2XNCA

Crystal structure of an engineered ferredoxin nadp reductase (fnr) from pisum sativum
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
287
structure length
287
Chain Sequence
SKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRVPDGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN--NADP REDUCTASE, LEAF ISOZYME, CHLOROPLASTIC
publication title Swapping Fad Binding Motifs between Plastidic and Bacterial Ferredoxin-Nadp(H) Reductases.
pubmed doi rcsb
source organism Pisum sativum
molecule tags Oxidoreductase
total genus 92
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2xncA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2xncA02
1J9ZA 4YAWA 1IJFA 2BPOA 1QUEA 2VYQA 1CQXA 3QSYA 1TTTA 2AHOA 3J81k 3W2HA 2NPFA 4RD4A 3U6KA 4IW3B 4EH1A 3B82A 3AGQA 4U9UA 2R6HA 2RC5A 4B47A 3W2FA 3OW2B 1BQEA 1AMOA 1AIPA 1YJWB 4Q7JB 4RD3A 3VNVA 3I55B 1G7TA 1GVHA 1FNMA 3AGPA 1VQ9B 3WNDA 4FN5A 5GV7A 2XNCA 1Q86D 1QVGB 1QFYA 1EFTA 1B2RA 3AVVA 4PC2A 1VQMB 4HE5A 4LBWA 4AC9A 1IB0A 2B7CA 3JQPA 2B5OA 3LVBA 2D74A 1JJ2B 2X3UA 3OJWA 1JA1A 1QFZA 1QVFB 4RD6A 1BX1A 3QFSA 4PC1A 4AF7A 2YWEA 1R5NA 4G1VA 4B44A 1B23P 4LBVA 5JBQA 3CB4A 4H9GA 1F60A 1FRNA 2DERA 1TLLA 2QTLA 4G1BA 2QTZA 1ELOA 3P26A 1KRHA 4M1KA 4ZV4A 1SKQA 2YWFA 1ZM2A 1VQ6B 3V76A 4AF6A 3ZC3A 5TR9A 3AVYA 2YWGA 3WXMA 2BMWA 1EFUA 1HA3A 1YJ9B 3VO1A 4ZGQB 2EIXA 3CCVB 4P3YA 4K1XA 1FNCA 4B43A 3CC2B 4PC6A 2ZITA 2CRVA 1KK3A 4M2LA 5TY0A 1QGAA 1ZM9A 3JQRA 1I7PA 3E20A 5THXA 3CW2A 1EP3B 2EFGA 2HDNB 1VQOB 2VNIA 1WDTA 1EP2B 4G5GA 1EWYA 1DARA 4WQMA 1H42A 4R71A 1G7RA 1W2BB 1KK1A 1KD1D 1EXMA 2YWHA 3WBKA 1S72B 4DQLA 3W5HA 3CCLB 2DY1A 3WYAA 1QFJA 4NBSA 2RC6A 1F20A 4HE6A 1XB2A 4TMZA 1XE1A 1G7CA 3U2QA 3QFCA 3ZBUA 4C43A 4RJLA 3SJZA 3LRXA 1YJNB 1G7SA 3QE2A 1QGZA 3CCSB 3CCUB 3AVTA 3CD6B 1E64A 1ZM3A 3WBJA 3A1FA 1ZM4A 4ZCLA 1BJKA 1E62A 1D8TA 3WY9A 4Y7CA 5HXBA 3W2GA 4FWTA 2OTLB 3OZUA 5DSZA 5KSWB 3FJOA 4YALA 4RD0A 2PMDA 4Y9RA 3JQQA 1KK2A 3AVXA 1N0UA 3CCMB 4B3XA 1EFCA 4FK8A 1OGJA 2OK8A 1QGYA 2VNHA 2BGIA 3CPWB 1SM4A 3U6BA 1YHQB 4MYUA 1TVCA 3LO8A 1YITB 2DEUA 4F7DA 1JNYA 4NCNA 1JA0A 1VQ7B 3ZZUA 4RCYA 1W87A 1GR1A 2BV3A 1CNFA 4TMXA 4ZCIA 1VQ8B 1NDHA 2QN6A 2BM0A 1EP1B 1KK0A 1KQSB 2XNJA 3FPKA 3VO2A 3OZWA 2FX3A 1KTVA 1FNBA 1N8RD 3VNUA 3CCQB 3ZZTA 4PGOA 2C78A 4N3NA 3P27A 2VZLA 3ZBTA 2VNKA 3W5UA 4QHYA 3QFTA 4PC7A 4TMVA 3W2IA 4ZGNB 1OB5A 3MCAA 1DDIA 1M90D 1K8AD 2B7BA 1Q81D 3QFRA 3W5VA 2CNDA 3CCJB 5GV8A 2XEXA 4YAUA 3ES9A 3ZZ0A 2QMUA 2DCUA 2OK7A 1R5OA 4YHBA 3MHPA 4Y9UA 1TUIA 2BM1A 4RD2A 1K9MD 2VNJA 4QFMA 1YIJB 4YAOA 3CMEB 2BN4A 1GAWA 1JB9A 3LYUA 4PC3A 1VQ4B 1N0VC 2BGJA 1KC8D 4LC0A 1Q82D 2E1RA 4UAJA 5AN9A 2BVNA 3WNCA 1A8PA 2BSAA 2GQFA 2HCJB 4DQKA 1QUFA 1M1KD 4ACBA 5TV2A 1QH0A 3CC4B 5H59A 3CCEB 1QG0A 5EMNA 3I1FA 4M4SA 3W2EA 4B4DA 1UMKA 4M0LA 2DETA 4TMWA 1FNDA 3CCRB 2OTJB 1GJRA 1GO2A 4TN1A 1U2RA 4P6VF 1H85A 4ACAA 1FDRA 3OZVA 1D1NA 1OGIA 2QEXB 2PLFA 4RD1A 1VQKB 2J7KA 4N3GA 4RCZA 2BF4A 3AVWA 4B48A 3PENA 1DDGA 4M53A 3G4SB 5H5JA 3E1YE 1VQ5B 3G71B 3CXCB 5FA6A 3I56B 1R5BA 1NJID 3WNBA 1YI2B 3MMPA 1BX0A 2PIAA 3CMAB 1VQPB 4MYTA 1W34A 4J0QA 1ZUNB 1D2EA 3B8HA 1KJZA 1VQLB 2QDXA 1GAQA 3CRZA 1QX4A 4YAFA 4ZCMA 1K73D 1FRQA 3AVUA 1S0UA 4LBZA 3G6EB 2GPJA 1W35A 4TMTA 1OB2A 3OJXA 3B78A 1E63A 2HMAA 3CC7B 4LBYA 1IJEA 4C0SA 1VQNB 2QA4B 1Q7YD 4BPRA 3VMFA 2C77A 1CNEA 1DG1G
chains in the Genus database with same CATH superfamily
5JLJA 2WM9B 2JFUA 3MXTA 1GZ5A 2XZPA 4EO4A 3VPXA 2X7XA 2Q4DA 4L9AA 5M34A 4U4AA 4I1PA 3V8MA 3CLSC 4E5VA 1D6MA 1LC3A 1X1CA 3NANA 4Y6GB 3ZKWB 3ASQA 2NM0A 3ODGA 5I4BA 3SHWA 3F5QA 2ZBUA 1C4OA 1KDRA 1OCEA 4LX0A 4QU8A 2WAXA 4YS6A 4QUJA 1JMKC 5KVAA 3IJRA 4LTDA 3U6KA 5BSWA 1HM5A 4IW3B 2OILA 2WJYA 1NRXA 3I30X 1JPNA 3R6LA 4FFVA 3KKKA 4F4CA 1G1AA 3ZG6A 4HXEB 1P2DA 1HWYA 4MKHA 5THKA 4M88A 2FN8A 3JZMA 3MILA 4UBJA 3BWXA 1JVNA 2HXSA 5HSGA 2RGNA 2CLSA 2H54A 2WTNA 3UC9A 3IURA 1Q77A 5CGZA 3KEGA 4P4LA 1PNRA 5FWXA 1IWPB 4EQ6B 2FUG6 5A4DA 3CLVA 3LU1A 5BRAA 5KNDA 3GJXC 3BWBA 1L5VA 4OLJA 3HP4A 3GZNA 2PZKA 4CL8A 3CTMA 1L5SA 2GOYA 1KMMA 1I3NA 2ONYA 2VZ0A 2Z4SA 3O4HA 4NMXB 4RA6A 2XNDA 4DLSA 1DX9A 3IILA 2XWSA 2F55A 4G6ZA 2IYAA 1E6UA 2C31A 4MLCA 3FI0A 3PJGA 2OSVA 4R3UC 1WZIA 3WLOA 4P5PA 4Z1OA 4S2UA 1IZ7A 3LA8A 1U1DA 1UJ5A 2Z8XA 3OZ7A 4F4FA 1IN6A 3UN1A 1SELA 1VCIA 2VNAA 4DNRB 4UCQA 1VQMB 2PA3A 3IH5A 3WS7A 2X6QA 1R3UA 2NOAA 4HQOA 5DV9A 3CWCA 2ID4A 3Q3HA 4HDMA 3VZDA 4X95A 4BN4A 2K6GA 2FUG1 1N6OA 3JARA 3ROQA 3X1WA 3C3KA 1DZIA 3M5CA 3WL7A 5AXBA 1S2LA 2OCGA 3F1LA 1C1DB 3OCJA 3HBJA 1B3BA 2WV7A 2X8JB 1ZX1A 2RH9B 2XLCA 3DYIA 3LVBA 2DJ5A 3DKIA 3NM5A 4HRYA 1RE1A 4KMMA 5LDDC 1BA3A 2QRZA 4B87A 1DO2A 2QLMA 1DT3A 1OXMA 2H0QA 2WJAA 4HWGA 1KE2A 4IG9A 1EUYA 1R6TA 3E82A 3RIYA 1Q1NA 1R6UA 3N2KA 3V4PB 1RMTA 1GNQA 5LPNA 1TAUA 4X1YB 4ZODA 1WIWA 4DBLE 4FFBB 1G59A 1O7JA 3PX2A 1R9NA 2J7PD 3EF1A 3VTKA 4W1SA 2IH2A 5DGCA 2QA5A 2F43B 3E9EA 4N0EA 2FKNA 1F60A 2DERA 4DZRA 4RWEA 3R8FA 3EBOA 5LYJB 2FMFA 3QELA 4HQNA 1CY4A 5ELMA 2IV7A 3KXLA 1W1IA 2QLJA 9LDBA 1PFVA 4J0DA 5A89A 3O0DA 5KNCH 1Z07A 4MRVA 3OZRA 1IHMA 