2XNCA

Crystal structure of an engineered ferredoxin nadp reductase (fnr) from pisum sativum
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
287
structure length
287
Chain Sequence
SKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRVPDGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Swapping Fad Binding Motifs between Plastidic and Bacterial Ferredoxin-Nadp(H) Reductases.
pubmed doi rcsb
source organism Pisum sativum
molecule tags Oxidoreductase
molecule keywords FERREDOXIN--NADP REDUCTASE, LEAF ISOZYME, CHLOROPLASTIC
total genus 92
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2xncA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2xncA02
2AHOA 1GO2A 3FJOA 1AIPA 1YJ9B 4Q7JB 5EMNA 1IJEA 3MMPA 1GVHA 1J9ZA 1M1KD 1FRNA 3AVUA 2DY1A 3W5UA 1VQ8B 3QFCA 4Y9UA 4WQMA 3WBKA 1JA1A 4M53A 3W5VA 1BQEA 4F7DA 3CXCB 2B5OA 4NCNA 5HXBA 3VO1A 3AGPA 3P27A 1XE1A 3CCSB 3MHPA 4HE5A 1QG0A 4PC6A 1QH0A 4G5GA 1ZM4A 2X3UA 2EIXA 1GJRA 4TMZA 3G71B 4B43A 5TY0A 2HDNB 3CCJB 2YWEA 4IW3B 1WDTA 1K73D 3ZZ0A 2QA4B 2FX3A 5AN9A 1YI2B 4LBZA 1TLLA 2BN4A 1QVGB 1HA3A 4AF6A 2VZLA 1KK1A 1D2EA 4YAFA 1YITB 4LBWA 4R71A 4YALA 4AC9A 3FPKA 3CPWB 4RD6A 3WY9A 1KD1D 4TMWA 4PGOA 1EFUA 2VNHA 4RD2A 3AVTA 4YAWA 1K9MD 3CB4A 1DDIA 4ZCIA 3WBJA 3OJXA 1YJWB 2OTJB 2QTLA 1E62A 1ZM3A 3CD6B 2E1RA 4Y7CA 2C77A 2YWHA 1VQKB 1B2RA 3U6BA 1OB2A 2BSAA 1QFYA 3B78A 3QSYA 4B48A 4DQKA 2B7BA 4AF7A 1JJ2B 1UMKA 4RD0A 3CRZA 4YAOA 1G7SA 3U2QA 4ZCMA 4N3GA 1XB2A 2GQFA 3CCRB 1G7TA 4B4DA 2B7CA 2QDXA 2XNCA 1VQ4B 4ACBA 4B44A 4TN1A 5DSZA 1VQ7B 4TMVA 1FNDA 2R6HA 4QFMA 1NJID 3P26A 3CC2B 4NBSA 3LO8A 1R5BA 1EFCA 2BGIA 2VNJA 1QUFA 2OK7A 1GAQA 1BX1A 1QUEA 2VNKA 4UAJA 5H59A 3ZZTA 4M2LA 1AMOA 2BPOA 1N0UA 4C43A 3WXMA 1ZM2A 4YHBA 3QFSA 3MCAA 1W87A 1DG1G 1KK0A 3JQRA 3G6EB 1YIJB 4RD1A 1VQPB 5H5JA 1QVFB 1QFZA 4FN5A 3SJZA 3A1FA 1N8RD 3OZUA 4P6VF 4C0SA 4ZCLA 1K8AD 1TUIA 1EP2B 1CNEA 1EFTA 1I7PA 2BM0A 3CCMB 1E64A 1YHQB 4PC3A 3E20A 2OK8A 5GV7A 2QN6A 4Y9RA 1D8TA 1F60A 3LRXA 3I55B 3AVWA 1FNMA 3W2HA 1ZM9A 2PLFA 3V76A 1D1NA 1F20A 1QGZA 1DARA 1R5OA 3CW2A 2PMDA 1S0UA 4G1VA 1ELOA 3LYUA 4ZGNB 2ZITA 1KC8D 2BGJA 1M90D 2CNDA 5GV8A 4B47A 4RJLA 3VNVA 1BJKA 1IB0A 3VO2A 5TR9A 1ZUNB 5KSWB 3CCVB 4LC0A 2BMWA 4TMTA 2QEXB 3B8HA 1VQ9B 3OZWA 1GR1A 1QGAA 4K1XA 4TMXA 2XEXA 2C78A 2VNIA 3G4SB 1CNFA 3JQQA 4H9GA 4DQLA 1TVCA 1JA0A 1N0VC 3WNBA 3OJWA 2OTLB 1VQ6B 2CRVA 2DETA 3WNDA 3CCLB 1JB9A 3OZVA 1G7CA 4PC2A 5THXA 2BVNA 2DCUA 1KQSB 3PENA 1Q7YD 3LVBA 1KK2A 2RC6A 4HE6A 1GAWA 3CMAB 1Q81D 1IJFA 2GPJA 4ZGQB 3U6KA 3AVXA 3J81k 4RD3A 4U9UA 2PIAA 1W2BB 4FWTA 2VYQA 1Q82D 4B3XA 1QGYA 1KTVA 3B82A 1E63A 3ZBUA 1H42A 1DDGA 2YWGA 1VQ5B 4M4SA 3W2FA 1FNBA 2HMAA 3CC7B 1VQLB 3JQPA 1KK3A 2RC5A 4P3YA 1H85A 1R5NA 2BV3A 4PC1A 2YWFA 1EP1B 1EXMA 4FK8A 3CMEB 4N3NA 1OGJA 4RD4A 5FA6A 4ACAA 1OGIA 1U2RA 4EH1A 3QFRA 3WNCA 3E1YE 1B23P 1KJZA 4LBVA 3ES9A 2HCJB 1BX0A 1CQXA 2XNJA 2BM1A 1FDRA 3CCEB 4J0QA 1YJNB 2EFGA 3I1FA 4MYUA 1VQMB 1FRQA 1VQOB 1EWYA 4YAUA 1SKQA 1QFJA 4PC7A 1VQNB 1G7RA 1QX4A 2J7KA 4RCYA 1NDHA 5TV2A 3WYAA 4G1BA 3ZBTA 1OB5A 1Q86D 1JNYA 4RCZA 2BF4A 2QTZA 2DEUA 4ZV4A 2QMUA 4MYTA 1W34A 2NPFA 3W2EA 3I56B 3OW2B 1TTTA 1KRHA 1W35A 3AVYA 4LBYA 3AGQA 1SM4A 4M0LA 1S72B 2D74A 5JBQA 3CC4B 3W5HA 3W2GA 2DERA 1EP3B 3QE2A 1FNCA 4M1KA 3ZZUA 3CCQB 3VNUA 1A8PA 3CCUB 3ZC3A 3AVVA 3VMFA 4QHYA 3QFTA 4BPRA 3W2IA
chains in the Genus database with same CATH superfamily
2PUAA 2X7JA 4EABA 4LF4B 4JS0A 4AMUA 4OKIA 3HLYA 2ONCA 4TLLB 3CW8X 1DZIA 1SBYA 3QLUA 1NJ2A 5G2OA 1FBNA 3VPGA 5K3DA 1T2AA 4F46A 3F73A 1RCFA 3K9CA 3UOAB 3WLIA 1OX6A 3OBIA 3VKWA 2NU7B 3F6SA 3TTUA 5LQKA 4I9NA 5J9FA 1WEHA 3VSEA 1I94B 1I1NA 3CE6A 4R81A 2I8AA 3EIOA 3U7EB 5BXYA 5ARCA 3VR2D 5BV1A 3OH8A 1GUDA 1Z16A 2JBHA 4KRYA 3U4AA 2UUAB 5HHTA 4GZ5A 1YJXA 4IIXA 5ANRB 2PX4A 1QE0A 3R0JA 4Y3UA 5EHIA 1QE3A 3D2CA 3ACBA 1UMCB 3VO1A 4KLCA 5LZ9A 2QRMA 2XWBF 1S8FA 4NBWA 2XQIA 2X6XA 1ODIA 3C3AA 1WP9A 3EWIA 2PQ6A 2BTQA 5H16A 3UXYA 1RNLA 1GAXA 5ELXA 2ZAYA 2EC5A 3GA7A 1EGMB 5JQGF 2NQ2C 4A5OA 4CF6A 3LZCA 3RVPA 4BWGA 3RRZA 3ZQKA 3AFIA 4D0LB 3B60A 4ESEA 1U5BA 4RLQA 3MTGA 1U0LA 2ZJZA 3ZCSA 2CHQA 4BNIA 3T56B 1DAKA 3S55A 3DMPA 5JNWA 4MWOA 3UFBA 4UAGA 4WXMA 2HZ7A 3V33A 3K05A 1O4VA 5HZHA 4BNJA 3OTQA 5ITVA 3FLBA 2F67A 5JADA 3UM9A 3LUPA 3MTEA 2HRDA 3IO3A 4P9SA 1WNFA 4EP1A 1P80A 3ME5A 3IAEA 1VFNA 5T41A 1SIUA 1O4WA 2XQJA 4QE3A 1V5GA 1J20A 1RKQA 3D3QA 4E03A 4RZ3A 3S2EA 1Y9AA 3LY5A 3EH2A 1A2QA 3M34A 4H27A 5B3JC 4ZAFA 2WHYA 3LCUA 3L7KA 3NCTA 1WXEA 2QTHA 4HS9A 4MWZA 3EE6A 1VJDA 4RELA 1GTRA 5TMPA 4WFIA 1T5EA 3HKCB 1BYIA 2BMVA 2GXSA 3DV9A 4TLAA 3FUWA 1M2OA 4K87A 4GI7A 3AL3A 4ZO7A 3T9DA 3KBBA 5BMVB 2IY8A 2J7PA 1KAOA 4KQ2A 4UBOA 3LXUX 1V8OA 4JOBA 3FYDA 2VNHA 3NUQA 2F00A 1AOXA 1NWCA 4G5QA 1EM6A 2XOXA 2XNKA 3F6RA 4X54A 5AVVA 4TXJA 3LFUA 5ESRA 4YAWA 4AY5A 1ZJ5A 2VNAA 3PJEA 1BWQA 5A4FS 2AXQA 1CUDA 1ANKA 2CE7A 3CC8A 3TAUA 2OFOA 3Q8KA 2AEMA 1GITA 4Z7OB 2GVDC 1QR2A 4PYIA 1QHSA 2IE8A 5AVSA 5CB8A 4DMRA 4KXQA 5CYPA 4CKCA 1W0KA 4DY4A 2PWBA 4Y2QA 1XRRA 1IOLA 4IOLA 1IN7A 4I8XA 3AUTA 1E69A 