3HUJF 3BIKB 4X0KA 3ZTNH 4KC3B 4NN7C 5DO2C 5GISL 3B9EA 4ZAKD 1SJEB 2H1PH 4P46C 3P9WB 2AK1H 3M8OL 5IWLA 3D25B 2XFXA 4NGHH 3BVNB 1FNGA 3WE6A 5IBLC 3UC0L 1CIUA 3NAAL 1LO3H 4MSWB 4XPHL 3GBNH 1YEIL 4IOFD 1L7TH 4JCMA 5HI4C 1QQDA 2DQEL 3ROLB 5JOPE 2MPAL 3MBXL 4HQQH 4QXTB 4LSSL 1Y0LB 1TZHB 5DJXA 1K5NA 5FCUH 1CFQB 3MV11 3IF1A 4NC1C 2DQTL 4ZPVB 5KW9H 2YZ8A 3D5OF 3E2HB 4M61A 1CXEA 2FEDD 3TBTB 1WICA 2CUIA 1MF2H 2L4OA 4PJIB 4R8WH 5FYLD 4BM7A 1HHJB 3RY5A 2VZSA 4PY7A 5E2WH 3TA3A 4ZAKB 3WXWH 5E99H 2QSCH 1GGTA 4FQ1L 1OARH 1OCWL 2D7PA 5FDWB 3PHSA 3AXLA 4ONHA 4FTVD 1FZMA 2PYEA 1F4YL 3UO1H 1BAFL 1C5BL 2XTJD 4JPVL 2XA8H 1H8OA 4Y88A 3TEUA 3FB8B 43C9B 3VFGL 1T1WB 2FNBA 5E1AB 1IGYB 3WN5B 4YHYB 2ZOKA 5IF0B 2P7TB 4HCRA 4PY8J 5DC4B 3FQNB 1P9MA 3AROA 3FOMA 4IRJA 5AAWA 3D0VA 3MRQB 4NO3A 4CBPA 3GSXB 3FOLB 5ID0A 2V17L 1ZVSB 3O2WL 1RULL 3ARFC 1C5CH 3BO8A 3HE6A 1OLZA 5I1DB 5D70H 3T2OA 1BQHG 1X5FA 3RBGA 4ZFGH 3TT1H 4QHNA 1YC8A 4RMSA 4FTVB 1DTUA 3X3GH 2XTJB 4N5EC 1IAOB 1J0KA 4NQCA 2AGJH 3RA7L 4X6DB 3P0GB 3K81A 3O4OC 3RNQA 1GXEA 3O0RH 3UAJD 4OQTL 1UXWB 4M48H 3QQNA 4X6BB 1XF3A 3OG4B 2AS5M 3GIVB 1PKQB 3QG7L 5KSUA 1JF6A 3DX6A 3NZHL 1NANH 4D9QD 1KJ2B 5JMRA 4HDIA 5GGVY 2GSIA 3CCHB 1FP5A 4JZJA 1OAYH 4EUPG 2NY7H 1Z9MA 1HHKA 2ESVA 3QWQB 4KPHH 4Z5RB 3MOQA 5DQJA 1D9KD 4LHUG 3D3VD 3GJFB 2PW2A 4MAYD 1CF8H 3NZ8B 2X89D 5FGBA 3PWLB 1RZKH 4LPUA 4S1QH 4KJYB 1CLZH 1L6ZA 1S5HB 4QXWA 3VFMB 2F19H 2J6EL 1P69B 4FQHB 2NTFA 1X7QB 4JY5H 3RY6A 4PJHA 3QFDA 3OB0K 5EUKA 3TO4A 2Z92A 1J9CT 1X5KA 3ELAT 3FO1B 3CIQA 4XMLL 4TPRH 3UXFA 1CLOH 1JF5A 2DLHA 4XPAL 5FAAA 1AKJA 2UY6A 2Z93A 3QJHB 3DXAE 3GB7A 3IETB 3VI4F 3W0WD 3CLEH 5I1JL 4GW5A 2Z91B 1QLFB 4JG1H 5KVDL 3VA2C 4UUJA 3VH8A 1D9KB 8FABA 1C12B 3D3VB 3TPUB 1GHFH 4PV9A 4MAYB 3RX8A 4YGVB 1U8LB 2R2CA 2X70A 3S35L 3K80A 1VPOH 2LU3A 3RVTD 1CXIA 5T1MB 1SJXA 3IDJB 1FNEB 3QEQD 2P8LB 4S1RL 1N2RB 1FN4A 3ZHKA 4F7MA 4JN1L 4KTEL 4XCYA 2E9IA 4YFEA 3FN3A 1T1XA 1JZ5A 5F7EL 4NQSB 1IGMH 5CCKL 2EDJA 2FJHA 2RAMA 1X4YA 4J8RB 4KQ4L 5BS0E 3MLRH 4N0RA 3LQZB 4MNQA 1M1SA 4M1CC 4YDIH 5F8RC 1U95A 4YFDB 3W0WB 1DLHB 3L3HB 3CSPA 4PIRF 2QQKL 3TN0B 3EOAA 3VCLB 4XB7A 1Z9OA 1P1ZA 1HI6B 3DUUB 4XT1C 3SGJA 3RPKA 5CP3H 4UAOB 1LK2A 2FX7L 3ARSA 4WI5A 5GRYA 1A3RH 4MD5A 4DW2H 1RUAH 1NLDL 3X13A 3QEQB 2ZG2A 1MNUH 1CI5A 4RFEA 5DYOB 2XI9A 1G7QA 2YSSA 3VXUD 1I1AD 2MHAA 2P46B 1KJVA 3PQYE 4O58H 1OB1B 4LPYA 2A9ML 2BOCB 3QRFM 4LSUH 3L3IB 4NO5B 3C09B 2W9DL 3C9NB 5K9OA 1EFXA 5EO0A 5E5RB 2CDFA 2XZCH 3JV6A 3IDGA 3UJTL 1ERNA 4Y1AE 2F5BH 1RJYA 1QFWM 3BSZL 4XP1H 4ACPA 2JE8A 4Z7VF 1ZLSH 5JNYA 1HKFA 2HTKD 3OXRB 4KGLA 1MFDL 2BSRB 5JHDA 5DUMH 2Y4SA 1QLRA 1SVCP 3VFNB 1U3JA 5I16B 3VXUB 1UXSB 1Q9OB 3RBSA 1I1AB 2M8XA 5SX4I 4OIBA 2BNRD 3IS1X 3BRDA 2ZUQB 4RFNB 1JYVA 3SE8H 3WIIL 3GHEH 1DBBL 4GS7C 1NCNA 2PW1B 1ZHBA 2OK0H 1RY7B 2OZ4A 2OR8A 2XRAL 3V5DB 4TVPE 2G2RA 2DWDB 4J6RL 1RQ5A 2YD8A 3AS0A 5CINL 1BIHA 1XMWA 1Q0YL 4AEHH 3ZE1E 5KAQF 2XNAA 3L7EB 4GQ9L 4POYA 3UTPE 1TITA 3UJJH 5DD6A 4U1HA 5IEHB 4UIKH 3BGFC 3B5HA 4F33B 1OT2A 1O5DT 4XC1H 3BFOA 5CFHA 2BNRB 3KYAA 4XNQA 4Y8AA 1Z9LA 3FB5A 4DOHB 3DHMA 3UTTD 1F8TL 2ED7A 4YH6A 3BWAB 4JFPA 5GSVA 3MZTA 2F58H 4NYLB 3AAZB 1PW3A 4NPYA 1FDLL 5IT2L 5GGQL 1CICD 4IIQA 5K9QI 3MRGB 3Q6GL 3QCUH 1OOAA 5IVXB 4Y2DA 2C4XA 3BQUD 3QHZH 2WIMA 3LQAL 4TSCH 1CXKA 5D7KE 1QFWL 5GGUB 1N5YL 1FL6B 4XRCB 3ZKSD 4MCYA 1P2CB 2ARJQ 5IIEA 4K71C 4Y89A 3LV3B 3MO1B 4JDVA 1MHPL 2OTWA 2IALA 1SYVA 3UTTB 3KWWA 5GHWL 1P4IH 3VH8G 1F6FB 4MS8D 4P57B 1QBLH 3AM8C 4WI6A 3PWVB 3RWDA 1UB5B 2ENSA 1UJ3B 5B38A 4L5FL 4Y5XA 3ULSA 4QOKE 4OAWB 3BWUC 1F97A 4B5EA 3MA9H 2P42B 3BQUB 4LSTH 3O9WD 3BZDA 2OXHA 4OF5A 5BW7C 1YQVH 2HG5A 5C86A 1A0QH 2VAJA 4EOWH 4X7TA 5CHNA 1T5XA 4YEFA 3FB7B 5D9SA 5B8CA 1VB9A 1LO0H 3HNTH 2ITCA 2VDQH 2BOBA 1OP9A 3B8SA 3F6IA 4JZNA 4R26H 1T3FA 2X6MA 3TVMC 3QXVA 4ZSOB 3TIEB 4OGYH 1I9RL 1FFOA 4TVSa 1YEGH 2Q1EA 4G3YL 2DAVA 