2XNCA

Crystal structure of an engineered ferredoxin nadp reductase (fnr) from pisum sativum
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
287
structure length
287
Chain Sequence
b'SKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRVPDGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVYW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN--NADP REDUCTASE, LEAF ISOZYME, CHLOROPLASTIC
molecule tags Oxidoreductase
source organism Pisum sativum
publication title Swapping Fad Binding Motifs between Plastidic and Bacterial Ferredoxin-Nadp(H) Reductases.
pubmed doi rcsb
total genus 92
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2xncA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2xncA02
1KRHA 3CC7B 1EFCA 4LBYA 3CCSB 2HMAA 1YJWB 5H5JA 1QGAA 1Q7YD 1QG0A 2GQFA 1W34A 4PC2A 1ZM2A 1JB9A 3U6BA 1CQXA 2C77A 2C78A 4AF6A 1VQNB 1KD1D 4YAOA 2B5OA 3OZUA 3U2QA 4ZGNB 1Q86D 5AN9A 1FRQA 3CD6B 1QFZA 4DQLA 3VMFA 3CRZA 1YI2B 2DETA 4FN5A 4PC7A 3W2EA 3G6EB 1R5NA 4K1XA 1H85A 1TVCA 1GAQA 1JA1A 1XB2A 1U2RA 1YIJB 1GVHA 2DEUA 4Y9RA 3ZBTA 5GV7A 1FNDA 1QX4A 1OB5A 3AGPA 1KC8D 1KK2A 3WXMA 2GPJA 1Q82D 4HE5A 4ZCMA 3ZZTA 1YJNB 4M53A 1H42A 1D2EA 1FNBA 3VNVA 1QUEA 5HXBA 1IJFA 3ES9A 4PGOA 4C43A 1VQPB 2YWGA 4G1VA 1EP2B 1QVFB 1CNFA 1DG1G 1BJKA 1R5BA 3CCQB 4RD1A 3CC2B 1S72B 3OW2B 2XEXA 1EP3B 4LBZA 4N3NA 3AVWA 1YJ9B 4RD6A 2YWHA 1GR1A 3CCEB 4QHYA 2CRVA 4Y7CA 4ZGQB 3AVVA 4EH1A 1VQ7B 1OGJA 1E62A 2QEXB 3I55B 2DERA 1F60A 4B4DA 5EMNA 4RD0A 4ZCIA 1F20A 3CCVB 2BM0A 1BX0A 4TMTA 3WBKA 3W2HA 1B2RA 3I56B 1R5OA 4B48A 1VQ6B 4RD4A 4MYTA 3CCRB 3W5VA 4FK8A 3V76A 4ZV4A 3P26A 4NCNA 2QN6A 1KK0A 4R71A 1K73D 2PLFA 4AC9A 3ZZ0A 4YAFA 4LC0A 1GAWA 4P3YA 1M1KD 4TN1A 1XE1A 2PMDA 4M2LA 1UMKA 2EIXA 1VQKB 3LYUA 2HDNB 3AVXA 1ZM4A 2BV3A 3A1FA 1TLLA 3W2GA 2QA4B 5JBQA 2VNIA 3B82A 3CCJB 3WYAA 4M4SA 1G7SA 2EFGA 3CMEB 3J81k 1G7RA 3W5HA 1YITB 2VNKA 1ZUNB 3ZC3A 1EFTA 4IW3B 1AIPA 1SM4A 3MMPA 3QFRA 1M90D 1D8TA 3ZZUA 3ZBUA 1BX1A 3E20A 4WQMA 1KK3A 1Q81D 3G4SB 1QGZA 3JQPA 1VQLB 2R6HA 2B7CA 4G5GA 3G71B 4MYUA 3W2FA 2VNHA 2BM1A 1TTTA 4UAJA 4RD3A 1CNEA 4TMXA 1K9MD 3LRXA 1VQMB 1W87A 3AGQA 1W35A 1DDIA 3WBJA 1N0UA 2D74A 2QTLA 2HCJB 4Q7JB 4B47A 2RC5A 2X3UA 2ZITA 3CMAB 4TMZA 3CXCB 4PC6A 2DY1A 1NDHA 3VO2A 4N3GA 2BGJA 4B3XA 1VQ5B 4DQKA 1JNYA 1D1NA 1FRNA 1VQ8B 1OB2A 3OZWA 1GJRA 1J9ZA 4RD2A 1KK1A 4G1BA 2OK7A 3OZVA 3LO8A 4BPRA 1SKQA 3PENA 1VQ9B 3WNBA 2DCUA 4PC3A 3FPKA 3P27A 3AVTA 3OJWA 2VZLA 4TMWA 3FJOA 4PC1A 3VNUA 1VQ4B 1ZM3A 4F7DA 4LBVA 3QFSA 3CB4A 1TUIA 4QFMA 1KTVA 2FX3A 4ACBA 2RC6A 5TV2A 2AHOA 4LBWA 3AVUA 1DARA 1FDRA 1EWYA 3CPWB 3CCMB 1K8AD 5TR9A 3AVYA 1N8RD 3I1FA 4RJLA 3JQRA 5DSZA 2QDXA 3VO1A 3WNDA 1HA3A 1JA0A 4Y9UA 1IJEA 2VYQA 2E1RA 2XNCA 3W5UA 2CNDA 1S0UA 5KSWB 1KJZA 2VNJA 2YWEA 3QSYA 1NJID 1VQOB 1I7PA 1YHQB 4ACAA 1E64A 1FNCA 5FA6A 4H9GA 2QMUA 4FWTA 3SJZA 3QE2A 4C0SA 1BQEA 1EP1B 1B23P 2OTJB 4M0LA 2BSAA 4RCZA 1E63A 2B7BA 2OK8A 3CC4B 1QGYA 3MHPA 3JQQA 1ELOA 3QFCA 4NBSA 3WNCA 2BN4A 1W2BB 4P6VF 1OGIA 2J7KA 1QH0A 2XNJA 2BPOA 1QFYA 1KQSB 4B43A 3MCAA 4HE6A 2BVNA 1EXMA 1QFJA 3E1YE 1A8PA 4YAWA 3CCUB 5THXA 3B78A 3B8HA 3WY9A 3CW2A 5GV8A 1DDGA 2NPFA 2BF4A 4ZCLA 5H59A 2QTZA 2YWFA 1FNMA 1N0VC 4YHBA 1EFUA 4AF7A 1GO2A 1QVGB 1WDTA 3W2IA 2OTLB 2BMWA 3LVBA 4TMVA 4B44A 1QUFA 2PIAA 2BGIA 1IB0A 3OJXA 4YALA 3U6KA 4J0QA 4M1KA 5TY0A 4RCYA 1JJ2B 3CCLB 1G7TA 1G7CA 3QFTA 1AMOA 4U9UA 4YAUA 1ZM9A
chains in the Genus database with same CATH superfamily
3K5WA 1E94E 4PQGA 1SBIA 1FFWA 4TROA 4DMGA 5EXSA 2Q5JA 1SUSA 2FP4B 2YBEA 3NI2A 3R3XA 4MV3A 4GMHA 4XFDA 3UK7A 5K6AC 3EPKA 2P6RA 4OAQA 2D3LA 4HYEA 2M6LA 5H5JA 2F67A 3VR5A 2NTEA 5F1YA 3WICA 1T4GA 1HDCA 1IUOA 2R6CA 4KJZA 1OX6A 2PS1A 4LJKA 3WA7A 2AYZA 5I4IA 3HC7A 3QYFA 3VYTB 3JQ6A 1THGA 4AJ4A 4RY8A 3TO5A 2FN7A 1BGVA 2I6SA 2R6GA 3ORFA 1R2QA 1TF7A 2PS0A 2FW9A 1P9RA 2R00C 4ZIRA 1YFKA 3AKCA 1XNRB 1IM5A 1EPUA 5DI3B 3W6NA 2ISSD 3L1KA 4BFYA 5AQ1A 5CVEA 1COWD 1U8YA 3JAWB 2Q3LA 1AS0A 4QNNA 4A6DA 1OBVA 2XH8A 3PQCA 1O94D 2C8KA 3A10A 1LNQA 1TZKA 2YS7A 1H0SA 4QHTA 4U7TB 1W36D 4M0DA 4B3IA 2I54A 1U8TA 3W2EA 3KQSA 1P80A 5F5XA 3DF9A 3LW7A 4MRMB 3WYEA 5CURA 3UIEA 4XPZA 4B76A 3WKEA 3MWDA 4ZC1A 1V9SA 4QDXA 1CJKC 1JVBA 2AXQA 3L4JA 3I5XA 3EJ6A 3LVQE 4Q9AA 2MMCA 4HX5A 9ABPA 4OSOA 1IZ8A 3LBHA 4KITB 3CRMA 3GWGA 2RGUA 3F2VA 3T56B 4ND8A 1YIJB 1YVEI 2ZTLA 3W5DA 2QX9A 4QASA 1KP9A 2VXCA 3EVAA 3TDKA 1N8NA 3H5RA 4KKTA 2C59A 4UPEA 2ZQZA 2ZRAA 1JEAA 3IUMA 4WZAA 3JARB 1PBTA 3A6JA 4RQUA 4KL8S 1FU4A 2AZTA 2D8MA 4QOEA 3VH1A 4BLRA 2JD0A 1GL9B 4FYIA 4MO9A 4YRZA 1AGYA 1AURA 2WM3A 3N53A 5FBHA 3TGPA 2QUKA 5K6AA 3KB8A 3KT8A 4P3IA 2ZSBA 4FTWA 2YVLA 5G4KB 4Z4UA 1YJNB 3EZGA 1J23A 4PINA 3ANMA 5IC6A 2QR2A 4EJSA 3L6UA 4WY8A 3NHKA 4FVTA 4OHZA 5C9ZA 4LDPA 4WINA 3VKGA 2J5XA 2VP6A 4R98A 4JLUA 4PZUA 1H65A 5HXBA 4CMAA 1LRLA 5LMNB 1KQFA 4C43A 1RMQA 1S96A 4BWFB 3NAQA 3EGXA 4D43A 1T36B 5G41A 1P7YA 1BHQ1 1ISPA 1SBTA 1H1DA 1V41E 2DT8A 3AHIA 2PUBA 2I3ZA 5LMCA 1EUCA 4Y2SA 2M2IA 2A57A 3DTVB 1EZ4A 3NKVA 4BVJA 3T15A 4R8MA 1MAWA 4EHNA 4PZEA 4A6XA 5LQCA 3MG9A 4HDOB 