4P4SB 4RWEA 5A9RA 1VDMA 4HPXB 4RNCA 4WOBA 5DN6D 1DKRA 3DNPA 1G3IA 3VU9A 1MZVA 2CY0A 1B2RA 1SKYE 3H2KA 1FTNA 2ETVA 1G8PA 1J22A 1M5UA 3PCTA 5HF8A 4ZA2A 3TSYA 1GN9A 3F98A 1L3CA 3HXMA 1HZZC 1C7RA 4KPEC 1DXOA 3RBVA 3W8EA 3Q38A 4QTZA 1FJXA 3UXHA 5KJCA 1R5JA 1PG2A 1L6IA 3NHWA 1UBEA 2FP4B 2WTMA 3IJ5A 1H94A 2DVMA 3KLOA 1Q20A 3E70C 4G65A 2FZWA 3DEJA 3QMWA 2E49A 2IY9A 3PQ4A 5BO5A 1M7BA 2EF1A 3O8LA 3BXZA 4QYTA 4B48A 2XT0A 2R84A 2FMUA 2IQ5A 2HIMA 3H1BA 2F55A 3S7TA 3QLJA 3UK1A 2BE9A 3W1WA 2VJMB 3IIKA 1KIMA 1RQLA 3LBAA 1T3LA 2FLVA 3KXPA 4J76A 1VLJA 3EFEA 4KKVA 4L5AA 1RBMA 5JZOA 2O5EA 2OM2A 5TF4A 5GINE 1HDRA 1R8YA 2GKOA 2P9JA 1Q0QA 2DOKA 3M33A 3U0VA 2EEPA 3UV7A 4BVHA 5EJ9A 3DKPA 4DIFA 4KNYA 2F8MA 2DG2A 3PC8A 2A9RA 3EISA 2FPPA 5FBRB 4LK3A 1PJRA 1DTWB 3A9TA 2BM8A 2OCGA 3EVFA 3U48A 4W5TA 2FK8A 4ITVA 4JU9A 5CD1A 2HLDA 1VQ4B 5H9WA 2Q1XA 2W6CX 3H2HA 3CT6A 4KPUA 1HSZA 2W0SA 1PFWA 1NJ1A 2DXIA 5D1NA 3FYUA 1Y7TA 3BC9A 2ECQA 1WSDA 1FW8A 1YE3A 1ZDMA 4OHOA 2V5AA 4JYCA 3FZQA 4LCBA 4TV8B 4C76A 1VPVA 3GFPA 5JI2E 2ERXA 2WZQA 1TF5A 2ZVDA 4HDMB 3KZXA 5KQPA 4UNNA 1HO3A 5GQSA 1JSLA 1IZ0A 2BR3A 2IOFK 2XA1A 3N5CA 4MR7B 4DY6A 4JKOA 5U1PA 3Q3JB 1YB4A 3NGXA 4LRSB 3LSYA 2CXHA 3MWFA 1Z0UA 3G5LA 3B9BA 5BNZA 3K2EA 5JNUA 1CEYA 1FX0B 3P0JA 4GE0A 2XY4A 2BGIA 3GGDA 5LYJB 1B3RA 1J7JA 1V37A 3F9RA 4MTLA 3VC3A 2IDMA 2OL4A 5LUAA 1GPKA 4LK2A 3KR9A 2X6TA 3HO6A 4TN5A 5IJ0B 3AUJB 4I55B 4UE2A 3W6NA 3LBYA 3X1KA 1EXWA 4D6XA 2W4QA 5JASA 1UXKA 2C7RA 4BFCA 2DECA 3W4IA 4KQWA 5L40A 1GV1A 2ZRCA 1V1MA 3IBSA 3PDIA 3WL5A 2GLUA 3MERA 4E21A 1H8EA 4RL4A 2VPXA 4NNJA 3DTTA 4KGXA 2P9FA 1BIFA 2RHDA 4EG8A 2NO9A 1LQUA 3F90A 1O89A 2DSNA 1TEVA 3JALA 4YDRA 2O59A 2NLOA 2XH8A 3PVSA 2O8CB 2KQUA 1DG1G 1Z07A 3Q7TA 5HZKA 1ZINA 3N8IA 1ORDA 2H5LA 5IJ9A 3PA8A 5IYZB 2N46A 2C59A 4NULA 2AXNA 2ZWOA 5EP3A 3VH3A 2E9SA 2C1ZA 2REBA 2XE4A 5ALZA 4EJSB 4TVKA 1Y81A 3UMMA 4PX9A 4PY2A 4FSXA 3T5BA 5EG5A 4C0HA 3BICA 4U7HA 4ZJUA 5F7JA 4DXAA 1AQIA 3B7PA 8LDHA 4EY6A 5H83A 2V96A 5AVZA 1OFUX 2DHEA 3CNLA 3K30A 1U3WA 2ECPA 3A4IA 1NJ6A 3T3EA 3IO5A 3FFWA 4B7ZA 1KO8A 5EJGA 1Z9BA 3FPAA 1KFBB 2R1TB 3HBJA 2VUUA 1ILWA 3PX2A 2OE2A 1Y9DA 5DBIA 2R6FA 4KQGA 2I9KA 3AKYA 4F3NA 4BV8A 1U8XX 2F9LA 1DIHA 3IXQA 4YJHA 4JT9A 3Q98A 3V2UA 3GUUA 2Q3MA 4X66B 2Y3IA 5HS4A 5L8VA 3KT0A 4MB0A 3IQZA 3LLVA 1DLIA 1V26A 2VS1A 3ANSA 3GRRA 2C0QA 5A8AA 2I2DA 2VHJA 4RSGA 4BYGA 4CG1A 2ZRHA 3GJ6A 3VDRA 1PT6A 2YDYA 3AC0A 5AP9A 2XHZA 3W2HA 4DBLC 4PW0A 1LPBB 1Z34A 3N1UA 3N87A 3FOCA 3GCDA 2KJQA 1WCIA 2C3UA 3PBKA 1K3TA 4NCJA 5CK5A 2HW8A 1KFCB 1PKEA 3VVLA 1NJ5A 3OCVA 1M0WA 3KPYA 1SBCA 3QKRB 1VRWA 5C53B 3BJIC 3MT7A 2PAFA 3ICCA 1LI5A 4IHAA 4YLGA 1OBHA 1SZJG 1TYZA 1WXGA 2DUJA 4OH7A 2IV7A 5CFQA 1MIOA 5GJBA 2ZULA 3HSSA 2GHIA 2B1IA 1T5IA 2GF2A 2RHWA 5DLYA 4ZGNB 3GJQA 2X8JA 3N8HA 3GEMA 1XTRA 3GJTA 4EVIA 3AB7A 3BTSA 2GCOA 3SICE 4B4OA 3G0CA 3B6MA 1IC6A 5LOVF 4WXHA 4B47A 4RVSA 4MVJP 2FVXA 4LDQA 4KITB 3I05A 3U39A 1EUZA 1V96A 1KAQA 1ZUNB 4N03A 4OFZA 4UU7A 5ILQA 2XAAA 3C8UA 3WTBA 4PTYA 3LHDA 3FD8A 3OZTA 4ZP1A 2ZSEA 1EJ6A 5FULA 3V32A 5K6AA 4AULA 3BGWA 4BZQA 3ETLA 1X13A 4IGIA 1DC3A 1JS1X 3U17A 2ZWAA 3ND6A 3GK3A 4G5XA 2QEXB 3B8HA 2WFAA 2QA5A 4OLJA 5K8LA 5EAIA 2XCUA 1NR5A 2XMQA 1G8HA 5HYVA 1QK4A 4H31A 3CZAA 3L0DA 3UTDA 3V7YA 5DHQA 2VHZA 2PH3A 3VYUB 1U28C 3WMFA 1AUQA 5BOVA 3TOVA 1N0IA 5E3HA 4L4ZA 1ADCA 1YK1A 4M86A 2G07A 1LS6A 1NN3A 1Z0JA 1FVXA 2QAGC 1P5RA 2Q5IA 4MINA 3RJTA 1E4EA 3IEPA 4BEJA 5HGJA 1YJBA 3JS5A 4L3OA 1NURA 2W90A 4E22A 1EDBA 2HDOA 1B6SA 1HMPA 2J46A 3WA6A 2REOA 1JJIA 1M3SA 4I5IA 1KJWA 3KVRA 4M83A 5AXBA 3W8FA 3WK6A 5BN3B 4MUEA 3M4XA 4WOCA 5D3KA 2FETA 3VNQA 5BORA 4BNUA 3AI7A 3E2IA 1C1HA 1MGOA 1GAWA 1JG6A 2WSSA 3EAGA 1XEFA 2D7DA 1S01A 1ZP6A 4NAHA 1ADJA 2A2ZA 2GK7A 1KI2A 3AVXA 5U9CA 1B74A 2NTNA 1KL7A 3G2QA 2H1OA 3THXA 2PGOA 4UVGA 4XCVA 1ZAYA 2PUBA 4O4JF 1W2BB 3Q9NA 3BQJA 2O2SA 2Z9CA 3QELA 1BXRA 4MGIR 4JI3B 1KTVA 1ATIA 2YS7A 3CLUC 4JWKA 5KTTA 2Q5HA 4XWWA 3D9QX 3EXAA 2MINA 1T2FA 3P9RA 3WHIA 2QRJA 1H42A 1XCLA 1TUBA 2XBUA 4B6PA 5TIIA 3SLGA 3U16A 2GH1A 2E48A 3E15A 7REQA 3R8FA 1F9EA 4J6FA 2J8ZA 5CB4B 4QHSA 4BNWA 2OGWA 1YB5A 3FWZA 4CG0A 3WLMA 4ZKDA 4HVLA 2R62A 2VDWB 3DFIA 4CLRA 3BXFA 3JD4A 3GG9A 4BGDA 1QFSA 1K75A 3TQQA 1WETA 1VSTA 5U4XA 3HSYA 5K0SA 1ZA2A 2J0UB 2MTBA 3GGJA 4KQFA 4UAVA 2LIPA 5B5SA 5CXXA 5J35A 2HSWA 3IDAA 2CF5A 4JEIA 1RRPA 3MK31 4QEZA 4KBYA 3TZCA 1JSZA 4PWZA 4C5AA 3AG6A 4AJJA 2HBRA 2N75A 4LXIA 1EUDB 3JWEA 1KC3A 1FC0A 1QR6A 3KKKA 1HYBA 4KXVA 5E1MA 3ROGA 1SHUX 2Q8PA 4FEAA 4EHJA 2DLNA 2XECA 4C4AA 4RQUA 1OGJA 1JI0A 2MJLA 4R0MA 3WLEA 1KO7A 2AZMA 2OOKA 2PXCA 3GWZA 3IBYA 3QWAA 2AL7A 4IIJF 3P0IA 4U2BA 1NVUQ 2FWBA 3QUAA 3LI2A 5AVTA 1CP3A 3G89A 3IP9A 3SIRA 4BU0A 1BU5A 3DDUA 3TLCA 3RFUA 1FF9A 4OOEA 4WUVA 5T7BA 1HX7A 3O5AA 5IXSA 3CT4A 2VXBA 2O9JA 1Z08A 1J6UA 2XMGA 3O0TA 3QVGB 4HRYA 1PTKA 4UREA 4S3MA 4ZAZA 1P2BA 4C87A 5ISMA 2IODA 1S3IA 1OHHA 3NI2A 3OCXA 3QQPA 2PSHA 1QYRA 1QRUA 3ZUGA 3GLGB 3V48A 3PGXA 2WJJA 1EWYA 2V4ZA 3O2SB 3LP8A 1MX1A 4BNZA 2QHXA 2BGKA 4WTOA 4DBVO 5FD8A 1KA9H 5CT6A 1BU8A 1QRSA 4PZYA 1MC4A 3FCOA 