2XNCA

Crystal structure of an engineered ferredoxin nadp reductase (fnr) from pisum sativum
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
287
structure length
287
Chain Sequence
SKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRVPDGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Swapping Fad Binding Motifs between Plastidic and Bacterial Ferredoxin-Nadp(H) Reductases.
pubmed doi rcsb
molecule keywords FERREDOXIN--NADP REDUCTASE, LEAF ISOZYME, CHLOROPLASTIC
source organism Pisum sativum
molecule tags Oxidoreductase
total genus 92
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2xncA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2xncA02
1W2BB 1QVFB 2FX3A 3OZUA 2BN4A 3OZVA 2R6HA 2PMDA 3AVVA 1JJ2B 3VNUA 4TMVA 1FNDA 3E20A 1R5OA 4RCYA 2DCUA 4M0LA 1JA1A 5TY0A 2QMUA 3SJZA 4ACAA 3OJXA 3E1YE 1ZM3A 2B7BA 3CCQB 2YWGA 1VQ8B 3OW2B 1KD1D 1YJWB 4P6VF 3WXMA 1VQ4B 1FNCA 4RD0A 1YJNB 4F7DA 1IJFA 1CNEA 1A8PA 1E62A 1CNFA 3QFRA 4Y9UA 3JQQA 4QHYA 4B47A 1QG0A 3WNDA 4UAJA 1BX0A 4YAUA 2BMWA 2CNDA 4ZV4A 1QUEA 1AMOA 1JB9A 1DG1G 1R5BA 2YWHA 3W2IA 3LRXA 4MYUA 1VQKB 3W5HA 1EP1B 1YIJB 3WBJA 4R71A 3VO1A 3AGQA 3PENA 2X3UA 4N3NA 3OZWA 4M1KA 2HDNB 3B82A 3CCEB 2QA4B 1K73D 4C43A 4B4DA 3ZZTA 1HA3A 1SKQA 1R5NA 5EMNA 4G1BA 5DSZA 1JA0A 3B8HA 4B3XA 3QFCA 1GAWA 4RD2A 1VQNB 5FA6A 3P27A 1KQSB 1GJRA 1KC8D 4NBSA 4QFMA 1FRNA 1S0UA 1GAQA 4K1XA 4TMXA 4YALA 1IJEA 3WNBA 4YAFA 2BPOA 4WQMA 3VMFA 4LBWA 3QE2A 1EP3B 4H9GA 2BGJA 3AVYA 2C77A 2BVNA 4IW3B 2XNJA 5TV2A 1KK0A 1YITB 1VQ7B 4PC3A 4DQKA 4LC0A 4TMZA 1OGIA 4ZCIA 4YAWA 2QDXA 1D8TA 3CC7B 3J81k 4Y7CA 5H59A 1ZM4A 3V76A 2RC5A 1E63A 1FDRA 4Y9RA 1ELOA 1CQXA 1FNMA 3MCAA 4PC6A 3W2HA 4MYTA 1KRHA 3ZBTA 1M1KD 1GR1A 1Q82D 4HE6A 1F20A 3MHPA 4PC1A 1KK2A 4FWTA 2B5OA 2DETA 3W5UA 4AF7A 4ZGQB 2QTZA 1W35A 4LBVA 3LO8A 3CCMB 1B23P 4AF6A 1YJ9B 2HCJB 4B44A 2B7CA 2PIAA 1XB2A 1G7TA 5H5JA 4RCZA 2BF4A 3JQRA 3WNCA 3ZBUA 4TMWA 1J9ZA 2HMAA 5GV7A 4YAOA 3AGPA 2DERA 1VQMB 2YWFA 4RD1A 3CD6B 3MMPA 2QTLA 4PC7A 3U6BA 1FNBA 4RJLA 3VO2A 3W5VA 2OTJB 4RD4A 2OTLB 5JBQA 1NJID 1VQ9B 2CRVA 3CCLB 2BV3A 3G6EB 2VNJA 1VQPB 1N0UA 3CC4B 1TVCA 1Q86D 2BM1A 1QFJA 1QGZA 1QGYA 1VQ5B 1AIPA 3B78A 4ZCMA 1Q7YD 1ZM2A 5GV8A 1EWYA 3WBKA 4TMTA 2BSAA 4ACBA 1M90D 1SM4A 4M53A 4ZCLA 5THXA 3I56B 