4C76A 2QI9F 1U3CA 1K2WA 1Z2EA 3T52A 2ZSDA 4JLKA 4PANA 1WBJB 3RSLA 2IS6A 3U13A 4MKFA 4NICA 4NBTA 1CJSA 2FEWB 1L8AA 1PI3A 2HH9A 2J1LA 1E8MA 2OG2A 4NMXB 5DCWA 4OMUA 3ZU3A 3QY9A 2BTEA 4RBNA 4XFJA 3AB7A 3DZ8A 2O6LA 2WR8A 1FTYA 1NUQA 1IOLA 3PFGA 1ULSA 1J22A 2QJFA 1RE1A 2ET6A 2VYCA 2ZIXA 3JVIA 3KUUA 3WYNA 1N7HA 2VPXA 4EL0A 2VWPA 3PU6A 2MSLA 2AQ8A 4GGMX 3TBFA 3ISJA 3CEHA 1E7YA 4EPXA 2AZXA 4K6HA 3UHPA 7MDHA 2X2OA 1FW8A 3OEWA 1FIUA 2DERA 5IUNC 4HQLA 2CB0A 3D4OA 4X6YA 4C4YA 2JI7A 5CNMA 2V7PA 1J2EA 4NYJQ 1P2GA 3X2SA 4ZEMA 1NLFA 1E9VA 1AXRA 3I4CA 1JGTA 4RD0A 1CF9A 1XZGA 3DZDA 3K1YA 4ZHQA 2F8MA 4RETA 3UWMA 5BV2P 1F20A 2HA2A 4QGAA 4R8RA 5CB4B 3QHAA 2IZZA 2XCIA 4IQ0A 3RSZA 3VR5H 3DCIA 5F23A 3GP3A 2V0GA 4JI2B 4IQ4A 2BL4A 2J9XB 1U8CB 2BEJA 1TUGA 2PKYX 3A58B 3GJ0A 2OUIA 3ZWBA 1R27A 4JJGA 1B2RA 1N2XA 2PT6A 1R5OA 1FP4A 1KYVA 3EASA 1S4MA 1FA9A 4ZWNA 4UQPA 4NNJA 2DLDA 2OV1A 3TKYA 4ARBA 4D0RA 1FDVA 1NZDA 2FETA 3ZTWA 2VWGA 3VHXB 2Q62A 2R4UA 1EDEA 1C50A 3WS7A 3ENZA 2CDAA 2ZB4A 4ZVRA 5JD5A 5FD8A 4F3KA 3IP9A 1PR1A 3VX4A 3I1YA 4CCYA 5CB4F 3ZDAA 1I3NA 3GPDG 3I9KA 2VDOB 3PFWO 5DGDA 4HZUB 5LZ4A 1M2JA 1KGDA 4CTJA 4KXFB 1XPRA 1TF2A 2JLVA 4RWEA 4OXYA 4UAVA 3BXOA 1RACA 4AZ3A 2ZE7A 1G41A 1WY5A 4Z4ZA 3RTCA 2PLFA 3CU5A 3P71T 2FPGA 2JI6A 3LL7A 2HYDA 2ZBQA 4QEZA 3V80A 4FHCA 2F8SA 1E0KA 1RAIA 1OBCA 1WZIA 5I9NA 4KFUA 3AINA 2O2JA 3I37X 1K8XB 2C5HA 2EIXA 1OZHA 3A1PA 3HNRA 3WL4A 3WAJA 2QLNA 5F98A 3Q41A 1BNCA 2AN5A 1KL7A 2FUG1 4L4UA 1H2XA 1XQ9A 4MRNA 3THXB 5K0CA 5DX1A 4YRQA 2QTRA 5SYNA 2G17A 4I99A 1NW8A 4QYTA 1QVRA 5L4LA 1T4CB 5KWIA 4IL5A 4RPIA 4LNAA 4W82A 2OB1A 5IHPA 4DA4A 3CCJB 1F51E 2VPTA 1NR5A 4JELA 2WAXA 4CUJA 3KLMX 5HIMA 2O6HA 1RPJA 5KYUA 1VRWA 3DP9A 1NM5C 3ZDCA 4CGYA 1YB4A 4CKWA 3DPIA 2QZZA 3R40A 5K2MA 2X3YA 3OQNA 1ZBDA 4FX5A 2PWBA 4OQYA 1Z0SA 1Z2OX 3L7DA 4P1ZA 4F92B 1SULA 2GFQA 2C2HA 2REOA 4DJFC 2XCQA 3OLCX 3BQMB 1UKCA 2R1TB 3M1LA 4OL0A 5DTQA 2QM7A 1TKAA 2WU0A 2VRNA 3HG7A 5KQPA 4CM8B 1BMTA 1P0QA 5FTLA 3O9VA 5FPQA 4NJEB 2IXTA 3RYCA 3DFFA 4KLRA 1VL0A 3MLBA 3UOGA 3ZWOA 3IKLA 5ALVA 4C4ZA 5K8JB 3FLBA 2WJGA 1TQ4A 4BZWA 4I1PA 4P0QB 2QN1A 2LCIA 1YLOA 1HQYE 4G6ZA 3BJMA 2ZI9A 4XLCA 1L5VA 4L9WA 2A58A 3G85A 5EJ7A 1XLUA 3PI6A 4U7HA 3LZCA 2XB2A 1A71A 1TW2A 1GEEA 1O9GA 3ZGZA 3HJTA 3FPHA 1II8A 2VJOA 3D2CA 5I4CA 4M1QA 4M1SA 2Z5FA 5M3BA 1MEJA 3DNPA 4N49A 4OFZA 1Y9AA 1D0IA 4NJMA 5JZOA 1UANA 3DOCA 3ZGXA 4PNHA 3VV3A 1QZXA 1W5SA 1LC3A 1W5BA 1NBME 1SN7A 1TYCA 1XRSB 3C8UA 4L8YA 4UAJA 1X7DA 3EVBA 4KYUA 3ZJUA 4U5XA 1A9ZA 1U65A 5IUJC 1KEVA 3M4NA 4RTMA 4YJ3A 5DGHA 1VC2A 3LG2A 4M49A 1ONBA 1P31A 2OLJA 3EPRA 3W8DA 2GYUA 2RHJA 3BQNB 3DEKA 2XZOA 3HSKA 3AG5A 1EJBA 1PTKA 4M8IA 4NPHA 5REQA 5ECDA 1OYYA 1P2UA 3HDQA 1BFDA 2QAGC 3INTA 4KK4A 4NHOA 3AEXA 3SE0A 2FN3A 2HV8A 2DY1A 2WOJA 3ICPA 5EI5A 4DCCA 2RFLA 3ETDA 2GBIA 1DRWA 2Q3CA 1YFLA 1MVLA 2GLUA 1GPNA 5CA0B 3UCXA 3HN7A 5HUHA 3IAEA 5AW3A 3ZKAA 3KFVA 1XG5A 4DS3A 2HB6A 1ABEA 4ASUA 1T5HX 3ESXA 4G0OA 3MJHA 4LE0A 4JX8A 3S7ZA 4DRZA 3B1VA 3IQHX 4F9TA 1Z9BA 1KZYC 4ENSA 1GQFA 4HK4A 3DAGA 3MGBA 3LECA 5CXSA 5J63A 4X1KA 2ZI4A 5ALZA 3WG9A 3UXYA 4L8WB 3D0KA 3E70C 3H4VA 5CFNA 4OXNA 2HF9A 1YRQA 4ATNA 1GG2A 2QRQA 3DGEC 4LZZA 2FGKA 4Q00A 2AJDA 2DH5A 1IG3A 2NO1A 3LA8A 2IEGA 2FUKA 4G1FA 2WSBA 2C98A 4IINA 4PX5A 4O1MA 2G6BA 3V00A 4XDGA 1SMKA 3CR7A 3RDPA 2WB2A 1ZK1A 3O3OB 4LZAA 3HZOA 5BN4B 2ZYWX 4U3JA 3WBFA 3TQSA 1W0JD 1YTLA 3T38A 3OZRA 4XLTA 1SXJD 2Q7XA 3V2GA 4E7OA 1WEKA 3OAAD 3P0EA 4EELA 1EIZA 5AICA 3IKJA 3KYDB 5KTOA 4YCNA 3GLFA 4TUYF 3WMWA 4MVJM 4TMWA 2XTZA 4K9PA 1XP5A 3UPDA 1QP0A 2ID8A 4ARZB 1L6RA 2J0EA 5I3CA 3QBEA 1PR0A 3OPVA 2XB8A 3Q88A 2DXIA 1YDMA 1NVFA 2NWQA 2QRKA 3IEKA 4HCJA 4YMVA 1M83A 3CEJA 2X22A 5GMOA 1KSGA 3C3JA 2UYGA 4JVOA 5KEIA 5KBYA 4PF1A 3ONEA 4UFOA 1K66A 3RU9A 4ISCA 1TIKA 2V7WA 4IJVA 4X6XA 3IXMA 1NP7A 5DBEX 1XSEA 4JJ8A 1GGFA 4POOA 3R7WB 4PVDA 3NHRA 3SXUB 3ZCTA 2IUTA 2PRSA 3VZCA 5B2FA 4IOKA 4EYOA 2D0OB 4D42A 3AF1A 2ZAMA 5KSZA 3K4QA 4H7IA 5E1BA 3W7BA 3QEMA 3PXEA 121PA 3W6ZA 2UVDA 4M1MA 2B4TO 3EZ7A 4CEJB 3RD5A 3I1FA 1WCXA 3IAM6 5FOWA 1VBKA 3T5DA 3Q8LA 3HV0A 2O0MA 1XA3A 4B33A 4EJ6A 3WMFA 2AFHB 3VO1A 3KEWA 2R11A 4PQYA 4E51A 4PZYA 4AT1A 3I39X 4A8TA 4Y9UA 2COUA 2PSDA 4RS4A 3ERCA 3NT2A 5AI0A 3UB2A 4C21A 2P2DA 3R0ZA 4RY9A 3LCUA 3RS3A 3RIXA 1V4NA 2B7LA 2YINC 5FO0A 1Z15A 1OBFO 2BJVA 1Z5UA 2QROA 2QZ4A 3GVPA 2IPAB 4YROA 1UODA 3PE6A 4YCDA 2XA2A 1O7JA 2VK2A 1TAGA 3BEDA 1XR3A 4HGRA 4XUCA 5JSYA 1IXZA 1N2OA 1QE0A 4O3MA 1YCFA 1QOPB 3GAAA 5B6IA 2RK6A 4HWOA 5TMDA 1V25A 4CF4A 4DIDA 5HOEA 4ZTBA 1PFUA 5AHKA 3B51X 2GN8A 2P78A 2HYIC 1ADYA 4JLOA 2BGGA 2WICA 2FTKE 2W2TA 3DHEA 1NMYA 2FHSA 3NJRA 3U09A 2VEOA 2UUPA 3P96A 5K4AA 3G0HA 4RHYA 2PZBA 4UHEA 2CZCA 4V2UA 4IIVA 1YRAA 4OFXA 3T7SA 3S2FA 1WP4A 2UZ1B 4F6LA 2HREA 2B78A 1XRRA 2MINA 3OTWA 1WB5A 3DEHA 1GDTA 4CQNA 4QTXA 4UTPA 2B37A 3D7KA 3K96A 4DYDA 3ABRB 4D8UA 1AC5A 3AR3A 1XKTA 3WKBA 2CF6A 5IYZA 4PRYA 3LY9A 3RNOA 1JFFA 1VCHA 3NUGA 3T3GA 2IS2A 4NBSA 1W36C 3I9V6 2XUJA 1Y48E 4IYRA 4ALLA 4S35A 1JG3A 2RG1A 1F6WA 1FCJA 4M38A 2BN4A 2I2CA 3RNLA 4QX6A 2ZEJA 4HHEA 4FHZA 