3I5UA 4HVCA 3DKIA 1ZH8A 3PD1A 2Q4EA 3PWKA 5EMMA 5J1TB 4RTLA 2GN2A 4O4HA 3UA4A 4BO9A 4LZOA 3P0HA 5TE9A 3PI6A 4YJ3A 5ALOA 1TL7C 5J2UB 1WF6A 3ZGVA 3OA2A 3MT0A 5FTMA 1PJ2A 3E22A 2FG6C 3I52A 3EVCA 4KI0A 4U7TB 1TDJA 4M87A 5E4JA 4US2R 3I56B 1GFWA 1LPMA 3A4NA 4DQ0A 5I47A 4FOSA 5A9SA 5KJ6A 2OXCA 4WKCA 4UM5A 1WSAA 1FYVA 1K2WA 3L01A 3AFHA 1M9NA 1TOAA 4ZTBA 4GGMX 4X6UA 5IW8A 1ECPA 2E2WA 2RHMA 2G8NA 5MFZA 1IG0A 4DSTA 1DO0A 3AUFA 4OAQA 2QYHA 4COKA 1W7AA 4PR0A 1ZJ4A 1V8FA 4ZVUA 4AO6A 3PQFA 1XA4A 1WS6A 3FX2A 3RKUA 2ZM6B 1Q1BA 1BE0A 2EX0A 2G08A 1EFVA 4YS6A 3CH6A 2CBZA 2PMKA 3I9NA 5DCWA 2VRNA 2I67A 4PXYA 4WH0A 4OPOA 2D1TA 4CIVA 4CLEA 3AVVA 2ZJ1A 3NWJA 1DJNA 1Y89A 4Z4YA 5G02A 4ALNA 3ZWYA 2V0NA 3RK1A 3R6TA 1GO2A 3OFNA 3QG5A 4HAIA 1EG7A 1GKKA 3HY3A 4Q9JA 3RRBA 1FPQA 1KERA 3STWA 5CFPA 2QK4A 5IM4F 1DHRA 3ZQJA 5TARA 1SK9A 3ONWA 3A6HA 4YCLA 5M7EA 3O93A 4G7WA 3QKWA 1QCZA 2ZPUA 2GZ1A 3GNQA 1ZW1A 4UMFA 4CI9A 5LA6B 3NBKA 1SCUB 5A06A 4ZRMA 4LVOA 3AJ8A 4O5OA 5EA2A 4BJ6A 3IALA 2CLLB 3A58B 3F4BA 5BSWA 2W7TA 4TWJA 3K5PA 2X0EA 3RSCA 2E82A 2XTJA 4B85A 3DOJA 2PA3A 2AQKA 5D2CA 2NVBA 4QOFA 1E1QA 3JVEA 3A2KA 1PT8A 3BHNA 1TC2A 2FUKA 1EEXB 4QTTB 1QU3A 1L7VC 1VBFA 1RRVA 2GXQA 3LX6A 1SIWA 3CWCA 3FI0A 5ECGC 3USZA 4MS1B 5CITA 5MFPA 3GL9A 3B5IA 4TT3A 5C34B 1AQLA 4L3WA 4JLMA 3CCSB 2QW0X 1EKXA 3CX3A 4N9QA 1UUFA 1Y3FE 3OUTA 3HAGA 3NHKA 5JS2A 5GVSA 2A0UA 3D5QA 2PJZA 1XVUA 2ZAMA 3VOSA 4ARSA 4E70A 1D0SA 3B20A 3OPOA 2CLSA 1T1GA 3CIFA 3GCZA 4DLXA 1I0ZA 4B43A 4HP8A 1S1MA 1DTEA 2PSFA 3LW7A 1UADA 1J33A 3QV1A 3KKNA 5D3MB 5M34A 4HKTA 3I2GA 3TH5A 4EY8A 3ISVA 1HLDA 2PZLA 1KOJA 4RNDB 3T1QA 3SG0A 1X1BA 3LUAA 3LYAA 4RGYA 5DTJA 4UU0A 5IM5A 4EY7A 3C3XA 2G82A 2EHDA 2J08A 4G23A 4ZGGA 1E66A 3QEAZ 1GVNB 1I5RA 4UUNA 1LXCA 3HRHA 2W8ZA 1NTRA 1UFRA 3MM4A 1Z17A 1FUKA 4R5MA 4X84A 5AI4A 5C8XA 2JF0A 1RVV1 2O1SA 3L2OB 5EYPB 3UUEA 1NNSA 3JV7A 1OA0A 2NYRA 1M2FA 3EUFA 2QD3A 4HI0E 1PJTA 3EXHC 5FL3A 4C89A 4NJMA 1Y8RA 3FPKA 4DCNA 4RD6A 1GTVA 4CL8A 1BN7A 3PGA1 3UJ7A 1KHTA 5C7IO 4N7JA 2HXYA 1UOOA 4CHGA 3H0KA 5F1OA 4BQFA 1PDWA 5TQ0B 1KI8A 3PIRA 2A7XA 5DRYA 1PJ6A 3AQ4A 1H2HA 3DM5A 1GR0A 2DJ5A 1NP3A 3OO1A 5HEKA 5K6TA 5KWIA 5LWHA 4X8IA 5FF9A 1WF3A 4YUYA 5I7SA 3LVFO 1VJSA 2JVJA 1HH4A 2QGFA 4K6KA 3UHAA 4I8IA 2YHAA 3TYXA 3DEFA 4PINA 5FUXA 4GGPA 1P1FA 1PGJA 1H2XA 2ZT5A 5F3WB 4KWCA 4LHEA 2H2DA 1WQ3A 1WUIS 1XRQA 1H4VB 1FFXA 3AF0A 4MJXA 5M2QA 3GELA 4S2EA 5C8YF 4M98A 3V1UA 2C4HA 1T3SA 4XB1A 1YDGA 3CD6B 4KYUA 4RACA 1QHEA 4D41A 4EYQA 5ADHA 2VJOA 3SQNA 4PGHA 2XE7A 3Q1LA 1AHHA 3I23A 1K7SN 2WU0A 3L5OA 1LLQA 5JCOC 5K0TA 1ZQ1A 3O8DA 2V7GA 5ENDA 4QPPA 1I3LA 1ZGHA 4ZOCA 1PI3A 4I1PA 3EVDA 3C4VA 3B9QA 1K1EA 1OFHA 1LLUA 1NMXA 1OB2A 2Y67A 3ANNA 4CT4B 4F8EA 2HF8A 1XRLA 2IUFA 4PHHA 1U4OA 3IDZA 3Q3GE 3RHZA 2VT7A 1NULA 5GJVC 3KL4A 3K0KA 4QOGA 1U8TA 1T9HA 2WT8A 4AICA 4BMOB 4KPUB 2ZE8A 4AU1A 1IK4A 4GLLA 4YCJA 1VPEA 4FD3A 2OO5C 4JLUA 3RUEA 1Z35A 1X7HA 4UKDA 3EQ2A 2PUCA 1LKZA 1LS1A 4UMDA 1VJCA 4W5NA 5IAGA 2IV2X 4IOMA 4UEWA 3JPWA 1G7SA 3EY4A 3EXG1 3U2QA 1JJ7A 3D3KA 3GIWA 2G72A 1UMBB 2FMIA 1FMLA 3RUCA 4Q7QA 2L42A 1QHIA 2XKJE 3S2FA 4WZ6A 1JH9A 1UODA 1POWA 2C8KA 1C2YA 4JJZA 5FOVA 3P2IA 3FDZA 2W6JD 4UXJA 4Q1EA 1NZDA 1QG4A 1EHYA 1E2IA 2Y1GA 2O57A 2D3TA 2EKLA 3WMRA 3ZG6A 4NXMB 1K8QA 4RETA 3TTTA 4GWLA 4UQOA 2PKQO 5B3JA 4ACBA 1DAFA 4IMJB 1QH8B 2XDQA 4IDDA 2HPAA 1NYQA 3MUNA 4XIGS 2RGYA 2FWIA 1TM1E 1YBHA 2WAAA 5ALIA 4BLOA 4BCBA 2XUKA 2MSCB 4TKZA 1Y3DE 4LWQA 4EFNA 2G7MC 1LSJA 4W8OA 1QP0A 2LVBA 4YRSA 2IHBA 3NTXA 3NYQA 3BK2A 3R0VA 1NXWA 1Y6JA 2YWDA 2BEUB 4UDOA 2C5EA 4KE7A 5IT0A 4QG7A 2QZ4A 1H2EA 2JFHA 4MW0A 2XIQA 5JH7B 4XQ0A 3UKDA 5EN4A 4EEXA 3OP4A 5HZAA 4Y9TA 3SX4A 1XTUA 3KOXA 1XRJA 2ZCUA 1B8PA 4B3RB 3UB2A 1GN8A 4GX1A 1QLWA 1N6RA 4O4IA 3WZMA 3ASSA 1C3OB 4YJHB 3SHVA 1KYIA 1RWVA 2QDKA 3EXIB 3PT5A 4HZGA 4RVHA 3WL3A 5ARBA 4LI0A 1KTIA 2IW1A 2NU6B 1NLFA 3B6EA 1WDWB 3RS3A 2VYCA 2VH5R 1NOJA 3GPBA 5AW1A 2O2CA 3KAQA 3C5HA 4R9UC 1GP2A 4EWLA 4DMLA 1U7HA 4D3FA 1AMOA 1NGSA 4P7BA 2VJMA 3N70A 3EVGA 2ZZEA 2DUMA 1FTQA 4QYXA 5ALQA 2C9OA 2X4LA 3FZGA 2JFGA 3SEJA 5BY2A 1BDJA 3OOJA 2QBYA 1UZNA 5ER9A 2WWVD 4H7IA 4JVOA 4ZI7B 4HLQB 4CBVA 5KTNA 1SG9A 2NYVA 5KYYA 2X8KA 2GZSA 1AGPA 3I4FA 4V1CI 2W6IA 4WBNA 5EQFA 2O7SA 4FT2A 4YFYA 1P4AA 2DKOA 5DNAA 1UFVA 3WX0A 2OBXA 4C4YA 2ZUSA 1LJUA 4OHMA 8MHTA 1QAQA 2EU8A 3N2GB 5AD1A 1W76A 1QVFB 3EDQA 1EHIA 5HF5A 5A2GA 4B7XA 3UXEA 5E6UA 1VE5A 3DF7A 1KSHA 5IS2A 2PSEA 5KW9A 2PANA 2QI9F 1HKHA 1UH5A 2XB4A 5JR3A 4REQB 3QUCA 3IEMA 2ZS7A 3ORYA 3UO8B 4DUYB 4AYWA 5I7VA 3WLAA 2CK3D 4HGNA 3T0GA 4ZD6A 5G0UA 1COWA 2AXEA 3E9ZA 3UJPA 5JO0A 4I5EA 1COWD 2PUDA 4JENA 3B70A 4BNXA 3G6WA 1UMCA 2XNHA 1P9LA 2WM8A 4R0VA 4HDRB 4MUIA 2UYGA 2Y71A 3WGTA 1FTSA 1YIOA 4KUHA 4RFSB 1BRTA 4PC3A 3LK6A 1P60A 4L9RA 1GCGA 1ADGA 3F5QA 1Z6GA 4P3PA 1JWLA 1VC2A 4DEXA 4X8HA 4QLOA 2OZKA 4Z0PA 1P33A 1YKSA 1AN0A 4ZEOA 4LDAA 1WBDA 5FFNA 3KT8A 3ZV3A 3R74A 3I55B 3E6AA 3LFHA 1WR8A 3WK5A 2Z58A 1XTSA 4C6TA 3I76A 4KR2A 3L0CA 5DNWA 3A36A 4PZEA 1TYDE 2QKYA 4TKLA 4X61A 3SC6A 1E1CA 1T0IA 1SHTX 4J2HA 4ZI3A 1CYEA 4K8OA 4C0QC 