2CHQA 2C4MA 3HO8A 3VOAA 4JP3A 3CR8A 5EXXA 5JSKA 2VJIA 1PSDA 3EVGA 3H11B 4XQGA 4JT9A 1UWLA 4J2HA 3T3MB 4EHNA 5DBIA 4DA4A 3ERCA 1SQ6A 4EW2A 4OP1A 4XGNA 3W3AD 1X77A 4H31A 3SQNA 3TECE 4JL6A 4MCAA 3VO1A 1GZSA 2YJ3A 2EIXA 4LQCA 4WXPA 4BEVA 4Q9IA 3LAWA 4TTIA 1RJEA 1YE3A 3IEIA 3OOWA 3CONA 3F98A 4D8WA 1V16B 2AFHB 3M2PA 4YV7A 1YR1A 2CRVA 3GLHE 2K5UA 4JMLA 1N0IA 4YRRA 4CG0A 4DSNA 5JXWA 3PSAA 1K8ZB 4D2IA 4YY3B 4KFCA 1V5VA 1EAMA 2WSSA 1SU8A 2C2YA 3LLVA 4HDSB 4GR9A 5JZ9A 1GILA 3KEMA 5DCLA 1NW5A 5JTTA 2XZOA 4UNQA 1WP6A 4CETA 1JEQB 3H4TA 1Y4UA 3RCBA 4HNHA 1K86A 1Y1QA 2CLIB 2FEWB 5J4VA 3B6MA 5CJ2A 3OOHA 2QL9A 1ODFA 4JK3A 2I8AA 3PE3A 4BBJA 2HDNB 2VS1A 2JFNA 3L1IA 1YV9A 4E03A 5LL6P 4TLMB 1QRTA 3QLTA 4CFYA 1S01A 3LPDA 4J7XA 2ZSBA 3AERB 5BWBA 1G8KA 5D51S 1ZMTA 3LHDA 2WZBA 1YTUA 5IPFA 3V4OA 3DDHA 3FOAA 2ZAYA 3RSZA 4PYJA 2OUIA 4MKFA 2WF7A 3LX4A 2QYOA 3FX2A 2DTXA 4M86A 4NMHA 3ABZA 4CIXA 1GFSA 2IYPA 1KZ6A 4EHKA 2B35A 2OZEA 5LQJA 1CS4C 1OFGA 5BNWA 1I1NA 1QIDA 2V4DA 3RC2A 2X4DA 3W5HA 3CCLB 3PIDA 4HG2A 2W2MA 2E9SA 3EXFA 2AH5A 4PQGA 1LQ2A 1PFYA 1RYZA 4DRYA 2XUGA 2WIGA 1ZGBA 2AB0A 2AMJA 1QAOA 3DM9B 1HL7A 1QCDA 4TUYF 1KQFA 3NIDB 4P7KA 4RCVA 5GP1A 4RFSA 4MRSA 4NOMA 1F20A 1AX9A 5G2OA 5IJXA 3ZDDA 1K5PA 3HN7A 1TEXA 4CXMA 2QQFA 1ATZA 3WYNA 3C3JA 1TQDA 4O4IA 1PEAA 2D0IA 2DLDA 3GJ5A 3KPWA 3B70A 1TLFA 1XEFA 3OPVA 5DIFA 3UHOA 2ACKA 3EISA 4DN6A 5I45A 3ABQB 2E21A 3QOXA 3BT7A 1Y6JA 3WLSA 4MV6A 3CD6B 3PEUA 1V7CA 4BE7B 4YGXB 4ON9A 1X3LA 1FFAA 1LPOA 3BCFA 4GRAA 2PO5A 1KL7A 4RXMA 2PH3A 3AEKB 3K35A 5CH5A 1F5NA 4GE0A 2Y2UA 3L5KA 4TVBA 3EGVA 5JMWA 5ADUS 2LE0A 1T91A 2JFFA 3Q87B 4EL0A 1BS2A 3RPEA 4YPOA 4C0HA 3A05A 1NPYA 4DREA 2VBVA 1P60A 2AMFA 1YQTA 5COQA 1NPDA 3U3MA 3QIVA 5BV1A 1WAMA 1LTKA 4OPOA 4JGBA 3ZU3A 2PKYX 3PQ7A 2DYKA 4HDNA 5D3MB 5DW0A 1PD1A 1RQNA 2M1XA 2HHJA 4PPNA 4BMVA 5F4ZA 1L7RA 2LV8A 1G4UR 5K3EA 2AZDA 5C53B 5IU6A 2XQJA 2JLVA 4G3XA 3C85A 4ZMBA 1UK8A 4UOQA 2E1BA 1S4QA 4L08A 2LGJA 4IJ5A 3DV0B 1ZITA 4E46A 1WTCA 4LOHA 1E18A 3YASA 3N2ZB 3PRYA 5I47A 3VJRA 2NX2A 2BMAA 1XZAA 2V0CA 3MTIA 3OTGA 4QV2A 2I8CA 5L8VA 2AJBA 3OKCA 3EQZA 3EVBA 3DTVD 4XUCA 2XMZA 2FQQA 3GFRA 4OUKX 1WHSA 1XZ8A 1KDZA 3I52A 3AUYA 3LLUA 1YDGA 3EVTA 4YQEA 3UB3A 1WABA 2DEUA 4F5ZA 2JLSA 3UJ8A 2EKLA 4CQLA 4MV8A 4KDCA 2H4YA 1HDIA 1NWCA 2BZGA 3QUQA 4QUIA 4LXYA 3KQHA 4K81B 4O4JF 4BZWA 3ZZUA 3C6MA 4RCYA 4H59A 4A0HA 1W87A 1T1JA 1WBBA 1XZIA 2GN2A 3EA4A 1JKMA 2BHRA 2GNAA 3K96A 3LOPA 3LUAA 4TMXA 1VQ8B 4Z7OB 2G3YA 1OILA 3G2LA 5TNXA 2ZQ5A 5GMOA 2C5BA 4DJEC 1Q7TA 2W2PA 1LU9A 8MHTA 5CUQA 1HR0B 3O4RA 3AVQA 1ZZEA 3R7LA 2V8OA 2O5EA 1QQTA 3FPGA 3KZOA 3SIRA 4MWGA 3AH8A 4FMDF 1BMFA 3RAPR 4OQXA 2VLIA 1FMCA 3EMVA 1I1OA 1R8JA 2IQIA 2O8BA 4C7BA 1WD7A 5DNEA 3OIWA 1DLIA 1JNXX 1LJLA 2ZGVA 4Y2PA 4DIUA 3VNUA 3LA6A 5IHPA 3Q9UA 3V80A 2VZLA 2OFXA 4HLQB 4QLOA 3ZK7A 2ZJBA 4O2AF 2OP0A 3WA6A 1BVUA 3DKVA 3R3JA 4KC0A 2SKEA 5BN4B 4CL3A 4JI2B 1N5KA 1WCXA 2W5UA 1MV8A 5DN9A 1L4NA 2I71A 3MRVA 3A4TA 2AOXA 3IEVA 1M90D 2VBIA 1NTRA 3ISJA 4CEJB 4RK5A 3AFMA 5CLLA 2BH9A 2QAGC 4KHZA 1I2BA 4M1OA 5TPZD 2IYQA 3EQ6A 4I9UA 2D2XA 3VU8A 3KL2A 3W1WA 4ZJZA 2V6GA 5IS2A 4PPGA 2BE7A 5DNUA 3H5RA 1W0JA 3NXSA 4MIKA 2YQ4A 5IMBA 8LDHA 3GROA 4DUPA 1XQVA 3D2AA 1R00A 4JD5A 2IW1A 4HR7A 3WLFA 1J09A 2CJWB 2YQZA 1W29A 3P4UA 2JC3A 4BGVA 1S8NA 1OF1A 2PX2A 2X5NA 3BSYA 5B58C 1BXRA 1RZRD 3AR4A 2WKPA 3ROKA 2PKWA 2CNKA 1XCOA 5CVCA 2WAAA 2VHCA 4ENSA 5KWVA 2ZT5A 2NTYC 3AF4A 3CZRA 4XVQA 3IBCA 5EMMA 1NN3A 3H0CA 3WOVA 4F21A 5AHXA 1P4JA 2QU7A 4XOPA 3CX7A 3GCZA 3MPUA 4KQMA 2EQAA 2XCOA 1UMDA 5FV4A 4RW0A 1A50B 4G1CA 3ZS9A 1E9VA 3QU7A 4YAOA 1YC5A 1AGRA 1AKEA 1K6JA 4R3NA 5AJYA 5TEVA 1KGDA 1ODSA 4KODA 4S0XA 4KHPB 4Y2RA 3EH1A 2BN4A 1NMYA 1NNLA 2Q4RA 1HLFA 4P3XA 1W4ZA 1GUYA 1NASA 1C4KA 1HI9A 3WKDA 2VI5A 4ESEA 4R7GA 1DC4A 1JQ3A 3LPAA 4WAUA 1B8NA 1E8DA 2CFRA 1UANA 2DMRA 1Z29A 3QV2A 1GKUB 1M1ZA 3HRHA 4U2BA 1YDMA 2HXYA 3FCEA 3FHCB 1KJWA 1I36A 1RLUA 2R47A 3KOUA 1KSJA 1KSHA 1W9HA 5BV8A 4RA9A 3QHQA 2GXSA 5E38A 5BSRA 1J6UA 3D6AA 3HZOA 2PUAA 2BRUA 4QPJC 4XVCA 1ZWKA 2VJKA 3IAAA 3ROEA 1LW7A 1Z8HA 2HC9A 3Q7RA 2ZAIA 1LDMA 2GREA 2I4RA 1XXHE 4CG2A 4CKEA 2DLCX 2VOEA 1W5TA 3AUTA 4EVQA 3I2IA 5K3SA 4AX4A 1DEHA 1Q2XA 4CM4B 4DLWA 4CCAA 5CYFA 1JG4A 4WZBA 5BSMA 1P0IA 4WN9B 5I4KA 3HO1A 5AFSA 4P3OA 1GPMA 2OCAA 4X9XA 5BP7A 1KIFA 2OOKA 5TE9A 1VHLA 3PFNA 2QR5A 2ERCA 2C3YA 2XV1A 3W2EA 1KO4A 3DAFA 3BRCA 2CDAA 3Q6RA 3G2IA 4ZC1A 2WD7B 1MO6A 4CLXA 5JSZB 4X3OA 4YDRA 4E4RA 1D4OA 3WV4A 4KUHA 3EG9A 5KCMA 1PVVA 1QHSA 4JR0A 4PZLA 4IZOA 1OZHA 3KSDO 3RD5A 3ENKA 4H60A 3D1JA 3R0VA 3PWZA 1KEPA 2OL4A 1VJRA 1MQ8B 2X7JA 3BMOA 1M0WA 1RRMA 3D3WA 4TRMA 3TCKA 1R0WA 2QGGA 4OP7A 1TM7E 1UUFA 3QMVA 1LSUA 4MEJA 4UHHA 4PGGA 4S04A 1XGKA 2BJWA 3E48A 4FFRA 3SX4A 4RMNA 1D4ZA 1NF2A 3B85A 2JA1A 3LUJA 1Q3HA 2QRQA 2Y3IA 3HABA 3IMCA 4FFMA 1BX3A 1HZZA 3D02A 2C7GA 1SUWA 4UBKA 1X8XA 1G38A 3BTVA 1WSDA 3PTLA 1YB7A 1QANA 1U2DC 3BKWA 3A36A 3EAGA 2VHEA 2PRSA 3M3HA 1PWEA 3GPCA 1QYVA 3P32A 2NACA 1Z7YA 1ZXBA 2A33A 3PCRB 1CJVC 1YZUA 4XDZA 4B7ZA 2B0JA 5T8KC 3VBEA 3WO1A 1RXWA 4XUEA 2I2XB 