3U39A 2IEIA 3ZPXA 1ARZA 3E7DA 3RJ9A 1OGIA 3AT1A 3LK7A 4NCKA 5D00A 4AJLA 1R9NA 1GYPA 1VRVA 4XORA 1JLKA 3OTHA 4G9EA 4C3ZA 4BASA 4EMTA 1D4ZA 3A6GA 3CSDA 3DDZX 2SKDA 3URMA 3CG0A 2NT3A 4Y9TA 4A1FA 1GRCA 1PZFA 4IOLA 4WDRA 4YQZA 5I9BA 1YZFA 2Q0QA 1CSEE 1M8GA 1NSFA 1S6YA 2XE8A 3JVVA 1AMNA 1BRTA 2V4UA 2FDRA 2VHXA 4G5QA 4CMIB 4Y3UA 1J39A 4DR1B 4QPDA 4U3JB 2YWFA 4CG3A 1U5CA 3T61A 4BNDA 1N0VC 2OHXA 2A9QA 3DAYA 3AF5A 4EVQA 4CNQA 5HZAA 1D2MA 3FHCB 1V3UA 1YCGA 2J3IA 4KNVA 4CLOB 3PD0A 1CDZA 1M0WA 1XJ5A 2ODBA 1XVUA 2P6PA 4BX3A 1K7YA 2QB5A 2XUHA 1VTKA 4N0DA 1TZJA 1W1WA 3CW8X 5JV5A 1DIBA 1L7RA 1TK9A 1IB0A 3D8TA 1ZX1A 2OYSA 3GNLA 2XR1A 3MJ4A 1YACA 4AMVA 5JS7A 4PN3A 5FEMA 1EQUA 3ET4A 2DMRA 1A82A 5KMGA 2VXOA 4RLHA 2W48A 4D9EA 5JTTA 1Q2XA 4MUJA 2VSXA 4COKA 1BU5A 2DQYA 3H5IA 4PEVA 3WDSA 1RWVA 2I7CA 3A8IA 3HYRA 4I1YA 2DFDA 2CYCA 1QRAA 4EA8A 1E1QD 2JCGA 4BGEA 1ITZA 2QQFA 1ZUD1 5LBUA 2CNKA 4D3ZA 5FHRA 4OHWA 2BP7A 4W5NA 5TGZA 2RGAA 2BSXA 3ZDBA 1LDMA 3FFAA 4O4HF 2QV7A 3S7TA 5BSUA 2ZM5A 3AUKA 5CVCA 2ZSAA 3OZTA 5DP2A 1GSAA 3G8AA 1YJWB 4HUQB 2YX1A 3N5CA 1Q7YD 2JIPA 5E1MA 1G8HA 1VI2A 4HB0A 3UMGA 4MV7A 521PA 1U1FA 1Z2PX 2ZRDA 2IYSA 2R2AA 1KFKB 4U63A 4PLZA 4YJ3B 2GZ2A 1WSAA 1JB9A 1PK9A 2OECA 1M8FA 4RL4A 4L27A 5B37A 1GU0A 2NZXA 2GKGA 2JIRA 2WYRA 3KCQA 5JHHB 3MELA 2HTFA 5EZYA 2EFHB 3BGIA 1M6WA 1VGRA 1OFGA 1ODCA 2W2QA 2XQJA 3I64A 3SD7A 3VPSA 4AYTA 1CFZA 2NO4A 1L4EA 1RAFA 1KQ3A 2VDNB 3NETA 3ZE1B 2D62A 1I3MA 4ERNA 1N8SA 2BFCB 1OAOC 5JFOA 2I3BA 1QFZA 3PNSA 1PR9A 4LGMA 3VTAA 4BLPA 4BIIA 4UC0A 1BOFA 1NVXQ 2GBFA 2IHKA 4YJ3F 4DCUA 1XTUA 3WVNA 3AF2A 3Q3JB 5IYRA 4NV1A 2YHIA 3O1IC 4RFSA 5ELMA 5EWLB 2KVOA 1N9ZA 2H1WA 2ON6A 1P4AA 1QAOA 2AE1A 2MYUA 4NEGA 5ALFA 5AOAA 1NI3A 3BVPA 1CRQA 1X9IA 4UM9B 5E9WA 1QZUA 2QAJA 2V7XA 4IQFA 4W1RA 3SAJA 4Z1MD 1G1MA 2IA5A 3E9EA 3TIVA 3GLFB 4LDZA 3TI9A 1JQ5A 2BOVA 1GITA 1L4UA 4RGYA 3L7CA 3UMYA 4FEAA 3UJPA 1RHUA 3C7KA 1JPJA 1T2DA 2AR0A 2RB4A 4I2VA 2ZFUA 1XDBA 1E1RD 3MOGA 3PUJA 5EUQB 2VT2A 2CHUA 1LLCA 1VMIA 3HUTA 1QIEA 2HMSA 3LCCA 5D84A 4ZAGA 3EA0A 4BRSA 5GV7A 1YBFA 2FQ1A 4QDTA 4CM4A 4DANA 1W1IA 4P83A 3F5FA 1U7ZA 1G5FA 2JAUA 1F12A 4IEIA 3V8RA 1HYBA 2RGDA 3DAOA 4NLLA 3E3AA 4LSMA 1JG2A 4YCAA 1KJ9A 1NWCA 4L72A 4WSOA 3GCGA 4HE5A 4XM3A 4ZCMA 1X3SA 3B48A 5BSRA 4GQIA 4OKNA 2XDQB 5CM2Z 3T0GA 5FWYA 2RGYA 2Y76A 3R0QA 4YRJA 2G5GX 2TMDA 3Q6IA 4IMPA 1ZU5A 4RHEA 1I4WA 5EP1A 5DX8A 1JUDA 2PXAA 2FP3A 1RI2A 2O9JA 3E03A 3IUYA 3KE9A 4MUGA 4MWBA 4GMKA 4QLOA 2DHRA 4G8BA 4ZEXA 4LX8A 3OFND 1DG1G 4MNTA 3WYCA 4B81A 1CR1A 5K01A 1X80A 2OO5A 3NVMB 3O82A 2W11A 4RVHA 1R5BA 2I0FA 5JW6A 4BHTA 3LCVB 4BTLA 4IDBA 3JZFA 3SNHA 3TX6A 5AKKA 3F9RA 4NYJR 3GPLA 3NHLA 1WKVA 1ZL0A 4DLWA 1CK4A 5EE5B 3A3GA 4GPAA 3DDSA 2NTYC 5E9AA 2DUWA 3W3AD 4CQMB 1X70A 2IHZA 1D2NA 2AE2A 3BXZA 3M1YA 2YV1A 4IJKA 1TQ6A 4TMKA 2JBWA 4WLEA 1VE9A 2G1PA 1SOWA 3F4LA 2K2QB 3QTTA 1G6OA 1ESNA 1OXXK 1NQTA 3QOXA 2VSOA 5L6LB 3BPSA 3D8UA 1SUCA 1Z25A 3FSEA 3BICA 3T1QA 3I1JA 3WSTA 3A0UA 3R1IA 1DE0A 3OCUA 1WMSA 5IABA 1ZVKA 1JQKA 2I4MA 4Q9HA 2FEAA 5H3LA 4JMPA 3RIEA 4XIIA 2NACA 4O2LA 1Q95A 4UEWA 1E18A 4NCJA 3E9CA 3D6JA 3F4KA 3B38A 3GRFA 3SICE 4R8LA 4D5GA 2C7OA 1VB3A 1T8UA 3K1AA 2X86A 1EG2A 2VYVA 3LCRA 3BC1A 2JKZA 3MJSA 3HKBA 3U49A 1P2SA 4KIUA 4J91A 3UJAA 4MHTA 5KKAA 4HLCA 2BKUA 3OTOB 1KHHA 2J9FA 4KDCA 4M9UA 5JZ9A 4EZBA 3KCNA 1GPWB 3OI7A 4Z3KA 2HQSA 3OJEA 5EOVA 3I1IA 1FDSA 3M7IA 4BQPA 4F96A 4LG1A 2FQQA 3NPAA 2VHYA 3LD9A 2OHGA 2CE7A 1LDNA 5G0VA 2AX4A 3IVMA 3OF3A 3SR3A 4DVGA 2X15A 1UWKA 5A4JA 3PHJA 3PNYA 2ZZGA 2IYUA 3DZFA 4D3SA 3OG9A 2GUGA 2IBMA 4X7CA 2RGCA 1QRSA 4N54A 5HXAA 2IYRA 2YY5A 1EVQA 2ZRNA 4PRLA 1HYEA 4TRMA 5I8PA 2QM3A 5FA8A 4J76A 1IBMB 3VPDA 4ROTA 3DQZA 4CEJA 5ENVA 4PAAA 1Y89A 1RAHA 2WD9A 2VJDA 1TECE 3AERB 2ZTHA 3B9RA 2PLNA 4RLFA 1I2ZA 3EY9A 5KKNB 2NNLD 3QKTA 2LWIA 4LC0A 3L06A 1T5IA 2CHVA 3EGXB 5FBKA 1NRIA 4MP6A 1UWCA 1XE1A 4L3VA 1SB8A 4NMMA 4TV8B 1UEIA 4JKOA 4BGIA 2X5KO 2A84A 3H04A 2QR3A 5EYPB 4Z7QB 1TC2A 1FJ2A 1YDEA 1LSJA 4GZMA 2GN2A 3OPYI 3ILSA 3DYVA 2SBTA 3KZMA 3QPUA 4H1UA 3PF9A 4LJ5A 4RJKA 3D5TA 4I9HA 4OLFA 5THQA 2VDWB 5CDFA 3HLTA 1V5IA 1VLZA 4JUBA 1U04A 2EP8A 1NP6A 2OYNA 2W8BA 3ESQA 3OCWA 4HPJB 3STXA 5DIZA 2QGGA 1SPXA 4M36A 4CTNA 1K4MA 4JP2A 4Y6LA 3UFBA 5KQMA 3JWJA 3QBVA 1G7SA 1TRHA 1VYTA 5JZMA 3CMEB 3I9MA 4B4KA 5LMZA 3SQDA 4EPWA 2OBTA 1J8MF 5K1ZA 1DC5A 2VQEB 3QGMA 4MWZA 3K05A 5B55A 1AJEA 4FQ7A 3F46A 3WAGA 4PCUA 1LBTA 1IEWA 2ZSEA 1GL6A 4OEHA 1JKJA 4AJPA 4RGQA 4DDMA 2ATVA 1GFWA 4UNIA 3GGJA 1OA0A 4RLSA 1JIKA 4FDVA 2E5WA 1PGNA 4AZ0B 3M5DA 4EHJA 1EFVA 4OIFA 3NUQA 4GI2A 1WCYA 4A36A 1E79D 2YZ2A 3OZAA 5B58T 3K7EA 4X84A 5ESDA 2O8BA 1RXWA 4XYMA 4FR2A 4Q48A 4LPKA 2EP7A 1PG5A 3ZN2A 5LL6P 4PR3A 4Z4HA 1VG9B 2XUFA 3T0IA 5IBCA 4Z4TA 4WVLA 3PTAA 4X41A 5FBWB 1QP7A 5CCEA 1J5XA 2P0YA 4X06A 5EP4A 3ZQ6A 3HXLA 3P9IA 5A0TA 1Q11A 4GZ5A 5ITVA 4TYNA 3O3NB 3PQ4A 3HA5A 2HK7A 3UHAA 1M6HA 1WQ1R 3BCFA 3DMYA 1K5DA 3BXEA 1QS0A 2P6UA 4MCAA 1N0HA 4JGIA 4S1VA 4ZI7A 5JD6A 2YRFA 1GXSB 1A96A 1UADA 4FFRA 5CT6A 2X42A 1K2VN 1QHYA 3JQDA 5TQJA 5KVVA 5G1NA 3RB8A 3MWEB 3R0JA 5CH5A 