2KH2B 5DEFA 1SEQH 1QR1B 3O9WB 4LF3A 2ZSWA 4S1DC 5TQ2H 2EYSA 4MXQD 4XAKE 4F57H 5T33L 1EVTC 1BVLA 4IMKC 2JF1A 3ZKND 3D2UA 4PJAF 2HFEB 4M00A 4HK0B 3P0YL 4NNPL 1TJGH 3UBXB 1K6QL 3H9SE 5IHUL 4M7ZB 5IW3A 4YGAB 3RVVD 5L8LB 3ZMRA 1JGLL 2H2PD 1I9JL 3T0EE 3UP1A 1NGYB 3CUPA 4WHTA 3HC3H 5HHOA 1DEEB 3CPLA 1KCRH 2EYRA 2IAMC 3S97C 1ADQH 5L9DL 1KN2H 3IVKA 2IH1B 3V5KB 4MA3B 2LVCA 2BRQA 5FKAB 1D6VH 1H3TA 4LVNC 3WS6C 1Q8MA 4X98A 1BJMA 4XVSL 1A9EB 3LEXA 1X5AA 1LE5B 2FB4H 3RZCA 4C56A 3BP6A 1MFBL 1ED3A 2BNQE 1SJVA 5HGBB 1GZQB 2YUWA 5EZJA 3UPRB 2ORBH 3TJEL 1TZGH 4R0LA 5LCVL 3BPNB 4ZUVA 4OFYD 5C0ND 3MV9D 3VDAA 3L5WB 2AEQH 3MGOB 2I25N 1G0DA 1YC7A 1ZOXA 5LWYL 3SPVA 1Q9LA 4X6CF 2DQGL 3QIBD 4HUUA 3LOWA 3VGAB 3DETC 4KK6D 4O9HH 4TTDD 2R0WL 1I7RA 1B3JA 3P4NA 1KIPB 3GRWL 2E7LC 4BSWA 3W9EB 1KCKA 2JB5H 2WUBL 4LSRL 1BZ9B 2RCSH 5GRXG 4U1KA 5CS7A 4R4NC 2ICWB 4G7VL 5AWNL 1CXHA 5DI8B 1CGSL 4TNVK 1S9XB 3T8XA 3GK8L 5E4EB 1AD9A 3QIUD 1F2QA 3ZKMD 1FZOB 3B5TA 3MV9B 1XGQA 1YY9C 3NCBB 1JNHB 3FT3B 1BBJA 4RIRA 1WZ1L 3I3EA 5GSRB 5KS9B 3O6FB 3QIBB 1LNUA 4JFFD 1QA9B 2ADIA 4ELME 4GG8A 3MFFA 3L3OA 1MREH 4I0PC 2NTSP 3S34H 2NMSA 1S7TB 5KVFH 1MPAL 4KDTA 3WL9B 5INCA 3WJLA 4EI6B 4NCC2 3EYQD 4R3SB 3L5XL 3ISWA 5DA4A 3QIUB 4FQQB 4OLZH 1R3JA 4EBQH 3KJ6L 5ANMA 2BVPB 4R2GC 1VGEH 1EK3A 1JWUA 4OV6F 5E8EA 3U7AA 5JR1H 4JFOB 3MLZL 4H0GA 3WFCH 2NX5E 4BQ9A 1N6QL 3HI6H 2OLDA 4Q6IB 5B38G 3P40A 1FC2D 5GGTL 4JN2B 5D7IB 1RK1A 4WWKD 2ZUYA 4JFFB 1KT2A 3QWOA 3ZZ1A 5L7XH 5GGRB 3R8QA 1YZZA 3KYKL 1SBSH 3GHBL 1BX2B 3HNSL 1WWBX 2FD6H 1RJLB 4KKBD 2M1KA 3Q5YA 4MXWL 3QUYD 1MIEL 1VFAA 4P4KA 3TH3T 4DGIH 2HT3C 2ADJB 2YPKA 3MRNB 1D5MA 2Z35B 1S5IL 3T0DA 5LXGL 2WBJC 4LDOB 25C8L 5DVKA 3I2CL 2ITDA 2VSCA 2YEZA 1OTTD 4TNWK 2RFXB 3HMWL 4G80B 5HJ3A 1W8NA 2VDNH 1EA9C 4HK3N 1FNSL 2OSLA 3VXPB 4PBWD 4OZGF 3LIZH 3OGCB 4MLIA 4QWWD 3WHE1 5J0BA 1J0JA 3OJDB 1EGJA 1S7UB 4ODVL 5HTSA 2FJGA 4WWKB 5DD3L 3ZKQD 1IRAY 2DLFH 3SDAA 5DQDH 4FFWD 1V7NH 2I9LA 2DQUL 4EUPH 3P73A 2O61B 3CFEA 4ETQA 4AZ8A 3HS0B 1HDMB 4PJ5D 4EDWL 2ZUXA 5MEOA 3QUYB 3EOTH 1CE1H 2YPLE 4FQIL 3C2SA 5DEGB 4UZGA 2XKNB 4JKMA 1GH7A 5E6YA 2NXZD 3JV4B 4KY1H 3VRJB 4NDMA 2WQ8A 1AXTH 2FO4B 3D69B 4LASL 4MMZC 4HX1A 5HI3C 5IEKA 2H9GA 4NNXA 3KR3L 3MBEC 5FUCC 1XF4B 3UTQB 3SCMC 2RGSA 3NBNA 5DR5H 5LGHL 4NP4L 2VXUH 4WCYL 2HH0L 1I8KA 3KLDA 3SE3A 1ZWIB 5ISZD 3HUJB 4UMGA 5I1HH 1Z5LA 1I4FA 3LB6C 4PJ5B 3RWHA 4DN3H 3VRIB 1A6WH 2J5LC 1JZ7A 4MXVE 5A2FA 1K4CB 1KBGL 2VDML 5D96C 2HJKB 3N9GH 5TF0A 1QRND 1JGDA 1L7IL 4TOYH 3KPQB 5FKPA 3D6GA 3IS0X 5JXEA 5FYKL 4OD1H 3OAUL 4FS0A 4LHQB 4QHMB 5ISZB 1O0VA 5D6DC 1NCBH 4QRUB 5IKCA 5FUZH 5DZOA 4K3DH 2HJFA 1JNJA 4KTYA 4R96B 4LEOA 3U7YL 3V7AE 4HWZA 2OTUA 5DTFA 4GMTL 2JELL 4RX4A 1F3RB 3IDIB 5CEXB 1NCCH 4XP6L 1QRNB 2NY0D 5TDOB 4M7KH 4X7CC 4FFVC 5D8JH 2GJ6E 5DJ0B 4LP4A 4PGBB 1MHCB 5DLML 1XIWC 3TIDB 2R4RH 1KYOK 2R23B 4NQDD 4FXGA 5CBAB 4NFDA 4HWEH 4M1DL 5GIRA 4NKIH 4AEIH 4DK6A 2QSQA 4X4XA 3CMOH 3MUGA 4QRRD 3KS0H 1HXMA 4PRHE 4UIMB 5AZ2L 2FATH 4Q9QL 2SEBB 4Q6YA 1E28B 2AXFA 1OVZA 4I9WD 1YYLH 4X9HA 4OZHA 1N5AA 3FB6A 1E6OH 4JHAL 3QXAA 2Y06H 1TVBB 2NY0B 4P2QE 4DTGH 2A0LD 5HDBE 4F58H 1I8IA 1RJZA 5FO9B 3MODL 2BDNL 2X42A 3P11L 4NQDB 3ARBD 5IR1A 1DQMH 1S9WB 1FQ9C 2MNUA 2PCPB 3CSGA 4GXUM 2Q3ZA 3NFNA 4LLYB 4ODUA 2AJYH 5GZOD 2PYFB 5CP7B 5EU3B 3O3BB 3BE1L 35C8L 4QRRB 4G43A 1FPTH 4P4RB 5IJKC 4HBCH 2G60H 4ODXB 2A6DA 4OFIA 4XWOC 4DKFH 1RIUH 3PQYA 4M4RA 2Q7YB 2E8ZA 4WU7A 3G08B 4LAQL 4PGDB 3VW3L 5F3HA 4WEBH 4JCLA 1T2JA 2J8UB 5DK3A 2GCYB 3SO5A 4PP1D 3ZE2E 3BI9X 1HYRC 4LLWB 1GJIA 4ESKA 1D6EA 2QHRL 3B9KD 4GH7B 1G6RB 3MLVL 3ARBB 3D18B 4MDIB 2R69H 4JPIB 5A16B 2A73B 3RAJH 1JGVH 2ADGA 3MCKA 3AY4C 5ICXA 2GT9B 4HC1L 3REWA 2X41A 4KK8C 4U7SA 2OL3B 3UPCA 2AV7A 3O2DL 2FO1A 1NFKA 4U1IA 4JY4A 5IMLA 5KSAA 4QCIB 4OQTA 1HZHL 2HT2C 3BKYH 5K93A 3GI9H 3MLXH 4XCEA 1WIUA 2P24A 1IJ9A 2X4PA 3MPCA 1X5XA 2WUCL 