2QTTA 2V9CA 1R10A 5JD5A 1U2PA 3BQJA 3E22B 1NJID 4QUHA 5JAMA 3RAFC 2DPGA 1V9SA 1RBYA 2TECE 5ALPA 3R09A 1ZK0A 5ICGA 5BV7A 4E51A 3CLTC 4DCUA 1UZUA 4C6RA 2OPBA 1DWOA 2XHEA 4RHCA 3G79A 5CURA 5T4FA 3RHZA 3UH1A 4BWYA 4R0MA 4XCXA 1FRQA 1BCRB 1RI2A 5E0KB 3HM9A 1UWCA 1ZA1A 2G7MC 4MPTA 3T54A 1MKYA 3WLIA 3WNQA 3X1ZA 5BUQA 1NXOA 2F9MA 4EG8A 4RTKA 4IIJA 3CVWA 5KO2A 4MB0A 2QSJA 4DMGA 1DUSA 2Z8ZA 5ELLA 2O3JA 3AU9A 1JFRA 1OJ7A 1XZCA 1YZYA 5EOVA 2F3QA 2HMAA 4W7IA 1J9GA 1M34B 1Y1PA 1S96A 2F1OA 2WFLA 3VRHA 2WNIA 5JRJA 3DLBA 5DB4A 3T1HB 2IHKA 3AWDA 4UDYX 1WZ2A 2X5OA 2WHEA 1OFHA 3NONA 3QUSA 1X8KA 4PO1A 1WU8A 3GRPA 4QICA 2NZ8A 1C0EA 5LP6A 4L8JA 3QE9Y 3W79A 5TQ0A 2ZETA 1JSXA 3H5OA 2PD6A 2AG5A 4XYEA 1TT5B 1CZRA 1USGA 3I6BA 3QW2A 3UIEA 5EINA 3BC1A 4EA6A 2FAXA 1JG1A 3TW8B 3A9CA 4EHHA 4EMTA 1PKVA 3GMSA 3JX9A 4MA5A 4WXHA 2NU9B 2XXAA 4JLKA 2ZRGA 1O96B 4CMAA 3PKJA 2O4UX 4HWSA 4Y1FA 4Z0HO 4ZVNA 3BWDD 4XA8A 3BERA 2ZBVA 2R79A 3QF4B 4P7GA 2A2ZA 2VRCA 1XELA 4DNOA 3DB1A 1RI5A 3NYWA 1KP3A 2CXQA 2JAPA 3W6OA 1CUCA 2XUOA 2EWVA 4D4KA 1UCFA 4EZEA 3JVIA 1OI4A 1SUIA 2F8LA 1WDLA 5JADA 1BOOA 5AI0A 4LJSA 1ABBA 4I4NA 2G04A 2YVUA 3RRNA 5JHHB 4ZICA 3HP1A 3ZXSA 4LGVA 4EYEA 4YV1A 3UK2A 2P78A 3I04M 4R2XA 2WZPP 2RKOA 4QBIA 4KSCA 4E31A 2QZSA 4K0KB 1J0XO 2EIHA 2XBLA 3N8NA 2YMQA 4G26A 4OREX 4NDNE 5JALA 3WWDA 3K0CA 4JFRA 1IY0A 4PM4A 3VJKA 1Y6GA 2W8BA 4OJMX 2JJ1A 1MU0A 4IDCA 3E9DA 4RD3A 1C30A 3EPHA 4QULA 1X87A 3R5FA 5TVGA 2V3CC 4YRFA 1TLTA 1UJ2A 2AD5A 1K6MA 5GV7A 2N3ZA 3ZZNA 3MWFA 3DA8A 1UODA 3OFJA 4NV1A 2CCKA 1ZKMA 1I4DD 2Z3ZA 2F1MA 2Y1LA 3K0HA 4M8LA 1YR8A 3VO9A 1YDHA 2MOKA 2P27A 3A6DA 3CZ9A 3GRUA 4W4TA 5C46F 3E4CA 3THXB 4N65A 4PFJA 3R20A 1TZKA 3KEQA 1JLRA 3SBEA 4NJMA 3U4QA 1G8MA 1O6CA 2JATA 4EK9A 1MNAA 4X8LA 5HIIA 4RTOA 3AFNA 2AVNA 9LDTA 3HXOA 2H5EA 1UFKA 4LTMA 3IDFA 1VL8A 2EJVA 3QXJA 2BFFA 2H1VA 4MI9A 4YK7A 2JI4A 5ARCA 3G1WA 3MQ2A 1DVRA 5F5NA 4DJAA 3WWZA 2HM7A 2CMDA 3EVDA 4YWJA 5LQAA 4YXWA 1O87A 4IKPA 4PS1A 4CCYB 4PXSA 3RRFA 5JI2E 2GEBA 3B6KA 1BHSA 1FA9A 1ZJ4A 4M1EA 3GJ6A 1GTJ1 4N7BA 4CUZA 2N9UA 2B8NA 3EF0A 4BVBA 1E2PA 1V41E 5L4NA 1AF4A 4GPBA 1JSZA 4UQLA 3NPMA 4GBJA 2I4MA 2OFFA 2FMUA 4ND8A 1G20B 2FETA 2NP6A 3HI4A 1RJGA 3EPRA 1RAEA 3F3YA 3RS2A 5BW8A 2UZIR 5ALTA 4NYMQ 3EXEB 1EFVB 4BN0A 3C4JA 4RY2A 1VQ6B 1JR3E 3A27A 3HAGA 4LDZA 3UKDA 1R4NA 4EA7A 5CTAA 13PKA 3LXUX 4RC9A 1GSHA 1WM1A 1GQSA 1O3YA 2A78A 2C4KA 3N74A 2AN3A 1Q6ZA 4B3BA 1Y8RB 4EFLA 5ALVA 1HA3A 4URZR 1K8QA 2R7NA 3O8NA 4HS9A 4OGWA 3T7AA 5FUWA 2HNKA 3CCVB 1MGPA 1U2GA 4HYYA 3A9UA 3AL0C 1Q6YA 3A1CA 4EBFA 5BSXA 3LBNA 2VYFA 1C41A 2Z98A 2HW8A 4CMGA 2FR0A 2CZCA 2R6CA 1CR2A 3GPDG 5CW1A 4HB0A 1SVSA 2H92A 4ALLA 5E3HA 2VP0A 4BZPA 2KS6A 3N9IA 3P5SA 2D59A 1MR3F 2QU8A 3WLLA 3BMQA 1GYPA 2NVWA 2XH8A 2GLTA 2WIDA 2X7HA 3IBSA 3E5MA 5ERGB 1NI3A 2HF7A 2ZS8A 1N32B 1ZN9A 2ODBA 2KSQA 5DIZA 2B82A 5MN6A 3UNXA 2Y4OA 5A5VA 1H3NA 1VIYA 1L7PA 2VEDA 3DCJA 1T9CA 1DQZA 3O1HB 1ZD4A 2PQ0A 4P4SB 3R3UA 4UVHA 4ZVTA 5JWHA 5TMDA 3TD6A 2YYYA 4B6GA 5CCEA 3WLEA 3H9UA 5EHZA 5FWYA 4CEJA 1PL6A 4CM1A 2F7SA 1E2KA 1Z4IA 2YWRA 5JOQA 4FFLA 4RZXA 1C3JA 2NO6A 3L7OA 1QMPA 3NB0A 1W2BB 5F7OA 2PEYA 2XB9A 3OIVA 2G71A 5K8JB 1HEYA 4X06A 3GLIE 1DX6A 1FVXA 4YP0A 1DBRA 4ZK2A 4Z4VA 5FNVF 3RV4A 2CEAA 2FP4B 4V1CI 4ABTA 5CFOA 4LXGA 3U49A 3U31A 6CHYA 1FRFS 1FP4B 3C24A 3C8MA 4JZKA 2HF9A 2RGBA 2DU8A 1AKWA 1UR5A 1X7GA 4EYOA 3HDTA 5KYYA 1ZAKA 2BKXA 4IV5A 1MQSA 3LFHA 1U3WA 4C0XA 1NTOA 3F7OA 3ZHSA 4BCDA 2H4WA 4HE6A 3KSMA 3ZWMA 1J90A 1EK2A 4S1VA 3HS3A 1SU7A 3WYDA 2PBLA 3E8XA 1W9MA 1C0KA 3KG2A 1BWRA 3OQPA 3PUKA 2CXSA 4KTTE 4NARA 4QODA 1DMRA 2QV0A 4Z2YA 3RBVA 1P2VA 2JGMA 3ETDA 4G63A 1RAIA 3JWIA 3LWNA 1NXQA 1NE7A 1KKUA 4KIFA 4N0QA 3I12A 1GZ7A 1G7SA 2W48A 3O83A 1M1YA 3NDIA 4RSGA 3GH1A 5E6RA 1U04A 2O8DA 3VJMA 1Z0KA 4LGMA 3CE6A 1Z7GA 3VC7A 3KQQA 2WHYA 4XGIA 1ZM3A 2QSYA 3RR2A 1Z4PX 1K3FA 3F8TA 1W94A 5BPHA 1RXVA 2BCEA 1BDHA 3U4AA 1G5PA 1LGYA 3NHRA 4Y1EA 1TM5E 2VRBA 2VWPA 1E6CA 1IN1A 1E62A 1Y1RA 3PDUA 2GKSA 3EQ2A 4GMHA 5AUNB 2I29A 4G01B 4ZOCA 1JAYA 1XVUA 4AJIA 2Q7DA 2ERXA 3EVCA 3JALB 4PHGA 4QXQA 3BHJA 2EP7A 1XZGA 2OTLB 3VYRB 3ZX5A 4QJIA 4GU5A 4PTYA 4ARAA 2H3EA 4BO2A 1FNSA 4F9EA 2PS0A 4OVKA 3WIEA 5EIAA 1CR4A 4MV7A 2IQ5A 5C8YB 1V6AA 1G8GA 1QDLB 5ARDA 2GLXA 3QKRB 1C7JA 2QTFA 1HNNA 3UZUA 3DFZA 1X7YB 3AUUA 3NVKI 2XXJA 2BKLA 3TQQA 5IN5A 2QF7A 4Y67A 4FK8A 2BRUC 2FLVA 2BIFA 3QEJA 3SSMA 4CKYA 2H2FA 3P0HA 3CVYA 4HLUC 5BNTA 4KH0A 3COJA 2H0AA 3BWYA 3GEDA 4AP5A 5CT6A 1R74A 4WX2B 2DH6A 1P6QA 2JS7A 1Q0HA 2I0FA 2UVPB 3Q3GE 3KEWA 1UQUA 1YX2A 4D57A 3OC0A 2PGXA 5CGQB 3KJXA 2GGSA 2P2DA 4P2GA 3I1JA 2C2KA 1K7YA 1MA0A 4Q1AA 4UE6A 4BMPB 4C7VA 4P1ZA 2IKSA 2WMNB 4CLEA 1YHQB 2F90A 4AY6A 3I73A 2PNJA 5EIHA 2F4VB 4GPAA 5IYZA 5JXJA 3RVQA 1O57A 5LLTA 1W2WB 3GL9A 2H48A 5HEKA 4PYKA 1SU4A 1HMYA 1L5MA 5F4BA 4KFTA 5JO9A 3ROZA 2UKDA 1TF5A 1MJHA 3RVBA 4C4XA 4DQUA 1QRSA 1M7HA 2VKTA 4UEQA 5JSHA 3LS2A 2IDKA 1NZJA 4X94A 3WE7A 3U16A 3THYA 4ETNA 2BD0A 1NR1A 4ND3A 1H9BA 1HC7A 2QTRA 1S8AA 4ALJA 5KKAA 3CNHA 4V0OA 3CLHA 3RRZA 5P21A 5JNUA 1W7AA 1UAAA 3V4ZA 2ZJ3A 4N5DA 2WTMA 