4E4RA 4YXFA 421PA 2YNMC 4POOA 4QECA 1SKAA 4S12A 5I4CA 5JD3A 4UM8B 2NP7A 3UG6A 1DBQA 3UBMA 3QXSA 1S0UA 1ZL0A 1Z6PA 1FDUA 5AKKA 4XNFA 3U3KA 2ZUVA 4G1VA 4FMDF 1A9QA 4Z5XA 1XV5A 1F2TB 1WXHA 4FNAA 1CERA 1Z73A 4ROSA 5T8KA 3DTVD 3CZ5A 4V1CA 2F8LA 2ZPTX 4H3SA 1V8BA 3WHPA 4GOXA 3DTYA 5DXJA 5A2QA 4KWHA 5ALYA 3RU2A 4CM8B 1XNHA 2RGNA 3MWLA 3NM5A 3UIEA 1M6WA 3TQOA 3SFZA 1U31A 3SZRA 3KVVA 5E4YA 2CXRA 3BMNB 1XJWA 3N59A 3TE7A 5GZ1A 1R27A 2QN1A 2GCGA 5JCJA 4FYKA 1P6UA 3PFKA 1MA3A 3QOXA 2ATXA 5FLKA 2H92A 5CA0B 2HHHB 3TLGB 3OQOA 2AJTA 2ZJFA 1Y1RA 3IVAA 4WV3A 3ZIAA 1GTL1 2W71A 3QVWA 5LMCA 4CLDA 2Y0CA 1V0FA 6PFKA 1ST3A 3GVLA 5HG0A 4P0TA 3FPJA 2H52A 2EQBA 1H6CA 3HEBA 2OCLA 3KYBA 4Q3AA 4QFBA 2XT9A 3SY8A 4JOSA 3GGSA 2W9XA 5AKGA 1SG0A 3PQEA 5CCXA 4XUCA 4OYLA 5JQWA 3JWPA 4R7TA 5BQXA 4KRXA 1SEPA 2FG5A 3FAKA 2Q5OA 3HVKA 4PO1A 5E7QA 3TFWA 2I4TA 5IYQA 3EGEA 1DAEA 3DLPX 3WFIA 2B4QA 3CVXA 2IYPA 5KSYA 4ZC1A 1F7UA 1J90A 2EW8A 1NOKA 2VT3A 1X6VA 2GTHA 2XB6A 4DNOA 1RWKA 3WNDA 4QUHA 3LUBA 3L0OA 3ZOZA 5FUWA 1UK7A 5J5VA 4ZIRB 1RW4A 2YJTD 3JQEA 1F8UA 1TJYA 2JHAA 4O29A 4O25A 5DYNA 3V1NA 5H80A 2RKOA 3MJHA 8GPBA 4P4TA 5KTKA 3EGDA 2WTEA 2R6GA 2RIPA 1DKNA 5F7XA 1Q81D 1FS6A 3RJ5A 4NJOA 1NYTA 1ND6A 3D8NA 4ZQEA 4E5VA 3SYTA 1FFWA 3COSA 4O8CA 1GUAA 3AV3A 3BQ9A 1PL0A 4LI3X 4N7MA 3IHKA 2DWQA 3OQNA 4WESB 4URZR 1I4EB 2IDKA 4YCNA 1WW2A 2FY8A 4XR6A 1IHUA 3K70D 1I4WA 4U9UA 3ZE6A 3HA5A 3GD5A 3TX2A 1YNSA 2NU9A 1JIKA 1Z36A 3TIIA 2QLNA 1L7XA 3DMDA 1F0PA 1PQWA 1XMVA 1V2HE 1GNQA 4GOMD 5PNTA 4E5UA 4A1OA 1NBHA 1CQZA 2X1VA 3RS8A 2ES4A 2CYBA 1DIAA 2YWJA 1CJUC 1ZS9A 3E5MA 3JARB 4TSFA 1M2VB 3P2EA 4KHPB 2ON6A 4OUKX 3TF5A 4DWJA 3CC7B 1OFUA 2B83A 2RHBA 2J09A 4U9IS 3WBBA 3F46A 4JLSA 2ACKA 4M1OA 1VHEA 1J0BA 2BHTA 2FJ0A 4WASA 5FWDA 5LNK1 3OQHA 3DC7A 1E99A 3L9XA 3O6VA 5IKMA 3H0CA 2BR4A 2BBWA 2D4HA 1CJBA 2O14A 3PXUA 2WFZA 3WLOA 1MW9X 1OI7A 4RVUA 4OQ4A 4M1SA 4Q9HA 2CVZA 2PL9A 3KDSE 2V74B 3IUMA 3KJNA 3LSTA 5DOZA 4J3NA 4KREA 3OSZA 5JATA 2CL6X 4FUQA 4MJ7A 3OAAD 2WJ3A 5EXXA 3J81A 3NHPA 4TTRA 5FOXA 1KXJA 2L19A 5KYVA 1JVBA 3V2HA 2QUBA 4DPMA 2OHGA 3NFYA 4XCQA 4BCDA 1YL5A 1SIOA 3O8OB 4JLDA 4XEUA 4QSHA 3ZN2A 3I6YA 2VBVA 4IXWA 1CDOA 1OIWA 1PTJC 4QTUB 4RYDA 1Z0IA 1C7QA 2D54A 4HLCA 3R6JA 4B6RA 4KMOA 3LQ4A 3LQ2A 3A1PA 3U3MA 4U2FA 1KWGA 1V0JA 4Y67A 3QY0A 3ZDZB 4ZICA 3VZCA 4DARA 2CF6A 1TGYA 1QG2A 1X7ZB 2ZDHA 3LH5A 4XM2A 3VR6A 2C7BA 2AK3A 2J4FA 4C3VA 4ZRDA 2QAGA 2QZSA 2R8RA 2HNAA 2GNOA 4L7VA 4OH1A 5F73A 3UTCA 2VJIA 2YW9A 1GUBA 3LGSA 4MRVA 4NAUA 3TAXA 5LQAA 4DV4B 1H93A 3A26A 4EPVA 5KNCH 2P6NA 1W0JA 1SHJA 2KVOA 1XF1A 3JPYA 4OJMX 2EBWA 4WVLA 5F64A 2ZJ8A 1OZHA 1VQNB 3A4YA 4MWGA 4LWOA 1WPXA 2OLJA 4N49A 5FNVA 4X62B 5TV2A 2FGKA 3TL2A 5EJ4A 2LTAA 1H0HA 4LRUA 1E5QA 2RFLA 3CURA 3PS9A 5DB4A 4X93A 3I28A 5FADA 5ESDA 4IWNA 1KU0A 3FGOA 2VDWA 2EGUA 1FXWF 1N2SA 1P3Y1 1PRYA 3KJIA 2QTZA 2BFCB 5CW1A 4MUFA 5T67A 2C54A 3ZWMA 1E5XA 3FKSA 1H66A 3A10A 1J42A 1NYLA 2RK6A 2RHTA 2IPLA 4DSNA 5FYQA 3TIVA 4HDCA 2J0VA 5EE5B 3AGQA 3KWMA 5CDHA 1VM6A 1PDVA 2VP5A 1TA4A 3EBLA 2C94A 1JHDA 5ES3A 4IFBA 3D6TB 4ZVNA 4FMCF 4EFLA 4CIWA 5LJLA 4QRIA 2YZNA 3I1IA 2JJ1D 4M37A 4HH3C 5AQEA 2Q3JA 1AHNA 2VDQB 3LQ6A 1XHLA 1XUOA 2DWCA 2P3OA 4D74A 1A4XA 3AOEA 4I9HA 3ZZUA 1PK7A 4NHEA 4NU5A 4CNBA 2NIPA 2H8GA 2H5EA 4U4AA 1TC1A 2C83A 4BRWA 2PWZA 1QVVA 1THZA 5EIEA 2VDJA 4YMLA 1ISJA 4GMFA 4BFLA 3EZFA 4HYEA 1SQ5A 4XM1A 4KWTA 1N6LA 1T25A 3D6HA 3C6XA 4HWTA 4MS4B 4ETWA 2GRJA 5CLJA 1IBMB 2GX6A 5KHLB 5DBEX 5B2FA 1KQOA 4CCYB 5K8IA 1XDGA 4KDRA 2VQ6A 1GVHA 1Z5PA 3S6JA 4BQEA 2PH5A 3WYBA 1FP1D 1E96A 3M1IA 1NY6A 3FCCA 4HAOA 1GKIA 1VPDA 4IGAA 4MQ6A 1CUUA 1SNYA 1W581 2ZRMA 3TQCA 4BNLA 1TX4B 3PXAA 4ESOA 4ZCRA 5KTOA 5HSGA 2A5FA 2AMFA 3FHLA 2H4XA 3T3HA 4BRUA 3BH4A 1JA9A 4EX7A 1MR3F 4Y9UA 2F3QA 2FZ4A 4K9NA 5JXWA 1LBHA 1F3OA 1FSPA 3WKDA 4DSOA 4ZWNA 2V3WA 2BMFA 5ERGB 5EFZA 1JLKA 4WZKA 1JL3A 3H5NA 4F7DA 1YDFA 1WVIA 4NWIA 4BE7B 1LVUA 2FSUA 1SC4A 4LFCB 3GT7A 4D44A 4XVUA 3ZVNA 4O4LA 5I7AA 2FEPA 2L17A 3MHPA 3U7QA 3KR1A 4INZA 5DWQA 5IPFA 4D57A 1FNSA 5BV8A 1OLSB 1QH0A 2V03A 4R1TA 4HAXA 2EZTA 4M1QA 1YJQA 2EZ9A 1RXCA 1M83A 3TZQA 5LCXA 3C6KA 4F9GA 3JD1A 4ZU1X 3M4ZA 2C2GA 3AHHA 3EIEA 4FWBA 3G71B 1M74A 3OLZA 4R1QA 2P2NA 4C4TA 2HDNB 4AP9A 3O8CA 4PTLA 1EM8B 5GONA 4JBHA 4PAGA 2ATCA 2TMYA 1K86A 2C9YA 4HGRA 4OJYA 4B2PA 3TGWA 1K73D 3OIUA 4BB9A 2NUAA 2FUCA 1SU4A 2W2OA 3PKZA 1R0XA 1YWGO 5IBRA 4HG2A 3KLBA 1R6BX 4GM0A 1IATA 1IUNA 2G4LA 4OFXA 4OL9A 3GT4A 2C88A 2R5NA 2HQSA 4DMCA 5AVKA 2PGDA 1QGUA 4XD7A 1SXJE 2EFHB 2BWJA 2LP4Y 4PIMA 1ILEA 2HKIA 3UY4A 1EQUA 3IURA 1Z7WA 1U7PA 3STVA 1GSOA 1XIVA 1XQYA 2IUYA 2RDMA 4JQSA 1Y5IA 4AC9A 3LUFA 1C9YA 1DS6A 1R4NB 1SURA 3FDFA 5LJIA 2JATA 2PBZA 1HPLA 3GX1A 4PGOA 4LVUA 2P5SA 1II9A 2ZIVB 1MD9A 2QTCA 4MVJE 1T0BA 1UIMA 2OBBA 4KSYA 4XARA 3GBSA 4I1VA 2W93A 2GTIA 3A9SA 1UZUA 2WOJA 5J63A 3RIXA 3N8DA 1ZD9A 1PL7A 3N0RA 4FOTA 3TNDA 3THWA 4N0EA 5C8ZA 2AN1A 3SQWA 4DR4B 4DM4A 3TLEA 2FE4A 4G36A 3WBJA 2G67A 4C3UA 3OJXA 3TUIC 4HUTA 3PVDA 1NPTO 2IT1A 1RAHA 3NEJA 4MPDA 2Q49A 3QYJA 4D9FA 2OBMA 3EEIA 2GMWA 4ZAGA 5LWQA 5JEDA 