1BZ7B 1F6AB 1FHGA 1YEKL 2ZCLH 2D31B 3GMOB 1EDQA 3K2UL 4OF8A 4XAWL 3LKRB 3IU3B 1ZLUK 3O6ML 4FFYL 2CJUH 3B9KB 3VE0A 3TBVA 2WIIB 2EECA 2AEIT 5C0RH 1DQJA 4HPYH 1KENH 4U6XA 1KB9K 1D7FA 3E2HC 3M1BA 1NBYA 4LLQA 1XR8A 4PJDE 4PLNC 5B39B 5FYKE 3IJHB 1FYTE 2E27L 1CDGA 1YN7B 3GZKA 4ZAKC 4BQBA 5D7SH 4Z7UB 3OKNB 4OI7A 2J6EA 1LP9A 5TDPB 5KG9B 5ERWA 4BZ1H 4FA8A 5D71H 1X5ZA 4NC1E 1ZV5A 4IOFC 5HGDA 2GIYA 3KYNB 5ALBL 3DBXA 3VFTA 2VAAA 4YHYC 4PFEA 3FN9A 4NRYB 4JPWL 4YBLB 5C9JB 2KZWA 5F7DA 4CW1B 4LCCA 2JJTA 5FHAH 4A2LA 1KIRA 3U6RA 2OP4L 1Z3GH 3QDJE 4JKPH 4TQEL 1RSFA 3BN9D 2JCCE 5C6TL 4APQD 2GAZB 1R3KA 1TZIA 2ARJB 3BGAA 3EJJX 5HHVL 3PUCA 3GSUB 3DYOA 4Z7VB 1F4XH 2XXMB 5DD0H 1F11B 3ULUH 2XTJC 4YNYB 3WNLA 5GPRA 1YY8B 4XC3H 1CDBA 2D9CA 5L2JA 4GG6B 4YPJA 1KFAH 3G6JA 1D5IH 4OZ4B 2OJEA 3AC0A 4OZIB 4PD4J 3QDGE 3RWJA 4H8WL 5TJWK 1TTUA 3C5ZA 1YNLH 3U0WL 1A6ZA 1BIIA 4JJ5A 4M1GH 1B0WA 4QOKA 5I1KL 4G8EA 2X4NA 1NFDF 3KJ4B 4KKCD 4NKOB 5AYUL 4BSVB 1ULVA 1VADB 1AO7D 4APQB 3X12B 4I18C 1YDPA 3GJFK 5BQ7B 2W65B 4LLDB 3ZO0A 2YMXH 1Y18B 5EZIH 4BFEA 4FFZH 1DVFA 5DD1L 2VZTA 2BZDA 4NZTH 1MY7A 3CDGA 1W0VA 4OUUA 1RIHL 4MAUL 4MA8H 4U6TA 3HAEA 1MJJB 5EUOA 3UAJC 4S1SL 3T1FA 1WCBB 5JUEH 4GKNB 1M6OB 4MJID 1AQDB 1G0XA 5HYJE 3U30B 1AP2A 1R3LB 5FF6A 4XVUD 5IW6B 5F9JA 2E9JA 1KTRL 2PF6A 5CZXC 5DJDB 1AGEB 5C0CE 4YZFF 3QCTL 1HH9B 2OZ4H 2QQLL 5EOTA 1AO7B 1GGYA 3RFZC 4YHNA 3RRQA 3D39A 2HLAA 4YHIA 3MNWA 2GTWA 3SQBA 4PJ9A 1FV1B 5IFJA 4WY7H 1BVKA 4JVUA 4KZEL 1QKZL 1MFCH 1OAXH 4AEEA 4PP2B 4MAYC 2AI0L 3FT2A 4ZPTA 1TVHB 2X1OA 1ZLWH 3L5IA 2P48B 1DUYA 3IDNB 4QHUB 4MJIB 1EEZA 3MLTA 2R9HC 5ALCH 1S7QB 3OKDB 1QR4A 5TE4H 1T2XA 1JPFA 2N7AA 2VLME 3WHE0 5MI0B 1MLBB 2R8SL 2CIKA 5F88A 4OV5B 2Y6SD 5KTEH 2BNQA 5IMOB 5ICYB 1RVFL 3LY6A 1ZSDA 3RI5F 1I1YB 3TN0C 3BUYA 3R06B 4E41D 1MI5D 1WIPA 1PEZA 4GJTB 2XOTA 2EYTB 4TRPH 3WFHA 3VJ6A 2CMRL 4X8JB 4KUCD 3GMLA 3FO2A 4UAOC 3RVTC 3U46B 5F1IB 4CU6A 2C1PA 1SJHB 5F96L 1FVDB 2DTML 4JQVC 2Q86B 2B8OT 4ZNEE 4NUJA 1RV6X 5H35B 1JHLL 2XZQH 2BK8A 4KQ3L 5EBLB 4URTB 4WI4A 4JO1L 3DIFB 2VR5A 3C09C 3HMXL 4HMDA 4MDJA 5ENWB 3KPSA 5E2VH 1ZA3B 5K9QG 5CILL 2FX9L 5FHBL 2YBRA 2JK5B 4DAGL 1G9ML 3BKCL 1C1EL 2DKSA 2F53D 1H3UA 1MCWW 1HWGB 4E41B 1MI5B 5K9KA 1INQA 2UWEB 1FZKB 4WFHD 1G7IB 5IVOA 1J10A 1ROWA 2YA1A 4M5ZL 3L5JA 5D1ZB 3KPLB 2GTZB 4YQXH 3HC0A 3E6HB 4XCCH 3L3DA 3VGFA 1WBXA 5HGAA 4EN3C 4KUZL 4QTIH 1I1AC 1MJ7L 2ZPKH 3MMEB 4H25A 5CMAB 1UACH 5K9JL 1F2XK 4I5BB 4RFNC 3BT2H 1HOCB 3KPRB 1DFBH 4H88H 5F9OL 1UFUA 2AABL 2R1XA 4KDVA 4XX1G 1NKOA 12E8H 2NXYD 3ZSSA 1JMZA 2O5ZL 4K07A 2COQA 3VRLE 1MCPH 1CFNB 2YK1H 4OBRA 4TUKL 3UTSE 2NW2B 2F53B 5TE6H 1HILA 3NPSB 4HH9B 2APWA 1GGIL 4TYUA 4KROD 3R8BB 3BDYH 4XHJD 3RU8H 4G9FD 2CR6A 2WMPA 2BFVL 1K8DA 4QRQB 2APTA 2BY0A 1Q9KB 3E0GA 5EZLB 3WMSA 1VKXA 3BGMA 2VUYA 3OB0H 3V6ZA 5J11B 5IFAH 5C0AD 2GFBA 2AV1A 2FDBP 4NQVA 3GSVA 1HHJA 2UZIH 3JWOL 1W0WB 3PGDA 4XTRD 2HRPL 3BKJH 4LVOB 3HFML 3MOAL 3VXOB 2G9HB 2ZJSL 1QHPA 5FDWA 5KVEL 3H7LA 4U1NB 1CS6A 4JQXA 4K94L 1F58L 4KROB 1T1YB 4X6CB 3KXFE 4KK5C 4G9FB 4MNHA 4POZC 2DDQL 4EI5A 4ZFZA 2GSGA 1A1OA 3WN5A 1T1WA 4QYOB 3B4NA 5A43C 5IF0A 5E9DD 3RDTA 3SHSA 3I9GL 3ZE0F 3GSXA 3FOLA 4R6UA 1T66D 1ZVSA 1QBMH 2DKUA 2VLKE 1JVKA 4OSUH 5C0AB 3PV6B 1QHOA 3K7UA 1CDUA 5I1DA 4LPCA 1G6RL 3MACH 15C8H 3BXNB 3ETBF 3T4YB 2NZIA 4D3CH 1UYWL 3OHXA 5K59E 3VXME 4QNPE 4GMSL 2D9QB 2EE6A 4X6DA 2X7LA 2DQIL 2WINA 3CDFA 2FGWL 3VGBA 1IGFH 1R5IA 4O4YL 3BQUC 2HYMA 3PL6D 3N1MC 4JM2C 4P2OD 5E9DB 4LIQL 1T6VN 3LEVH 2ATPA 4HHAA 2KL6A 1FYHB 4Z7NE 1PKOA 1K8IA 1CFBA 1D3CA 3V4VH 4ODTH 4GOSA 1HIMH 4JG0H 1S3KL 2PTTB 5C92A 4D0DA 2FX8H 1TETL 1U91B 3GRWA 5E8DL 4MS8C 3KPNB 5ADPH 2K9UA 4N1HB 4BFGA 5I17A 3C2AL 1EEQA 3CNKA 4YWGL 3TNNA 3LS4L 4FMKA 1JJUA 4O51A 4PG2A 1TMCB 3KS0J 3UPAA 3GJFA 5AZEL 1H0DB 5D1XC 4PB9L 3QIWA 2HWZH 4PJHF 4HEME 4Y4FC 3R0MA 4KJYA 3GMPB 2EZ0C 3CDYA 1JRHI 3PL6B 1UZ8A 