1ZNQO 5CHYA 2XZLA 1WUHS 4KMRA 1PR3A 2FX3A 1OR8A 1U8YA 3GEEA 5AW7A 1I6MA 1XQWA 1XU7A 2HHHB 4B0PA 1YBHA 3ANMA 1RP7A 4B9AA 5LOVF 4LK2A 1FNBA 3ZI7A 5IC4A 4TM7A 2V65A 4F3KA 2J3HA 4QVJA 2Z9CA 3VNRA 5FPPA 1L7DA 4NDAA 1TCAA 4LYDA 3MJ4A 4LY9A 4R81A 3AI1A 3UFXB 1DBIA 1IUNA 3WGZA 2GD6A 4JYMA 1WZEA 4R7ZA 5JPIA 2Q3LA 2WVGA 3EC2A 5TQVA 1NATA 2O59A 3QVKA 5T57A 5FXMA 2P9ZA 4MVJF 2ANBA 4UNPA 3A04A 4R4JA 1GPUA 5HIAA 3KXIA 4DLKA 4EI9A 1TYAE 3ZHCA 2R7MA 4AIRA 4OSOA 4BMYA 1NW4A 2XEDA 4KZPA 4HS4A 4PN3A 1D2NA 2JAHA 5EKTA 2K4MA 2Y93A 5IW8A 4BX8A 4NHEA 3QBTA 5DASA 4G1EB 1EDOA 1HVXA 3UA3A 2W8ZA 1CUZA 4R8MA 4ZANA 1T4CB 4QPPA 4BX9A 1AURA 4X7EA 1WNFA 1XDWA 2QRGA 3V1TC 4WBNA 3GOQA 3QEMB 5D8DA 2HHLA 4UU7A 5AVSA 1TC2A 3KV3O 2QN9A 3GGJA 2JGLA 1E0AA 3M83A 2OV2A 3PF8A 1Q0UA 2J45A 4L0CA 2QYSA 1DWPA 1J8VA 4ZQFA 2KHZA 3QWAA 4B4WA 5A88A 3KCNA 4NYJQ 2YMLA 4AYXA 2DT5A 1GADO 1NBOA 3CLRD 1LJUA 1P19A 3MUOA 3IQIX 4AUNA 2CN1A 4C08A 5K09A 1UBCA 4V02A 5E7QA 1E3JA 4O5AA 3PFIA 5K4GA 3PXDA 1XC7A 2R8OA 3D31A 2EC5A 3D4PA 3EVZA 2WLTA 3LZDA 4OM7A 4PSDA 4YASA 4Y98A 1G9XA 4GZLA 4NLLA 1M2HA 5BSVA 5AM2A 1VQ4B 4MVJH 1YFLA 1N0VC 2HT6A 1GWNA 2CNWD 2V5UA 3O4FA 2C20A 2EGGA 2PGAA 1I3OA 2VP6A 5A03A 1N36B 2D5LA 2YNMC 3HLKA 1JAZA 4YPFA 2FJ0A 3NBYC 3VGPA 4MO2A 1ZLYA 1XQ1A 4KWEA 5ENVA 2D54A 3PHHA 1NZFA 1RTKA 2KWIA 1EZ4A 1O89A 4OBEA 6AT1A 1TJNA 5KW9A 3ZDAA 4RF3A 5BW5A 2EX1A 4ENTA 1P5ZB 4FMCF 3W8DA 4QNMA 3NIGB 1NMQA 4MUEA 4E2YA 3WAJA 3V48A 5F7XA 1UDXA 1U9ZA 1V47A 2CFCA 2YOHA 4JBWA 4LJAA 3I23A 2Z6QA 3HFJA 3I62A 4ZC8A 1Q0ZA 4ZYYA 3Q5DA 3FUTA 1ZGHA 1J22A 2IU4A 3M89A 4R0NA 5BPFA 3ETEA 1H8ED 1I33A 1DAEA 1KVSA 1NYLA 1O9BA 3D54D 4LXUA 4AMVA 5D5PA 4BQIA 1M1KD 4E2XA 1WMAA 1GPAA 2W6ID 1YJBA 5AVXA 1O54A 1MTZA 4RIFA 5I8PA 3Q9NA 5TMEA 5C7LO 2FWAA 2VDMB 3AWIA 2MSNA 3FWKA 2OR3A 5IWAB 3W4KA 4BNGA 1Y0RA 1KF0A 3G8YA 2IYZA 4B4DA 4X45A 1Q7EA 3K53A 3JTMA 3J7TA 3NYIA 2NO0A 4IRMA 4BFCA 1QJ4A 1XFOA 1K06A 1LWOA 1W4LA 1NNI1 4LHXA 2QTMA 3FNHA 5CVUA 4TRJA 4REQA 2HRQA 4OD0A 4XB2A 1AHIA 3S5JA 4B8YA 3CEAA 3SIPA 4D6XA 1ZCBA 3B89A 4TN5A 1KWKA 4TN1A 2AF3C 1DCFA 4GYJA 3T3EA 1YQXA 1H85A 1IK6A 2FMKA 1NP6A 1RTTA 2J9RA 4N12A 3ZJYA 3GA5A 4BDSA 1DBVO 3KTAA 1RWOA 2DVMA 2R25B 4JWTA 4BVAA 4DGSA 2GEDA 2WU1A 4O1MA 1Q50A 2DT8A 3G0OA 5GWXA 5LC1A 3WK4A 1LX7A 4JMQA 1QOQB 2GKOA 3BE5A 4Z0PA 1PDOA 4BX2A 4M36A 5KPJA 1DG9A 1QE5A 4K6MA 5FL7D 1UC9A 1UPTA 4TXJA 1U0FA 3FPFA 1BWQA 1SKAA 1HYQA 2OHXA 3P2YA 1YHZA 2ZJ8A 3D7NA 3BL8A 2FF5A 3PUYA 4M76B 4DCOA 1EFAA 5BUZA 4MRAA 2ZXIA 1B74A 4CNQA 3GUCA 4ER3A 3VPCA 3CXCB 4QJ5A 3I56B 1XNHA 4WVFA 3HPRA 2DAPA 6ABPA 1RVV1 5EIEA 3WHPA 1NG9A 4R0VA 5ENZA 4JX8A 5FBHA 1ZK4A 2E2WA 1J0CA 1H1DA 3Q2OA 4YP5A 2WK1A 3T0GA 4ZARA 3PD0A 3DMGA 2XIQA 2D3LA 2FSIA 3QRWA 3LC7O 1II8B 1YB6A 2Q3DA 1F9EA 4BNZA 2RJNA 2JCYA 2OFPA 2V4UA 4HPXB 3BXZA 1PT8A 4I50F 4BLUA 3DDWA 1JHZA 5K8UA 4MUKA 1IQ0A 2IHJA 1U6KA 4ZI5A 4MQLA 3COSA 2LWIA 3AEQA 5P8WA 1ZN2A 1V1MB 3PL5A 3R3WA 4LY3A 2HY7A 3NGMA 2ZTGA 4Z5XA 3AP1A 5JBNA 1K97A 1EM8A 2E6KA 3AU8A 4NZYA 1IJEA 1JHXA 1MORA 2IUTA 2WTXA 1K7FB 4LOKA 4KIGA 4TS4A 4MA0A 1L0BA 1TCCA 1VG9B 1WXDA 2IZ7A 3WNVA 1EE2A 3PTAA 2Q3CA 4GECA 2G1UA 4KG7A 2Z8YA 2IELA 4HAVA 2WG1A 2EYQA 5CFLA 4U8HA 3QYFA 3TMYA 2C99A 1PJRA 2ZSIA 1E7MA 1G21E 3D7SA 4HUQA 5LFAA 2ZVQX 3RY8A 1ES9A 2I6GA 1Z47A 1LV7A 3O3OB 5ALIA 1J49A 3F6SA 4UREA 1NVVR 3ZD8A 2O8FB 3EGWA 3OWXA 1J2JA 4YCAA 4W9RA 3UEOA 1QC5A 2N47A 3VHXA 3WDSA 2BYTA 3HWWA 3QHPA 4FJ2A 4N9WA 3GJ8A 4CF7A 4LZWA 5DX1A 5K0FA 4IIDA 1L5ZA 4LJ8A 4HNGA 3UQZA 2FK7A 1A4UA 3LX5A 4IHJF 3LDGA 4DV7B 2H00A 1MT3A 3NO4A 3WHIA 2PZAA 3D3KA 4EEXA 1CUVA 1HF3A 1HXHA 2X15A 3IP9A 2XQIA 2CXNA 3O8LA 3RC9A 3OD1A 5FLYA 5L40A 1NQTA 2AFHE 3M6UA 4G85A 4E14A 2FSFA 5DPMA 5EUMA 2XHZA 2CXHA 2JFBA 4YRLA 3ZDYB 4KXVA 2R6HA 4O33A 5H3CA 5B6JA 4P12A 2QLFA 4J0CA 2RD2A 2IY7A 1ST2A 3RRXA 2X76A 3K0BA 4Q03A 3V42A 3OUTA 1YU6A 5HCNA 3I8OA 1HT1E 3KVOA 2I03A 4UHKA 3U26A 1VFPA 5LIRA 3DP7A 2IGTA 1U6JA 1SUBA 4Z99A 2CF5A 1P1FA 5AOCA 4ZJYA 1JQAA 4KYUA 1NMZA 4HRXA 3DZBA 3AY6A 1AS2A 4QGGA 1MOZA 3L4SO 2IS6A 1VQ9B 1MTOA 1V5FA 1XU4A 2PU5A 4BFTA 4D5GA 3LRPA 4NFLA 5BQPA 1J7KA 5AHOA 4YRGA 4XIJA 3G5MA 4OLBA 1RACA 2GWRA 3Q3JB 1I1HA 5FOVA 2OD9A 2V9PA 3OY2A 3T6KA 2JIZD 1Z6ZA 5I7OA 3ZS8A 4X0CA 1EJ2A 3UT5B 3L7NA 5LQKA 3V2HA 4GC9A 2YJ4A 5BNFA 3THRA 3WHKA 4COKA 1BE6A 2BZSA 3NNDA 2WUGA 2X23A 3JAMA 5B7QA 5J43A 4GAEA 3HUFA 4OI2A 4XJSA 1XLTA 2BP7B 1GOTA 2B78A 1NJ1A 1UOEA 4PZZA 3U9TA 2YDYA 5C35A 4QUZA 3L5OA 4RM0A 2FI1A 3DOFA 4OL0A 1PJ2A 1H6BA 1CX9B 1K98A 2GZSA 1V3UA 3OQNA 1R5NA 4LQ4A 4B7UA 2FOLA 4X1IB 1ZMXA 2XIJA 3U0VA 4B44A 3O47A 4KYVA 4CWAA 2PRZA 2YVLA 4LF9B 1WTHD 1E4EA 4HLDA 5LZ9A 1Y7IA 3ENVA 4I0WB 3FNQA 2GD2A 5JJLA 1DMSA 1KO7A 1W25A 2GBIA 2JGDB 3A4MA 3ESCA 3EZFA 4MKRA 3WP1B 1BU5A 1Z74A 2QTZA 2EZUA 1JE1A 1PBTA 4J6EA 2DOGA 3X1YA 4G9BA 3GFTA 5IKEA 1T13A 3C98A 5AVRA 3GLFB 1ISMA 1JT2A 3M1IA 4X90A 5INTA 4DNTB 3PWSA 3WAGA 4NH4A 3AY0A 3TW0A 3WAKA 2IOQA 3ED5A 1I3CA 4IIFA 2VO1A 1G60A 4G5XA 1F0YA 4HC4A 3U4HA 4R1MA 5BWNA 2Q2OA 3EDQA 5D5HA 2WNHA 1T8RA 1YJ9B 4EG6A 2G77B 3LQRA 2X6YA 4N54A 4B45A 2XAAA 