1L5SA 4GNRA 3NT4A 1YGYA 4IRXA 2FXIA 4LOKA 1DWQA 1GEGA 2ORED 1BYIA 2X3UA 2X1VA 3ICWA 3KVVA 1VHEA 5EWMB 5AWFC 2XTMA 4ARSA 4C3OB 4G3XA 1J2YA 1UT8A 4HS4A 3FWNA 1JRLA 3AHGA 4QAJA 1KS9A 5D7BA 2OCYC 1E2HA 3VO2A 2W71A 4LA4A 4QM6A 4P12A 3A6KA 3R8FA 1FZQA 1FSSA 4A8JB 1U4NA 4FBLA 3V1LA 3BRQA 3M2PA 3KALA 4JT8A 1SUEA 5AVWA 3BCHA 1N7IA 1FRNA 1SPBS 2AEEA 1V6SA 3E9DA 1D2GA 1DRJA 3OZWA 3AEUA 5KTKA 5M7EA 2XMDA 3WQBA 4UAGA 5IVHA 1YU9A 1U1DA 4MQFB 2W58A 1P4MA 1Q0TA 3O7MA 5BN3A 3JWIA 4J1SA 5DASA 2QVCA 3TQTA 3I0NA 1A9RA 2J48A 3DE3X 4I50A 4IR7A 1JECA 1YI8A 2G09A 3PXCX 1M2VB 4NY1A 1KYYA 2D2XA 4W99A 3LO8A 4LXYA 5SY4A 1HFEL 2RGRA 4J0GA 1QQAA 1ZD3A 4UMFA 3TG8A 4GBJA 3ZWNA 3A14A 3VSDA 2GHQA 5K0ZA 1JHYA 2IYEA 3P27A 2Q2OA 2CLFB 2LV8A 1TPYA 2PBFA 4P7JA 2R1TA 4Z9XA 3B60A 1XRPA 3LSTA 1KDYA 1BXGB 2H52A 2Y1KA 5DLDA 4UUAA 3GBSA 4PC1A 3JYHA 4HN2A 1B0UA 3FCXA 5JISA 2YMLA 3BRSA 3EZLA 3F7TA 4UZEA 3UOAB 5SZKB 5CFQA 1XX6A 3AFOA 1SJ9A 4NL4H 3RREA 1LBEA 2FX3A 2WIAA 1RAEA 5E6SA 2P79A 1PJ4A 2WUVA 1DG3A 3MUOA 1FMCA 1IYZA 3ABQB 3O2SB 4I19A 1ZJ5A 5DOVA 1AQIA 1NA5A 2QP4A 1N4DA 1RCFA 3G2OA 4Q4JB 4YA6A 3AY3A 5IX8A 1DELA 4L5BA 3R41A 3TPFA 4AG5A 3OZSA 3CCMB 1TNDA 1WNTA 5B53A 5MN5A 3K70C 4QIHA 3Q8WA 3RR2A 3CLVA 4TLLB 5D5PA 1QYCA 4BGVA 3J7AC 2BGUA 2NYVA 4Z4WA 2O8FA 1QC5A 1KH3A 1RLUA 3NTOA 2O3QA 1SIOA 3WOHA 5A4FS 2BDTA 2IEBA 4WK2B 4GDFA 5KMGB 4ESVA 1RLJA 2BONA 2EBHX 3D3NA 3IUJA 2RI1A 5IAJA 2Q4DA 3P7MA 2WHYA 1BAPA 1RD4A 2XTAA 1TYBE 4WZLA 4I66A 4YP7A 3KR0A 4Q16A 3TIFA 3PKZA 3I9LA 3Q3HA 2W2LA 4BO7A 2GSWA 1NHWA 3G88A 2YXEA 2GD2A 5CCDA 3UOWA 4EPRA 1AUXA 4RULA 1CS4C 3HJRA 2XECA 2CNDA 4KKUA 1C3JA 2Q4BA 2D54A 2QAIA 4LDJA 3E8SA 4W5WA 3OJFA 2G4LA 4TZ0A 2AW3A 3BBLA 1J49A 1YE8A 4DJDC 1A8UA 3GDFA 4IUYA 1Y33E 2OM6A 1J2UA 2BZ0A 2NLOA 2PWAA 1V4VA 4AX8A 3DZGA 5BW4A 2DFKB 5K3EA 1I1NA 1F3OA 2XCUA 1XGKA 3LDGA 1YIAA 4DFDA 4ZJUA 2Y05A 4I9FA 5L53A 4DLZA 1N7GA 3FYUC 4FOTA 4FT2A 4PQRA 1PWXA 2BMAA 2XKKA 3KKNA 4TT8A 5FA6A 3D59A 4W5JA 1R3UA 1O94A 5FWDA 3QE2A 1D7OA 1QVAA 1QRDA 1IUPA 3H5NA 4OQMA 2BE7A 4AMZA 4JB0A 3RI3A 1A2OA 4DCGA 4G4GA 3GGGA 4JCCA 2HHLA 4A8JC 4P7BA 3WLAA 4B85A 3VR0A 4BOYA 3YASA 2XMPA 4E13A 4EARA 1MH9A 3R3SA 4UBNA 4EZIA 4D82A 4F60A 1Q14A 3X1KA 2OGTA 2ZVJA 4M1TA 1L4GA 1DXHA 3GLRA 3AJ8A 1KJWA 2J0UA 3FNEA 1RYFA 3M3HA 4QM7A 1GGMA 5JS6A 1O0SA 1XVAA 1Z38A 1DTWA 3L0BA 3D6HA 4EW6A 2EJTA 4L7QA 2C3MA 3O4GA 4V2IA 5E1OA 1YR9A 2I1QA 2WM9B 3RSFA 3WWDA 4EFLA 2QTHA 4F2HA 3U4DA 4URZR 3T9FA 2MU1A 4KXYA 2J7KA 3D3EA 2JG3A 4EJFA 1EJ2A 4IDOA 3QOYA 3O38A 2YVQA 3RS4A 4LHZA 3FNGA 1RWWA 3Q3IA 3QLVA 3L1IA 4B6JA 4XX0A 2YXNA 1RZUA 4CEHA 2O8EB 3GFTA 3G9UA 4FP9A 4R2WA 3PE4A 3ECSA 3RRYA 2FJUA 4HATA 3ADOA 4JLJA 1MB4A 4PGFA 4XVHA 3RVQA 3BWBA 2V6FA 3UC9A 2ILTA 3V4LA 5J40A 4LX0A 4LF6B 2RAUA 4DUGD 3RKSA 5GJBA 5FOXA 2AC4A 3PFNA 1NPYA 2Z9CA 3WLEA 4XWTA 1KPIA 3HRIA 2JVIA 5AW9A 4ND1A 4YCMA 4AVZA 5H59A 2BUAA 1NHGA 3BY2A 5F33A 5LB4A 1IBCA 3SF8B 1V3TA 2W6JA 2D7CA 3DOEA 4W5HA 3L40A 1L4FA 1CBUA 4P81A 1TPZA 5C46F 5FIUA 2X14A 3DMTC 3JQFA 3DJFA 2ZRHA 2H4FA 2PWYA 4NZMA 3HHPA 3V33A 3R5FA 2FG6C 3HY4A 3HZRA 3QXGA 1E2GA 4KPUA 1SQ6A 4LFCB 3RVDA 4A03A 1FYEA 1QUFA 1JN0A 2GO7A 2GEVA 2XHEA 5CTJA 4YRGA 1VLOA 1ZCBA 1ADFA 4DCTA 3T41A 4YQFA 3RARA 3SIRA 4HD8A 1WCIA 3UB3A 2LGJA 2G9VA 4HQ6A 4Q19A 5G1PA 1X8KA 4J0QA 3GUCA 5EIOA 4AO7A 3AB3A 3AF3A 4IIHA 3TRFA 4Y7DA 3G8YA 4BAGA 9GPBA 2YC4C 4GW3A 3L0CA 3SDZA 4IFEA 5AW7A 3MIZA 2O23A 2HR1A 4QTZA 4CMGA 2OAEA 1AQ6A 1U0HC 4L4SA 1AMOA 4ENRA 5C32A 721PA 4L7VA 5HSGA 4DUYB 2E3JA 3ZR4B 3U0BA 3N2GA 3X44A 3ZNPA 2BY4A 2GXSA 2AFHA 1GT6A 1Z7EA 3FNRA 3FVRA 3JPWA 2WVJA 3KB6A 4NFHA 5BN4A 3CESA 3A2KA 2J46A 3AETA 5ED4A 1THZA 4XQGA 5BSMA 5L3QA 1OU0A 4C0WA 2WIGA 4C6RA 4QUZA 4BV9A 1HQDA 3LDAA 5AD1A 1PVVA 2Y6UA 1TX4B 5DHRA 3AFHA 3IUPA 3GLIE 5E7JA 3L8EA 3JQGB 4BQQA 3LDUA 4TWIA 4YEDA 4R1OA 2WIKA 2VDVE 3A1EA 4RVSA 3ENKA 3FRHA 1JQBA 4QREA 3RROA 2FZ5A 3UMBA 4WTOA 1IN7A 2CSUA 3DAPA 1M1YE 4Y1GA 3QVKA 3MWEA 2B5OA 2EVWX 5EKDA 1Q57A 4IXDA 1UPAA 2PEZA 4BVAA 1NR1A 5EESA 1E3JA 4TVSA 2C61A 2ZJ4A 4FWIB 1I2MA 3BA6A 3HWRA 3PL1A 2DBZA 4BRUA 1WJGA 5H80A 5F51A 1SUAA 2W4MA 2FSVA 2IXBA 3EOBI 3H42B 5JC8A 1CDEA 4OX9Y 2C2XA 3NGLA 3PI7A 3KO8A 1IM8A 4KCGA 4U9IS 1DEXA 2MJLA 4BLTA 5LQMA 3CPHA 2WD7B 4V0MA 1GQOA 3UCFA 1MB3A 5HS4A 5KO2A 1KYXA 2ZAOA 4O59O 4WASA 4GYWA 1BXRB 3BTVA 3K8YA 3O94A 4QOSA 3VC3A 1BEUB 2OBSA 1AGRA 2YHAA 5EEGA 3KBBA 5C5DA 1RLOA 1I7QB 4M0MA 4GI3A 3IURA 4NCXA 3FFTA 1M6VB 5F4BA 1SQ5A 2H63A 2OHJA 1E8NA 1LNZA 2OBFA 2PBRA 2Z43A 2VYVD 3GDOA 4J6FA 4YP0A 2PBLA 4J4BA 2AKEA 2BMFA 3OU2A 1VKHA 1K7SN 1QYXA 4NBUA 4TS9A 4BRZA 1YIOA 4GEKA 4IDDA 3OT4A 3RV3A 3RU3A 5B7QA 2CLHB 2YRXA 5HJEA 4ZQGA 1FS6A 1NMEA 1NJ8A 1ZN7A 3F5QA 1ZAYA 2OQRA 2VCEA 1OA1A 3OFKA 4QWWA 3HUEA 4U7JA 4L57A 5HG0A 4ZVKA 2B9EA 2DWCA 1B93A 4ZDIA 4UPDA 1F3LA 2I2AA 4HI0E 2F43A 3HVHA 1ZUNA 1PJ6A 1FNNA 4P0TA 4OYYA 3X1JA 1Z2DA 3JZIA 4FSHA 4URYR 3UJ7A 5GINE 1P3Y1 2IOYA 1O3YA 2WYWA 3BIWA 5HM8A 1VHTA 3O8NA 4ARUA 1CRZA 1AUOA 2FGJA 5HM6A 3PZBA 1CR0A 4RPJA 3JCZA 4JA0A 4L22A 2K87A 1DAKA 4QSMA 5LR6A 4NQRA 3NWJA 2I7XA 3WWOA 1DI0A 2BJHA 