2VNKA 2EIXA 1EFCA 4B48A 1H85A 1QFZA 4EH1A 4PGOA 2OK8A 3W2GA 1FRQA 3G71B 5AN9A 1OB2A 3AVWA 4G1VA 1N8RD 3ES9A 1G7SA 4RD3A 1KK1A 4TN1A 4Q7JB 1VQ6B 3WYAA 3CW2A 3CCUB 1ZUNB 1JNYA 4YHBA 3CXCB 3CCVB 5TR9A 2YWEA 1W87A 1OB5A 2E1RA 3ZZ0A 3CRZA 2PLFA 1EFTA 1H42A 3I55B 1YHQB 4FN5A 2QN6A 3A1FA 1DARA 1QFYA 3P26A 1DDIA 3OJWA 1D2EA 3ZC3A 2VZLA 4RD6A 1EP2B 1QX4A 2AHOA 3CCJB 4G5GA 2QEXB 1BJKA 2GPJA 3WY9A 1VQOB 3CC2B 1EFUA 1OGJA 1QH0A 3CPWB 3AVUA 1GVHA 3U2QA 2J7KA 1DDGA 1TLLA 1TUIA 1K8AD 1WDTA 4J0QA 3U6KA 3ZZUA 2NPFA 3W2FA 4B43A 3VNVA 2DEUA 4M4SA 2XNCA 3CCRB 2ZITA 2RC6A 1VQLB 2OK7A 4AC9A 2XEXA 1U2RA 3G4SB 1XE1A 1BX1A 2C78A 3QFTA 1N0VC 1BQEA 3LVBA 1QVGB 1G7CA 1KTVA 3FPKA 2EFGA 3QSYA 1QUFA 3AVTA 4PC2A 1EXMA 5HXBA 4M2LA 3CMEB 4ZGNB 1B2RA 1S72B 1TTTA 3CMAB 1KK3A 1YI2B 2VYQA 5KSWB 4FK8A 1GO2A 1IB0A 3W2EA 4LBYA 2BGIA 1K9MD 1D1NA 1UMKA 2GQFA 4HE5A 3CCSB 1NDHA 3CB4A 3FJOA 4BPRA 1E64A 3QFSA 1QGAA 4C0SA 2BM0A 1KJZA 4LBZA 2DY1A 4U9UA 4N3GA 1G7RA 4NCNA 1W34A 4P3YA 3JQPA 3AVXA 4DQLA 2D74A 1F60A 1ZM9A 2VNHA 2VNIA 3I1FA 1Q81D 3LYUA 1I7PA
chains in the Genus database with same CATH superfamily
2VBCA 2D0OB 1TAUA 3BMQA 1HE4A 5J5VA 4D9NA 2FQQA 5SY9A 2YVKA 3AVVA 3QP9A 3LPLA 1OTXA 2C0PA 4BNLA 1PZEA 1PW7A 3OCZA 4YIKA 1GTZA 2G1KA 1JJBA 3E20A 1F8GA 2ORIA 1E2EA 3VPBA 1R5OA 1J2JA 2PNJA 2IX9A 4NZNA 4M0LA 1UBRS 1ZR4A 2HK6A 3JYQA 5CTAA 2VN8A 4X20B 1HV8A 1UDCA 3LDFA 4DYHA 3HZRA 4ZV9A 1SOUA 2WUEA 3NVMB 2B7BA 2ASVA 3GLVA 4U7WA 4ZVMA 4EVIA 1SIUA 4JA0A 3QOFA 2F4NA 3FH0A 4WLEA 3NBFA 4R1MA 2GFQA 4YLEA 1RRMA 2BE7A 1JKJA 1G8GA 1FDWA 2HQSA 2QAJA 1TEVA 1X39A 1YDMA 1SHLA 5IYRA 3EQ8A 1N8NA 4L22A 4WSOA 5CM9C 1G63A 3DV9A 4Y6LA 3NAMA 3TSZA 3VO9A 4RDLA 4A73A 4F38A 2PEYA 3ABIA 2O8DB 4HVCA 3WWCA 1FA9A 1M0TA 1OAOC 2PBFA 3C5WP 3BIJA 1NVWQ 2O2GA 1I80A 2Z5FA 3DKRA 3O84A 2OGUA 4IQFA 4JS0A 2D00A 4HUQB 4C7JA 3ZCSA 3VV3A 4NF2A 2J4DA 3DO6A 1NN0A 4A9AA 3Q8LA 1DCFA 5ECGC 3CNHA 5B12A 5K6TA 3A9CA 3EFOB 5CCXA 2IYLD 2AZDA 4B47A 5JXGA 3NIWA 3N8GA 5KYYB 5DM4A 3JATB 1JW9B 5B1HA 2ZTGA 5E7MA 3UG6A 4JYZA 1N2GA 3LLUA 4CGZA 1FPMA 2BRUC 3QV2A 2X6TA 3TOVA 2DWPA 5H4GA 3MQFA 1JB9A 1ORTA 1SD2A 4C0BA 1XEXA 1KI6B 3H7IA 4L51A 2V7WA 5LZ7A 1H6BA 3DTNA 1N2EA 3VUFA 2YHAA 4HNGA 5BN1A 1MOZA 2FWJA 4V2UA 5GQSA 2JA1A 4KHZA 3ZHVA 1JALA 5FIUA 3R5FA 5F35A 1P2FA 