1X5HA 2Y5TA 1YNKL 5SWZD 5EC1B 2D7OA 5EU7C 4CU8A 4L3ED 2ZOLB 4M7ZC 3CC5B 3FO0H 1NMBL 4GBXD 4IRSD 4K9EC 3FO1A 2A6IB 1JNLH 1QP1A 3P9MA 2VXVL 3O2VH 4OBSA 3SKJH 4CADB 5I1LB 3IETA 3P30L 3PP3H 3RWIA 1KOAA 1RHHA 2VC2H 1HXYB 1M7IA 1ZANL 1N26A 5EPMB 3UZVB 3DTXA 1Z9SA 2EH8L 5F7LB 1D9KA 2CRYA 2AJXH 5ACMA 5GRUH 3EJYD 4RWYH 1FNEA 4MLSA 1XR9A 5MEQA 2LV4A 3HLAB 1N2RA 1NGPH 3HKFA 4P9ML 4MXQC 4OCSH 4U6YB 1CU4L 3DVGB 5SWZB 5BV7H 4KK9D 2OJZL 4X7SH 4R90H 4L3EB 5GGTA 2CK0H 4GBXB 4IRSB 4YDKH 3MRHB 3X3FH 3IDMB 2H2PC 3BPNC 4LVHB 4O00A 1EGJH 2R1WB 4PRNA 3LQZA 2VERN 3RKDC 2VN4A 5I1EH 3BAEL 1DLHA 3W0WA 4Z0BL 3PE9A 4OCLC 1XEDA 5E6ID 1J05A 4PG9B 5DRWB 4I8DA 2F8XC 3VGAC 3ULUF 3DUUA 1NLBL 3C5SA 3GSWA 2NYYD 5HYFA 2AXGB 1EIBA 5LGJB 4P5KB 4WO4A 1RURL 2G5RA 4DKEL 5IFHH 5FYJL 4D0CB 3QEQA 4Z76B 4GRLA 4NNYA 4EKXA 1K85A 3MLWH 3MJ9H 4TULH 3MCLH 3FONB 3PJSA 5JIIA 1A14L 1CQYA 5C0NC 1FG2A 3V52H 2YS4A 4PJGE 1JZ8A 3QI9D 4JLRB 5E6IB 3O6FC 3QIBC 1U92B 1XT5A 3HZVA 4I1NB 4ZD3H 3JTTA 4TTDC 1AJ7H 3RGVD 5AEAA 1UWGL 3O8XD 1PG7H 3V0WL 3VFNA 4XBEH 3IKKA 1MFEH 2IQ9H 1JUFB 1JMXA 1VDGA 5F3BB 3LRGA 5CUSL 1NGQL 4UBDC 3VWJA 2J4WH 1B0RB 3MRKA 2VITA 2Z31C 3BDXA 4HG4K 1QSFE 3QIUC 4LIQE 4P23C 1NFIB 3SDYL 1FZJB 5C2BH 5ID1B 3QEGH 2VKXA 3NPZB 3T09A 2R39A 1NGXA 1P6FA 3QI9B 3QG6B 1AGFB 1CL7L 1DN2A 1K4DB 3LVEA 3TYFA 5L0QB 4KJPD 1G7LA 4OCYL 2QR0B 3RGVB 1A6VH 3OKLA 2YWYA 3O8XB 3TH4T 4NUGH 1OAZH 1VA9A 3RWCA 1SHMA 5CEYB 3ARDA 4U1LA 4P46A 4PRBB 5I2IA 2EC9U 1WT5C 1KTDB 4PJDA 4NWTL 4UILL 4U49A 2H32A 4L3CA 5GS0C 2W59A 1YA5A 4F2MB 2GK0B 3M8OH 2LFGA 1JHKH 3UC0H 2CKBH 3LD8B 1IE5A 3VFUA 4ZXBD 4XPHH 2CIIB 1NGWA 1YEIH 2AJUL 4KRPC 4WWKC 3UZQA 1RUQL 3OKEA 2MPAH 4QEGA 3MBXH 5DJ2A 4LSSH 4CDGC 4PB0L 4KKBC 2A9NH 5HI5D 1EERB 2DQTH 3LZFH 2NCMA 3L6FB 4JY6B 5IJVB 1WBZB 1A1MA 3UTZB 1UADC 2PXYD 1AY1L 5BXFA 1OTTC 1VFUA 3QDJA 4FQ1H 1OCWH 5F1KC 3CFKA 5DRZB 5DK2A 4NZUL 1FNAA 5C2UB 4UU9A 4HIEB 4QWWC 2K3TA 1F4YH 1HCVA 4MWFB 1CICA 1BAFH 3QQ4A 1FFPB 4PJXB 1C5BH 1UB5A 4ZXBB 2DQFA 4R4BB 5EB9A 3MYJB 1YEDA 1UJ3A 3T3PF 2OYPA 2A6KB 3GSRB 2RQ8A 5D2LB 2GUOA 4OAWA 4DQOH 1HQRA 4K2UL 5TE7L 3W81A 3GMNA 4YC2B 3QDGA 2UVEA 1BFOA 2EDTA 2AJ3B 2V17H 1KTLB 3O2WH 1I3VA 4WUUE 1RULH 5DWUL 2YA0A 5FYJE 2H8PB 4XNYH 1A3QA 4JDTL 5FUCE 5KVGL 1V3LA 3GSOB 2PXYB 4GRMB 4G6AD 2F54E 1DDHB 4WI7A 5CIPA 4WIQA 3ET9F 2W1NA 2HFTA 4HJGA 2ZSVA 3QRGL 5C09E 3IJSB 4KVCL 5JOEA 4RMRA 3PWPB 2EDEA 3VXSE 2R0KL 4MQSB 1EEYA 4LP5A 1MUJA 4OIAA 1X5JA 1EMTL 4ENEC 3RA7H 1PYWB 4V1DA 3IYLW 4OQTH 3TPKA 1N6UA 4JO2L 2W60B 2IBBA 4ODBD 5GS1B 1FL5B 3O9WA 3DRTB 3HRZA 1YQ2A 4XBGA 1L4IA 2VWEC 4NOBA 2CPCA 1YPZB 3HZYA 1N0XL 5GJTL 3TJHD 2PO6C 5EBGA 4KTDL 1LO4L 4GXVL 1CDJA 3OAYH 2G75A 1DQTA 3QEHA 4WHCA 4WW1A 2WSKA 4QY8B 2XN9E 4JPKL 3A67H 3CH1B 3MJ6A 1UGNA 3PGFL 4CVXB 3SDXB 4WTZA 3NFPB 2AJSL 3TESA 1N8ZB 3QDME 4G9DB 4W6YB 1JPSL 5KN5B 3MRMB 4FQXA 2NLJB 4U6VH 4ETYA 4HXBL 5HYIA 3HPJB 3ES6A 4XMLH 5C8JB 3MLYL 1G7PA 2Q76A 3QEUB 5HPMA 4JB9L 4RGND 4XBPB 5FV2A 2HN7A 5I1JH 2V2TA 5C6WH 5KVDH 2ZG3A 3FCTB 5I18H 3M07A 1SBBA 3DRQB 3FMGL 3S35H 4BJLA 1R5VA 3JWDC 5DK0A 1AHWB 1C16B 4Z78B 5ECJE 4S1RH 1KJMA 4JRXA 3LRHA 3W9EA 3H7BA 3QXDA 2FRGP 4ZNEA 1E4XH 1OAQL 4KTEH 5HDQH 1Q0XL 2W07A 3ARGA 4FQJL 4XNUH 2ICWA 3L5HA 5F7EH 4AIZA 2GW5A 5DI8A 3QQ3B 5CCKH 5ITBL 1S9XA 4HMCA 5JW5A 5F1NB 2W9LA 4KQ4H 4YFLI 5D2NC 4AL8L 1AIFA 1REIA 1ACYL 3MRPB 4OFYA 4RGNB 4WNQB 3EDFA 2QQKH 3QWRD 4I0CC 3FFDB 4JQIL 5F7YC 4MQTB 3JV5A 4PJBE 3TBYB 3MRFB 1NC4A 5L2KE 3EYFA 2YN5A 3T4AB 3S36L 5JW4Q 1VGKA 2DMKA 4LEXL 3VFWA 2EIDA 4XGZA 5GZOC 3CFDB 5T3ZH 5EBMB 1NLDH 2V9QA 3UYOD 4AIXA 4M3JA 2HVJA 1S7TA 2FECL 5IW1B 3OV6A 2ZUWA 4AMKL 1YN6A 1T2QL 1QOKA 3CLFL 4HWUA 4LQ1A 3KDMB 2W9DH 4LHUD 1NEZB 3TFKD 4WU5A 2X4RB 4NQEA 1GIGL 4FQQA 1LEKA 5HHMD 3UJTH 1D5ZB 5C0IA 3PV7A 1YEFL 3B9DA 3B6SB 4J4PA 2GYSA 4JRWA 4Y16D 4C83B 4JFOA 2VE6B 3B9KC 4GRWH 5FO7A 1ZKAA 3VG9B 1EVUA 1MFDH 4L9LB 