5KDOA 5K3BA 4EJSC 1ZM3A 1G41A 1QTNA 4Z1OA 5LOVB 2OP0A 1W0KD 1VOTA 1DCTA 2FPGA 3B89A 4D45A 4CDRA 3BE8A 4FQ8A 4B32A 2C77A 1QIMA 1XQ1A 2PPLA 3CO0S 3ICOA 2VWPA 4NE7A 4OHXA 5HKKD 2GCNA 1A7JA 2OECA 3ZXSA 1IHDA 5ALLA 4FYVA 4CM9A 2HJRA 3HP4A 4PSUA 4RSRA 2DHQA 2H18A 1I24A 1NQOA 5G4KA 1PR4A 4UTXA 5A3SA 2LIVA 3J7AC 4UUOA 4AZ3B 4U6NA 3WKAA 3G8BA 3NP7A 1BVHA 3AF1A 4XGNA 4CL3A 2GAOA 2OVFA 2VEOA 2XUFA 4IQ4A 4D3ZA 3K6KA 4RLFA 1QFYA 4RDLA 1NXTA 5CGQB 1SBZA 2ZTLA 3CF4A 4PG5A 5KCZA 2FPXA 4DLAA 1Z06A 1RE1A 3GD7A 3FTNA 2XNDA 1F14A 3ENQA 3E9DA 1RHJA 1Y1KE 4JI0B 2IITA 5CVDA 4OOSA 4CKBA 4S1VA 2BBOA 2NO6A 2WPNA 3ZDAA 1UJ5A 3N2YA 3ZE9A 1UINA 1I3NA 1YBVA 2QJRA 1MTOA 2JRLA 4FHGA 4Q9NA 2AC7A 4J4HA 4DNTB 4Z7QB 1BA2A 1N36B 1XMSA 1JAIA 2FWJA 2Y1FA 4YP0A 5C51B 4ZYWA 1QO9A 2L82A 3WS7A 3Q9SA 4F04A 5KNDH 4R1OA 3ZS9A 4BFVA 4CLXA 4D3DA 3CCRB 1APBA 1LRJA 4NMLA 4RKYA 4NZZA 2FFRA 4I3HA 1J0AA 2ID8A 4EAAA 5KINB 2C9BA 3FOBA 2J1LA 2XNCA 1XCPA 3BRWA 4M22A 4P86A 5IABA 3U81A 4KXLA 1HSOA 4WOPA 1SKYB 4NVRA 3T9CA 1TO1E 2YMPA 2P4EA 2WUFA 3E2PA 5EVCA 3R0XA 5DSXA 2V6MA 1TMOA 5FEUA 3R44A 1EWQA 4ALJA 4OM7A 1YQGA 3B8EA 1P73A 3EZ9A 2W43A 3FVVA 3RV3A 5KREA 1LF5A 1N2XA 3IBFA 5BSKA 4DDVA 1EUCB 2PUHA 1G17A 2C0PA 2IK8A 3DCJA 1ZNZA 4OHZA 5KAPA 4H08A 1L1RA 1A8QA 2FW9A 3CB2A 1MLDA 3GRCA 4R8VA 3U62A 1KVUA 1VRVA 3JY6A 4ZJZA 3I39X 4O2BB 4BKOA 2WK1A 1TM2A 3JASB 3ESAA 1JQ5A 2HHLA 1R0RE 3H0EA 1O6ZA 5AVOA 3IKVA 2HCRA 3RTAA 3ZX4A 4YQEA 2WWXA 3BWEA 1GAQA 3BULA 1QYCA 3ABRB 3H5AA 1EVKA 1H2ZA 2FN8A 1OYWA 2HN9A 3M6IA 4LJ7A 4RHXA 1D7AA 3EXHB 3TLZA 3NHYA 5FI5A 5BSXA 3BERA 1FU8A 1NKVA 1P9OA 2YMLA 2XUHA 5FBLB 3KSRA 3DZKA 5FLEX 2DWOA 1XSEA 1QDEA 1JVNA 3NATA 3CKLA 2E5LB 3LYHA 1ETUA 2NV0A 2NAPA 2DLCX 4Q4LA 5BN5A 3OOCA 3AEZA 1H2WA 3RRYA 5IN4A 3LDGA 4KH0A 4LSGA 1LH0A 5LFAA 5DP2A 2I22A 2YYZA 3UICA 1ZVVA 4OAPA 2BJWA 1AE1A 4G4GA 5L3QA 1QAOA 1TZCA 2JJYA 2QG4A 1W1IA 1VHTA 4RD1A 1JR3E 2FN7A 4IIJB 4K6MA 2AZ4A 5FRDA 3G5TA 3L79A 3MAJA 3OZCA 4H60A 3WK4A 3NONA 4Z7NB 1TU4A 2GPNA 1DU4A 4YK7A 3RDPA 3J80A 3H87A 1AZLA 5C37A 1RRFA 2GN8A 1EAMA 4M1WA 2Z43A 3GZNB 4LSZA 1SB9A 3VHXA 3PL5A 2OP1A 1LY1A 3V8PA 1B00A 4N5DA 4C6TB 1E2MA 5TVGA 2JFWA 2JB9A 3AIOA 1X0XA 3NNDA 3PGKA 1YZYA 4UBLA 3ASQA 1ITZA 4FLFA 5IF9A 4OI0A 1CDEA 1HWYA 1E1CB 2EFYA 3FRJA 3I2IA 1JALA 3I8XA 3I9OA 4Q3CA 3WGJA 4DZTA 1CNEA 1OC4A 1YHYA 3OKPA 1R2QA 2E4WA 1I4TD 4DV6B 4RUKA 1YHQB 3CCCA 2QVYX 4UMEA 2D1FA 2X77A 2ZI7A 3GN1A 2AN4A 4J4TA 2OK8A 4XH9B 4AG5A 1NSTA 5B37A 2JH8A 1E0JA 4YRDA 1RWNA 3EVBA 3PEWA 1IQ0A 3B3AA 1ZGBA 3OU2A 1N0HA 1FUIA 1N8NA 3JQCA 5AK3A 4F1KA 4GO1A 3IL2A 5BSMA 4NYMR 5A7GA 3RSZA 3UJDA 3HYNA 4IUYA 1EZ4A 2WYWA 3B1VA 1P0IA 3K6JA 4BBZA 2O8FB 1KZ9A 1EJ0A 3CLKA 2R2AA 3WK7A 1F20A 2A9KA 3P9SA 1WPQA 1XCJA 3FWKA 3KE8A 3ZK9A 1IAQA 4CR8A 3F3KA 2GSDA 3UT5A 1USWA 4GT1A 3AVOA 3G1TA 4G0QA 1FVHA 4FFSA 1G6OA 2FEXA 2DJIA 3NOVA 1DKQA 1Z2EA 2UYCA 3R3WA 2Z8XA 4EKIA 3I53A 5IDVA 1I33A 5CA1A 1SOVA 1KE1A 4QXPA 2Z9DA 1P39A 4L5BA 3LQ1A 1YE8A 2UUPA 3V46A 1KJIA 2Q1SA 3OC0A 4M7PA 4BLTA 1XAHA 1W9MA 4HAVA 4N8SA 2R47A 1RM4A 2F3PA 3GFGA 3C3BA 4BGUA 4XD2A 4GSKA 4O0MA 1LB1B 3ZLVA 3PUXA 2CNWA 1AURA 3AHIA 3GFTA 3P9IA 3PGVA 3MGBA 4I1YA 4XUDA 4C88A 5A5VA 1QYIA 1LBEA 4ND8A 1NVEA 3EUAA 3SZMA 3EPHA 4RV4A 2W2PA 2GN9A 4FFDA 2PZAA 3IDQA 5IT4A 1FUEA 3NIBA 1U0BB 4ZANA 3LRPA 3TSZA 3ZI0A 4R31A 3ZV7A 4N6OA 1JYSA 2ERCA 3ZJ5A 4DGSA 4X6LA 4IS2A 2WLTA 5EWMA 1U81A 1VQ9B 1SXJA 2A7QA 3LOQA 3ST7A 3UV3A 2JW5A 4N6NA 4TRNA 3KIPA 5F21A 5BVHB 1JG4A 1PE0A 1GPDG 1D2HA 3IT1A 5H4GA 3MGKA 1PR1A 3DGEC 5HIAA 2X8AA 5EQJB 1U9ZA 3TPFA 1ONSA 2BKAA 5AKEA 5AQ1A 4KXNA 1I10A 1KKMA 3JYQA 1XBTA 2HBZA 4LNUA 3RYHB 4NYMQ 1CVIA 4D56A 1AKVA 1NTOA 1BFDA 4MVJA 5GAJA 4HFMA 3OJWA 1BCSA 3FHOA 3UJ3X 4K6OA 4XWTA 1QYXA 3AX6A 3BFPA 3TLKA 2DETA 1GZ6A 2R97A 3OCYA 1NU6A 2VATA 2GBLA 1Z4QA 4AX8A 2SKCA 4JDPA 2BVNA 1F6DA 5AIBA 3CP8A 3I9MA 3MAGA 3ECCA 4U7JA 1T4BA 2W6ZA 4HWOA 1DHTA 1KORA 3UGJA 1UM8A 2Z1MA 4LWZA 1T4DA 4RO0A 4QG3A 1J49A 3WDLA 4WDRA 4BEBA 4DKXA 1IE3A 2C1XA 2VT6A 1K6IA 1OIXA 1X7ZA 3W7AA 4CIAA 2ZRDA 1UWKA 1FSZA 2GRAA 3RYCB 5ALEA 2C61A 1KP2A 2O5VA 2PIAA 2R7NA 2J3IA 3BMNA 1U0FA 4OGGA 3A0RB 4Q4DA 4YJ2F 5JHGB 1WV0A 3FDZB 5TQJA 4IYRA 1BH2A 4D7AA 2DWPA 1E63A 1E6WA 3TLGA 1SKBA 1I4OA 1Z15A 3VPSA 5G40A 5IBPA 4CEIB 2B2CA 2IIPA 2RAVA 3E9QA 3UPDA 2O0JA 5IX8A 1AKRA 4B76A 5BSFA 2GWHA 4TV9F 4I1RA 1SCAA 3D7MA 4HEA6 4UATA 4E7PA 2B1JA 3FDJA 3E27A 4HPJB 4IXDA 3EG9A 3IMGA 4H6VA 3E58A 3JAMA 4X8OA 3AR7A 4B3CA 1JSRA 1E59A 1ZNXA 2GXUA 3UWDA 3X1MA 2B20A 3W06A 3PHCA 4HZUB 3X43A 4S04A 1CB0A 7YASA 5HJ2A 2KHZA 1AQ6A 3Q40A 2YWFA 1CS0B 2P9QA 5PGMA 3ZBQA 4BWFB 1NRXA 2FX2A 2XRMA 4Y2SA 4K28A 4QBTA 4B17A 4L78A 1UBTS 3UNXA 3PJRA 1YZTA 1RJDA 5LQNA 5EE0A 1ZK3A 4YMHA 1YB2A 3DUWA 1GRVA 3HVUA 3KTAA 2NU6A 1VIDA 5A4KA 4QU5A 3G2IA 1UBHS 5DX0A 1CY1A 4JA2A 2D2FA 4XWOA 3FNHA 3RAFC 3OOYA 1CFJA 4JH0A 2DT5A 3OMXA 3ZY4A 2C5FA 4B2LA 3U5TA 4HDKA 5HMMA 1M54A 5TPWA 5LUBA 2CMHA 1Z5NA 3ZGNA 3DDOA 6NULA 4Q37A 5G1PA 2HPHA 1H1LA 3A37A 4B7AA 3LJKA 1WKCA 2AN9A 4PS1A 4XGIA 2AEEA 1XCBA 3QVXA 1QKIA 4U6SA 1VLMA 1XK7A 3KXKA 4MZDA 