1PL0A 2FR8A 2YY5A 2Z4SA 4NHOA 5D1NA 4R1PA 3TAXA 2J3KA 2V5UA 4TUYA 5C1OA 3JWIA 1QR6A 3K73O 1TVEA 2D2EA 3AX6A 3K5PA 5EKTA 1S1MA 2RDMA 3O7WA 4TT3D 1GQFA 4GR4A 4QWWA 2EKQA 2Q5JA 1ODLA 5M29A 1HTWA 3RD5A 2C1ZA 3QM1A 5J63A 3X3HA 2QZ9A 1U28C 3K9HA 5DTMA 2ZWMA 3PNSA 3HB7A 1A9ZA 4Q1EA 5AH0A 2RJNA 3IILA 1TF7A 3Q4GA 2X2EA 1P4MA 3Q72A 2XYQA 3HUEA 4CCSA 4MVJD 2ZQ5A 3ONFA 4F21A 2C7PA 4II2A 4DN6A 3HL4A 1SXIA 3K0EA 1KNQA 3NKVA 3FOCA 1E3QA 3VSCA 4C43A 1D4OA 4BIIA 3PWZA 1G6KA 1Q22A 4NABA 1ETHA 5LN1A 4HLUA 2AT1A 1JQLB 1CEQA 5IT9A 4NDZA 1SKQA 4PZYA 1TI7A 4QBFA 4BWGA 3CS3A 1WTCA 5TLSA 2Y0CA 1ZK4A 2CVPA 5EIBC 3QVWA 5BUQA 1BO6A 4S3MA 1U0RA 2W6MA 4E15A 3LQ1A 1P4JA 2R5WA 1YB1A 1HDRA 2P2NA 4PQYA 5LMCA 1A88A 1AY0A 3WFZA 1EUCB 2ZIAA 2ENUA 1PG2A 4IH4A 2P5YA 3EGWA 3SHQA 1L4LA 5T57A 4B3SB 2P9CA 2PMEA 4DIKA 1W88A 1X86B 4XLEA 4EVQA 2ZS7A 5D8DA 4GIBA 3R7AA 3KQMA 3ZVKA 3P2IA 3B5IA 1WKBA 1R18A 2VQSA 3P20A 4LWOA 2CV2A 2PU5A 1PDVA 3C7KA 2ISCA 4GW3A 2AIRA 2V3VA 1ZPDA 3QFFA 4OX9Y 4KYUA 1M75A 3D7SA 1M66A 1DBSA 3GEEA 3RUDA 1QVWA 2ZVPX 1ICEA 1OH8A 4P3IA 4RY8A 1T8UA 1D9ZA 1U02A 1QGED 4CF4A 1AS0A 4XOTA 2MR6A 4H9GA 4LWPA 3ZKWA 4GWGA 4M9CA 3ON5A 4JJ6A 5L53A 2X8AA 2D1QA 1U0SY 2PSHA 1YBHA 3AQIA 4J0KA 4DZZA 5TEVA 4BB9A 1G9TA 3R7DA 3OA2A 4NAVA 2WJ4A 4Q15A 4WFKA 4F6RA 3QX8A 4L6IA 4B3FX 1IQUA 1E5XA 1T2DA 5DMHA 5IW8A 5FOQA 2AMVA 1W0JA 5BNFA 5LLTA 3IP9A 1E6UA 2HADA 3BWXA 5BN5B 3ORSA 2QL7A 4LC0A 2FRVA 4JJIA 3G9ZA 5LQJA 3BDIA 4YAWA 3THXB 1RHKA 3BE6A 3K0CA 4Y2QA 2H92A 5E4FA 4ZI7B 1BVHA 1QVZA 3OT1B 3OOHA 4QIHA 1UBTS 5FOWA 2EF0A 3JTMA 4PANA 1PLJA 4BLRA 1TW2A 3NC0C 4EB3A 4KH0A 4POOA 4X1IA 3BFPA 2O59A 4OUKX 1SVSA 1TKRA 1G16A 2EKZA 1T5OA 3C41J 1RBZA 4NBRA 4NESA 1E2MA 1KIFA 1SA0A 2P9JA 1NMZA 2W48A 4LZLA 4RFLA 1U0LA 4NEGA 5LMNB 3FPAA 3VYUB 2GVZC 4ZI3A 4EYQA 1V3TA 5JZSA 1KS9A 3BULA 4H16A 4Q02A 3STTA 4JENA 1TF2A 3OEHD 4YMWA 1HFEL 3SFVA 1P9LA 1RSZA 3BXFA 3OQJA 3TFOA 4ZT3A 2EBWA 1W52X 4P4SA 3R9KA 4UDXX 4MKFA 4DC1A 1H9CA 1AGPA 2X0NA 5KMGA 4IV8A 4LYEA 4D6XA 4KE9A 4ZGBA 1OA0A 4Z1MA 2VUIB 3HKCA 4S1PA 1GCUA 3EASA 3WFIA 3IP8A 2XWQA 1VPTA 4WW0A 1LPMA 2OCGA 5K3DA 2V5AA 5AKGA 2BFDA 2NXNA 1KEZA 2R47A 4LVNA 3HBJA 4FI3F 1GFWA 3DXXA 1N08A 2RH5A 1XNRB 3D2BA 5DI9A 5BURA 2QIOA 4DV5B 1LK0A 4MVJH 4JNCA 4ZVOA 3GPIA 3ZZMA 3ADCA 2HDOA 5LP6B 