1J0CA 3P0FA 4EOGA 5HKLA 5JMOA 2RI0A 2OPBA 5J47A 3FUTA 4HR7A 3PE3A 1A27A 2QTWB 3UAOA 3ZZ1A 1GCIA 4DV4B 4FGWA 2EBUA 2JAXA 1RPZA 3I32A 3QWIA 3EGWA 2I3GA 3KKQA 3N1UA 4OI1A 2BFDA 3VVMA 2XOKA 1KI8A 4FCWA 1JYFA 4HQ0A 1P7PA 3CCQB 1PKVA 3U7JA 2FEMA 3UZUA 5F9FA 5I8ZA 4I14A 1Q20A 1S72B 3CPEA 3FHJA 4XQFA 2XBUA 3G0OA 5AVQA 3SF8A 3GJ3A 4Y9SA 3H8SA 1JTFA 3SGLA 4MGZR 3IX7A 3K9WA 5J9FA 3K70B 3DTTA 4Q4AA 3BXFA 1YZYA 1PZEA 4RK4A 5AP9A 3T0FA 1XTJA 3JWEA 3SFZA 1W52X 4B6FA 3HWX1 1KZ6A 4UBOA 3M81A 3N0XA 2IV7A 4DQXA 4KK3A 3CVVA 5KVQA 1Z37A 3CCEB 3EWSA 3HB9A 4L0CA 1V16A 3Q6RA 5LVAA 4CEIB 3O4HA 4G36A 1P81A 3TYXA 4B40A 5JYDA 1L3IA 2V54A 5EHQA 1AGXA 2WNIA 2AEFA 1ES9A 5LP6C 4JMQA 1QE5A 4JSTA 3CEMA 5I51A 3ZW9A 1E62A 4J2TA 3DDUA 3RQSA 4QJIA 1T1SA 3SY8A 3PGJA 5CVVA 5IKEA 5BOSB 4E2XA 1E0JA 2EV9A 4Y2GA 2V7EA 1J07A 1YK0A 2I7DA 3Q39A 2O7SA 2XSZA 4MUBA 4CQMD 4HEA1 2HC9A 2HKIA 1G19A 3CRQA 4Q93A 3AL0C 1VDZA 2P3QA 1EGQA 3EAQA 1NAHA 3IAUA 4N9QA 3HKDA 1Z5VA 1YVDA 1UBUS 5CDSA 1IHUA 1Z5WA 3MTIA 1B42A 1TEVA 3MWGA 3EQZA 4JNCA 4P80A 5B36A 2V74B 3UG6A 2IJGX 1CJTC 1FTQA 3W2HA 1K9VF 2B34A 3HJBA 4WVFA 1N3LA 1OYWA 3FVQA 1WW3A 1ZR2A 1QV9A 1P6UA 5CT4A 4MQMA 3Q9LA 4EW3A 4ASUD 4HGZA 4MYTA 2J4FA 2XDYA 2ZYRA 3PK0A 5F78A 4O2RA 1XD9A 1AVTA 1T0HB 4NVRA 3UGQA 3BBPA 4BNDB 5CFMA 1A7JA 5H8WA 1YZVA 1Z0FA 2ZYGA 4UUQA 2GN1A 1GADO 1NKSA 5CM8B 4ZVPA 2VNSA 2CVQA 4YFYA 4IILA 4ARCA 3WJ7A 2NG1A 5DGCA 1RXEA 4E14A 4PPGA 1BHJA 3MS7A 3CF6R 4TWRA 4LQLA 1FXWF 4D92A 1G8KA 4DSOA 1Y8RA 4I3FA 4FNOA 2R8ZA 4YPOA 2F55A 2DUMA 2RAFA 4BJ3A 3MWYW 5FLKA 5KOJB 1F7UA 1CERA 1SU6A 1SD1A 1XMSA 5FL3A 1AT1A 4HH1A 2AL7A 2P68A 5C35A 1QRUA 3CRW1 5CXXA 3MJFA 4M22A 4FI3C 2X2EA 1Y8RB 1B2LA 1YS4A 3QTBA 3RIMA 3WRVA 4D4MA 4E32A 4XLAA 2J3DA 2YZGA 1WDMA 8ATCA 1OX5A 4KDEA 3L41A 2W37A 2ZREA 1Q7EA 4L9AA 2IK8A 1J0BA 1FFGA 2WHQA 1X74A 3C3YA 4KOAA 3L1VA 1IK4A 5B1DA 2IHJA 1XCJA 1N4AA 4PXSA 5KAPA 5IG2A 3VKFA 1E1DA 2P9FA 1TB4A 3ZJ5A 3CVUA 2C88A 3RAEC 1XTTA 1YS6A 3UEOA 5L3SB 1XLTC 3PC2A 3ITKA 4IZIA 5AW2A 2W6QA 3HB0A 3VA7A 4V0OA 2RK4A 3F3MA 4XN3A 3OOWA 3V4VB 4JP3A 1Z7WA 1CUGA 4UU1A 3ND9A 2R9VA 5B3LA 3KPVA 4BLQA 2YZNA 1M90D 3COYA 3ZHUA 4GPEA 4EI2A 4TWBA 2NU8A 3EQ6A 1QYWA 1TIBA 3LIPA 1BX1A 3QHQA 4RKWA 2HA0A 1LWNA 1V43A 2IXDA 4KI7A 4YN3A 1K8ZB 4O6VA 4RNCA 1WBBA 2XRYA 4HDMA 2QU7A 1GA4A 1C3EA 1V4BA 4Z4RA 2ZI5A 4KEAA 2NIPA 1R0ZA 3H0CA 1G4HA 4Q24A 1N1DA 1RHMA 4HAVA 4IG4A 4LXQA 4ITVA 3TCXB 2M98A 4KBYA 2H59A 3W2FA 2IT1A 2OLEA 2XVZA 2D2EA 4RM2A 1IN6A 1JMKC 3NOOA 4AZVA 1HY3A 3DP7A 1K98A 3HUDA 2UVQA 1T9AA 2XDWA 4MP8A 3SIXA 4TMXA 1K9MD 2E2WA 4ND6A 4CV0A 3E58A 1PR6A 4EFNA 5AM3A 1OXMA 2Z56A 3C6KA 3I76A 3QUQA 5I7VA 4S24A 1EBBA 4N0EA 2V4ZA 2P6NA 2AC2A 1LQUA 4O0MA 2OVFA 3H1BA 4R2IA 4XM0A 2FPIA 4RPLA 4DJJA 2XYQA 4II2A 1HLDA 1O03A 2QTLA 1TCAA 2VFAA 1B6GA 1NI4A 4ZOLA 2FSHA 4CIDA 3I61A 2V98A 3PUHA 3DZJA 3N3BC 5MDHA 5DTEA 3CMAB 1YHZA 3Q7IA 1E96A 4WBSA 3I9NA 4B83A 5ENDA 4UW9A 3F2IA 4ZODA 5EQTA 3T1HB 4GRAA 2EXXA 4ZQIA 4JP5A 2QJOA 3H2SA 4BVBA 5GAJA 2GAAA 3GLUA 4IIFA 4U5QA 1Z73A 1X7XA 2HT6A 1AF4A 3U56A 4S1PA 4DQKA 1VJTA 2C94A 3OC0A 3VVCA 4OSEA 2CNLA 2DRIA 2CHQA 2IIVA 2RDMA 5E0OA 5BRAA 1XZNA 2LVBA 3SHWA 4L85A 4WGGA 2O54A 5LP6B 3HSYA 4HSGA 3GVKA 4A27A 5AYVA 1Q0QA 1QTIA 4ZVTA 1XTVA 2SCUB 2WF9A 2ZWVA 5BWNA 3H6HA 1G5PA 2BFEA 1JHMA 1CY7A 1LY1A 2DFLA 2V7BA 3P9YA 2VDUE 1Y4UA 5A9TA 4TTPA 3UMSA 4BNWA 3ZZMA 4OL9A 4ESHA 3RC8A 2WDZA 1C0IA 1WDWB 3BB4A 3ZV6A 3E9MA 5BW6B 3EAFA 1I7DA 4BPRA 5D3ZA 1Q0ZA 5FT9A 5LP6A 3MWKA 2O2EA 1VB5A 3GHHA 3GN2A 5ALOA 3QXCA 1Y1QA 2DPMA 3EAGA 3N59A 2P3MA 1YFJA 4K86A 2V58A 1Y8QA 5TRTA 2QJWA 3EF1A 3ZWMA 8ADHA 2GBPA 3LFTA 3TIIA 5CIWA 3FCOA 3U60B 1HC7A 2EYQA 4DLVA 2GJRA 1ZJWA 2X0NA 2VBCA 3DL4A 2E5FA 4LZJA 3OJWA 4MR7B 4V0KA 3HDGA 4BATA 2A30A 3U7GA 3A4TA 3SR0A 5CIQA 2ZPTX 2R8BA 3RYFA 1X0XA 4O02B 1JP7A 3GDWA 4EW1A 2IBSA 1VJ0A 1YV9A 4XX0B 2AQIA 2CW5A 4RZXA 1JIXA 1T9CA 3HJFA 1RJWA 1PSZA 1QG4A 3KJZA 3OZIA 5AK5A 3FWYA 1KFEB 2GGSA 1IZ9A 3CZRA 1JH9A 3O4RA 3NDJA 2MYTA 4BWVA 5CLFA 2H2FA 3M3DA 4LJAA 2J3JA 3ZQJA 3A32A 2QAGA 2QDKA 2QRZA 1HG0A 4I46A 3RKRA 2AN3A 4MAAA 1O9HA 4JOSA 4AYXA 2C1EA 2J9GA 4L6CA 4PCVA 5L95A 5BP7A 3K6KA 1KOFA 2QYTA 2QLLA 4AL4A 3CNLA 1Z17A 3O21A 4X62B 3VZRA 1CP3A 2H7VA 1M34B 1SWWA 3GPIA 4JLVA 2GZSA 1EFVB 1YX2A 5AK4A 3LV8A 3IQIX 4ZGGA 5CLLA 5IZ4A 3TR0A 1QIFA 4QNMA 3QMMA 3WGGA 3V2IA 4EL5A 4S05A 4I5FA 1IXSB 2JW5A 2LCFA 5JRZA 4JMLA 4QGBA 2FP4A 4X8LA 1RWNA 3WNDA 4Z0HO 3REQA 3EZ9A 3VI4B 2O5VA 2QGZA 1HTBA 2I4TA 1ZH4A 4FJ1A 5JZVA 4AUKA 1XD8A 4FDAA 2WZBA 2ZXUA 1FDOA 4C0HA 3OIDA 3I12A 4WN3A 2CBXA 4E70A 1M2KA 4YT8A 1EDOA 2ZUSA 1KJZA 2OGUA 2YWEA 1ODKA 2XUOA 2MWMA 3DXXA 4WXYB 3ZV7A 1ADBA 4IXNA 3AMVA 4RMJA 1X42A 4L8GA 1E98A 1QZ3A 4EKIA 3ISTA 2W6MA 5KTYA 5KYKA 1VQOB 3HCDA 1JXAA 3C7TA 4IF6A 3KHUA 3G5TA 4MJ7A 4AURA 4ZYZA 4WUVA 4BMYA 2G83A 3H05A 3O0DA 2A5FA 1SU8A 3HNPA 4GR9A 4P5PA 4C7BA 1E4OA 1FNCA 2JGFA 3F7MA 3IIMA 4IIUA 3AI1A 4KZKA 4XM2A 1OFUX 3VBEA 2ILVA 2VHTA 1VOTA 4KXNA 2ADFA 4JY7A 5CT5A 4AY2A 1B23P 1JEYA 1MUUA 1L5HA 4HAYA 1OH5A 5BWMA 3OEYA 1B74A 2WYOA 4OBWA 2EQAA 4KFCA 1P8JA 4JLSA 2ZWMA 