2GNPA 4Y2XA 4E1BA 4D3FA 3EZYA 1BNCA 4PQYA 5EHIA 3NPAA 3ICEA 3SNHA 1BRMA 1CKEA 1ZICA 1NF3A 4DPKA 4XONA 1Q0LA 2AV6A 1XKXA 1KQGA 1K4KA 2V98A 4QGAA 4NZMA 5I4IA 5AM5A 3BUSA 5DCUA 3N2YA 5J2UF 1IMJA 2XE7A 2ZTUA 1VJTA 1Z22A 3QPCA 2BC9A 3H1AA 3G1UA 1FS4A 3CKYA 3VTAA 5B36A 3QG5A 2QAIA 5ELXA 2JJ8A 1EBFA 1E60A 2FWNA 4KRGA 1LB1B 2RCNA 4AJPA 4B80A 1R27A 1G5RA 1WE2A 3OSZA 2H1FA 3ON5A 4ZVLA 4YBZA 3EZNA 3LC2O 5E2IA 5K45A 1E3SA 4L5YA 3KAQA 4EWLA 3H3JA 4U5XA 1N8KA 2RHTA 5KOYA 3KXPA 1XQYA 1J4AA 3JSAA 3Q10A 4KVGA 4K3VA 4RHYA 5CHEA 4ZP1A 3SMVA 4W5TA 2WYRA 4JJ8A 5CBPA 4G5GA 2Q3BA 1KPHA 4R98A 2I54A 4J1TA 2O8CA 2B2XA 2H4JA 5J4LA 4U7WA 5BR4A 1RLMA 2ABWA 5CA0B 4RY8A 1GPH1 3OOCA 2GCEA 1M0EA 2CLCX 3OLCX 4D4LA 1E9SA 4X93A 2ZRIA 1AG9A 4PIPA 1UM9A 3C3YA 4V24A 3PL1A 1IIBA 2ZSUA 4Q1BA 1U28C 3BXEA 1XP5A 2AWNA 4M6WB 3M1AA 2GO7A 3DJFA 2JF0A 3ENZA 3WYAA 4OHOA 5K9ZA 2HMYB 1NBMA 2JGAA 3FVQA 4W9NA 1D8AA 1SIOA 4ND6A 5DULA 2EVWX 3CZCA 4NBSA 2O2JA 3DWEX 3L84A 3NVAA 2OXEA 1NQUA 3BSWA 4HZIA 5COAA 1EGQA 3Q1LA 4DSTA 1M7BA 3QMMA 4KFSA 1TC1A 4MCIA 3EULA 4K0RA 4RY0A 5T67A 4Y2QA 4GKKB 4G2TA 4E21A 4EQZA 4WZAB 1QO7A 5F78A 1CY1A 1XK6A 4DLVA 4ECAA 1B6GA 2PL3A 3PLAE 1RWWA 2DGDA 2Y27A 3DQPA 3O9MA 1ZVMA 2UXBB 3LRXA 2IH4A 3LLSA 3UWPA 4YJ3F 4DYHA 4PAMA 4EGCB 3QE2A 2H2DA 4AJ2A 2MT9A 5KYXA 1GIAA 1E0SA 4GM0A 4QYSA 4ZVKA 5AW9A 1T0UA 1KFEB 2E3JA 2X9GA 3DSRA 3GYBA 1P74A 3ONWA 4OQYA 1EZZA 1TKRA 4V0KA 1F5SA 3AF2A 3TOXA 1EK0A 3HG7A 3A1FA 2N75A 2XQGA 2Y1XA 1U2TA 4WZEA 2BEKA 1UD3A 3D7KA 1JN0A 4NBNA 1D8TA 1PGOA 4NNJA 4J29A 2P9HA 3NORA 3ZK9A 4BNHA 1UH5A 3FWHA 1QNLA 1VZ2A 1D1SA 5DX0A 2R1VA 3WI7A 5BSGA 2ZZNA 1Q74A 5LA6A 1Y5LA 1NKTA 2R7KA 3H87A 4R2WA 4U6NA 3UK1A 2C4WA 1TM1E 1C3LA 4KO1S 1W36B 3L0BA 4TYYA 3NP9A 4IO1A 4MW6A 1A9XA 5K20A 3R8XA 2C5SA 2AEFA 4NBUA 1N0UA 1E3LA 3GJTA 1JL3A 4Z4WA 1ORWA 2ZI6A 3UJPA 4BFXA 4LXIA 1KH1A 1GDHA 2FRDA 1M6NA 4CLRA 1E3WB 3RHFA 1T15A 4EGJA 2FSVC 4KXYA 4K9OA 2WA1A 4KQHA 1VCMA 1QLJA 2KLBA 4HEJA 2DFLA 1WSVA 3JQFC 2RB5A 1QSGA 4URXR 1ADFA 3ZD6A 1K63A 3AI7A 3IO5A 3K09A 4ZI7B 1BD4A 3OTIA 4GX5A 2JIOA 1UP6A 3V4VB 3DDYA 1PGPA 4TM8A 3ZU4A 2RHBA 1C1HA 5LU9A 2CYAA 1G8JA 3P9RA 1YRQA 4OLAA 2RGXA 3NVMB 1WZNA 4MYUA 1MDFA 3FCUB 3HXLA 4Q47A 3ZTYA 3V4RA 3ACDA 3KBOA 2PL1A 3L46A 1DO8A 3FSGA 3MB8A 1EDBA 3P2MA 4UE3S 1G63A 4ZJPA 2D3NA 5K03A 3BRSA 1U1IA 4L75A 2D2EA 2YXEA 4QRDA 4XQ0A 2Y99A 5DNDA 3GD5A 1KERA 4JJAA 2GZ2A 3A2LA 4WT7A 2PVSA 2XXBA 4IRUB 5BYBA 4DQ0A 1ZN8A 2HDHA 1P77A 2BV3A 3CYFA 1O2DA 4H4EA 4ZCTA 3S2SA 3AXTA 5AVWA 1T2AA 5FQOA 4YC7A 2UUAB 5JAUA 2X4LA 4MAAA 4Y18A 4OJYA 1INLA 1DC7A 2GHTA 1SCJA 2IYFA 1QYXA 1U80A 4IIYA 3VSBA 4TWZA 1EZ1A 5ITSA 1L6RA 4N5HX 1J2EA 3A6FA 3DVLA 4IDEA 4H16A 1BJTA 4R9VA 3ZNQA 2VT2A 3ZDQA 4CF5A 2F2TA 2B1RA 3NXKA 10MHA 1D4FA 4LDAA 2ZIZA 1TUEA 2VPPA 2QQEA 1V95A 3CVOA 4UVEA 1WUIS 3CPJB 5IBPA 1BZYA 3MJCA 3KLOA 4CW7A 3QSGA 1AM4D 5L3QB 2O0JA 3WLPA 3L2OB 3DWGA 4GSYA 4PGOA 2F3RA 3PC8A 3BD6A 3ZBTA 2HIMA 5IVDA 5LNK6 3EODA 3LP6A 3P0EA 4L6AA 2XCTB 3K9FC 1R6BX 5JCOC 1WCIA 2XB8A 2B4QA 5DNAA 4EYKA 3VU9B 5LQMA 1GUFA 2GI4A 2B8WA 1Y9JA 4RY9A 4TTAA 2D1TA 4BO3A 4LYHA 1A8QA 2W2XA 3B6ZA 3Q9LA 4Q02A 1XKLA 1Z56C 3DHVA 3BWMA 3M3PA 3KQUA 2QE6A 3PR1A 1Q7BA 4C01A 4ZQIA 5EQFA 5CDYA 2IEAA 1A5AB 3OLVA 4HAIA 4MTCA 2MMGA 3EAQA 3UUGA 4DY4A 1SD5A 3NH6A 3CCJB 2CVQA 2DXIA 1P9LA 3C7CB 4RHUA 3FAZA 2POCA 3EFOB 3P2KA 5D5QA 4ZVOA 3ES9A 1D0VA 5LNK1 3U3ZA 2HF2A 1XTKA 4BRZA 2DR2A 2GM4A 1WPGA 5A9TA 4PIMA 4HN2A 4UNSA 2I65A 5ITWA 3KQLA 2FZWA 4HDOB 2DRIA 1U02A 1JKJB 4AZSA 5IWCA 3DZJA 3UCEA 3GCWA 1Z9BA 5FI5A 2GZ1A 4RACA 2WFAA 4NAVA 4QXPA 1KOJA 3FPCA 3V5NA 1FYXA 5L51A 4FSHA 4F38A 1MABB 2IIPA 5MFPA 2QTAA 1ENPA 5KOHA 4ZQCB 5CCXA 4TTPA 4WA8A 2W6ZA 2Y68A 2C97A 2FKAA 4NBRA 1JAXA 2V7QD 3LZCA 4NJEB 4OA5A 4TTRA 1N5IA 2ILTA 3H2KA 3M9XA 2REXB 4G0OA 1RWXA 1RM4A 4XLFA 1GP2A 4GEKA 2XQKA 4YCSA 3EQ9A 3CMEB 1XRQA 2GUGA 3KXKA 4MZXA 4ZZ2A 3TBKA 2CE2X 2CYBA 4LMPA 2EJTA 2BCJQ 2A8YA 5LB4A 2H9AA 1W44A 1YK1A 4GMDA 2Q9BA 1FC0A 2QZPA 3E0QA 3F6YA 1VHQA 1OA0A 1WSAA 4N3AA 3WIUA 3ZWQA 4U6QA 1EQ2A 3K73O 3UWKA 3TTTA 3QLUA 2HLDA 4Y1RB 3DD1A 5KSYA 2ZSHA 3EA5A 2I2WA 5FJIA 3BJMA 3L04A 2BHTA 4P35A 2OXCA 4EF5A 1TK3A 2JH8A 3BJEA 2EP5A 2WJZB 3NVDA 4LTNA 4UFOA 1F4PA 1P31A 2HX1A 2JGIA 3RUCA 3T0FA 2HJRA 2IYNA 1ZC4A 3C97A 4D45A 1T2DA 2F59A 1FW6A 2R8ZA 1M34E 3CS3A 1MQAA 1ARZA 2MYTA 3Q9SA 3DE6X 4J9VA 1C4WA 3NV7A 1CEEA 1JFSA 1E3XA 1XA0A 2FZ4A 2J0EA 1Q14A 3HGMA 4E5NA 1TUGA 2WJ4A 4DCMA 1G2PA 4WOJA 3KR1A 1T3ZA 3LUHA 3I9V6 4DMLA 3I9JA 4Q3OA 2ODPA 3UAYA 1YAHA 4AY2A 3T95A 3VDMA 3X2FA 3M4XA 3DCIA 4LAFA 1WP4A 4NXNB 3RYCA 1L5NA 1D1TA 1AN9A 4PGMA 3KTOA 3WLMA 5CA1A 4WDQA 3DKRA 3EVNA 3OSUA 4LJYA 3M9WA 2Z1NA 1C2YA 1J9EA 1N9GB 3IEUA 3CRRA 3CCFA 3V8BA 4WXYB 3W6NA 2Y0DA 5JISA 1EUDA 2A5DA 3FLMA 2VAMA 2Y05A 3HC7A 2CVHA 3L0OA 3PJDA 3PPWA 1DKQA 1SXJD 2C5HA 3H2IA 2R48A 3GVPA 4MUYA 2WOOA 1RW4A 4TYPA 4BEBA 4RVGA 5LWQA 5MFZA 3CN7A 4F6RB 4LSWA 3GLTA 3D4IA 3GH3A 1C7RA 2QYTA 3KDSE 4B81A 4P25A 2P30A 4PN7A 2PT5A 2JN9A 1SOUA 1OJLA 3I9V1 3N28A 1FDRA 1MIHA 3NEAA 4N18A 4QA9A 4XX0A 4Y30A 5I9SA 3OZVA 1MAUA 1T4DA 