2B4YA 2HT1A 3E1SA 4Y2GA 1XHEA 1R10A 3SYNA 3P9IA 2C2GA 2Q2NA 5CA0B 4P38A 1WMFA 4V2IA 2NO0A 5SV2A 3GY0A 3C8MA 4NG5A 1QVAA 1PD1A 1N05A 2VSNA 4L9SA 5C35A 5H70A 4HRAA 1VMIA 2APJA 1EX1A 2V9ZA 4YRQA 3SEQA 2AKYA 2O5EA 1MB2A 2OV8A 3PRYA 1ZP6A 4RPJA 4XWAA 1R12A 2XB2A 4W1PA 4Z49A 4AWAA 4CGYA 4HWKA 1LDEA 1PJ7A 4L74A 3QF7A 5EUBA 5LQNA 4DZRA 4OMFG 1B1AA 2QM8A 3DOOA 1PGNA 5A5GA 2E4YA 3CMCO 3MSXA 4NTZA 1S1CA 1JEOA 2JLBA 2ORWA 3A9SA 3CR3C 5IDYA 1VPVA 2EX1A 4B45A 1YD7A 2C4NA 3A1TA 1ATIA 2C8JA 3DUFB 5BSUA 3QKSB 1ID1A 2MCFA 2GZ3A 4WA7A 3UZUA 1QNLA 3HMQA 3ZHYA 5MGNA 1U5BA 5ALWA 3I9V6 5DM60 2X8LA 1JFVA 1NJID 4PBSA 1Z5WA 1EYZA 2G9VA 4BNIA 3NYRA 4QQFA 4TQ9A 3TQQA 1M8JA 2NN3C 1DELA 4B6GA 2I7XA 1GL6A 1Q86D 1F12A 1A0OA 3ESXA 3S1AB 4JYAB 2JG3A 3L0BA 1ZONA 4N9WA 3AF0A 4MV0A 1DJNA 5CR9A 2WR8A 1DWPA 3OFJA 2HYDA 2EBUA 4RAOA 5IBPA 2YMPA 2BR3A 3FFXA 3FNHA 4UM8B 1P1BA 2JS7A 3O9VA 1B8OA 1QIDA 3PKJA 4UUAA 3TUJC 4C29A 3WYNA 4OHYA 3IVXA 5JHHB 4AECA 2W5UA 3THSA 3ENQA 2EHDA 5EZYB 3CB2A 3QLVC 4BE4A 1K8QA 1YIDA 5G41A 1F4VA 1U80A 3NC1C 1BKDR 2KPOA 3BHMA 4A0QA 4Y1RB 4TVSA 2L69A 1AT1A 1T2EA 3WK8A 3U7FB 3N0TA 2J7PD 2NACA 4G89A 1NBEA 3S68A 4YMLA 4FYMA 3EG9A 1ECPA 2JLUA 1BDHA 4E12A 3DE2X 4KXNA 1GIAA 4TZTA 5F78A 4CU5A 4DV7B 1R6VA 2WZDA 3K1ZA 3LYLA 3OE1A 4OHZA 5DYTA 4HRYA 1OPXA 5BSYA 2G9ZA 4O4JF 2YY6A 3GSIA 4E1VA 1C4KA 5EVCA 3I4FA 3GGOA 4RSRA 1TGYA 1U99A 3NB0A 4RY0A 2Q3LA 4YN3A 3DOJA 1F7UA 1X1SA 5DIFA 2VDJA 3WX0A 3CW8X 3UJNA 4R2WA 4NENA 5G1OA 3T12A 2AQIA 4RZIA 4WZAB 5T4BA 4BNKA 5A3QA 5F9FA 2WP8J 1X1EA 3IULA 1VCMA 3QELA 3O1IC 3OZCA 4I14A 2VP3A 2IS2A 2YWEA 2ZREA 1FLAA 1XRLA 2KS6A 5BRJA 5C1IA 3JAWA 4JI2B 4JSYA 1TQHA 1DO2A 1A7AA 3H2YA 4OQQA 1YRBA 3LD9A 3GLFB 3H5LA 4CT0A 1YK0A 4IVRA 3HI6A 5FL7D 4H7JA 2CSXA 1AS3A 1MPTA 4P4GA 1D2GA 4GSLA 4LHYA 4DPLA 4YX9A 1NRIA 4LY6A 4H4DA 4JFAA 2A67A 5THKA 1GNPA 1SC1A 3MINB 3T7DA 4RTLA 1Y3HA 1MFZA 4RHYA 1JR3A 2QVXX 5LXTF 2FQ1A 6ADHA 3D1LA 4WBNB 1JHAA 1N9ZA 1NBWB 1QNFA 4CR8A 5BW8A 2XZOA 3NTUA 4YCDA 3L7MA 4V0QA 1SXJB 2NLOA 1YLOA 3WC4A 3MMXA 5ALSA 4DDHA 3MCTA 3BA6A 3UHOA 1BEUB 1FDSA 4X1KB 2IA5A 1EFUA 1NE7A 3COPA 3HY3A 4XVUA 2NWQA 5KTRA 2QVLA 1WPCA 2W70A 1QH0A 1ICIA 3DMHA 1O6CA 5ALOA 2BI8A 3IPLA 4BNXA 2WM3A 1MIOB 2YHUA 2GBFA 2IHYA 3NDJA 5LZ8A 1GPMA 2IHTA 3V00A 1GG9A 2CF4A 2BHRA 3ILVA 