4KVNL 4HIHA 3QULB 4NO2A 1DBJL 1WITA 1IC5L 4YHLL 5GGRA 2NNAA 2DJSA 2DMCA 4OM0L 4ZOBA 4EUPB 4R7NB 1I8MB 2QBWA 4ZOEA 1A7NL 5BO1L 1ETZA 1RJLA 3Q1SL 1QZ1A 2R2HA 4LHUB 3BRFA 3WIIH 4WDIA 2OQJA 2IBZX 2C1OB 5JIPA 3TNMB 4PJEE 1KPRB 3NIFF 5HHMB 1KLUA 5H94B 4IM8A 3GSNL 3HI1B 4C57C 2IQAB 5JPNB 1H8NA 4TN9A 32C2B 4Y16B 4DFIA 2XRAH 1WAAF 2V2XA 3C60A 4XNXL 1CLYL 1A6TA 4OD3L 3F7VB 1MHEA 4YBLC 1G7JB 4EDXA 1IILE 3KXFA 3FQWB 4GQ9H 5L8JB 2R56H 2XYCA 4D0BA 1V3JA 4AT6B 1P7HL 5FGSA 3SKMA 3IXTA 4N1EA 4PTTA 1FE8L 3WJJA 3SKOA 3N85L 3SGDI 4L8SB 2EC9T 1TCRA 1F8TH 3TP4A 1H3PH 3RL1A 2FO4A 5I76A 1ZHKA 1MAJA 5GGQH 1IM3B 3U4AA 5IT2H 4HS6A 3EKCA 4YEEA 1R3HA 4LVEA 2X9WA 3QQ9D 4X0KB 4MJ6B 4P2CG 3Q6GH 3V7MA 3VI3F 3EYOA 4LARL 3TA3D 3FHAA 5IBUG 3HCVA 3L3JB 1FO0L 4F7CA 4WTZG 3KJ4C 4RBPK 3S4SA 3VGGA 5A2JH 3WE6B 2XFXB 2E7CA 1FNGB 1QFWH 3BN9C 1N5YH 2PYED 4ZO7A 5SWQA 1S7WA 2IG2H 4PR5A 1E6JL 1MCJA 2QQQA 3E6FA 1QQDB 5I66A 2B20A 1MHPH 5GHWH 2CSPA 2HMID 3C8HA 5DJXB 1K5NB 2DQHL 3HMXA 2O5YL 3IF1B 2VDRL 4YDJA 4M61B 3FRUA 3SDDD 4ZOCA 3HE6D 5EA0L 1IC7L 2B4CL 1MCRA 4G5ZL 4PY7B 1FL3A 2P5WE 4OJFL 3F7RA 3TA3B 3QHFL 4JFEA 5C08A 4QHMA 1TIUA 3ZT7A 1DN0A 4NHCL 3G5XA 4QXGL 1GC1L 3AXLB 4ONHB 3HR6A 1FZMB 3O6KL 2YRPA 4PTUA 1BHGA 2PYEB 5LAXA 1YJDL 4Q97A 1T6WA 1M05A 1M7DA 4NQCD 5CD5D 3OB8A 2F15A 1L0XA 4FN0A 2ZOKB 3TVMA 3CFCL 4PYHA 1QRNA 3FOMB 4HUVA 3D0VB 1ZLUH 5E7FA 4NO3B 4MQXC 1E4KC 1U2HA 4LBEA 1MELA 3SDDB 2R23A 3T08A 3HE6B 3RHWF 4WFEE 2YD7A 5ACLA 3VFRA 1IQDA 4G3YH 4XVUC 2EDKA 1LO2L 2ESVD 2WBKA 4XB8A 4U2YA 4OZHF 5MI0C 3ZDXE 4QHNB 3SEPA 1SY6L 3GM8A 2SEBA 1E28A 3N50A 3P0YH 4NQCB 1K6QH 5IHUH 4EXPX 3RNQB 1JGLH 1I9JH 5E94A 4I2XA 4XP5L 4UV7L 4KDWA 3EYSL 2XWTA 1XF3B 3QXWA 3HR5A 1VERA 3PIQA 5L9DH 2HVKB 3O3DA 5KSUB 5HHPA 4LNRA 4XPTL 5FYLH 3VWKD 4HDIB 4EZMA 2GSIB 3HA0A 2DD8L 4JZJB 5CP7A 1AKJD 5EU3A 4XVSH 3O3BA 1HHKB 2ESVB 4M7JL 2E6QA 4QRRA 1RZIA 3MRIA 2CDEB 5DQJB 2LU7A 2Y6SC 4ODXA 3RWGA 5HVWA 2PW2B 3Q6FA 4PGZA 1FGNL 4TNVF 1U93A 1U6AL 2DQJH 2IPTL 3TJEH 4EJ1C 3G08A 4WV1A 5LCVH 3RJDA 1UM4L 1PG7X 2J8UA 5T5FL 3KLSA 5D1ZC 5E24E 4M8QA 2NTFB 5HYSA 4KI5E 4PJHB 1XGUB 4LLWA 4WGWB 5KSBB 5EUKB 3TO4B 1G6RA 5CJBA 2DQGH 3ARBA 2Z92B 3L1OL 1KJ2H 4JPIA 2AJVH 2R0WH 3X17A 3VWKB 4YUEL 3RTQA 3WFEL 3H3PH 5F9WC 1AKJB 4MNQD 2Z93B 5DJ6A 4H1LA 3GB7B 5E8NA 4UUJB 3VH8B 5C9KA 5AWNH 1E27B 1QSEE 5CKGA 8FABB 1CGSH 3GJFH 5GZND 3DX9B 4OIIL 3NPSC 2X70B 3GK8H 1P4LA 5B4MD 5CJ5A 4ERSL 3VXUE 2CLRB 4JVWA 2X4UA 3GMOA 5E8PA 2D31A 1FN4B 2MCPL 4F7MB 1YNTB 4XCYB 4ZS6D 3I75A 1WZ1H 1T1XB 2CR3A 1BREA 1EFXD 1OAKL 4BUGA 2NPLX 3FQUA 2ZKHL 3S4SG 4YHPA 5HY9A 4RDQF 2QV2A 4MNQB 1GGBL 1U95B 3UCRA 2GJJA 5CEZL 2D4FA 1LP9F 4F80A 1YN7A 3RIAF 1P1ZB 3V9FA 1JN6A 4LPVA 2HFFB 3L5XH 4PJFF 4WI8A 5E5UB 1DSFL 1LK2B 1IKFL 4KROC 3GMMA 4MD5B 1I85A 3T0AA 4XHJC 3X13B 4JFZL 4RFEB 4MX7A 1G7QB 2YSSB 2VR9A 3MLZH 2F5AL 5JA9A 2MHAB 1KJVB 4NJ9L 2IBZY 1NSNL 1FNHA 3MRJA 1C7SA 5K9OB 1EFXB 5EO0B 5E8OA 2CDFB 1NUNB 3JV6B 1A64A 3IDGB 2MKLC 3KYKH 3GHBH 1KCSL 3HNSH 1RJYB 4CVZA 4L3AA 3HZMA 4N9GB 4XTRC 1MIEH 5JNYB 1P4BL 3ARWA 3GO1L 2GITA 1CD1A 1MAMH 4N0YL 1S5IH 4FABL 1DQDH 5LXGH 1FJ1A 5IVXE 3KPPB 25C8H 4ONFH 1QLRB 1S9YA 3I2CH 1UQSB 2A74A 5MEPA 3OQ3B 3HMWH 3ZDZE 3G6JF 1FRGL 4RAHA 1J8HE 1FNSH 1RU9L 4HKXA 1DL7L 5INDA 4WI3A 3QA3B 4HJ0D 5DEZA 3U4BL 1HHIB 3DECA 3UTTE 2B5IC 3EUUA 5C0FA 3GKZA 4P2RE 1ZHBB 4FQ2L 3BP7A 3ZSTA 4AENA 4LLAA 4BSVA 2Y23A 3HI5L 3IFNH 3TZVC 2G2RB 3UJIL 4FQIH 3X12A 3J7HA 4WUUA 1OGAD 1JFQL 3C6SA 1Y18A 4DGYL 1XZ0A 2XNAB 4NQUA 5EUOF 5DF0A 2F54A 3MREA 4LASH 4OFDA 1DE4A 4Y2DD 5DD6B 4FQLL 3FQRB 4U1HB 5C09A 2XZZA 4R9HA 4GRWF 5LGHH 4XNQB 4NP4H 5EG6C 1UM5L 4R7DB 1BJ8A 5T5NF 4Z7WE 5KJRL 2HH0H 1AQDA 3BRGC 2NY5L 4Y4KD 5GSVB 3KPMA 4XPFH 1YMHA 1R3LA 1MCFA 1CN4A 4HEPG 1AGEA 2BVYA 1T1ZB 1UH2A 1MVFA 1IGIL 4H5SB 2Y5EA 4IIQB 2Z0BA 2FBJL 3BZEA 2VDMH 1II4E 3HB3C 4Z7OF 5T1DL 4UT9L 5DHVB 1BECA 1L7IH 2VQ1A 