3AFNA 3H75A 4G4JA 1U2DA 4X07A 2WSSA 4MWEA 3P9CA 4Q1FA 3KEMA 4FW9A 5BNIA 5BMVB 5A9RA 4Q4DA 4WKBA 2A1IA 5EJMA 3QJGA 4QV2A 2AG5A 2P6MA 3B6ZA 2Q6KA 2OG1A 3QV2A 4MUHA 1VL5A 2ZJ7A 3SG0A 3QMVA 1FFAA 5KHAA 3JYNA 5ICGA 4FFWA 3CNEA 4DBLE 4EY5A 4U2BA 4I1UA 1P2FA 4Z6KA 2J87A 2X58A 2FHPA 1W19A 4M21A 3JD4A 2V03A 1E3QA 4C14A 1Y1SA 4FINA 5JCJD 1EFRD 1KIMA 3E9YA 1IN4A 1VXRA 4G07A 4H7HA 4TL9A 3B6IA 1X7YA 3FWZA 5JG7A 3VR4D 2X5OA 2V3CC 2GZHA 2C07A 4NSNA 4ND3A 4QVAA 1EFKA 1IZ0A 2BVNA 1F8UA 2FFHA 3CF2A 2PGNA 2RHCA 4IDQA 4KXXA 5JAQA 5LA6F 4RMIA 5EIBC 5E7MA 4BUZA 4EGCB 4H4EA 1O0CA 2ODQA 1S3FA 1HFJA 3TQHA 4XWKA 3B78A 3AKYA 3Q7SA 2B69A 5E95A 2JDID 2Z0MA 1MOZA 2K4MA 3NW9A 2A5DA 3FH0A 3E61A 1WPXA 3FWPA 1ZLXA 3EYAA 4IYJA 5LYJA 3P9ZA 1WW2A 3D7SA 1GO2A 3I72A 1MKYA 2RAVA 5I7EA 1EXDA 1XU9A 2OTLB 2P4QA 3U7RA 2QD4A 4Q4HB 2BCEA 5JJBA 3TQFA 1RFGE 3V2UA 2NUBA 4H59A 4HDMB 2DPGA 3BGSA 3TDMA 3I8XA 3PXDA 3EVDA 1C29B 3IBCA 2NQ8A 1XQBA 3JQ8B 3PRJA 5SV2A 5KNDH 4C88A 3NKLA 1JT2A 5JAIA 4HBGA 5BNFA 2ENUA 4OIMA 2HPVA 3WK9A 2Q1YA 4TL8A 5HMMA 1E6KA 2AFIE 2B36A 3E7XA 2WNSA 3S2SA 3LLUA 3U3KA 3C3MA 3AZPA 3L49A 3OFSA 3WMGA 4EEXA 1U81A 2XYVA 5C8YA 4MWSA 3DD5A 5BN3B 4HEHA 3QBTA 2B8NA 2PMFA 1IEXA 3OCVA 1T24A 4QU8A 3MZ0A 4EGJA 3LPDA 1ULHA 4LVCA 3HR4A 3LUKA 2FEPA 4P5EA 1LKZA 3HDHA 2IELA 1IXRC 3CC7B 3AEUB 2H2DA 3WO0A 2EFCB 3L4EA 3PP8A 2C8VA 2PGAA 4JBNA 1VMEA 1P0CA 2RI6A 1PD1A 4MRSA 4WBNA 5KSPA 1GPLA 2X2PA 3OPQA 2Q5EA 5TB5A 4PPYA 2CN1A 3ADKA 3EIUA 2BZSA 4WCDA 1UMCA 2ZT5A 3GOHA 3IC5A 4ER7A 1AQJA 2WZCA 1E5XA 1VKRA 2HCTA 1B0ZA 1P4RA 2QRVB 3HO8A 2QT9A 3OTGA 3Q8XB 4A2WA 3D4PA 5CAEB 1ZD9A 1TZCA 1BCRB 1I2CA 2DWQA 2WAOA 4IS3A 1NVMB 1JR4A 4FN4A 3MILA 1LX7A 2ZSIA 3OZUA 5DYYA 5INTA 1VSQA 7YASA 1P1RA 4EHKA 4FE3A 4L75A 4E2YA 1XWWA 2DCMA 821PA 3EMVA 5JCOC 4Z4SA 4V38A 3OWOA 1XHFA 2ZUDA 4NECA 1IOVA 3PDHA 2SKCA 1ESMA 4GOKA 3DVAB 3KZ1E 1V1RA 3Q7QA 4N12A 1D5WA 5AQEA 3UJHA 3KR1A 1N9GB 3DDOA 4JLMA 4N1AA 3LW8A 4FDLA 2C5SA 2F43B 3WGLA 5CCXA 2FW7A 2XRZA 5F3DA 3AHEA 3RM3A 1Q7RA 4K1XA 3AUAA 1JHDA 4GI5A 2C96A 1II8B 1XZJA 1YNSA 2GKSA 4NMWA 4GUDA 5BUZA 4NEHB 5IMSA 3OUUA 4I0WB 3KOWA 4L2IA 3ND6A 2QE7A 2H17A 4DY6A 1Y8QB 3NP9A 2B8WA 4UD6A 4R01A 4N3BA 4QOGA 3UXMA 2O50A 4K46A 1DLJA 2F17A 1SHZA 4ECEA 2WU1A 2YW2A 3QI2A 1KOJA 4W63A 4FWBA 5B1SA 3ZE2B 2ZUCA 1I5RA 4NOJA 1WUHS 2CV2A 3H9UA 4R3WA 2JPDA 3K9BA 3R0VA 4S0ZA 5DM0A 4C07A 4DDVA 1SCAA 4LZOA 5JT1A 2C4TA 4CFSA 4RHCA 5F3WB 1JH8A 4FE4A 3TQQA 5BMVA 1PLLA 2PA0A 3VR5D 2W2KA 1TIPA 3TRIA 1XZEA 1XF1A 3P2IA 2VZEA 2OAGA 4F5EA 1JL3A 3A3NA 3GC6A 1VRCA 1M76A 1VJ1A 1YDGA 3F9IA 3K1JA 1UOOA 1Q82D 2LUOA 5TC4A 1SVMA 1FE8A 1UPCA 2HGSA 4C2TA 1NX9A 2Z2IA 1V5WA 2R4TA 4M53A 1QDUA 2HU8A 4KYIB 1FYXA 2C2MA 2P9EA 2J32A 4XR6A 3AP1A 4LYFA 2LBPA 4MS3A 3THSA 2QLFA 1XL0A 5M29A 3QUTA 5DFAA 5IEJA 3L6CA 4DCOA 1R4AA 1N9KA 3FTEA 2YWGA 2C0PA 2HMTA 3MEQA 5LZ7A 1Q1EA 2G7MC 3FIJA 5C8DA 2GTPA 4YC7A 3GUZA 1TYAE 5EJAA 3RFVA 4DHWA 3GRVA 2MSWA 4G5HA 4Y2QA 2IYAA 4MS3B 1YRYE 3DMDA 4M86A 3M6LA 4F3CA 3AETB 1B26A 4C4AA 3JSXA 4TQUS 2P3OA 3LQ2A 3TB4A 4GOXA 4BMVA 4OQLA 4C4RA 3I6BA 5B2EA 1AZLA 1E9AA 4H6XA 2DWUA 2OM2A 4P9NA 3RS5A 3VGJA 2OENG 4LBZA 5DNYB 3U16A 1B4DA 4N3NA 2Q9UA 3EVCA 3I30X 1HLFA 1L7BA 3LTEA 3PUZA 5CX1A 3CT6A 3VBCA 4GYYA 4MQLA 4YWHA 4Q4HA 3UATA 4NIMA 3KXPA 3K0HA 3BZBA 3ORYA 4BNUA 4PPQA 2P3SA 1OJ7A 1NKTA 2H7YA 2R6JA 3FTPA 3ORSA 4YV7A 5AVVA 5LCXA 4Z9FA 3ZS9A 4HNGA 4LZNA 3K94A 3ZCUA 1QIHA 1XKLA 2PLAA 4F6RB 4XVCA 5ITSA 5CD1A 3NMUF 1QHGA 2Q7DA 4I4TB 1CHNA 5T3YA 1JXQA 2PUCA 1M8PA 2CFCA 2VQDA 3CLTC 1K8QA 2JHGA 3UPUA 2V6IA 1D0VA 1KJQA 1ZA2A 2I87A 3LZ6A 3NGXA 4JYCA 1QKJA 5KNBA 1VLYA 1UBGA 3N2YA 3N58A 3ZKWB 1LI4A 1L5HB 5LUAA 4CI9A 3IIKA 4QLBA 1DAHA 1N25A 1BHSA 4JR2A 5F76A 4WH0A 3Q6MA 3KL9A 1QAQA 1E3TA 1MJHA 1ZGJA 1MG0A 2FMXA 1XVIA 3G2NA 5DWVA 1B8VA 2J67A 2XQGA 3UKJA 4FYMA 3K70D 1NXOA 3RLFA 1ISRA 2NU7B 2FEKA 4KE7A 3FFBA 4R31A 3S3TA 3IEIA 3DV0B 5ITZB 2HIMA 2AMJA 1U2QA 3PEEA 2NVUA 5KYNA 1BX0A 1IONA 1FVFA 2QKYA 4ZVQA 1MQ9A 4U2KA 4XE5A 1JEJA 1P3DA 5BWLA 3Q5EA 1OZFA 2RARA 3L8YA 3HVUA 3I6IA 5FWYB 4OLAA 3F9CA 3W8EA 5IAAA 4RH0A 1IZZA 1M75A 1RM4A 3G1TA 4MV4A 5E1DA 1QLJA 1SVSA 4K6FA 4YLEA 4YAEA 3HB5X 1SKUA 4G4SP 1PR5A 2CL0X 1IIRA 3PJEA 3PF8A 1ODIA 2IGBA 3E5HA 4IOJA 4AP9A 2ZM6B 3CBQA 1JMVA 1RRKA 3QELA 3EPJA 2A7QA 3JAKB 1UBJS 4BO8A 2AFHE 3GW8A 3ASSA 4M6WA 5HE9A 3NEPX 4CM9A 1J25A 2Q6VA 4JQSA 4OQDA 4S1OA 1F6DA 1BDIA 3ASRA 4KQJA 5LYJF 1AKNA 3UMVA 5B3KA 4KFSA 4E3ZA 3PPVA 2CD9A 2PR2A 3ZZ0A 4JODA 2J0UB 1KDTA 1ZW6A 3HYCA 3KKPA 1QGDA 4K6CA 2O1WA 2ZIUB 3R9WA 1RI3A 3HVJA 3JX9A 3K0KA 3LOQA 4GF5A 3UJ3X 4M2LA 1SVKA 2ZBFA 3R8CA 3UYKA 3QMPA 1GNPA 4JB8A 4PZPA 3WLOA 3HM9A 3LYUA 3AVXA 3FZGA 2HWUA 1OY1A 4RFSB 2YXPX 4IJ5A 5DVZA 4CCAA 1T36A 5FBZA 2DQZA 1V96A 3AESA 4O5OA 1C0LA 5AKIA 4FZ5A 1N32B 5LDHA 1CB7A 5DXFA 5CVJA 1F8GA 4K88A 4MX8A 4BKUA 1MVNA 5BSVA 1RZVA 2UZ1A 2UV8A 3I2FA 1JQDA 1S2GA 2PJRA 3WYAA 1E1QA 1NOJA 4DV5B 4YXFA 2VBUA 2F48A 1L5RA 4BNVA 3L7OA 2ONZA 4GMFA 3VISA 1KY4A 5FTMA 3A27A 1OT5A 4CIBA 3AY6A 4R54A 3ZC3A 3BMNB 4LK2A 1KAGA 1A4RA 1XRQA 4LTMA 4F5YA 5HZHA 1AO3A 