3NPMA 5LQCA 5IUJC 2X6YA 1VSTA 2ALJA 2JK0A 4L5YA 3JWEA 5JS7A 4W9NA 3SF8A 4YQEA 2IDMA 4AF8A 4YUZA 4ZJYA 3RVMA 3EODA 1MORA 4CQMD 4OAPA 4ZFNA 1QGDA 1HZZA 4GICA 4J4TA 2AI3A 2ZKLA 2H00A 1HTTA 3CCRB 3MILA 4EX7A 4C7MA 4PVDA 3VZSA 1E0SA 2HPAA 1DAIA 2RC6A 1R00A 2UUOA 3QG1A 5DW0A 1TO2E 1YU9A 1Y3IA 4BJHB 4S04A 3IAM1 3ZVMA 3S5JA 4PLWA 3WSVA 1JEEA 4YJFB 4JC8A 4OLBA 1NF2A 2HO4A 4MARA 4OEHA 4DRZA 1ECFA 2HF8A 3E84A 2JD0A 3KKZA 4O4IA 2GZRA 2QUAA 3QXHA 4D6PA 1NJ1A 3GZTB 3RBZA 1D8AA 4LK2A 3WDLA 4MYDA 1TJYA 2NIPA 4GOKA 4O4HA 1VJGA 3IUBA 4Q3EA 2C5GA 3EVNA 5LP6C 3WRYC 1Z2OX 4AS3A 4P9SA 2Z30A 3WLTA 3P0RA 4B33A 4AJ2A 3R0ZA 4RPIA 1GQ2A 1RTTA 2AYYA 5DGDA 3L7BA 2A0KA 3VR4H 1EJ2A 1E3EA 1KYQA 2QXYA 1UFKA 3GVHA 5IJXA 4UUMA 5EIEA 4J1QA 1INLA 1RBMA 1RPAA 3PQCA 2BTQB 4YP9A 3RS4A 2PWYA 4B6JA 1WCWA 1SOAA 4PG5A 3UJ3X 4HX9A 1OAAA 3LF2A 5BSMA 1YBAA 2G63A 4BEBA 3R6TA 4H17A 2HU7A 1E9VA 3L8MA 5CDFE 2UUCB 3WWOA 1VPEA 1LDYA 2UYYA 3AFIA 3JQ7B 3LWNA 5A0VA 3L7YA 4HFJA 2XXAA 5BQ5A 1T3LA 4BRUA 2V6FA 3F5SA 5A03A 1DG3A 1LLFA 1V7QA 4LNUA 4NC9A 3KLMX 3RF7A 1YBVA 4LX0A 5JALA 1ZO8A 4LQ4A 2REXB 4EA6A 6ABPA 2O8BB 1L7VC 3TR5A 4I4LA 1LQ2A 1J20A 4QBIA 3TNJA 1T9KA 2OZPA 1M7HA 3AFGA 3CLTD 3FYTA 5LMUB 3UT5B 4MRMB 1QBKC 1IUOA 4HMPA 3X1KA 5JQGA 1XDGA 5EHGA 1HI9A 1PNQA 2MWMA 4ANFA 4F84A 4X8IA 3ITNA 5EIWA 1GPLA 3R5HA 4C0SA 2CDBA 2V6MA 2Y1EA 4US2R 8ATCA 1XXHA 4HMQA 2WG0A 4QUHA 1W6UA 3CG0A 4U1RA 3AUUA 3ND7A 1TD1A 4OPMA 2XECA 1I0LA 1I5OA 1TZBA 1YOVB 2GKOA 3Q0TA 4WK0B 1JN0A 3C3CA 4L5BA 4Q4HA 2XKKA 1N3BA 4DQLA 2EEPA 2TSYB 1Z5PA 5DS0A 1LV8A 1B0ZA 5I3CA 5JFGA 1S8AA 1DXQA 4W9MC 1ONPA 3LBFA 3EAFA 3BCFA 3GI1A 1P31A 4JV5B 1RWOA 4BB5A 1GPYA 4XWTA 4RQBA 5IDQA 1SFRA 5FWYB 4B8WA 4EVSA 4RDCA 1ONBA 5CH8A 1TKCA 1ACJA 4CKZA 5DEOA 4K81B 4Z9XA 3KTDA 4L8YA 3RIMA 3RC7A 3B9QA 2A3RA 4E30A 3C6XA 2BN4A 3IDFA 1I5EA 4JODA 2R6HA 2EL9A 1CR1A 4R8SA 1PJTA 1OMOA 5DJ5A 4D8YA 4G9GA 4EB0A 4BATA 3CUSA 1CP2A 1T25A 3BTOA 3KTAB 1BE0A 4HQ0A 5ARBA 1PT8A 3S8MA 1P1RA 2NVWA 2X6QA 1Y8RB 4ACAA 3GJ3A 3R5XA 1XL0A 2FP4B 4V24A 3MIIA 2W2VA 5KVQA 4AMZA 2O8CB 1NLYA 3IIIA 3HEMA 1VE5A 1I9GA 4YUWA 5JCJA 3RTGA 3F73A 2JKVA 2QKYA 3PEFA 1VF7A 2K2QB 5EXDA 4H59A 4KFUA 3H6HA 3HMKA 3HXKA 4UBMA 2X5OA 1EEXB 1SCQA 1T29A 1TKAA 1OHHA 2PMCA 4LZJA 3BFVA 3K71B 3ABSB 2C2MA 1H4VB 1MEJA 1SBZA 