4Y2DB 5HYSG 3SGEH 3DNKA 4XPBL 1JPTH 1TVHA 3EFDL 4MCYB 3V4UH 3HTLX 1CVSC 2H32H 5IIEB 3OAUH 4JDVB 1NCWL 4A6YL 2H45A 2OTWB 2IALB 1SYVB 4WUKL 4H1LG 4Y4KB 1IC1A 1R0AL 2IMMA 3OKDA 4P49A 4GBXC 3G5VA 3U7YH 4LVHC 4POUB 3RWDB 1ZHNA 5IMOA 3EGSA 1NL0L 2V7NA 4GMTH 3U9UA 4DJMA 3BW9A 2JELH 3BESR 3S35X 5CEZE 4Y5XB 5F72S 4MA7H 1MVUA 4ZOAA 5IHLB 2EYTA 3ZKXB 5A2IH 1VENA 3OL2A 3MFGB 3EJYC 5CKAA 3CX5K 2HG5B 4FZ8L 1WEJL 1FVDA 4ZO9A 1IBGH 4M1DH 3T65A 4X7DC 1F90H 1LHZA 4KK9C 1CFVL 1UG9A 4O02H 4YHKL 5BVJB 5AZ2H 3LDBB 2Z8SA 2ITCB 5EZOL 4Q9QH 1CDIA 2BOBB 4N8PA 4JGUA 1T3FB 3DI3B 1BVZA 2Q7NA 2HRLA 4U6HA 1FCGA 2NY1B 4RQQB 4Y4HA 1J0IA 3TGXA 5D7JC 1FFOB 2X4OA 4F9LC 3RX5A 5TDNA 4TUOB 1UEMA 4E41A 5E6IC 1IEBA 2D4DA 1XGYL 2UWEA 1NMCB 4YHZH 3WFDL 4C56D 2ZSWB 3MODH 1I75A 2RR3A 2V9TA 3PGCA 1BVLB 2BDNH 3P11H 1NEUA 3NA9L 3F58L 1NKRA 1XH3A 5L2KA 1LDSA 4BUHA 5CIPH 3MMEA 4U7MA 5EU4A 4M6NL 1B90A 2X4TA 3BE1H 35C8H 3SJVE 4GKSA 3CUPB 5KS9E 1HOCA 2DLIA 1XGRA 3SDCA 5HHOB 4QGYA 2ZCKL 3CPLB 2EYRB 1KYOJ 3E8UL 4X5LA 3QPQD 3IVKB 1FFQA 4LFHG 4LAQH 2F53A 1ZAGA 5EORL 2AK4E 4X98B 3QYCA 1ORQB 2I60L 3LEXB 1ZT4A 3Q3GB 4ORZC 5L0QC 4C56B 3BP6B 1ED3B 5T3XL 1CIDA 2QHRH 1BOYA 3O8XC 3MLVH 1A5FH 5EZJB 2AQ3A 4QRTA 1AGBA 2Y07H 4HC1H 4HUWA 4PJIF 2I24N 4R0LB 5EZLA 1U8JB 5IROC 3F8UB 4ZUVB 3MXWL 3O2DH 1KLGA 4UT6L 5FYKU 3ZDYF 5B3NA 1W0WA 3SPVB 1Q9LB 3CDCA 3AGVA 2R4SH 5HHNA 4HUUB 1HZHH 1MCLA 1I7RB 1PVHA 3K2UH 1YEKH 3IKCA 4PJEA 4BSWB 4XAWH 3BUTA 5EC2A 4KJPC 4U1KB 4FFYH 1W72L 5J9PB 4LCWA 3P0VL 4WW2A 5J6GA 1Q94A 2BXYA 3ZT6A 3T8XB 1AD9B 1DBAL 1PEWA 5I19L 1I7TA 2BVQA 2IH3A 3ROOA 1I1RA 1XGQB 4HUXA 2ERJB 1BBJB 4RIRB 5A2KH 5IESH 1LNUB 2ADIB 4GG8B 4X6DF 1U8NA 3MFFB 3L3OB 2XA3A 4ZXBC 4U1MA 5JOPD 2AAVA 5ALBH 5INCB 4M93B 3JVGC 4P4KD 4UDUB 2W38A 5EWIH 3NA4A 1KACB 3BP5A 4JPWH 5HI5C 4XNZB 1R3JB 5JDSA 2DJ4A 4NCDA 4U3HA 5KANI 2IPKA 3GM0A 1JWUB 3WIHH 5E8EB 5J3HC 4YXHL 3N1GC 2OP4H 3OAZK 5FM5O 1LDPL 3KHOA 5C6TH 1B2WL 4PY8I 5HHVH 3H3KA 3HUJE 1U91A 4W4OC 1RK1B 1KB9J 4OCRH 5JLZA 1KT2B 2XWBB 3QWOB 4JO3L 2WLZA 3EHBC 3WUWA 3STBA 4BH7B 4FMFA 2BMKA 1PY9A 2A77L 1FNFA 3DSFL 4NRZA 1CD9B 4W81A 2V5YA 2R29L 1J12A 4PJ8A 3CJJA 4P4KB 1J8KA 5C3LD 1IAII 5E1HB 2YPKB 4H8WH 1ITBB 1D5MB 4L29B 1F45A 4P2OA 5BOZG 1HSAA 2ITDB 2BVTA 2YEZB 3OMZA 2P5WA 3MOBL 5I1KH 3CSYA 1EHNA 5HJ3B 1F3JA 5AYUH 2EDXA 2OSLB 3KYMA 4G6AC 3U0TA 2A6IA 1VEMA 2FJGB 4HLZG 5D1QD 1KPUA 1TXKA 1XGPB 5I1LA 4I77L 1M7XA 1HXYA 2I9LB 5EU6E 3P73B 5A3ID 3CFEB 4ETQB 4P59L 1DP0A 4M03A 3MGAA 4MAUH 5MP6H 2VLJE 1QUNA 3TC9A 3WD5H 4S1SH 2VWEE 4IRZL 3GBMH 1GAFL 1P7QA 1QVOA 4LAJH 1UWXH 4QF1A 5T3XE 3AB0C 3KPTA 1NCAL 5E70A 1I9IH 3TBWA 2AQ2A 4XNMA 5IEKB 3SGKC 3QCTH 5F1OB 2QQLH 2H9GB 4NNXB 2GJZA 4IRSA 3BMVA 4Y2OA 5ETUA 4YPGB 3IT8D 4NKMA 1YUHA 2YWZA 4KZEH 1I8KB 1IEAA 3MYZA 4JR9L 3ARXA 2AI0H 5DJCA 2V7HB 4KU1A 1HKLL 5CBEA 1Z5LB 1I4FB 5JZ7C 1AHWC 3RWHB 5I8OL 4OCWL 4XCFL 4ORGB 2AXGA 3GSNA 1IKNC 1P5UA 2O5XL 4RX4D 4HFUL 2FR4A 1NUFA 1EFQA 1F6LL 4NQDE 3FONA 2R8SH 3T0WA 4D8PA 2PUQT 3EJZD 4NBYB 1H5BA 3LHPH 5FKPB 1RVFH 5IM7B 2YUZA 4B53A 1A4JA 2W0PA 5T1LA 4NKDA 4NZJA 1T7ZA 3ZE2F 3NACL 5IKCB 1INEH 2CMRH 3IU4L 2HJFB 5IHZA 4CNIA 3PHQA 2JJWA 5JW4M 1QSVA 5E4IA 5F96H 2DTMH 4HWZB 5GRVL 2OTUB 3BPCA 5DT1L 5D2NE 4N68A 1JHLH 1U58A 3IB4A 5C3TA 3T2NL 3FZUD 4JO1H 4UQ3A 5F3BA 1SQ2N 5BS0D 7FABL 1A1NA 1KXVC 1XCTB 3CFJA 3HMXH 3FQXA 4B7LA 5CILH 2FX9H 5HD8C 4S2SB 4DAGH 1G9MH 3HE7C 1A7OL 1RHFA 3MRRB 4N8VA 3BKCH 1C1EH 4LSQL 1IM9A 1FO0A 1QSEA 3KAAA 1HNFA 1A6PA 5GIRB 4X9FA 4X4XB 3S8WA 3HZKA 1MCCA 3MUGB 3VG9C 4OLWL 4Y8DC 1HXMB 4L9LC 4M5ZH 3VI4E 4KJQD 2V9RA 3PQYD 1U8OB 2AXFB 3RGVA 1UCBL 3QB7C 2XT1B 2QADC 1CK0L 4OZHB 4KUZH 1N5AB 4UTAH 3FB6B 1MJ7H 3W11C 3QXAB 4OZFA 3QNYA 1G9NH 4JFDE 2W0FB 5K9JH 3H3BC 4DCQA 4XXCC 5BS0B 1OPGH 2UZXB 4Y1AD 1VESA 5F9OH 2FSEB 1I8IB 1RJZB 5IUSA 1IGCL 4UINL 1PLGL 2H26A 4TUKH 5C0GA 3NIDF 1YEEL 4Y16C 2GK0A 3NFNB 