2NSJA 3BH0A 2HHJA 4RGBA 3GVXA 3NVDA 1LGYA 2I62A 4ER5A 1Z88A 1OLUA 2CY0A 3KOMA 5IJ9B 2JFXA 2R1VA 3NM6B 2IBTA 1HMPA 3BXHA 4H0CA 1EGMB 2F1HA 2ZL5A 2QZJA 1RKXA 4CE6A 4MVJA 3JD2A 5AOBA 1V47A 2Q07A 4ZO7A 4XM1A 2WIBA 2J33A 4IJQA 5IMBA 1JWBB 3L82B 4X8IA 4DK1A 1NTOA 3K0CC 1KE1A 1QFXA 4JH0A 4DPMA 3G0DA 1FDIA 3G71B 3GD5A 3VSAA 4C0AC 3LBAA 4AZWA 3VU0A 1U1EA 4TKVB 1AMUA 2P3LA 2G1AA 4NI5A 4YJ2F 3QP9A 3TRHA 2LZ0A 1ORWA 4X90A 3IR6A 2GJ8A 4OQZA 4DRYA 7GPBA 3BHJA 4YRTA 2PUJA 5AVSA 4HJXA 1H4SA 1U2GA 3T9CA 1S01A 4PIVA 3BY1A 3RVKA 4BMDA 2B8EA 1CQJA 2D74A 4M46A 4OQNA 4ENTA 1I4DD 4AFNA 1VCNA 5CW1A 3DGFC 2FW0A 1H4TA 2G70A 2I1WA 4BEJA 4O4JB 1NT4A 4TWZA 5A4DA 2IDJA 1VLHA 1CFJA 1HT2E 2FZGA 4I9UA 4N3GA 1KKMA 3GLGB 2WJ6A 1FFHA 3UV6A 1VQ5B 5LM3A 3WIDA 3C1UA 4AKHA 1RRPA 1T13A 2G72A 3GAMA 3GEMA 2H9AA 4Z4CA 2OKCA 3GFRA 3IOBA 2CMKA 2HWYA 3FPSA 4KUHA 5D87A 4JWTA 5K0LA 3UV3A 4CFYA 4J7UA 2RGEA 2I6FA 3A6EA 2VBIA 2YOGA 1QPGA 1GCUA 1ZK2A 1GQYA 1U9YA 3NASA 2OCLA 1CW2B 5F4ZA 3ZCPA 3DBHB 2HU2A 3GY0A 2C7VA 3PNPA 4R8VA 3QVXA 5DN9A 3RAPR 4YI5A 1T1GA 1GPJA 3WRXA 1M2EA 1SCUA 2GN6A 1NBAA 5CBPA 3ELUA 3K9LA 5A3SA 3T12A 9MHTA 1N8TA 1IY9A 1CUFA 1HE2A 1LSSA 2PKEA 4K6MA 5DXAA 3PFFA 3LF1A 4K9MA 3RRXA 1I0ZA 2VHCA 2WOOA 4RMHA 3AUTA 1P5RA 2VF7A 2VSFA 3IOYA 4RMNA 2Q27A 1LW6E 3C4JA 3DKPA 4FDMA 2WZNA 2A9KA 2P5TB 4QDOA 1K63A 1DXYA 1GV0A 1P1BA 3GEDA 3MAJA 4GGOA 3IAHA 3DDYA 1T1IA 3A35A 4CZ2A 1EX9A 2JK1A 3O1LA 1HETA 1KI2A 1UDBA 4I4CA 1QORA 4XB1A 3VR6D 1DC7A 4DB2A 3GXOA 3E22B 2ZTUA 3WWYA 3ZHZA 3W9SA 5JD4A 4DQDA 1VJRA 3EG9A 3BGDA 2SNIE 1CCWA 3DFMA 1XNJA 3LVRE 5G4LA 2ZAGA 1HE4A 3C15C 1I01A 1K8RA 4KODA 2DX7A 1PJ7A 3RYIA 3WDKA 2HLHA 4C6SA 4F0JA 3GLGE 2EOAA 1DCFA 3CNBA 4F06A 1DB3A 2Q29A 2DYIA 3KWMA 2GN9A 2D3WA 3G5MA 3Q10A 2VJKA 5DK4A 4D9NA 1P72A 5L4NA 3C7AA 1Z0KA 1BD4A 2KLHA 2PMCA 3AVPA 4G26A 4URFA 3ZCVA 3HJUA 3ETGA 4F6RA 2WNHA 3HTXA 4O2AF 3VJKA 3EC7A 1VJDA 3OPXA 1ZGGA 4HZGA 4P32A 4RVUA 4W8HA 3BM5A 4K40A 4MPPA 4R6XA 2E37A 3C1OA 4G5FA 4QPZA 3C3KA 4D02A 1SCDA 3JZAA 1MO2A 3R3UA 3MINA 4LGCA 4G89A 1V1MA 2CXTA 2NO0A 2R1ZA 2WUDA 1E1MA 1ZD8A 1S9HA 2GJAA 2JBAA 2R8YA 3G2HA 3PKIA 3PJGA 2XI4A 3QPAA 1M7HA 3OOYA 1H2BA 4I1VA 2VDQB 4OA5A 4JBXA 3DTVA 3C6YA 3FZNA 1QPBA 3IT0A 4PLVA 4RJLA 1ISHA 1DFIA 1U31A 3CBGA 5CHEA 5ECGC 4E5MA 2PZFA 1HSZA 2P2LA 1WQ3A 3VAAA 3IA7A 4M1ZA 3VKHA 1JA0A 2V1XA 1RR6A 3K2QA 1J24A 4OHBA 3E53A 4W7SA 1E1RA 3SYRA 3CUSA 3WOVA 4F97A 1N5OX 3CLSD 4RYDA 3P45A 2W6ID 4U1RA 4ZVMA 5TJHA 3UENA 1JJ7A 3VZPA 4F5DA 1JR6A 1KZ7B 4A0GA 2ECOA 2GAFA 2IYNA 1X7HA 3E35A 4JC0A 3CJRA 1NV9A 2FMUA 1WLSA 3JR3A 3EMKA 1V6CA 4JQOA 3WFIA 3RK0A 3WX0A 4ZYLA 3ZXUB 1YL7A 4NYMR 5BSEA 1E2BA 2INGX 5BQPA 1OXBB 4GT1A 3JZDA 2V7TA 3I01A 1PQ4A 2FZCA 2I2DA 2OEPA 3FPLA 5ISMA 4JB3A 6YASA 4YV1A 3ONDA 5LBTA 1IY8A 1DO2A 4CHGA 4CM9D 5JJCA 3UHFA 3K9FC 1UD6A 2W8ZA 3BXPA 4EKDA 1ZC3A 5FPHA 1H2WA 4FHFA 4IDNA 3RHSA 1GIAA 3M34A 4QSHA 5G2OA 1UD3A 3FCSB 3SHFA 2VBVA 2CXNA 3T6KA 4IIJB 4JV5B 4WOKA 2HJGA 3BFPA 3V8VA 4XQEA 1WXWA 2OV6A 2PM8A 3JTMA 2A92A 3LC1O 2VHEA 3QENA 2QYSA 1KH1A 1Z36A 1TAHA 4CETA 5E3JA 3S8MA 1O95A 3H8VA 2XUAA 1WX1A 1CQIB 4QELA 5ALUA 2CFIA 5HIJA 2H4WA 3CH5A 5HHTA 3SHQA 5ILQA 1RYZA 3BH7A 3CC4B 4BNNA 3MWLA 3PGVA 1SBYA 3PUKA 3U7HB 2PZGA 2J0VA 2XLCA 3M6FA 1Z6YA 2BUBA 3KV1A 3UT5B 4FFLA 4KNYA 3U7IA 4MH0R 1YKFA 3RC9A 4MROA 5C1OA 1QFYA 2EZUA 2P2SA 1W49A 4GS5A 2Z5VA 1N5LA 2P40A 2C2KA 3MSCA 3OZEA 2R3SA 3CCCA 2WSLA 4ZJZA 3QKRA 1ADGA 1JU3A 4TT3D 2HJWA 1NQVA 4GI1A 4HPXB 2FMKA 2EBFX 5T4EA 4XEUA 3I5MA 3RVOA 4IVNA 2QSJA 2NPFA 4DIMA 1XDZA 2PQ0A 2H1VA 4FFBA 4JAVC 3JYQA 4YT5A 5LP6F 1LA2A 2VDPB 1SVLA 3D1JA 2JA2A 3NEAA 1M74A 1CZHA 5BSFA 3L93A 1PGQA 4EB6A 3IVGA 3ELYA 3AIIA 3H7AA 4HDNB 3FNQA 2X6TA 2BMWA 3BORA 3IOMA 4QUKA 4WT7A 5DGXA 1HDOA 4EZEA 1CUYA 2V9PA 1PJBA 1RKQA 3AL3A 1FQWA 3EFHA 2CV1A 3PQ3A 1N5RA 3CR3C 4HAIA 2MCFA 5HR5A 3NHSA 2H2IA 2A4KA 1XLVA 1E60A 1TA9A 2GPWA 2ATEA 3LAWA 3B3GA 1PS9A 4M6WB 3RYHB 3V9AA 2D0PB 1J8YF 5JAZA 2VF4X 3ZLUA 1Y1LA 1JXOA 4UNNA 4IXMA 2VIIA 3TX2A 1JIJA 1V37A 5DN6D 2YTZA 4A91A 2TMKA 2A0KA 3A1CA 1D8AA 3BJIC 4G5RA 1PGOA 4MR8B 5D5QA 5HJ7A 1BQ4A 2PUFA 1DKPA 4DAOA 5JDIC 2C2GA 4PNEA 3ESRA 1S89A 1NF8A 4CM8A 4IFBA 4OGLA 2XA9A 1HNXB 1WHSA 3I4LA 3P9NA 1Q50A 2OV8A 2GSDA 1NOIA 4Q7MB 1U6JA 4FOOA 1KO7A 3HP1A 3Q8MA 1JHQA 1HX7A 1D7AA 2ZYAA 2QTMA 3ESDA 4MQEA 3E82A 3BF8A 4G1UC 2DSTA 4Q1EA 4DW8A 3G0GA 2TMYA 3EH2A 2IOFK 4H0NA 3PRKE 4RQAA 4RF3A 2QPTA 1Q86D 3A1NA 5DB4A 5TJ9A 1EEHA 3WMEA 5EJFA 4Y1EA 1I4OA 1WIWA 1HV8A 2W83A 4HWRA 2W70A 5NLLA 2D2FA 2ZRFA 4DMRA 3N39C 1PR2A 3GP5A 4N39A 2G9NA 2HQBA 2AJLI 3ETNA 1L5NA 1LPSA 3DB2A 1PUXA 3T3MB 1ZRNA 4TLMB 2FV8A 3A3BA 2ZATA 5IYWA 1F8YA 1WQ4A 3IBFA 4YDHB 2DETA 3DT6A 5BNZA 1R5NA 1W25A 3A1TA 5DHQA 4I50B 3ISXA 1NFQA 1YB7A 5AJWA 4B31A 3F7NA 2VATA 4Q1DA 3IYLW 1CZKA 2ZIEA 4PVCA 1YRBA 4WNCA 3IDOA 4HDSB 1U3UA 2PR7A 5LNK6 3VR4H 1RXUA 1IWBB 2WIJA 4I7EA 4LMRA 3TSOA 3BNWA 2AH5A 4YI3A 4D9GA 3GJ5A 4L15A 4ZEOA 3HEAA 1GVHA 1SCNE 2VPPA 5LYJB 2JLAA 3OSUA 4B7ZA 5ANRB 3B3JA 4MDYA 1EHCA 1MCZA 1J5PA 3LHKA 4ANFA 2Q5IA 2QUBA 3H5TA 4IHKA 4KW7A 2PRZA 4LCBA 3TFWA 