3LKDA 1A7KA 4M0MA 3KHKA 3MXOA 3SG0A 3L43A 4WEQA 1BDMA 3VAZA 2UVQA 4UTNA 3TNDA 1FS5A 4D9CA 4TS1A 1S9HA 1TL7C 1G9SA 2Q9BA 1O8CA 3PEWA 4CLEA 3ZUGA 5ADWA 2B4TO 1MAVA 1Z2DA 4JDUA 4YGXB 5DHUA 2BYTA 4FJ0A 3LVFO 1XMOB 1CS0B 4FUQA 1PJ6A 2BHLA 4MGEA 1V5FA 5A5DA 1ILEA 3E9CA 4ZI7F 3DZCA 3BXGA 1BX0A 1AXEA 4OSEA 5GONF 3LBHA 1KY5A 1SUDA 2P4UA 4L27A 5ADHA 2CNDA 4N03A 1SXJC 4NR0A 3JQCA 4O1HA 2HX1A 1A4IA 4WNAA 5JAHA 4FM9A 2AJDA 2AQHA 2EJVA 4RS4A 2VBTA 4V0MA 4X45A 2VPXA 3RHSA 3HGQA 2Z6UA 3UMFA 4MTCA 1QCZA 4UQLA 4JBNA 1IK6A 2HWXA 4NECA 4NXMB 1B26A 1EUDB 2YYAA 4FZ3A 1AKQA 4IXMA 2ZJ0A 4QEDA 4MGHA 3SIRA 3C1UA 1EP1B 1VKJA 4EY5A 1A77A 2F3UA 4PGMA 3QEMB 3GLIA 2Y27A 5IM4A 2PUWA 1Z6YA 2ZIXA 1Q74A 4FR0A 3RSOA 3WL4A 3LPCA 3R3YA 2I33A 4LMBA 4AT1A 5CG1A 2B8TA 3RVKA 3RHFA 4F96A 4YRNA 5LQSA 4DJ5X 1PS0A 1O0SA 3EGXB 3S7TA 4C88A 1OAOA 1JT2A 4G1EB 5HF8A 3FCUB 4G6IA 3L1UA 2O2YA 4G37A 5ED0A 4NYJQ 3Q8XB 2H51A 3OQVA 3P7MA 1XTIA 1I30A 1U7WA 4OM8A 1U9CA 3VTAA 1K2WA 3IXQA 1UKEA 1N2HA 3B82A 3OTIA 2EZUA 4HGQA 3G2PA 2FPXA 3JV7A 3D3WA 4INOA 3H8JA 3SJBA 2EX4A 5CA0F 5BQXA 4HG2A 3K0KA 1KE2A 4AROA 3ECSA 3K1TA 4P5DA 3BHIA 1D09A 5JNSA 2BRUA 1E32A 1SVUA 2P1RA 3REGA 3V1LA 3DBHB 3C1AA 1U0OC 1QHIA 4YRJA 4F6CA 3TBFA 4ND4A 2OCBA 3WZMA 5BQFA 4U8HA 1T91A 3Q9NA 1P3JA 1DWOA 2H57A 4BYGA 1K63A 1ULZA 2ATXA 2Z5LA 5C8YA 4E31A 1Q7GA 2A35A 5CNIA 1XHLA 2XMPA 5KDLA 3TCKA 3WI7A 3GOQA 3Q1LA 5IAOA 1NVTA 3HE3A 4M1EA 1L5KA 4DNXA 4RTRA 2IV2X 4BV9A 5IYQA 3AHDA 3BWMA 3Q1KA 5EJ9A 2ZUDA 4AJLA 4ZHQF 5LFAA 1HSZA 3K16A 4PPFA 3CPEA 3MWLA 4MHOA 5DX0A 1DIAA 2XF8A 3W8FA 2QN7A 3AIOA 4IAOA 3ASPA 1OB0A 2N1BA 1U28A 2BFAA 3GJ0A 4IP0A 4K1XA 4CR6A 3THWA 2GD1O 1OZHA 4M9SA 4PINA 5AOBA 2HLDD 4YALA 3L6OO 4YBRA 1A2QA 1P29A 2C1EA 1MF7A 1KH2A 3JQ6A 5EZ5A 3UKJA 2QMHA 3WNBA 2HF2A 4FDUA 4ZYYA 5J3JA 1UL1X 4EJ6A 2LIPA 1E7WA 2NAFA 5H02A 2ZULA 3MWYW 5JMPA 1QAOA 1SC6A 4FC6A 5B1IA 1UD6A 4GMGA 4U5XA 4G26A 4JL6A 5LQUA 4AWXA 2CJXA 2FEKA 1ZFNA 2OQVA 3KOOA 4BNUA 2XWPA 4GLFA 1YAHA 3QXJA 4AJPA 3F8TA 4XVCA 2ERCA 1A5SB 2I6TA 2NV6A 4IWYA 1I1OA 4PPYA 3EXG2 4PC3A 4UUBA 1ORDA 1WY7A 1RIIA 2R4TA 2WYUA 2ONJA 2YMQA 2H3HA 5B58C 4W6QA 1EX9A 1GPBA 1PK8A 3KHUA 4L16A 4L1KA 4PGHA 3UJAA 2H4ZA 1ISIA 3H1AA 4GNRA 1NF9A 3FSGA 5EZYF 5LQDA 1VL6A 4HH1A 1D8TA 4UXIA 3MPUA 3MJEA 4OXQA 2GXSA 5K3FA 