1ZK1A 4NU0A 4AROA 1NAIA 2P7HA 1ECBA 4RD1A 1VQKB 2XY4A 3LOQA 3ZHVA 2II6A 4BRUA 4FHGA 1CJUC 1H9CA 3PQ8A 1RBZA 3QVUA 1UD2A 3VR3A 4KPUA 4YPVA 3OQIA 3HDJA 3OT5A 4KWIA 3VR5H 5CFNA 2XGGA 1ZJZA 3FM9A 5IAAA 1ZSNA 3A6KA 1ONOA 1F1JA 3CU5A 2ZZKA 1VBFA 4X6XA 4A6EA 3TFOA 4WNIA 1CR1A 4XYMA 1R5BA 3GPBA 3LCRA 4BMXA 1F6BA 2VXCA 4M0FA 1E3EA 1E99A 4LPSA 1VQPB 3VZBA 4EOGA 4HDMB 3OCYA 3A6LA 5LR6A 3OPOA 1EEXB 2K87A 3JARB 2HJ9A 1SZDA 4YVFA 3UGQA 3ZY6A 1PL7A 1KNXA 5CH8A 4TXMA 3G2KA 4YAFA 1UT5A 4FGLA 3Q98A 4Y9DA 2QN8A 3OOSA 1MLDA 4D0SA 1E8NA 1PS8A 2C1XA 4HTFA 3TZCA 3ZD9A 1UXOA 4LBZA 1RYDA 5DWDA 3G6EB 2VDUE 1QHHA 4JX9A 4L28A 2FPUA 1W35A 2WLSA 1OXVA 3BE6A 1DV1A 2H5JA 4I4LA 5C18A 5IN4A 5AD1A 4WZLA 1EE1A 3SLKA 3BN3A 3FKSA 4XYBA 1P44A 1KJ9A 1WXWA 4B3DA 4IILA 1ACLA 4L07A 2IHNA 5AVUA 4TKUA 5IYQA 3KTFA 4KFUA 3GAFA 3OA0A 1WBDA 2AT1A 2Q7OE 4F3RA 4M9SA 1Z5UA 3UKOA 3ASSA 1E1CA 1VOTA 3LQKA 1E94E 1KC1A 1MOSA 4I08A 5CDUA 2K7FA 1OH5A 3BEOA 3F5FA 4DZZA 1ZEMA 4ZAYA 4M1TA 4P0QB 2FPKA 1PV2A 1QHXA 5CDHA 3A4VA 4XLZA 1A9SA 2EOAA 4JWKA 3SQOA 4OHBA 9ATCA 1ZESA 1B0AA 1IJFA 3BB4A 1A0OA 4G36A 4I3FA 1G20E 3UHPA 4ZIRA 4XARA 5KVSA 4C88A 3PJFA 3EXIB 5DHUA 4RKYA 1EUZA 2PZJA 4Z4QA 2PM8A 2OM6A 2HA4A 2YJZA 4IIUA 4YA6A 3ISXA 5CLGA 4DAEA 4NCKA 5B3JC 5C2JB 5CYPA 4IV8A 1DTEA 4TLAA 4XDYA 3OZEA 4OHVA 4WLNA 3C41J 5E7JA 3HBLA 5DEIA 4PYOA 1Y6QA 3LJKA 3RABA 1AZTA 4I5EA 4Q24A 1GAXA 2BHLA 2E4YA 1E7WA 3GJ7A 3NBMA 1X8JA 5ER9A 4YFYA 4YRBA 3H6GA 3SM3A 1NP3A 4BEWA 1ZVKA 3AW9A 1REQA 4QQRA 2HREA 2JVIA 5GIOE 1FFBA 4YI5A 1WSBA 5EHGA 1CQJA 5F1KA 4DA7A 2P9JA 5HUHA 1AA6A 1N0HA 4BNLA 2X8AA 2VTKA 1WXHA 1QP0A 1DBWA 1GVHA 3ILYA 4I1UA 3U62A 3K9QO 1SRQA 4CIVA 3KB1A 1FJGB 4G8BA 2AA3A 1T8UA 5KOJA 2XNCA 2ADFA 3V2GA 2XCSB 1Z6AA 1E6KA 1U0BB 1NJ8A 3H84A 4P31A 5AOBA 3W9YA 3R9WA 1RYBA 4RV9A 1MB0A 3NOQA 3HZRA 3AVVA 3G0DA 1Q16A 4PC2A 4GPTA 3JYNA 3EDYA 3T9CA 4DLTA 3Q1KA 2IE0A 1SC4A 2GVDC 1FXSA 3O21A 3SD7A 1Z4KA 2JGFA 1SEVA 2HA5A 3I9FA 3OM1A 1X1RA 5K8TA 2XNDD 1O03A 3OQJA 4MR7A 3EXFB 4BTEA 3ABSB 1JW9B 3MCTA 5FP0A 1EQUA 4E5UA 3LNCA 2O7QA 1EFRA 4XRRA 4X63A 4REOA 1H23A 4E3ZA 2LKDA 1OIVA 2UUPA 2HRDA 3N2NA 2YVAA 4QOEA 3KUUA 3MAAC 4YT4A 5KWIA 4RFSB 1AT1A 3AF6A 1MH9A 3K94A 2F00A 4G4IA 3TFWA 1E7QA 2B98A 1JDVA 4L3OA 4IXMA 4PWZA 2W6NA 3VTZA 4F5DA 5BVHA 5I9NA 2RONA 4YMLA 4O4IB 2M6LA 4EHDA 1G42A 3ZHRA 1SVMA 3CO5A 3OTHA 3DEJA 1OI2A 4KO3S 4URHA 2J67A 5F1PA 3VXKA 1O1YA 1VP3A 1CRQA 4ZVMA 3CB4A 4EG7A 5ICEA 1SOVA 1KJ8A 3A9VA 3H18A 1P0MA 1ISGA 1EI9A 4UUPA 1XX6A 3KL9A 1VB3A 3ET5A 4IHQA 2GN0A 2GFIA 2YKGA 1CR6A 1I4TD 4OI4A 1E2FA 2DFVA 4BNJA 3ZV6A 3HJRA 2Y6VA 3DOHA 4B85A 3GNSA 4ILKA 3NDBB 1T9DA 4J0HA 1E2HA 5DI3A 2WU8A 5EWJA 5KX5A 5EQTA 1FFSA 4NZOA 4BVHA 1TVKB 3LQFA 4LOAA 1FTQA 2GM9A 3H9BA 1E5TA 1ZIYA 2BGKA 5AI9A 5FX2A 2REQA 3L6BA 3U4IA 3V8QA 2ZRAA 4HNVA 3UOWA 3GJSA 3H3FA 4FE4A 1U6IA 1U9IA 1U7XA 3EOAI 4HDNB 4C4RA 3IAM1 4NHOA 1ZCFA 2ECKA 2B36A 3WL8A 1VMKA 3BIWA 1I8TA 4MYCA 5CK4A 1KARA 3NBKA 1X15A 5E2AA 2BFBA 2VA9A 2JW5A 2WHQA 3L4BA 1L1RA 5FOUA 1QH1A 1AUPA 3CX8A 2IITA 2GCOA 3OJOA 1OXUA 3D8UA 3P52A 4EPRA 4MRMA 5GADl 3HV0A 3DMNA 2I2CA 4PINA 1E6EA 3REOA 1RQXA 5EMLA 5B5SA 2GH1A 5L7YA 4ESHA 3LKDA 3WMFA 1RKVA 4ND5A 3NUZA 3SZGA 3F46A 3EWAA 1SWVA 2NW6A 3PLRA 2PXAA 1JH9A 2KW5A 4MHSA 4MWBA 3NHZA 1NUQA 4RADA 1F4LA 2WSSD 3KVNA 3U1TA 1T3GA 1JSCA 4FS3A 4PXYA 1EP2B 1H0HA 2X41A 4IIBA 1FX0A 1NW6A 2XI4A 1YJCA 2ZBQA 3H04A 4JR1A 1QU3A 1ZIOA 3B2EA 2PT6A 3FF1A 4OXRA 2BFPA 1Y3AA 4RPCA 3WLNA 6REQB 4S35A 4B2PA 4WFKA 1OY1A 4Y6LA 4NL4H 2AQHA 3DHNA 1ISIA 1RWPA 2GEUA 2VYNA 5JCXA 3OQOA 1JPJA 2HQ1A 1RADA 3NLLA 4LS3A 4UNRA 4QWMA 1IOWA 4MPPA 1Z5GA 1RCFA 3OCUA 4MO9A 4YRAA 5KTSA 1N78A 3E0XA 2BCGY 3ENQA 3EC1A 2IZ0A 4Q1DA 4DV2B 1UBMS 1NURA 4QDJA 3LQYA 4OIFA 1Z2DA 4XQ9A 1QFJA 4F2HA 3TDNA 4TV9A 5FAKA 4QUBA 3A37A 3NETA 3GOHA 1U7PA 4G2NA 4NU6A 2XOXA 2OGWA 3C6ZA 4OQFA 1BXZA 3CLKA 3W8NA 3U1BA 1LDYA 4RIEA 1CBUA 3JQDA 4TMZA 3NT2A 3QFCA 1U7WA 1P39A 2PVPA 1YVDA 2PMCA 1BLIA 2NXJA 5AK6A 3NE5B 4C43A 3BSFA 4FGZA 3RBAA 3VKVA 3CZQA 4RJLA 2QUJA 3VR4A 3IUMA 3I76A 3P9IA 2EKDA 4OQQA 1I5RA 3C5VA 5ALGA 2D8AA 1QGZA 1G2IA 5A4FS 4ZT5A 2ZTLA 4IDNA 3FMFA 4KE7A 2ZWOA 2NVBA 4N0DA 1QYDA 1X1DA 2R7AA 5HMMA 2AQKA 5DP2A 2ZUSA 1H2RS 1OVGA 2AYXA 2PX5A 1JSLA 1ZM4A 2BJHA 4P08A 3DAOA 3H7AA 4QJ4A 5HKKA 4X3PA 4EY6A 3L6CA 2VJQA 1APBA 1H66A 2AWOA 3T5PA 2FB9A 3WNZA 2XBMA 5TPWB 1XVAA 4UATA 3ZCUA 5DE3A 1FTWA 2I7XA 4PX5A 1VB5A 3DOOA 1C9YA 4ZREA 2YCLA 5CT9A 1ZW6A 5AM0A 2DQSA 4MKXA 5HZMA 2XD4A 4FWTA 1YFZA 2FMTA 2VZ9A 1T36B 3PRJA 1PJLA 2ZROA 3QXSA 1H2AS 4PLCA 5CM2Z 1KH2A 4YDSA 4AU1A 2O2DA 1GCUA 1GG9A 1IH8A 2QD4A 2ZTMA 3HWX1 4D1YA 5A3RA 1HGXA 2WQ6A 4RPBA 2J30A 4MDYA 5JWOA 2PMDA 3GVIA 2WFMA 4TL7A 1L8AA 3MQ4A 1LNSA 3DL0A 2XCLA 4FILA 4B6EA 1M6WA 2QRVA 1SUFA 3WLRA 5CCBA 1Q44A 1Z33A 1W47A 1VI5A 1ULZA 5F3WB 3PI7A 4B3SB 3IHTA 4IL5A 4E2FA 1I7QB 4OH7A 2IEGA 3MCZA 5L3VA 5LXTB 3GP5A 2BM8A 4GLBA 3E2MA 1FVHA 1ICEA 1L4EA 3IDQA 1KI1A 2NU7A 3QEKA 1EB9A 3B13B 4J3JA 1Y9ZA 4DVJA 1H4SA 2QXUA 4E6PA 5JVDA 1MPXA 1GT6A 2V54A 3H9GA 1XD2B 1NG1A 1I6KA 1WCWA 2XGJA 3R23A 2EF1A 