3LYHA 2CWDA 2EWMA 2P1RA 2FVGA 4N5LA 4LMBA 4Z4VA 2R6R1 3RGWS 2X8BA 4WKPA 3T7AA 1A5AB 1ONNA 1PWEA 2RHOA 3SM3A 3HBJA 2VAPA 3PHCA 4ZU1X 5J4KA 3NIBA 5FV7A 3CG4A 4AS1A 4DUZB 1EFPB 2XMQA 1D2EA 3JQ9A 1UBTS 2NXNA 2FEXA 4GM1A 4M0KA 5GJVC 3EXHA 3TFQA 1FMTA 5HS6A 3R75A 4X7RA 2QPOA 3GJ6A 4TYWA 5F4OA 3NFYA 4OM8A 1XPJA 1W4AA 1GCOA 1N8KA 3WQHA 1P1IA 1DWPA 4YXWD 1XZFA 4MWCA 2OZKA 5AKEA 1VKZA 4Y2RA 3C2QA 3RVNA 1QU3A 2GD0A 4HFNA 3V32A 5G0SA 1E3SA 1X1EA 2VH1A 2OC9A 5JO9A 5H02A 3UGKA 5CIYA 4MA5A 2I76A 2H8GA 1XD2B 3KOYA 3LX4A 1T0PA 1DT5A 4W8OA 5B3JA 1Z2AA 3GCZA 3HEMA 1KRXA 1DADA 2XWBF 4YP5A 2MYPA 4QJ3A 1A5TA 2A7XA 4ER0A 5TF0A 4BNMA 1AXGA 1JQAA 1XC7A 4U2FA 4FFPA 4AX4A 5JQGB 1JFTA 3PDIB 2ZSUA 3BMQA 3VR2D 3RPEA 4O2AA 1VYVA 4YACA 4L28A 4OQQA 1Y1KE 3DQPA 4I9GA 4LRWA 4HDAA 2GHIA 2ORVA 3D6MA 1MDFA 2VJIA 3NV9A 4OK5A 3E9NA 1O08A 3PPIA 3GSIA 2HBQA 1C1DB 1FUKA 3ITDA 5DRTA 3N2GB 2Y68A 4L74A 2HU5A 3G2JA 4GZ6A 4PS0A 5GWXA 2OAP1 4EG8A 4ROXA 3PBKA 3ROGA 4XTCS 4NX2A 2GD1O 3PGLA 3QKSA 4Q0MA 2PUAA 4MCIA 221PA 2GXQA 2ZJ8A 3KUDA 3WBBA 1MGPA 2QEQA 1G3IA 2QBYB 2NO6A 2H2WA 3ZJ4A 3CE6A 3NDPA 1FJHA 1QK5A 1W4CA 1M10A 4JDUA 5BO5A 1RXCA 4DDTA 1KYTA 2FR0A 5J5AA 1DPGA 2HF7A 1GQ2A 3G1UA 3IIJA 3DS8A 5CYOA 3ZVLA 4D97A 2GVZC 2F4VB 3I56B 1Q17A 4Q18A 3RRBA 3TLEA 4PG5A 4CL0A 4MJLA 2C4VA 4HSEA 4EGSA 1E3MA 1KPGA 2DUNA 2SCUA 2V7QA 4BE7B 4E6EA 3OPYA 2Q50A 4GLOA 5LQNA 3PL5A 4J9VA 1GPUA 2C5FA 3D9QX 2IP1A 3GQBB 2COEA 3PFKA 4QG3A 1G59A 1E2IA 3DPUA 1HNWB 4K9SA 3R23A 1DOZA 2VBGA 4NU8X 1D2AA 3I83A 4JKIA 4TQ9A 3TAUA 1A76A 2EJCA 1FTGA 4HG2A 4DF3A 4FB4A 3F78A 2WU4A 1DFHA 4DNOA 2CWWA 2JLQA 3AM4A 4MVYA 1J9EA 2D06A 2C5AA 4RDJA 3KDAA 2G77B 3ENQA 1NNI1 2EX0A 4A1OA 1BYUA 2FFQA 2KX7A 1T3HA 1OZAA 4P3YA 1M1KD 4AMBA 5MFPA 4GRDA 4LQDA 2RJ3A 3DEIA 1BN7A 2R5WA 1UKZA 2WT9A 2PKXA 3EEYA 4OQXA 5KWJA 5K0GA 3A1FA 2YVAA 4NF2A 5CYFA 2XQFA 4F3RA 4C4TA 2F1KA 2XPCA 5DU2A 3KYCA 2ZYDA 3C87A 3FKJA 1PKEA 4Y1FA 3T4UA 4PIPA 2I91A 4Q9LA 1LRKA 4ZAZA 3PLNA 2RE8A 2GT1A 3X1ZA 1C9KA 1KP3A 2QX7A 2J5KA 3K1TA 4FCVA 3OOJA 3TPZA 2FPRA 4X85A 4LSWA 3NT5A 2BGNA 2FOXA 2X7XA 2V6MA 4NMLA 2V0CA 3AR8A 4PLCA 3E7FA 1ECGA 1EFLA 4JROA 5BNWA 5L7YA 1JT9A 1E2LA 1XK6A 1OB0A 2RBEA 2WTAA 1MOSA 1O97C 1TVKB 1U7WA 2CLSA 2OVBA 2XF8A 3B1FA 3DVQX 4B6EA 4YRSA 4R1QA 4HT3B 3HXMA 3PC4A 4B75A 3TLZA 3ZGOA 1X7WB 4UU0A 4E08A 1ENZA 2HWXA 5KOYA 1DAPA 4X1IA 3JW8A 3GNTA 4F2PA 1SC6A 1RKUA 1Y37A 4XFKA 1OKKA 3R5JA 3E84A 1C3VA 4A16A 1EKXA 1JDUA 4KQXA 4KLAA 1ND5A 3NYIA 3ROTA 5JQWA 4R68A 2KHZA 2MR5A 2DR3A 3AEZA 3O9ZA 3KM0A 5C4IA 4NH4A 4Q9IA 4KXUA 1Y7IA 4NC9A 3K9GA 1OVGA 3O26A 1G5TA 3QIAA 3W9UA 3QA3E 2C2YA 2REBA 3MINB 2FX2A 3ZWDA 2H31A 3MMSA 2QQGA 4MYUA 3ELDA 1GUZA 2OD9A 4Y98A 2JJMA 3ZYCA 1YCDA 1XTPA 1YO6A 4Q01A 2IDZA 3PGA1 1ZA1A 1PJ3A 4PSKA 3VPFA 3CUWA 4P3PA 1GV1A 1QHFA 2XOXA 1CNEA 2DBRA 4JVSB 3HNOA 4QLAA 3Q38A 3R76A 4B4VA 1Y6GA 4MDHA 4AY3A 3SQMA 2HMUA 3GLHA 1DDIA 3TNLA 4QXMA 4Y6OA 5BYBA 3L5KA 4GUAA 1W2GA 2W98A 4B47A 2BIFA 5T8KA 1VP9A 4Y2HA 4Z4YA 4H6WA 3IMKA 5I7UA 2PT9A 3R3YA 4RCVA 1BW9A 2DKOA 1BA2A 2IH2A 4OK6A 3M70A 4K2AA 4ZDKA 5EUMA 4TV9B 2XB9A 1QR2A 4DKXA 4UFPA 4BFZA 3BGVA 3D8SA 3NRBA 5CLQA 2X3FA 4ZVNA 4P4UA 2AMVA 2GCNA 5F2OA 4E5PA 3ABIA 3CUVA 4I8IA 2PFGA 1QHSA 4HXEB 4MCHA 4AAYA 4B73A 5KNLA 1TZMA 2W2OA 1EGHA 1K0UA 1GTZA 4Y9DA 3WMRA 2NSYA 3LVFO 5A5FA 3D3WB 3EWAA 2YKGA 3G89A 3WAKA 3DDCA 3WB1A 3P2EA 3BC9A 5A2QA 4IKPA 3F8TA 1R64A 4DB4A 2ZPAA 4Z1OA 4G1BA 3PCRB 2PNJA 3WL5A 2OK7A 1QCZA 4HQRA 1S2IA 1U7DA 4UARA 2WWFA 1I3LA 3BIXA 1L7AA 5CHYA 1VQ9B 4MVCA 3EXIA 3WNVA 4CDMA 4REMA 2ZOSA 1VG1A 2ECKA 2W8BB 1VI5A 1X87A 4IOMA 1E20A 2PFSA 3JRWA 3AVTA 4P08A 2PAAA 4OXRA 1NJGA 1MGOA 1P9LA 4HAUA 4KRYA 1QZTA 4PBSA 2GFIA 5ALYA 4AKSA 5CLJA 1DIOB 2VZLA 2B4RO 5COAA 5HJ2A 2JJQA 5CU7A 4AULA 3PNVA 1FYFA 1EWRA 1AD2A 4CVNA 5A1JA 5B6PA 3R5XA 4MYCA 5IM4A 4PIMA 4KB5A 2G71A 1MNQA 2JKVA 1QV6A 2AKAB 4IQGA 1GZ4A 4KN8A 5A5GA 2RHGB 2VUTA 3FNBA 1S2DA 5KC9A 2WG2A 2ORWA 4WESB 1X6VA 3PPWA 4DR4B 5JPIA 2IIBA 2OXEA 2X6XA 4Q3NA 5IKMA 3KYCB 1FBNA 2VJQA 1BLIA 1P0FA 3MJDA 2LRHA 1PL6A 4HL6A 3MJEA 2BTQA 2Q4RA 4KIWA 4ETNA 4ME6A 4HQFA 2XD4A 4XKVA 1WY7A 3MFQA 3LGAA 2JLCA 2IUFA 1M1UA 2WK1A 3VNRA 1XJWA 5PNTA 1A2BA 1DFGA 1O5TA 1CPYA 1AZWA 2Y77A 3OZGA 4FYVA 3OT1A 2WKRA 1RJ9A 4RWZA 3VZDA 4ZI2A 4O8CA 4HH0A 1ZVVA 1Z18A 1TU4A 5HFNA 3GJSA 1INLA 3AVYA 2NGRA 3TTXA 1DXOA 1NW5A 1SKBA 3AJAA 3Q1KA 5EIXA 5ALDA 4IVPA 1M66A 4YMHA 1EGVB 2C4NA 5ALLA 1KC3A 3VH3A 3N7TA 4FYXA 3EODA 2AR9A 1T9KA 2JGMA 2ZS8A 2QP3A 2H9YA 4OGKA 1Y6JA 2GPSA 1R18A 5DYWA 4I6GA 3RWOA 3N8IA 1O6CA 4IY1A 4G0XA 3PVZA 1X9HA 2P4SA 5BVGA 3BL8A 4RORA 3OD1A 4D8VA 1HYQA 2P1ZA 4UU8A 1LQTA 2YJZA 3V6MA 4DHEA 2GM9A 1ZMRA 5F9MA 1PDOA 2C54A 2QN3A 3S44A 2AJCA 3TQCA 3EA4A 3WV4A 3KT6A 1NJID 4LQ4A 4D9MA 4EJSC 2QSUA 3MGCA 5GVRA 4DUPA 2EGGA 2C7QA 4FYKA 4EK9A 1GHTA 1N9GA 3ZCXA 4F56A 3VMMA 4OYLA 1T0IA 4TLAA 3WIVA 1PEKE 5KTSA 5CA1A 4QULA 1UFKA 2VKQA 4MLZA 2FWJA 5IM4F 5I7OA 1UZNA 1G2QA 3T7DA 4RK6A 3G5LA 1BQEA 3OMLA 4FGLA 2ZYIA 2RAPA 4RTOA 2A5JA 4BIMA 4M0LA 1SK9A 1R88A 3DOJA 3SYLA 1AKRA 4YNBA 3OBBA 3PA6A 1MBZA 2R7LA 1QQBA 4O63O 3