2J1LA 3B2EA 3UH0A 2CLDX 2JHPA 1NR1A 2Z1NA 3CN9A 4HAYA 5ARCA 3WGTA 4UBLA 1OVMA 2DFNA 3GD7A 3GELA 4P3XA 5FYDA 5KAMA 4V1CI 1U63A 1K6EA 4N8SA 1CRPA 2P9QA 5C31A 5BSFA 3I9JA 4EM6A 2QJOA 2RG1A 3DLPX 3U37A 1BJRE 1T24A 1XVTA 2WSSD 4RVSA 3S4YA 5ILGA 2VJCA 4QBTA 3CESA 4KK3A 4GMDA 3T5MA 2RGBA 4HNQA 2P4QA 5E6RB 2YFQA 1X77A 2EQ5A 4I81A 4Z8YA 1Z08A 4JEHA 1L6IA 4K9PA 1KVQA 2J3MA 1HVXA 3K8YA 3TQFA 3GYGA 2NUPA 3GGDA 3OCJA 1MB4A 1V6CA 3DBVO 1SVOA 1VG9B 4TYMA 1UZLA 1WD5A 2IDJA 2IIQA 2B92A 2QQFA 3DPUA 3RVQA 4ZANA 4UM9B 1EWTA 1D0IA 1DAGA 2QAIA 1GGHA 4W1QA 2G28A 4PPQA 1TQ2A 4F2PA 2WD9A 3RSQA 4HK4A 1CZUA 3HO1A 4CW7A 4H3KB 3NANA 5A71A 3B6KA 3EXFA 5TQ2A 5D3QA 3M6UA 4NAHA 1VL2A 4TYNA 3I6BA 1Q92A 1NTOA 5FWXA 2PVSA 5PNTA 5AVZA 3HG7A 4YJ3A 1JHXA 1DPFA 1QMGA 4UPDA 1FP6A 1W5BA 3BMCB 5KJFA 5JLJA 1A9PA 3OECA 1BA2A 3D8TA 4XYEA 4YLYA 2E89A 4CT4B 4IIBA 1TOAA 2R8EA 3FROA 1I2CA 1T3ZA 4V1CB 2Q3CA 2ID7A 5T4FA 4QUZA 3KB1A 3UPDA 2IH2A 4BXOA 1F8UA 3BGSA 3FVVA 3PT9A 3TSCA 1C4OA 1T8SA 4N0PA 5KOIA 2C2BA 4RPKA 2X0FA 2B7LA 4HWTA 4DWWA 3O73A 2PYZA 3LJKA 3PXUA 3OPYB 4IDDA 4OQPA 1NN5A 4PCVA 1PWEA 2CJFA 3MUFA 2RCYA 4HLNA 4LV8B 4F4UA 4W5RA 4PQGA 4PEVA 1WX1A 3R09A 3BSSA 5GM2A 4S35A 3ETDA 5H3LA 3EDCA 5FWNA 3CCBA 5TSDA 1UPXA 1YVDA 2R85A 3ENWA 4HADA 4CL8A 4HC4A 4R2LA 3TZQA 1BMFA 3CYFA 2AKEA 1LSSA 4RJLA 1M1UA 1KZ4A 3PS9A 3ZGZA 1H66A 2BGKA 3A9VA 5IVHA 4FHDA 2YC2C 4YCAA 3RVJA 3DEIA 2BFEA 1VI2A 4D41A 4B85A 3Q3GE 3RYHB 3JYPA 3EVFA 1XFAA 3WMRA 4XM2A 4DCMA 5KQSA 2ZRIA 4J7UA 4URZR 1I1QB 3BICA 4TTPA 4X20A 4BV2A 4DBZA 3H1EA 2QUZA 4D96A 4D45A 1W1WA 3QU4A 4I50B 1B0UA 1QGYA 4H08A 2BP7A 2FRXA 4XIJA 4CPDA 2DFKB 4PX3A 2W00A 4QJ5A 3ZHQA 1Q20A 2ERYA 4K26A 4QE3A 1E3DA 5K8CA 3G0IA 2WHPA 2J0SA 1KWGA 3AU8A 3OFND 1Z0UA 1Q7RA 3IUSA 1X7HA 4EYSA 1P1JA 1UBGA 1X7YB 4LCEA 1J8QA 4KN9S 2J08A 3CZ4A 4PYIA 5E3IA 3JS5A 1IWBB 4TMTA 1ACMA 2QSYA 3W3AH 3DEKA 1O1YA 4ACBA 3ZXIA 3DTVA 3QA3E 1CVIA 2AUTA 1HDOA 3KLNA 4NOJA 5IM4F 2XI4A 3BQMB 721PA 1N75A 3O2NA 4DLYA 4FKZA 4KE8A 1MBZA 2QD2A 1T4MA 3GN1A 1HDZA 2AD1A 3CRVA 4GPTA 1MD9A 4MWGA 4JP5A 1FFCA 1Q0QA 1WDKA 2L42A 4IDEA 4LJKA 5GGXA 4EI8A 3SNHA 4X0CA 3QKUA 4ZOBA 2P78A 5E0OA 5KYYA 2AF3C 6CHYA 3CT4A 3LECA 1ZX1A 2GVNA 3FWZA 5K9ZA 3PRKE 2P35A 3N2YA 1QV7A 3GJ8A 5CHEA 5D7NA 2Z6AA 1I3OA 5TQJA 3VYVA 2GPTA 2QT0A 1JAIA 