1YA4A 3P4XA 4R69A 2JH3A 3MWYW 3OJFA 4I9GA 4TXHA 5HFJA 1KYZA 3OCJA 1ZJZA 2Z5VA 2GB4A 2O50A 1SN7A 1ZI9A 4MUYA 4IDCA 3GP3A 4PLYA 3TEMA 4DLYA 2VJPA 4L2IB 2C0CA 1E98A 2OCPA 4E5YA 2Y77A 3U7JA 4UNIA 3QLVA 3ABQB 1RBQA 1S8AA 3W4JA 1THTA 1T2UA 3A8JA 2XUQA 1JPNA 2I3ZA 3IRUA 5DBFA 5HZGA 1C9MA 3EVEA 1MC8A 2NPFA 2B4RO 4Q0MA 1WULS 2NZVG 2WICA 2XKAA 1ARZA 3NFRA 4LE2A 5KYTA 1R18A 3K9FC 3N2KB 4WJZA 5FWNA 1S8NA 1P31A 1DG9A 1JEYA 1J1UA 1RJEA 5SY9A 5LPNA 2CVQA 1WCWA 4X7CA 2CE2X 3KHSA 4IH4A 4P4UA 4RWZA 4B82A 4OFBA 4EPRA 2I7VA 2BJVA 4M0LA 2H51A 2VWHA 3P45A 2Y4OA 1N9ZA 1V35A 2QD2A 1QK5A 3Q85A 5JBQA 3BJRA 2EKBA 5D51S 4J07A 1XD8A 1PN3A 3W2GA 4G81A 1IXSB 1E7WA 3R3UA 5K2MA 4G7XA 2A1TS 1DJOA 4ZI7A 5F35A 2IS4A 3A6PC 5FFMA 1AS0A 1EVYA 4RH3A 3OX3A 4AJIA 4URFA 3DVAB 5EJ2A 1Z4LA 3IXMA 4GPAA 2GBPA 4YT8A 1MJGM 1F7VA 4DVJA 4L0QA 2PXAA 3KPVA 3OWOA 4QZVA 4P7GA 4AKEA 1MC1A 5DU2A 3NKLA 1L1QA 3F6EX 4F72A 2Y27A 1QKJA 1J9ZA 3L9WA 1K88A 4W9RA 5L4SA 3D2AA 2R86A 4IPTA 5MF6A 1A8UA 2GYUA 4B34A 2GD2A 3PA1A 2VSNA 4EB0A 2BFNA 3ND7A 2WSYB 3TL6A 3NGLA 4ZI7F 1UPXA 2ZZMA 1KFJB 4BO8A 1XA3A 2BT4A 3A1EA 3K2QA 3NEAA 4L50A 1AY0A 5E4FA 2IYZA 3LLSA 2ISQA 3BE4A 1I2DA 1E3EA 1N7IA 3R5TA 2PO7A 4C3OB 2G9NA 3JQ9C 2CF4A 1XTKA 1GG5A 3ONVA 4TT3D 4J0CA 2R7MA 4RYLA 5CRIA 3VUEA 3R5HA 4Y0VA 2X53S 2G80A 4PLCA 3K5WA 2GK6A 3NBAA 4TL7A 2BMJA 2BZSA 4B79A 4RZQA 1DJMA 4R9NA 1FSSA 3UHJA 3MT9A 3BJZA 3RBXA 4AJHA 4G1FA 3LYLA 4OAOA 1V1RA 4JSYA 3N6VA 2UXCB 4HH4A 2WA2A 2KYRA 4UZSA 2VHYA 4RAOA 1L7DA 4RORA 3BB4A 4TV8A 1NUSA 2O2XA 1XQ6A 1JDJA 2VQDA 1ZW6A 4CU5A 1YQXA 2H0AA 3DZ8A 5CVUA 4BTEA 3ZZ0A 3AEKB 1P7ZA 2X7HA 3KEGA 1UZMA 3HB9A 1YI2B 2YFYA 1YC2A 1GZ3A 1C14A 1XKLA 4B6QA 5EWJA 1Q50A 4IIYA 2NGRA 2P77A 4IO1A 3IV7A 3RS9A 2I3GA 3R7WA 4IEIA 1KMMA 4BX2A 4RLZA 1MHPA 4YUZA 2GUWA 3SI7A 1D2EA 2JCVA 3D26A 3FRHA 1NBWB 5E9JA 2HJGA 5FBWB 4EK9A 2F1HA 2RIRA 2XNDD 4F1WA 1KEKA 4CIDA 5ETJA 2XCSB 2CUTA 3PVZA 5DJ5A 5LDGA 1X7GA 4R2IA 1JEDA 4B09A 3DO5A 3QKIA 4BMSA 1E1YA 1G2OA 5ICEA 1ZJWA 2GNAA 3G5MA 5DI3A 1GAJA 4WIAA 4KO8A 5FYDA 4HFRA 2XMBA 3PNSA 1YH3A 4MWTA 4JBLA 3TOZA 4UM9B 1ONBA 2GYYA 4CFSA 5IVHA 4TKUB 3LWZA 3CBQA 1YJWB 5B6IA 3KOYA 2H2WA 3U7QB 4MUAA 1OCEA 3O4JA 2ZJ5A 5I8ZA 5LQMA 1X14A 4GPZA 3HFJA 4TRMA 5A4IS 3L4EA 4UU1A 3I42A 5K3AA 1RLJA 2BDEA 3QFHA 3PWZA 2FPLA 1MQSA 3A7EA 2HHAA 3ACDA 4G97A 2R1ZA 2YASA 1JTFA 4PU0A 1W5BA 5KNBA 3O91A 3HADA 1F06A 5BNTA 2OVBA 3KTDA 4XB6B 1RIFA 2XBMA 4ZZ0A 1JILA 4BECA 3NCHA 3O8RA 4CNQA 2NUAB 3DR5A 2D59A 3D7RA 4J16C 4LJLA 4EO7A 3U26A 1ACMA 5J4YA 4RTSA 4H4EA 2WBLC 4K3UA 4RTOA 3HUEA 3PNPA 5E1DA 4JX8A 1B41A 1UWLA 3EMBA 1U0TA 4UCQA 1EI9A 1USGA 4TS9A 2PRJA 4H0NA 3B9RA 3W5SA 1RLTA 1AVTA 3M9WA 4NBKA 5AKJA 4OYYA 1FTWA 3RCBA 1X2BA 2BHNA 4GMGA 2GK3A 4BZWA 3OCUA 4K46A 4YMGA 3QPDA 3CZPA 3UWOA 5JY6A 1T8YA 5LU8A 4OA8A 5DM1A 3WLPA 1N32B 4PAMA 4PSCA 4NXNB 4Q3DA 1CWUA 4E0BA 4WFKA 3SQLA 4D42A 1A9YA 2PR7A 3RK0A 3OPXA 2A0WA 1PR6A 4FOPA 4WZBE 4YQZA 4IQ8A 1EINA 1YZHA 3T35A 4E07A 3PEEA 3ZIUA 2NUTA 4OQYA 3WGHA 4Y6LA 5BQ3A 2LDBA 3L7CA 3U3OA 2CLKB 1Z6YA 5TXGA 2PUFA 3VHXB 2Z4TA 4KX5A 1NL3A 1UOQA 2JGEA 5FR2A 1VQ7B 2O8NA 5GZ6A 1CQIB 1DFGA 1O6BA 1JQDA 4QXMA 2D0DA 3A05A 9LDTA 1L1EA 2AX4A 3GNSA 4NU6A 1ECCA 5BV0A 4HDAA 2V1UA 1BRMA 4OI4A 2YWXA 2D7JA 4NBSA 1R4ZA 4QUBA 3G6KA 1N5LA 2F8TA 4IP0A 1GU0A 2WNSA 1W59A 2HBQA 3V4FA 3JZMA 3WHLA 1WPCA 1AKUA 2VTDA 1RBZA 2W4IA 3C14C 3COWA 4IKOA 4FE3A 4L6AA 4JT8A 5E0KB 5EXEA 2UU9B 1HXHA 1YUBA 4MMXB 3QUSA 3H6GA 5DWDA 1G9TA 5T4BA 1BVUA 1Z7GA 2FR1A 4WLEA 2WDPA 4ZVPA 1PQ4A 3WYDA 3MJTA 2LBPA 4EJSA 3L7OA 3I73A 5C8DA 3IQHX 1KYXA 4J1NA 5HRAA 2G36A 3CS3A 1C4XA 1KZ1A 3WADA 1LPSA 1C7IA 3HDTA 4ENSA 2XODA 2ZZKA 4J2OA 4I8DA 2J7PD 1DEXA 1U7UA 2CHEA 3I32A 3AY7A 4PNHA 2ZUUA 2O8FA 4L8VA 2ACEA 1FLNA 1DC8A 2FWAA 3GJYA 4WJKB 5AWFC 2EW1A 1MW8X 1N0UA 1DXYA 1HFKA 2QX4A 3EN0A 3I62A 3HBFA 4BJ1A 4R8RA 3L4BA 4AJPA 4YQFA 1ESZA 2GCIA 3BWCA 3M6WA 3TIGA 5JXJA 2I71A 3WGZA 4PZUA 1KRWA 1W87A 3VSBA 2EWWA 1BWSA 2P3LA 5HQ3A 3AUSA 3STYA 2J3KA 1CF9A 1Q44A 1TYAE 2DQYA 4GHWA 1ZAKA 1Y5MA 2QMHA 4RK7A 1KMHA 2QXYA 5P21A 4D9BA 5FUMA 2BHRA 5D01A 1A5BB 2CW5A 4UHJA 4BLRA 4EHKA 3HYRA 1OWMA 2Z2JA 3HP1A 3LXMA 3EA4A 4L6CA 1DUIA 4PWYA 5KDLA 1UR5A 1LDYA 3WJ7A 1IWPB 2ZEJA 5CVCA 3G49A 3R0QA 1DELA 4RVDA 4XL9A 4YXWD 2VK2A 3SE0A 5TGZA 4JI1B 3ZGLA 4CEJB 1S2OA 2O2DA 2UVDA 4M9UA 2HNBA 1YTLA 2OV8A 3CR7A 1W36C 3CCMB 2PA0A 2VYFA 3EUEA 1E64A 5CT8A 3IJRA 3P9QA 2DR2A 1JHAA 1FFYA 4WA7A 1UD4A 4E11A 4G0PA 2OXFA 3KJFA 3RJZA 3ZLUA 2O8VA 4BDSA 4FFLA 1N8SA 1WTCA 4HLNA 1H3NA 2X8JB 2BGNA 1HE4A 4PS0A 1YRLA 1RKXA 3EZ6A 4UNQA 3PFBA 2YYAA 1LW7A 4GE3A 1Y4DE 3K1AB 2I4IA 4HFJA 1UKCA 4HWSA 2VYND 2Z3VA 4HAZA 4Z7JA 3H1FA 2PZBA 3ECAA 4IVNA 3EARA 3BMOB 3ED5A 1N3BA 1UM9B 1WNTA 4IG9A 3UUGA 4UHKA 3R6DA 2Y6UA 3CWZA 4AJEA 4P2GA 4UUQA 3PDCA 3ZJVA 4IUCS 3TJRA 3P9PA 2W2VA 3KALA 1E89A 2ZJ2A 3QUTA 1IPEA 4QDXA 1ECGA 2X9GA 2RAPA 3I4LA 4ASUD 2PEYA 5ECWA 5CB0A 3E1SA 2EP7A 121PA 2BFBB 3ADPA 4KTTE 4WLNA 4FINA 1WCV1 1S96A 2IDZA 1ELOA 3AM5A 3HZHA 1PNTA 1CULC 5JYBA 5IBCA 1NI4B 3EA0A 2WJGA 4J8PA 2W83A 3PF9A 1AX9A 4HB2A 2XCRB 4MKGA 