4ODUB 3WUWG 1GGIH 1T7XA 2R0ZL 2MTPA 1C8PA 4U3CA 4G43B 2CXGA 4K8RL 5DSCA 2BFVH 1EUTA 1NMAL 2IGFH 2A6DB 2QSTA 3PQYB 2V5RA 5KSAD 3Q48A 4AQOA 1S78D 4WU7B 3OF6A 4F9PA 5F3HB 3SKUD 5BRZE 5CSZA 5CD3B 1DBKH 5C0JB 4GLRI 2EXYD 4L8SC 4D9LL 5IJVA 1T7YA 4TTGA 1BFVL 2FYYA 1CGVA 1D6EB 1U0QA 5BOPA 2VB5A 2H2SD 1KCVL 4OTXL 2G5BA 4TVPD 3SE4A 4RGOL 1UH3A 2ADGB 3MCKB 5DZNA 5KVEH 2DBJA 3REWB 4K94H 3A6OA 4NT6A 1SY6A 1RUKL 4NGHL 3UTPD 2DDQH 4U1IB 4JY4B 5F9DC 4KHTL 1LO3L 1J8HA 5A1AA 5IMLB 5KSAB 3GBNL 3GSRA 1UKSA 2P5EE 5IWLC 4Y5VA 2LAAA 1ND0A 1WBYA 3I9GH 3Q0HA 4JGJA 4XCEB 4X6FA 2P24B 4MB5A 4AYFA 2X4PB 5JQ6L 5BCAA 5J13B 3WLWD 2CO7B 4OF7A 2H8PA 2EDQA 2Y1VA 2Y72A 3GSOA 2PXYA 1G6RH 3VE0B 4GRMA 4KH2A 4IJ3B 3TBVB 1MWAL 1DQJB 1ZT1B 4U6XB 4GKZA 1CZ8L 3M1BB 1PDKA 1OARL 4LLQB 5FCSH 1XR8B 1VFMA 4H1LH 3MLSH 3OKKA 1UYWH 5KOMC 3PWJA 1NBQA 4JM2A 4GMSH 5CGYD 3UO1L 2CD0A 3RGHA 5KVMC 3TA3C 5DQ9B 2DQIH 5GS2D 5D7KD 1ZLVK 1MQKL 3KVQA 1WFTA 2Q20A 3AREA 4O4YH 4JAMB 1RZGB 3DJ9A 1JYXA 3UTOA 5ERWB 4Z7WA 4GW4A 4OLYH 5HGDB 4F3FA 3DBXB 1S3KH 2VAAB 3VFTB 3DYMA 1MRCL 1P9MC 4IRJC 1TETH 1VEPA 3GI8L 1CFTA 5E8DH 3U82B 4F7PA 4YXKL 3L95B 1AD0A 3C2AH 1FGVL 1CDHA 2L7UA 4LCCB 4YWGH 3LS4H 4QOKD 1AO7E 3HE6C 1X6NA 3TCLA 1KIRB 3I02A 5AZEH 3U6RB 4NBZB 1QLEL 4PB9H 2CRZA 3X3GL 1OQXA 1R3KB 2XACC 4M62L 1A7RL 3SDXA 1DVFD 3O0RL 1YNKH 4C59B 4M48L 3QNZA 1V7ML 1NCDH 3PP4H 2BJML 2NLJA 3DLQR 5CD5C 1NMBH 1JWMA 3ESUF 4N8VG 3WSQH 4NKQB 1A47A 2OJEB 4X80L 3RWJB 2IFFL 3SOBL 5JO5A 1A9BA 3P30H 3PABA 4WFGE 1ZANH 1A6ZB 1BIIB 1PG7W 4JJ5B 5HBBA 4QOKB 5ITFA 4KPHL 4G8EB 1S7VB 2X4NB 4YR6A 3QUZC 1MLCA 4L9DA 3D87B 4JZJC 3EOBA 4MNGE 4IOIA 4XAKD 1HCFX 3D39D 5FXCH 1YDPB 1G6VK 5ICZB 1RZKL 4OZFG 4S1QL 1DVFB 3H9SD 1K9TA 3EO0A 3IDYC 2WQRA 1S7SA 1TJIH 3T0ED 3CDGB 5FGBC 1W0VB 3NOIA 4OUUB 1U8MA 4M5YL 3QUXD 3HAEB 3V8OA 5F93C 3PDOA 1OTSD 3BAEH 1P6AB 1AP2B 2EE2A 5GRWA 3RY6C 3FFDA 3TO4C 5HGHA 5FF6B 3BMWA 1BD2E 3O3AB 4PLOB 5F9JB 2R1YA 3T4AA 5IBTH 5EOTB 4ZTOL 2E8YA 3MRBA 3O41A 3CFDA 2BNQD 4Z95L 4YHNB 1ZXQA 1RURH 3D39B 4DKEH 4YHIB 1VPOL 3MNWB 1I7UA 4MCZA 4RBPH 2WWMC 2GTWB 2OR9L 3FAXA 5IFJB 4K23H 3T0EB 3FT2B 4Y5YA 1NEZA 1A14H 2KQMA 2P4AB 5EO9A 4W68A 3QUXB 2YRZA 1DUYB 1U8HB 4PJAE 2VMFA 3MLRL 2HP4A 3KPRE 5D7IF 1EJOH 4K7FA 2VE6A 3MLTB 4YDIL 3WNNA 2EKSA 2AK4A 1JPFB 1F13A 1MOEA 2CIKB 1UC6A 5F88B 4CJ0A 3S3PA 2EH7L 1UWGH 2Z31A 2BNQB 3ZHDA 4ELKA 2MWCA 3V0WH 1ZSDB 3BUYB 1A3RL 4RZCB 5CUSH 1NGQH 5GZNC 3SGJC 4Z0XA 3WFHB 4O58L 5TFSH 3VJ6B 4YHML 3VMOA 3GMLB 3FO2B 2C1PB 5DUPL 1A4KB 3SDYH 5DMGD 2ICWJ 1NGZA 3MV7E 3ULUC 4N8CL 5H94A 4NUJB 5JHLL 3TYGH 4L1DA 4ZS6C 2F5BL 1JE6A 1ZS8A 5DFTA 1DR9A 2VDLH 4MDJB 1CL7H 3F7VA 1G7JA 4OCYH 2YBRB 1IC4H 1GOFA 3OPZH 5HPOA 2IANE 5FM8A 4X6CE 3P77A 3WNKA 4AT6A 2VO5A 5K9KB 1INQB 3VD4A 4NWTH 4NN5C 2UV3A 4UILH 2UY7A 4A6YA 2DICA 3HC0B 3L3DB 3SE8L 5IB4A 1WBXB 5HGAB 4Q9RL 1WTGT 3DARA 3WIFA 4H25B 4BZ2L 4FG6D 3T04D 3WS3A 2DQCL 2YD9A 3WNOA 1KULA 2AJUH 4MJ6A 3U0PA 4P5TA 2R1XB 1IZKA 4RRPA 4RAUA 3T3MF 3L3JA 4M9OA 4PB0H 1HILB 4HMEA 4JM4L 2VDKH 3B9AA 3U79A 4HLZH 5TH2A 4Y7MA 2YXMA 3BEWA 3NTCL 3ULVL 4EI5D 1SYSA 2NQCA 1K8DB 4PRIE 1NANI 5FYJU 4XC1L 2EO9A 3AVEA 5AG8A 3ECBB 3VFVA 3JBG7 4UOW1 3RDTD 4A2MA 1E0OB 2B1HL 1VKXB 1TTGA 5EIQA 3BGMB 3V6ZB 4G8GE 3BP4A 4HF5H 5EOCH 2GFBB 2AV1B 3CX2A 5C07E 1N7MH 4NQVB 5IHBA 3LAFA 3GSVB 3P2TA 3PGDB 4WHYG 3LCYA 4LOUC 3U4EA 5GRVK 3MV01 5TE7H 1DUZA 3THML 3C6LC 3OZ9L 3CVIH 4IIQC 3ILQD 4ZFOL 3B2UD 3HC4H 5FECA 4JDTH 2FGZA 1SEBB 4MNHB 3NCYS 4EI5B 2QTEA 4ZFZB 3QUKA 1J86A 5KVGH 2GSGB 1A1OB 1RD6A 3S5LA 1H8SA 1TNNA 1TQBC 4Y2DC 1I1FB 3QRGH 4KVCH 3BD3A 3RDTB 3EO9H 3OJ2C 2R0KH 4L4TE 3W5MA 4J12A 1QBLL 3SDDA 1EMTH 1LEGB 1QG3A 3STLA 4OZGE 2F9BT 3OWEA 1D5BA 2VLJA 4IHOA 4JO2H 3TWCL 3F5WA 2PTVA 5E2JA 4WEUD 2CDGA 1NEZG 3OHXB 1CBVL 2DM4A 4Y5XC 4U0RB 3QIWD 1A0QL 2X7LB 3L3GA 1AR2A 2WINB 3SGDH 4EOWL 5TF1L 1PY4A 4UT7L 3ZKXC 1R5IB 1UZ6F 3CFBA 