5EIBD 4QPDA 4D9MA 4F2WA 3WLJA 3LY9A 3T5BA 3UUFA 3NGLA 3HDQA 2X9NA 3VC1A 2IIVA 4HWPA 5C5CA 3ESXA 2R5NA 1I0LA 1SMKA 3L6UA 4FLMA 1WY7A 1B16A 1KAQA 1NNSA 2EGUA 5E9WA 3LLMA 1NW9B 4RA9B 1RLOA 1UP4A 4OQ4A 4UTVA 3B48A 2D5IA 4MZDA 2AD1A 2PFGA 1XNQB 1ZOOA 2R8RA 1SBZA 4GDMA 4GUAA 3ER8A 4HFJA 1CUEA 3PGMA 1QBKC 1Y0BA 1Z2CA 4XVRA 5JDCA 4FI3F 2R6JA 5I8ZA 1JIUA 2GSWA 2PGLA 3HY6A 3UJ6A 4JLPA 1JTFA 4F06A 3OZWA 2A0WA 1QHGA 3AR9A 2G36A 2FPPA 3CEHA 4H3HB 3OO0A 4YO7A 2QG9A 1A69A 1G19A 3QX9A 4YFVA 2CV0A 1HX7A 2CL5A 1SC6A 2C61A 4YHHB 1SB9A 2YYAA 1M66A 4JQCA 4MKZA 4DBVO 5KNBH 4M0UA 1SQ0A 5LWHA 4EITA 2WG0A 2XYVA 1B76A 4MUGA 1YNOA 3B5JA 5KYVA 3W5UA 2PGNA 2QLTA 1I6WA 2VJMA 4XN0A 4ZT6A 1BMFD 1CV2A 3F5SA 5B64A 2QORA 1NRKA 1PEKE 2PGDA 4F6CA 2PE3A 2JEYA 3CT4A 2WJIA 5AKLA 2FFQA 2NO9A 4I2NA 3MCAA 3D81A 5CM9C 4JI8B 4W5NA 3E23A 4O4HB 3RT7A 5EWMA 3BMOB 3HR4A 3JQ7A 3KL4A 2EX4A 1Q81D 4M1SA 5JDIA 2V7XA 3QFRA 2FSHA 2WYOA 2X9QA 1B0UA 2ZRDA 4Z9AA 3F4BA 1QZZA 3IYLW 4KI0A 3WR5A 1I3KA 4PCVA 2D2FA 1E2IA 1CB0A 1GTMA 4MOWA 4MPRA 3RIGA 2ZU0C 5EC8A 3JZDA 1SA0B 4MQ6A 1T4BA 3R9XB 3JWJA 2YV3A 5ERXA 4QTXA 1F1BA 2QVZX 3RGGA 1JG6A 2GPYA 2I5PO 2BKUA 3EDCA 3FZEA 1O4VA 2O2XA 4CV2A 3S81A 1IY8A 1EGAA 1DIRA 3MVEA 1N5LA 4XYGA 1R18A 3HYTA 1DXYA 1W0JD 5TGDA 4H1WA 1JZTA 2ZIVB 1YR2A 2PRYA 1AGNA 5GVRA 4C3UA 2ZXUA 1KKLA 3B36A 3AEUA 1SUPA 1OBCA 3RYFA 4GW3A 3SICE 4JBIA 5DNYB 2X0KA 4MV9A 3SK0A 4F2PA 1TYZA 3G1TA 2XSZA 1N6NA 3WRXC 3ZIAA 4BO6A 2AEJA 1BFKA 2FWIA 1ZXLA 3TBFA 1IWOA 4BIMA 4WL0A 4Y0NA 5T3UA 2MMCA 4NESA 1K6IA 1IM8A 3VZCA 3KT6A 2EKBA 4ZHQA 3JYOA 3SYRA 3U7HB 1SOWA 2NUTA 3KDAA 2JI8A 1S89A 3AF5A 3DBHA 3IPYA 2CFOA 2WWWA 3AHGA 2ZXEA 1CTQA 2FVXA 3CM0A 1Q0PA 3JD2A 3LM8A 4RU1A 2ZRBA 4BMZA 4DLRA 1V37A 5ES4B 4FHEA 4RANA 4PQEA 4X8MA 1TDJA 3H5WA 3NC4A 2ODTX 2N42A 1ZCZA 3HMQA 5HCIA 2OXRA 5IEJA 2GXQA 3RC8A 4AZ3A 4NCHA 4JI3B 3F6RA 3UTDA 1WRBA 5DCYA 1QZ3A 1TKCA 1NYQA 4IS2A 4LRWA 2IPNA 2DHQA 5GZ3A 1W49A 5LP6B 2NPOA 4LI0A 1PK9A 4PZ0A 1PZHA 4F3CA 4KI7A 3DDOA 1QCYA 2K2QB 3RFXA 1KEEA 3KPVA 1NKSA 5EP2A 3C3DA 1EFPA 3D8BA 3A6EA 3RM3A 3KSZO 4D99A 3JZFA 3MWJA 3ROMA 2XXAB 1WPRA 3F0TA 3U1VA 1DIOB 4QO8A 2ORIA 4Q1EA 1U5CA 2RJOA 3IJEB 1UAYA 4XLLA 3VPHA 3VSEA 4GOND 1KZ9A 5HFAA 2I1LA 4FYMA 4NVRA 4BQQA 2W6OA 3G9ZA 4A5SA 1KI3A 3FWPA 4MMXB 4OHWA 3ZDXB 1NRIA 3LWZA 2B1IA 4MI6A 4NPHA 7AT1A 5HZKA 4M7RA 2B83A 3QLVC 4RWZA 1AXGA 1SIBE 2NU6A 4C03A 4XGKA 4EMBA 5L7WA 1F6WA 4GIBA 1ORVA 1VSQA 4QDZA 4BGEA 2QN3A 2N1MA 1E7YA 1X74A 4H1HA 3T7SA 3WZMA 4DLNA 2IOFK 3I0NA 4FNMA 4A36A 5JTUA 1O4WA 1N4AA 3ZTTA 4IFTA 3RHTA 3AY3A 4KGVA 1OGIA 4CN9A 1PGQA 5KNCA 5LDHA 5I7SA 3CESA 3ZCPA 2HA6A 2BZ0A 4N3GA 3FUCA 4RXUA 1S1MA 2W8BB 3K0EA 2Q5LA 5FI3A 3C6YA 4X41A 3O6VA 1I9CA 2I4OA 4QUKA 3ZCXA 4CMJA 1Z75A 1MXFA 1U1CA 3L7LA 1HEIA 3VVBA 5KQPA 1TI7A 2RHWA 4D9BA 2C58A 4WUVA 1GNLA 4P8RA 1BA2A 1YBVA 4RM3A 1QM5A 3CB2A 3RLIA 3A0UA 2X9LA 4Q37A 4XNFA 4W6ZA 2FG5A 2QT1A 1YMQA 3QI2A 5HS4A 4KV9A 3LVQE 1Z4QA 2HGSA 2RH4A 3NWBA 2GRAA 2Q4OA 4DEYA 2IYVA 4O8ZA 5DYIA 4H7FA 3I39X 1OAOC 3HJFA 2QDXA 1Q12A 3TO5A 4I6EA 2BFFB 4B74A 2C98A 3S1AB 3IOEA 1W4AA 2I4NA 1QQ6A 5AQEA 2G63A 2RGAA 4DCCA 2PVCA 1FZTA 4O1IA 2O8VA 1Z34A 2GPJA 2OQ2A 5CVEA 4M54A 3UV6A 5KYTA 4L15A 4MS3A 5CVDA 3IC5A 1OB0A 4PCUA 3ZVKA 1WSWA 2VCHA 4U63A 2XGOA 3GLFA 1JLLB 2B99A 5KTRA 4OCZA 4A10A 4C3VA 5SY9A 3COVA 4O5OA 4D46A 4LRTB 1H94A 4EVIA 2UYHA 4GBGA 2QA4B 3JCZA 2PWAA 4TKZA 3WIOA 4M1ZA 1M75A 4ND8B 4F46A 5K6RA 1RQRA 3K1TA 2X85A 4CKBA 4RVHA 1GCGA 3NCTA 1P5FA 5DLEA 3O74A 3QBDA 4Y8VA 2NADA 1R4NB 2GBFA 4MRNA 1JIXA 3Q7QA 3RTEA 4HDRA 5DP1A 3KT0A 5LMCA 5KTOA 3SF8B 5CFPA 4CDMA 4MQEA 1FQJA 4PNHA 3GLFE 2O0KA 3NEJA 4NYMR 1BDJA 2C57A 4RS3A 2ZG6A 3N58A 4G1UC 5A6SA 2ATEA 1CIVA 4AVYA 4R1SA 1I7LA 5BT9A 2QRJA 3DP9A 2YBEA 4N5IX 4QRHA 2QVYX 2ZVPX 2B9EA 5BUCA 1N6RA 2A88A 4BNDA 5K6AC 5IT9A 5B1YA 1W6UA 4H3KB 4K6OA 1ULAA 5CR9A 1XYGA 3S8MA 5JAHA 3QVSA 2Z8YM 3BFXA 1I9GA 3BMQB 4PGFA 1CUDA 1BW9B 5I7HA 1J2UA 2H2HA 2VRCD 5IM5A 3ZGYA 1F7UA 1EHCA 1ZJJA 4J6FA 4YMWA 2G1JA 3CX4A 3Q6QA 5TJ9A 3WYFA 2WSIA 1S8FA 1N3IA 2DFNA 5KJ1A 3KP1A 2GPSA 3OW2B 4OQLA 2PUJA 4KPGA 5F21A 3FJ1A 4CLOB 3QJGA 2OA0A 4TTTS 1AMOA 1R64A 4DV4B 2QIPA 2NQTA 2ZI3A 3M4NA 3FSRA 2C7PA 3MGAA 3N07A 3ISTA 2B4TO 1RSZA 1U2SA 2FZVA 5AI6A 1V35A 4QDKA 4Y6QA 4RPKA 1L5OA 5FWYB 3OOEA 5SY6A 4JQOA 2FPIA 1Q86D 3TE6A 2OORC 1OC4A 2CBZA 3CNEA 3JPWA 1L3BA 4JOSA 4CCWA 4CGYA 2QN1A 1ZK2A 4MVYA 3X1DA 3DAPA 4EB6A 1PR9A 4TUYA 4L78A 1H1LB 2C5EA 4H7IA 2YVKA 4ZOBA 5K8LA 3HBFA 3RF6A 2D5BA 2JJ1D 4RK7A 1NYRA 5C7YA 2XOEA 4OJTA 3QVGA 1E3MA 4H77A 5K51A 2FUKA 3A8TA 3LBHA 3UXHA 3UT0A 1SBYA 1OH6A 1VKRA 3NH9A 4RH1A 3PHBE 5KWEA 1FDOA 3I2KA 5L45A 1D9XA 1GR0A 3BCDA 1SXIA 2A9PA 5D00A 3T7JA 3UWSA 3R5SA 7ABPA 5H0IA 1LS1A 4FDLA 5BRNA 3Q0EA 4OPMA 3SIXA 221PA 1CUGA 1GKYA 1P2FA 4ZAGA 3W6ZA 1PJ5A 2OBMA 4IYJA 4DWVA 4CKWA 1VRVA 2EBWA 4X3CA 1T2NA 4RABA 5J47A 4WJLA 3RSCA 1H2YA 2CNBA 3OBIA 1F8UA 4FSDA 3E2IA 5EP3A 5A9SA 5JRZA 3VKGA 2JGJA 1U4OA 4DJDC 4R6WA 1M1YB 1PSWA 1JIVA 3KELA 3WMEA 1UWVA 4WZAE 1NI4B 3MFQA 4R8KA 1TLLA 4L73A 4MRPA 3CMCO 2PZ8A 2PZGA 3MS2A 1EINA 