3OF3A 5EL0A 1CK4A 1LC0A 3F71A 4RJLA 1E0DA 2ZB3A 3HUTA 3U61B 1LV8A 2PGJA 2I7XA 3L40A 1CQJA 3URMA 3IHLA 1QIKA 2V0CA 2XX3A 4FLMA 3GMSA 1RHKA 1ID1A 2ZI5A 4C7MA 4KVFA 3MNFA 3X1JA 5K3EA 2FUG1 3DKVA 1VJGA 3OM9A 3SQDA 4MJLA 4ER5A 4F5WA 2N3ZA 1ZOIA 4OU4A 2B4AA 3KQLA 4RPDA 4LGVA 3QKSB 4UNPA 1WZIA 3NTQA 4UTZA 3DZFA 5DM60 2H4ZA 2BFFB 2EKQA 4R4JA 5GJWC 4HB3A 2QMOA 4JD5A 5DHRA 9ATCA 4WXEA 3THOA 4B5LA 5LOVA 2GLTA 1QZZA 2G0TA 1XJ5A 2OG2A 2V7PA 4YUXA 2EQAA 2HD4A 1O0BA 2BP7B 4XN0A 3N2IA 4S2UA 3IPAA 3GOQA 2ZR7A 3OEHA 2R4UA 1SQSA 4OREX 5HFAA 1ZONA 4YN3A 1YS7A 1E8DA 3RV4A 1NPYA 1DC7A 2AF3C 4JASB 3UYKA 3WB1A 4LJ9A 1R8SA 2ID4A 3VKVA 4CODB 1PBNA 4EA9A 4CETA 4C2BA 1H2RS 1JAYA 2ISCA 1MJGA 3HPRA 1N6IA 1XLWA 3WLNA 2O8CA 4YIKA 3GV0A 4GAEA 3ROTA 4A2QA 3QF4B 2JGFA 2IDJA 2BCJQ 2WYHA 3BIFA 1TVEA 2CCJA 2QW8A 3AFMA 3HCNA 3K0BA 3QIVA 4LHWA 3EIWA 4CEIA 1Z18A 4L9WA 4UXHA 2Z6VA 3DT8A 4JITA 3SLNA 2ILVA 3T3OA 2FZCA 5DGCA 2FW8A 3CRW1 2F3RA 2Z30A 1VXRA 2HCTA 2OV4A 3EG9B 2JD1A 2P2SA 2QGNA 4GLBA 4CKYA 1DJPA 1VXOA 3FPGA 2R9VA 3CVVA 3E84A 1ABEA 3IQEA 3KKZA 1YQWA 3CXRA 3W7BA 3X1WA 5C32A 1E7QA 2YBDA 4QOIA 5HPYB 5K8VA 2VYQA 1HZZA 3SMQA 1P4HA 2WRZA 2HA2A 4YTEA 2P4SA 2GM9A 1J9GA 4F8JA 5CMLA 3O82A 1KQFA 3TVDA 1W4BA 1L7EA 4HEQA 4Q03A 1IBCA 3CNHA 5TDHA 3O83A 3ZY2A 3L02A 5H3HA 1J5PA 1IBLB 2HGSA 1K6XA 2IEZA 3K0CC 4KACA 1JAHA 3ESCA 2V7XA 1VQ5B 3FYUB 1QIDA 1XWWA 3N74A 1DC6A 4EIWA 5FPQA 1WZCA 1JR2A 3R0IA 2J9FB 1GPH1 3OP1A 1EDOA 2R48A 1S02A 2VKQA 3CCFA 1OLOA 1PAUA 4EEZA 3R9XB 4X20A 1I4DD 1KP9A 1PJCA 2E7ZA 1EFRA 4R8MA 1V7ZA 2QLBA 2YX1A 2FHSA 4LDPA 3UF0A 4XKWA 2HQBA 1PT9A 2DQKA 4DTCA 3S2UA 1XQXA 4O02B 1UT6A 4WZZA 1E2GA 3FHCB 1RDFA 1U1GA 2O48X 5DX1A 4YP9A 2H6EA 1FX0A 3CJRA 1UKVY 2HHCA 4WZBA 4BFXA 3OE4A 3HQ4O 1XZKA 1U3TA 1AK1A 1QH9A 1RR6A 1K7XB 5K8UA 4D02A 1MFPA 2LZJA 4ERNA 1MRSA 2B8JA 1WV1A 1JIQA 5DLDA 5AW3A 1T6XA 1NI5A 2V98A 5AVQA 4U2EA 3P4UA 1K5PA 1LTKA 3GVHA 1P6QA 5ESXA 2Q4OA 1DIRA 2PS3A 5K09A 1JZTA 2VRWA 3DGFC 5DCLA 2Q3CA 1SRQA 4E2WA 4O2AA 5KYXA 3L8GA 2WA1A 4QL3A 3WQZA 1W2WB 2WZBA 4Z4QA 2GPSA 2ZVPX 2NSDA 3S5UA 4WCFB 1KZLA 3BG5A 5EKXA 1KZYC 4LFBB 3PR2B 2O8DB 5EQDA 1P17A 1Y4SA 3JALB 4IDNA 1J0CA 3A9VA 3DP7A 3BDIA 1V9CA 4PGGA 3SSOA 4MDEA 1A9XA 3EZGA 3IP3A 4WNCA 2J41A 1CVRA 2JZOA 3AIMA 4IIJA 2VDNB 4JU8A 4DMKA 1NJGA 1KMIY 1V7PC 5LB2A 4XD7D 4RCYA 1E9RA 1PD0A 5I9MA 4KFTA 3RSOA 2XOEA 3I5XA 4Z8YA 1N7JA 4Q3NA 3WLTA 2YRFA 3V4OA 4ZV7A 5ICSA 2BR5A 4QPDA 4PAAA 4GRIA 4UC0A 2WTUA 3QXGA 2I1VB 3DE0X 1KJ8A 3BK1A 5AHXA 2PNJA 1GNRA 4ZV4A 3G8YA 2GZMA 3KZNA 4DM7A 4ZGBA 2DB3A 1XLVA 3DCYA 2PYIA 3N2LA 3PQ2A 2XMCA 1V5EA 3H05A 1CE8B 2P9CA 4QJ3A 4ARVA 5HJEA 2GFHA 1RQPA 3CM0A 4KOAA 1ONPA 3GR6A 1NR1A 4X8MA 1ZWLA 1IHXA 3PNVA 1BWRA 2HU7A 3ASTA 2VSFA 4JJFA 1MBZA 4B4VA 3RGGA 4E1AA 4ZXPA 3RC7A 4E12A 2ESRA 4NZMA 1SBHA 3NDBB 1UT8A 2EDCA 3IQWA 4KE6A 3SDBA 5IF3A 1VLOA 1MOQA 2UZIR 1UFQA 2XPCA 3H5VA 4HD8A 4LSMA 1N5IA 3GFVA 4RY0A 2ZT6A 3DLIA 3DPIA 1FNCA 3NLLA 3AMVA 1QLJA 1SUWA 2A1IA 221PA 2ZUFA 4DA6A 1L8QA 2JH9A 3L6DA 4QX6A 4KIFA 4ISCA 2FJPA 1MFZA 5LC1A 4PRKA 2XKKA 2Y1DA 4LYJA 1H1LB 4UHFA 4EENA 13PKA 3PPWA 4CZ2A 1VB3A 1PL6A 1EFKA 1BO6A 3DUFA 3S3TA 2OHJA 3G2HA 3I04A 4GC5A 1QYDA 5DF1A 3RRFA 2RI0A 5I7WA 1PK9A 4LYHA 2HJ9A 2W6ID 4RV9A 1AXRA 4G85A 2GM3A 4TWAA 5F2EA 2Q6KA 1JZQA 3D6AA 4L02A 4ZDWA 3A9RA 3IP8A 3JU4A 1DBWA 1IB6A 4YP5A 1T4CA 1XMOB 5E6RB 3DMNA 4DEVA 1T8RA 3W5UA 2VDPB 1J24A 1SUDA 3GEHA 3NIGB 5IKEA 4RY9A 3KJXA 5IK2A 1TF2A 3R7SA 1QIGA 3DDCA 2SCUA 4L9AA 5IP5A 2BKUA 1QANA 3TTYA 4B9EA 4OGFA 5AJVB 2UYOA 4YUVA 5AM3A 3GJ4A 2WIFA 5BSHA 3NEYA 3PGJA 5CBKA 1C9JA 1KQGA 3HCRA 3T1YB 2CXSA 2VBSA 3N2KA 5JCXA 2NO5A 2G17A 1ZH6A 3FVWA 3WDMA 5JAHA 5LVAA 3AGPA 4KXMA 1E3QA 1PKXA 3DE3X 3H1TA 4NV3A 5AH0A 2Q6VA 2YXBA 3CJTA 4IXNA 4NF2A 3WNVA 2FW1A 5LXTB 1Z56C 1AKWA 3VO8A 4TTIA 3BILA 2BEWA 3GO4A 1FFBA 4EHBA 4G0MA 1JG3A 3RBAA 2XCTB 2GGSA 4MRAA 5CA1F 1Q57A 4MWEA 4E33A 3IRVA 2A4MA 1HYQA 2RK3A 2WU4A 4OOFA 2VPIA 4PZLA 4X71A 5CVEA 1NW3A 2H1RA 1NC1A 2WYVA 1F2VA 1PNOA 1Q7BA 4G0ZA 4MQEA 3EXEA 3S44A 4WVFA 3AL0C 1WDTA 1ESNA 4KYIB 4ZVRA 2OGTA 2QX8A 1PV1A 4MGZR 2GA9A 4F3CA 2DF8A 3DO6A 1AZWA 3P4YA 2Q28A 2HK9A 1DUVG 4LVCA 2ZDGA 2OT3B 1OXTA 3AH8A 3AK4A 4MKFA 1CHNA 3IJEB 5JH7A 1Z2AA 3PJGA 4MPRA 2FN3A 1KMQA 4TXNA 4H0CA 1XXHE 3SM3A 1QVGB 4BGVA 5BN4A 3UPTA 3NMUF 3GLGE 1V8ZA 3VA7A 5BN3A 1W0CA 3DFMA 3AL2A 3DR3A 2BOVA 4MARA 4CQLA 3S8EA 4BE4A 4Q9IA 1A4RA 1VSQA 3I9FA 2FSSA 4E88A 5HKBA 3IP5A 3U9SA 2GS9A 1NZFA 1F8FA 3HZZA 3VV3A 3CN9A 3IOCA 2NXJA 3SK0A 1K97A 4RXUA 3UAWA 2P5UA 2ZYRA 4EMSA 3UAOA 3FPHA 5LMZA 4YJFB 3QVVA 3RSSA 1C80A 1XI2A 2ZUTA 3OU6A 4EZEA 1OAKA 1V7CA 2CN1A 2QL7A 2TSYB 4ZC8A 3EF1A 2YN4A 4I4TA 3AVTA 2JGDB 2RG1A 4KVAA 5F4BA 3IYLW 1M1YB 1BXGB 2QX7A 2ZSHA 5NULA 2Z98A 3UFXB 3ZDEA 2W22A 4RA9B 5A4DA 3V9AA 2OBFA 1Y0RA 1TCAA 1GUFA 3JD3A 4EG5A 3DOEA 3WFZA 4MQ4A 5T4FA 4OX9B 3MQ4A 2ZBPA 3KKQA 1TNDA 3OZDA 3U5ZB 3BMCB 3SIPA 5E95A 4BEVA 1L6RA 2HRBA 5FWAA 2IRWA 2ZJYA 1KAEA 4ZK2A 2ZU0C 3WL7A 1SA0A 4FJ2A 2G06A 5KNDA 3P96A 3REQA 2CVHA 4HSEA 4ND4A 3L8HA 2JJ8A 1CRPA 4Q6BA 3RS2A 1YVDA 1FSFA 1JH8A 2P2GA 