2C3HA 2C3VA 4IEFB 5GJTH 2ATPB 4RFOL 3MROA 4GXVH 4HHAB 5DGQA 1K8IB 2HVKA 5EFIA 5B8CC 2YUVA 4D0DB 4OGYL 2ARWA 3LDBC 3MC0A 3X11A 4TVPL 2ICES 3V0AC 2AJSH 4Q0XH 5I17B 2CDEA 4Z77A 1W72A 3TNNB 2WBWB 2VLLB 1U9KA 2NY1C 4O51B 2J8UF 4F57L 3KGRA 2HTLD 3QIWB 3FAWA 3C8KB 5FA3A 1NMCC 2NY2D 4JB9H 2EC8A 1UZ8B 1SVZA 2Y5TB 1TQCB 4KKAD 1XGUA 1SM3L 3QZWA 3HC3L 5KSBA 1X4ZA 3FMGH 4FQCL 1N4XL 3QPXL 3H9HA 1KN2L 5IQ7H 3VWKA 4AQ1B 2E5EA 3P9MB 2I5YH 3MNVA 3RWIB 1RHHB 1M7IB 1Q0XH 3MXVL 3DTXB 3DX7A 5HHQA 1E27A 4HKZA 3ALPA 4RSVA 5F44A 3DX9A 5GGSA 2WP3O 5I75B 3S98A 4AL8H 1FFNA 2CLRA 4WO4D 3ULVE 2NY2B 5KANG 1XR9B 5MEQB 3RZCC 3OJVC 4GRLD 3CU1A 5DS8A 5D4QA 2D2OA 1YNTA 3EIFA 5KZCD 3S36H 4RRPG 3PHOA 3DWTA 4K55A 4PRNB 2ICEA 2FBOJ 4PUBL 4AMKH 3O45A 4Z7UF 3CLFH 3QPQC 1J05B 1P7KA 2RCSL 4JFDA 5J7CC 2ADFL 4LRIA 2HFFA 3C5SB 3GSWB 2X9YA 4QTHA 2WM0A 2J88H 4OKDA 4WO4B 2MQ3A 4OCXH 1YEFH 4GRLB 4NNYB 3VWJD 3K1KC 1GGCL 4JREB 4HGKC 5KZCB 2EIEA 2W0LA 4M6ML 4DN4L 3PJSB 1KIUA 2AVGA 1DBJH 3ARPA 1IC5H 4YHLH 3DGGA 4OM0H 1FG2B 1FAIH 1HWHB 3O3UN 1A7NH 5BO1H 2A1WL 2ERJC 3Q1SH 1OSPL 4IDJL 4N9GA 4BK4A 1BEYH 1DLFL 4ZO6A 3HZVB 3JTTB 3S5LG 1XAUA 3KPPA 2AXHA 1V8HA 4HJJL 2P49B 5CZVL 3GSNH 4GG6F 1UQSA 5DO2D 5EO1A 1FORH 5SWSE 1MY5A 4KDTC 4OZIF 3FL7A 2VXTL 1VGEL 3VWJB 3ARDD 4M93C 3QA3A 4P46D 5FO8A 3ILPA 3MRKB 5JR1L 1HHIA 2VITB 4XNXH 4M7LT 1CLYH 4OD3H 4J1UA 4XNZC 5FYKD 3RQ3A 3HI6L 4H0IA 4UDTA 3CFIC 1CD0A 1QEWA 5HI4D 4HIJA 1BM3H 5L7XL 5D5MA 2P5EA 1CGYA 1FG9C 1L0QA 1SBSL 3GGWA 5EULV 1NGXB 3IAGC 3N85H 2EDLA 3VA6A 4NZRH 2VABB 3TYFB 4Q74A 2B0SL 1G7LB 3B43A 1C5DB 1KGCD 3OKLB 1XCQB 4NN7B 5DUBA 4HXAL 3WUZA 2ZUVA 4JJHA 3RWCB 4L8CA 1GCFA 4CUCA 4Z8FH 2NZ9D 3FQRA 3ARDB 4P4KC 4U1LB 4DKDC 4P46B 5I2IB 4EQ2A 4NFBA 4PJDB 3CXHJ 4R7DA 1BOGA 2H32B 4LARH 1NC2A 2DM2A 1EH9A 3WEXA 2P45B 1FO0H 5JORA 1R5WA 2CGRL 1CGUA 3QDJD 4L3CB 4DUWA 3PWPE 5BV7C 5CGTA 2DLFL 4L8BB 2ZUSA 5DQDL 5E5MA 1PJ9A 4J3UA 3VFUB 1T1ZA 3BJ91 4TSBL 4H5SA 4IS6B 1E6JH 1KIQB 1NGWB 3NABL 2UYLA 3SDAC 1OGAA 3EOTL 3OKEB 4DEPB 5DJ2B 3RPIA 1WZLA 5GGRY 4CJ1A 2DQHH 5DHVA 4OZFH 1YEHL 3QDGD 2XQBL 2O5YH 4WFFE 1Q9WA 4PJ7A 2E6JA 3QZWG 5EOQH 1MCHA 5C0BE 1DEDA 4P2YA 1IC7H 1A1MB 1WIOA 4H20H 4OJFH 5BXFB 4N5ED 1KEGL 3QDJB 4LKXA 5ESQA 4Y4KA 4NHCH 2JCCB 1TCMA 3LKQB 3CFKB 1GC1H 5L6YL 5DK2B 4UU9B 4XI5D 3O6KH 1CICB 3QQ4B 1RZJL 1YJDH 1PD6A 2PR4L 5I1HL 2DQFB 3F12A 1YEDB 3PXHA 3VXRA 4DN3L 4MJ2A 4V1DD 1IARB 1IAMA 2VXSL 1PZ5A 2GUOB 4HS8H 1GL4B 3RVUC 5A3IC 2X40A 1HQRB 3GMNB 3QDGB 1BFOB 1QO3A 4N0UA 2FZ3A 4TOYL 4I3RL 6FABL 4HKJA 4UNTA 2ED8A 4OLUH 3SBWA 4BSJA 5CIPB 1CD8A 4MNGA 4OD1L 4HJGB 2ZSVB 5BVJA 2ILLA 1KN4L 1NCBL 4Q2ZA 1SY6H 4P9HL 2VR4A 1EEYB 5T1KD 4PYGA 1MUJB 5I73B 4W6WB 5JXEC 2UWEF 4RQQA 1AQKL 1NFDE 4V1DB 4KUCF 4TUOA 3KG5A 4HGMA 4UV7H 4XP5H 3EYSH 3VFOA 3DMMA 4OF0A 2EEDA 5IG7A 3WDJA 4Y19E 3HRZB 4FQXD 2VL5A 4XPTH 4XBGB 1BD2A 3BPOB 2DD8H 3NN8B 2DWEA 4UOW0 4HWEL 3HZYB 4M7JH 4NKIL 3DVFA 3G9AB 1G7MA 3OAZH 3LH2H 5I1CL 3SN6N 2G75B 1YMME 1U6AH 2IPTH 2C5DC 3QEHB 3ARYA 4WW1B 4YZFE 5K33A 4PBXA 3F6LA 4JRXD 5IBUB 1ORQA 4G6JH 2ED9A 5T5FH 1WTLA 3Q3GA 4PJAA 4DTGL 4QRPE 1WGOA 3ARGD 3FN0L 4M1CD 2QEJA 4FQXB 1KC5H 2IJ0C 4F58L 1KF9B 3L1OH 4HT1L 1CT8A 1MWAA 1LEIA 3ES6B 5ESVA 4JKLA 3FZUC 4AM0B 1G7PB 3UYPA 1DQML 2Q76B 2HKHH 1VFBA 1U8JA 5HPMB 4KZDH 3LKOB 3EDEA 2V2TB 2HN7B 4GO6B 4RISL 1NC4D 4M4PA 2DI9A 4OIIH 4PJEF 1AXSB 1RIUL 1R5VB 5DK0B 3NVQA 5DJYA 2Z8WC 1E4WL 4F8QA 1KJMB 4JRXB 1B9ZA 4WEBL 3H7BB 3QXDB 1NAML 4JRYE 4OCNC 1XF5A 5I9QB 1PX3A 3ARGB 5J9PA 4AIZB 1JNNH 5HHME 4EVNA 1OAKH 4NQED 5JW5B 4BZYA 3MRCA 2ZKHH 2R69L 1MCQA 1AIFB 1GGBH 4FXKB 5SV4A 4J4PD 1ZTXL 3FTGB 4M43L 1RK0A 1IFHL 2Q8BH 1NC4B 4JE4B 3EYFB 1A6UL 3P3YA 5EOCJ 1VGKB 5L8KB 1U8KA 3VFWB 4XGZB 2YD3A 1DSFH 1IKFH 2R0LH 3D9AH 4U1JA 3QFJA 4WHYH 3BKYL 4JFZH 4YO0A 2HVJB 2CO6B 1RMFH 1X5IA 3T77A 3PF2A 1YN6B 5KSAC 1NSNH 4X6EA 1MJ8L 1TPXC 4UDUA 1S78C 2J8OA 5E95B