1EFDN 3OFSA 4I9NA 4JR2A 3EX7C 1WXGA 4YP9A 1K1EA 1GSAA 3DYVA 5KBYA 4TRRA 1MX5A 2DBRA 1C8LA 1U7OA 1ZBQA 2VAXA 3ONDA 3PUJA 1ECGA 2QRKA 3LQ6A 4LJLA 2Y76A 1XSEA 2RK6A 1GARA 2KJQA 4MR8A 4FDVA 1YB2A 4BX3A 1FPMA 2DBYA 5K3AA 4C6SA 4GWLA 2AOUA 3UMVA 2IYSA 5ICMA 3U56A 4C0LA 4CE6A 2C84A 5JCZA 3DZFA 4KNYA 2P9EA 2G28A 4C22A 2ZYUX 1T8WA 3CNLA 5CFMA 5C8YF 3N70A 3BHIA 4ML3A 1Y8CA 2EG5A 3HYCA 3EHDA 5DM0A 3E2PA 4Q1CA 3B60A 1HYBA 1ZJ6A 5JH7F 4F04A 1T3SA 4Z4SA 1YQEA 4E22A 5C1OA 2FMIA 1AA9A 2FDRA 1E9BA 1W2GA 3GLSA 4BJ6A 1HRDA 2XF2A 1QGAA 2PA0A 3HBAA 5DX8A 4RGBA 5LQDA 2GDZA 3BYZA 3SDSA 2H8KA 2E4VA 3C3AA 5IDQA 2V7PA 3SQLA 3DULA 4YCMA 4LC9A 3CNQS 2A6PA 3M4ZA 3OD5A 2WHPA 5HRAA 3AHHA 4O4JA 4XJTA 3W8RA 4F2DA 2A9FA 3Q4GA 4EX7A 1DAPA 1YHNA 3EIHA 2QZ4A 3EGXB 4LVNA 1JQDA 2FFJA 3LLCA 4OFXA 3BEDA 3AIOA 4BO5A 1TEZA 1QVZA 2O52A 3G9QA 4H18A 1TO6A 4OBWA 3VR6H 3OX2A 2PXXA 3TIXB 3LW7A 3JAKA 4RIHA 3CCCA 5FPKA 5IYZB 3HSSA 3IVAA 2BGGA 3IA2A 1NC1A 3GP3A 3W6PA 3TSYA 1YK0A 4Q4JA 4KFRA 4K6FA 4RVCA 4ZEVA 3A26A 1F8YA 3ZD7A 4MRRA 3UAXA 3FW1A 4Q4AB 1FP6A 2BGTA 3G23A 4UEJA 5JAIA 3B2QA 3MC1A 5TS3A 4P22A 1JHQA 4MW2A 5DYGA 2HRZA 3SXUA 3P9NA 2EERA 4O29A 4MVWA 2FR1A 4P33A 5G0UA 1RKXA 5BT8A 3E15A 5KTMA 1R0KA 2Q4BA 2IUSA 5DLYA 4IGEA 4O2AA 2RC6A 2ST1A 2YFYA 2RG1A 1IAQA 4EUSA 1FSPA 1R0LA 2A9JA 1EP9A 2H1WA 4V0QA 5FUMA 3H2SA 1VMAA 3LUBA 4C4YA 1MG0A 3ZBUA 1N3LA 1HDYA 4O3FA 4RMIA 4XM2A 3PZBA 4DDUA 2M6SA 1YS2X 4NENA 2ZYHA 3D4OA 4L85A 3U3KA 1TXGA 4K6HA 4OK3A 4JIGA 4HGRA 4MW1A 5EFZA 4EGSA 2FW8A 1BGVA 2A84A 3BQNB 4FOOA 2PSDA 3T3DA 5I9IA 4BKRA 5J3OA 1BEEA 1M2OB 1ZGGA 4KO2S 5BOSA 4PG7A 3UPTA 2VN8A 2VLBA 3AR6A 5EJ2A 1T5OA 1DWUA 2LP4Y 3VTFA 4QVIA 3GFPA 4X24A 1Q95A 5IJ0A 5JSQA 3A1EA 1UJMA 2YN2A 3WL3A 4ZI2A 4HQ0A 1RQ7A 1VP9A 3M34A 3BZBA 4HIZA 4YRKA 3BB1A 3TGLA 5BYJA 3DE7X 1H2XA 3KJQA 1OH7A 1DJPA 2V6FA 3G89A 4WBSA 1EUQA 1XZMA 4FZJA 2QJRA 5FIUA 3L7CA 3QVJA 4I1IA 4TSKA 2OGTA 4QFCA 4YH1A 4D4MA 5CAEA 2JJYA 1NI5A 2PQMA 2WPDA 3WICA 5A3JA 2NYAA 1EQAA 2O1XA 1I30A 2VAVA 2WBLC 2BGLA 2JHPA 3LCCA 3E61A 2NAFA 1BRTA 3AVXA 3LWBA 4WLFA 1XTZA 4WN3A 2W98A 1JSRA 3A1DA 1VPTA 3LHSA 3UXYA 4OKIA 5U9CA 2VWGA 4WE3A 2C83A 4AMUA 1M5RA 3IVCA 2OO5A 1YR6A 5K05A 2JRLA 2P8JA 2ZRKA 5DHFA 4JP5A 3G8CA 3CWQA 4ITRC 1XXLA 3HKEB 5IG2A 3DB2A 1V8PA 4KLZA 1FF9A 1K75A 1YJAA 1Q1AA 2YUIA 3LQ4A 2J6BA 2YFQA 1E1LA 4LPKA 4L5JA 1N8NA 4QPZA 5JMPA 4BS9A 4ZZ3A 3RF7A 3USES 3GLVA 2VDQB 1LXCA 1GQOA 3U6BA 2DR3A 1QS0B 4IOJA 5FBVB 5HBRA 1WMBA 4XMYA 2Y1KA 3F3KA 3KR9A 5G0VA 3ZBQA 1EGVB 5B1IA 4JT4A 3AV3A 2KVOA 3RUAA 5FBKA 4YXFA 2JKYA 4Q1VA 4YJFA 3PGJA 3OLZA 2LCIA 4W1PA 4CI0B 4BO4A 4RZHA 4HNAB 4EB8A 1RAAA 2W6PA 2IDMA 4GLLA 4H6WA 2HQBA 2CJPA 3PXBA 4RF5A 4JB3A 5JJCA 2IY9A 1F51E 2OEPA 3HCBA 1EP1B 3HJNA 3O8QA 5EE1A 1C3EA 4BLPA 1U3CA 3ZEIA 3IJPA 4FCWA 3HFGA 1F48A 1YS7A 4G0MA 3W5JA 5AI4A 5EKSA 5GZ1A 3EXG1 2I3GA 4XKWA 4RK6A 3DVSX 4UJ5A 5CVTA 5CT8A 1GTSA 2FZLA 2HSZA 3I05A 2BEVB 4YUWA 3O8CA 2GBPA 1LUAA 4N47A 4NK4A 3ZWKA 5SV2A 1XF9A 2WWYA 3KSUA 1A7AA 1MQ9A 2NSLA 1CDOA 2ZS7A 3DAYA 5GPBA 4EP1A 1JQLB 4TMVA 1KI6A 1XT6A 4FPXA 5FTNA 3SYMA 3L41A 3ZIDA 4LZZA 4FIZA 1N2OA 4D92A 4POOA 1DDIA 1TU0A 2IZ6A 1WXIA 2VG8A 2IIBA 5PNTA 4GZ3A 1JTEA 1UBSB 3ET4A 4TMYA 1E79A 1OLSA 2PPLA 2JK0A 4NG5A 3ZU6A 4CM8A 4CT4B 4IJQA 2BEUA 4RLZA 4YCDA 4MGYR 4ARBA 2WSYB 2Z2JA 4R2JA 2INGX 4J0JA 3ZCTA 4JDPA 1TTHA 1KYXA 3SZOA 1VHJA 2HLHA 3ND9A 1TFRA 3PQ4A 1L5WA 5G4KA 1SG0A 2C7QA 4JLWA 2I8LA 5FADA 4AI6A 5TF0A 3E1KA 4KDEA 5CB4B 4FOPA 1VE5A 1YCFA 2CLDX 2GAOA 2AW3A 2PKEA 2V3VA 3NC1C 3P45A 3SFTA 5KPDA 2EW2A 1K6XA 1ZOSA 2LUOA 4DSOA 1MFPA 2QY9A 3Q41A 4GPD1 4KX5A 5BWMA 3QKTA 3CVXA 2RBEA 3MCVA 2FH5B 1V43A 1WB6A 2BZ1A 3SYTA 2IYLD 2IF2A 1L5KA 4DCVA 3L8CA 5MDHA 5A4MS 1P7CA 4DXHA 3TW4A 1KEWA 4I1YA 5I5GA 3NYQA 4XOUA 3C1OA 3TXAA 4CKCB 1ETUA 3UTCA 2WSLA 1GTRA 3OU6A 5BR7A 4KKXB 2ECQA 3NWJA 2XDYA 1Z6QA 1ZNZA 3IV9A 4LOLA 2XWJI 3HNPA 4Y7DA 1ENYA 1LFDB 4C7XA 5JZVA 2FWMX 4LE1A 1K2VN 4FFPA 2F62A 4R2IA 2ZZGA 2W58A 4B6RA 3AJRA 4A73A 4W8OA 4DUYB 1PTJA 4WZTA 5EMHA 4XE5A 2ZIXA 4N4AA 3TKAA 5HP4A 3ROFA 3I2FA 5EIOA 2VUSA 3HN2A 1XO1A 3AEQB 3BH0A 1FDUA 3H8VA 3L8EA 2W00A 16PKA 2BFWA 1EIWA 1Q82D 5HOQA 3BPSA 4LDNA 3UHAA 3FDZB 4DLLA 2IODA 1EM8B 4A27A 3K1ZA 4BFVA 3W34A 3VOBA 1Y4DE 1EKXA 1T0IA 2A1IA 2FFRA 3GF4A 3QBJA 4FS8A 4Q12A 4QGBA 4M0EA 3K8YA 2VRNA 1GL6A 2WZNA 3GDWA 3EZ6A 2BSAA 2MSDB 2WDPA 2DZDA 3FD8A 4DIOA 4H15A 2YOGA 5JO0A 1MJGM 4IX9A 3NBZC 4XYLA 3QXGA 3KKLA 5FRDA 1FUYB 2ZRMA 1NN1A 5AKJA 2OXIA 2J07A 1IEWA 3JATA 4KPEC 1JEYB 2FR8C 2HMVA 2ZE6A 4BB6A 4NS4A 1WHTB 4E09A 2ZP1A 4JV5B 1XN1A 2DH5A 1YUBA 2ZYRA 1TMOA 1TOAA 3QFFA 5EMNA 2NZWA 4ZVRA 1K9SA 2FEKA 5HKBA 3N0WA 4ED9A 2IDZA 3L8DA 4Q15A 1CF9A 2ALJA 2OCXA 4OFZA 3WGMA 2FSGA 5AVQA 3T5AA 3OFND 3CEPB 4W1QA 3RFCA 3PR3A 4FGKA 5TF4A 2PSHA 2LIPA 1FP1D 2FVYA 3HNRA 3G0BA 4XLTA 1Z3CA 4M9UA 4Z2AA 2QLLA 5HJEA 4LQDA 3MD9A 3F3MA 4P6VF 1QVRA 2FSSA 2GF9A 3OT1A 1Y4ZA 2HU5A 5K3BA 4O4LF 4V39A 3W7BA 3VH1A 1R0CA 1JDBC 4QC2A 2H8GA 3LIPA 5M04A 1YQWA 1O95A 4NI5A 4LFCB 1T9AA 4MP8A 1YKFA 2YY6A 3VHQA 5A2GA 2R62A 1UXHA 3GAZA 4DR4B 3IRVA 5KINB