1HBJA 2VHTA 4GNRA 5BV2P 4BB5A 4XM0A 3AEKA 3FJ1A 1RWOA 1HVXA 4RDJA 1UJ6A 2OZEA 2WFLB 3A32A 5KTYA 1OLXA 1HNNA 4QDZA 4RPLA 1G8FA 4ZOAA 4ZI5A 3W3AA 3VR4A 1EWVA 4F2HA 1K8ZB 5HM8A 3VVCA 1C8VB 4XGKA 1ZSNA 4CTKA 3IXLA 3RC9A 4TSFD 2LDXA 4I4NA 1Z3CA 2O1XA 5ENZA 1N2HA 5F23A 2NUTB 3VZQA 4IHJB 1H1TA 4D43A 1JJ2B 4J0FA 3A6JA 4XVCA 4DNRB 3THRA 4QLAA 3TTVA 2GO7A 1L5HA 1YRHA 4P2NA 5HK8A 1XHEA 2Q41A 4IJ5A 2NU8A 4B0PA 1H4SA 4OSEA 4Q48A 5HJ7A 1A7AA 2SECE 4E08A 1U3DA 3OF2A 1P8AA 3TRKA 3H4IA 1GFIA 4ZCMA 3KT3A 2J9ZB 2C99A 3R6KA 3UMGA 2ADFA 2BGLA 3E5RA 3P2YA 4ZO6A 1N7GA 3HRIA 3WVNA 5LZ4A 1U4NA 4DA7A 1Y7IA 3N2ZB 1Y6FA 3SLRA 1JG1A 1ENZA 3EH1A 4TQGA 3SC3A 4BNYA 4AECA 1YDMA 4LY3A 5KZMB 2INGX 3UJNA 3V97A 1UJBA 2A0YA 2YQ4A 2X4GA 3OZAA 4FJ1A 4W6QA 3RIEA 1HNZB 5BRAA 3EW9A 4YWJA 1XFOA 1QRRA 1R0ZA 2G5CA 1WHTA 1NRWA 2Z3WA 3NYRA 3ZPXA 4K86A 3NNSA 4EB3A 4F12A 3BCUA 1CHDA 2QR5A 3CRMA 1P19A 4CM3A 3P26A 1E4YA 3HP7A 3H94A 1L7RA 1Z5WA 1TIBA 2J9RA 3K2BA 3DOFA 2EF0A 3LT4A 4HEJA 1QGED 1TVMA 3R2JA 1C1YA 4JLAA 1U1CA 1VHLA 3AJ9A 4KXYA 1BAPA 2WJYA 4HNAA 3RB8A 3RVLA 4ZZ1A 4ALMA 5JBIA 3PDJA 3ZNPA 3FSJX 3NR2A 4EMTA 4L95C 1GXSA 4HGOA 5KUTA 3ZW9A 2BZ1A 4LFAB 1U0SY 2JGRA 1S2DA 3Q3VA 5DK6A 4P3KA 2JAWA 1NIJA 1R9GA 3NHBA 3H86A 4DOMA 3F67A 3R5KA 3LBHA 1W73A 1EE2A 4LAFA 4YGXB 3QMVA 5D6OA 5JVDA 1A77A 1LC3A 2WB4A 5KNLA 3BMOA 2FSVC 3JR3A 4RMHA 3NBMA 4EHDA 3UVEA 3JAKA 4I46A 3AI2A 4MICA 1RHUA 1TADA 1TT5A 3CSSA 4YMIA 4YROA 2GWRA 3RC2A 1YDHA 4F4IA 2Y6VA 3C3JA 4KPYA 2VHUA 4WACA 1QVWA 3PX3A 4F06A 3UMYA 1Q7CA 3I83A 3P52A 1U2GC 2ZDQA 5LN1A 4ZIRA 2AN5A 1OYOA 1DAPA 4UVIA 4FNGA 5I3ZA 1Z5VA 2B94A 4QELA 1F0NA 1RD4A 5COQA 4YGYA 2M32A 1WIWA 2EFCB 3HWSA 1KYQA 5AXCA 4NKRA 1LPNA 3QYPA 1ZCAA 3D6VA 4C08A 1V3UA 3A8IA 4JEMA 4KKTA 3O0DA 1JMYA 2ZIFA 1UBGA 3L0YA 3PITA 1CC1S 4ZHQB 2P9EA 2M1XA 3OZUA 1J2YA 2WP0A 2Z8YM 3IMEA 4IJWA 2CDBA 1YFKA 2OBNA 3M49A 3WWEA 4F5YA 4DB2A 1J99A 1MAVA 1OUMA 3I2JA 3N53A 1EP2B 3DBHB 3TNFA 3T7SA 2EL7A 3COZA 3B1ZA 1VLQA 5EZQA 2YOFA 2CXNA 2P65A 3IOBA 1G6KA 3ZY5A 1E20A 4M46A 2OUKA 5B7GA 2AG1A 2Q1YA 2WABA 4MV1A 4Y9RA 1G3UA 1MVLA 1T6BY 2GEUA 4NBVA 4URWR 4XDZA 1O7JA 3BN3A 5DP1A 4KO1S 3NTVA 4HT3B 4TTQA 1H5NA 1L4EA 1WY7A 4CM7A 3FWPA 2BJHA 3O92A 3U44B 4AROA 3U19A 1JDNA 2AWOA 3GLVA 3LCRA 4J3JA 1SQ6A 4J4BA 5B7PA 1X9GA 1UT5A 3AM3A 4PLWA 3M81A 5JC8A 1XO1A 1ZIXA 5M29A 3K70C 3ZU6A 1U1IA 2E4YA 3D7NA 3UAXA 3VUFA 5IASA 1XHFA 4QOJA 3PU6A 4L08A 3BB3A 1ECBA 5TF0A 1UBJS 1O8CA 3Q10A 5DV9A 1BS1A 3HKEA 2QRGA 3ETDA 5EKUA 1YFJA 1S3SA 3L8MA 4PQFA 4G0NA 4Y30A 4QXAA 3LYUA 3M5WA 2D8MA 2JGNA 3D2LA 3TLAA 3GDFA 1L4MA 1O08A 1TW3A 4Q1FA 4U5XA 5AM2A 5HRCA 1ZCJA 1TZJA 3TSOA 5H3LA 1XCGB 3C3MA 5A5DA 1EQ2A 3HY4A 5JSZA 2WAOA 3G85A 2ZVQX 3Q12A 2BEUA 3Q0IA 3KQYA 4ZYLA 2Q7OE 1Y8AA 5KWJA 5C7YA 5DI3B 2J32A 4LV5B 1VL2A 5DBHX 1KBOA 3ASZA 3X0DA 4KODA 4UM9D 3ML1A 1PLKA 3A3KA 4BP9A 1G5HA 2AUNA 2FDRA 3AU8A 4EJ0A 1YFLA 4EF6A 4OQQA 5HJ5A 4YP7A 2QIOA 3MJDA 3R3YA 1KJQA 1JQKA 2PGAA 2PUVA 1P45A 4F5EA 2PD6A 1OIVA 2XEDA 4C4PA 1HDXA 4I1UA 3M9XA 3OPYI 1L5RA 3OHSX 2LCFA 2Y0DA 3SYNA 3T52A 1D3AA 3PXXA 4YH1A 3TINA 3KUKA 2I2AA 3WRVA 2H2FA 4EG4A 3Q3HA 4UE6A 4GSLA 3UN1A 4OXKA 5KNBD 1CIJA 3CTMA 1JDUA 4NYIR 3KFVA 3SBOA 2QRPA 4F6RA 3AZPA 4DWWA 3DZCA 4PABA 4Y1RA 1N8TA 2I65A 3RAEC 4BVKA 1JE0A 4NENB 5I9IA 5AVYA 3TSWA 4F4JA 2CNWD 1YVUA 2P9YA 4IQFA 4MAMA 3Q8MA 4GKBA 1QONA 5JPDA 2I6GA 1NN5A 2YZGA 3F6YA 4RGVA 1CFZA 3FPFA 1PWZA 3LT0A 2MMCA 4IICA 4DKJA 3VU3A 2DCUA 3P2MA 3S40A 1MGPA 1Q7YD 4KNWA 1IHYA 1DQSA 1CJTC 4IVQA 4LDNA 3LPAA 5E6UB 3BXOA 4HF7A 3TQSA 4FU0A 2P6RA 2YZ2A 4OB6A 3EIQA 1ZXXA 3SZOA 2XIJA 4ER3A 4RQBA 4TQUS 4OVKA 4U00A 4S1PA 1B4DA 2O20A 2ODAA 4R2JA 1QOZA 1UMBA 4XOTA 2HM7A 4OKNA 4GR5A 2BMAA 1UZLA 3QV2A 4V0MA 1BDBA 3OKFA 2VAVA 1PS9A 2ZXEA 4IDBA 1KFEB 1E6EA 1ZU5A 5FWXA 4AMVA 1U9IC 1FJGB 2UZ0A 4HGQA 1GZ7A 4KUGA 5TQ2B 4DR6B 4BYMA 1YRWA 1WABA 4J2TA 4MTCA 3VR5A 1OWNA 1T10A 1OXKB 1CRQA 3OBBA 4G4SO 1SKMA 4D3SA 3AF2A 3HSKA 2XSZD 4AJ2A 2XKBA 4OBWA 2RG7A 2I6QA 4BMPB 3ORQA 1OBFO 4ZAYA 3GJSA 2IXBA 1L7BA 5ILOA 1XXHA 1HFEL 3V3TA 4E13A 1KK3A 3R7LA 4TV9B 2GZHA 2VPZA 4PCUA 3MD0A 4KFRA 1B0AA 1BFUA 3DT6A 3A6DA 1M8KA 2H31A 3ZZNA 1Z39A 2H2GA 2XGGA 3ESXA 2IEDA 2CVPA 1YA8A 3OFSA 3UKOA 1XZQA 4ZVKA 2P67A 3FBWA 3RC8A 4MRNA 4DJEC 4EUSA 3LLCA 1PSWA 2A5DA 3ER6A 2VEDA 3H83A 5AVXA 3ZE8A 5K6AC 3LUKA 5CVVA 4F4UA 3QF4A 2Q9BA 2D62A 4TL8A 2GERA 9ABPA 3NDIA 3EEQA 3CZMA 2IEGA 3L6OO 4HAYA 1ULZA 2DM6A 4B1FA 4FGLA 4P33A 3BA6A 3A2MA 4X24A 3NJ8A 1KJZA 4ZTUB 3IAM1 4LBVA 5ALRA 1RCUA 1UEJA 3WLSA 1DUSA 1CQXA 3JATB 4RA6B 3G8DA 1IK6A 2BI8A 4Z3KA 3P2OA 5ALUA 2QBYB 3ZJ4A 1X1SA 1PR3A 4M9SA 1YJNB 4J1QA 1XD2A 4P1VA 1M76A 1RI4A 1W96A 4FCCA 4X7MA 3KP1A 3M2PA 4LJAA 4Q3LA 5CA0A 1N6OA 3VJMA 1HETA 4MB6A 4QVJA 4BQRA 2N1BA 1DTWA 2EKPA 1C7FA 3DLHA 3LW8A 4CM5A 4PF1A 2JC3A 4H7JA 2OSVA 3N7UA 4M21A 4IM7A 2ZBGA 4WY8A 3UOGA 1CUCA 3LHSA 3QHAA 4UBIA 2QLJA 2OBSA 1QO7A 2B98A 2HRQA 1KMHB 4P7FA 2VTVA 3T4EA 3TZEA 1TJNA 2UYHA 3FMVA 3MPOA 4N54A 1YR3A 4L4XA 4DUGD 1MXHA 2CV1A 2SCUB 1KBZA 1Q19A 4OXYA 1IPHA 4MP3A 4UEOA 2ZL5A 3EVNA 4JNCA 3JW8A 1QVAA 4W8GA