1C9KA 3SBDA 3D6TB 2CBXA 3QBJA 2OGSA 3PICA 4RD3A 1JR3E 1LTKA 3N07A 4MUFA 5E0KB 1RQ2A 1GPUA 2C7BA 2OSBA 3AKDA 3BXOA 3OF2A 1U2ZA 3WYAA 3H0KA 4QUAA 4WERA 3D26A 5DCYA 5EE3A 4K9QA 3AKCA 4Y2HA 3KD3A 5GOZA 5TJHA 4BO7A 5JCPA 1HX7A 5JV5A 4QPDA 2A0WA 1PGJA 2ZYUX 1QHYA 1P9RA 4TT8A 4UKDA 1YDWA 1B6SA 4KR0A 1W5TA 1IB6A 2GTPA 4XLTA 1ZD4A 2NZJA 2QYTA 2WV7A 5CTJA 2AXQA 3A31A 3DMGA 1XVIA 1V1RA 1H42A 1YV9A 3QLVA 2X6XA 4GI7A 4LRWA 2C31A 4KW7A 4MV8A 1A76A 4JWKA 2UXBB 3ZHRA 1P0QA 2I66A 3NWEA 2JJMA 5AW1A 3K5WA 1O58A 4Q00A 1IQPA 3KL2A 3ZNQA 1AKYA 1RAGA 1GUYA 2C59A 2Q46A 2VRWA 3GPBA 4JCCA 5JRDS 5SICE 1IRXA 1Y3CE 1YQDA 2HWUA 3K09C 1U3WA 2B0JA 3M6WA 1X8JA 2W6IA 3R7WA 3C4JA 3T1TA 5J40A 3TLZA 3TMAA 1CC1S 3F67A 2O3UA 4CODB 2F1JA 4ZQFA 4ICIA 1ZD5A 2Y76A 3HBAA 4Q7EA 3DMDA 5ALDA 4N5LA 2HKIA 1R6DA 4Q9KA 3O8OA 3GLSA 1IU9A 4Y0NA 2J7KA 4GBMA 4ZMSA 2X0EA 3ELUA 3W6OA 3MAJA 2JATA 2EFDB 5JVDB 4QOIA 3DD5A 4RFSB 5KSOA 2Q0SA 4EJFA 2VHQA 2X86A 2OESA 4P3PA 4UDYX 2OLKA 4UU0A 3TG8A 4L8FA 1FMFA 1VJ1A 4LZNA 4UPEA 2I54A 5HZHA 2G5GX 1WVGA 3LGAA 3TSOA 4DLXA 1FSPA 1RJ9B 1WQ4A 3C87A 4LJ7A 4CTMA 4MUGA 4Q9IA 1JS1X 3NHRA 4ROTA 1IOLA 1JEJA 1BEEA 2PL1A 4CQLA 3SLDA 3SEZA 2QIPA 2PRSA 3HUFA 2O7SA 3FNRA 3IO3A 2Y9PB 4L8LA 1QKIA 3IHTA 3MMZA 3BH7A 3PFHA 1Y3AA 3R74A 4E13A 2CGEA 3V7AA 2J6BA 5HOEA 4AC9A 4BKRA 2OV2A 2JGJA 2CNOA 2XUKA 5BYJA 4PRZA 3IR7A 4DCNA 3W3AA 3BT7A 4YPFA 4P33A 2OAEA 4LF4B 4YRDA 1U2SA 3G13A 1VM6A 4LOJA 1KPHA 1D4AA 3IRVA 1YX2A 5KOJA 1MMFB 2NGRA 1UBSB 2C2HA 4PS0A 4RM2A 4XUCA 1VPDA 1EB8A 4GUAA 1JAZA 1V6SA 2C4VA 4TLLB 3IL2A 2PSEA 4ZA2A 2YY7A 2ZLBA 4XGNA 4DC0A 3INGA 4CHTA 1C7QA 4WV3A 1VHTA 5HS6A 5BN5A 1EXVA 4GKJB 2I1VB 1CYEA 4OXNA 1TIKA 3FTCA 4YV1A 3Q3EA 3MCWA 3OWXA 2CK3A 1G8PA 3NHYA 3OX1A 4M8NE 1HLGA 1EXMA 3PGVA 5ALRA 4H31A 1DKUA 1VE1A 5EIFA 4M2LA 4QRDA 1XQYA 2Q21A 4LK3A 1L5QA 4PZ0A 3B1FA 4OBWA 1GNVA 2H11A 1MABB 2XLBA 3CT6A 3PX3A 4HAIA 4UMDA 4BNWA 1QZXA 3RFFA 2FPOA 1QLJA 2B1GA 3KEOA 4R2IA 1QR2A 2F9FA 1AU9A 3AETA 1C41A 3CFYA 1N6KA 4O63O 1RKVA 3KBOA 4OQFA 3KB8A 4TLBA 1XXHE 3E03A 3BE5A 2KI5A 2OGZA 2MSLA 2GHTA 4KGVA 2J46A 4R41A 4L0DA 4BO2A 5HSGA 3BCRA 3HFGA 1PWXA 2R1TA 1UC8A 2MINA 2ETVA 3MJCA 3MERA 2G9UA 3VHRA 1Z7BA 1N2ZA 5CM2Z 3V5NA 4C0HA 4ESEA 5T6MA 5I45A 4OKNA 4ND8A 2Y99A 4LPKA 1E7YA 4LDPA 5TX7A 4GEKA 3L8EA 1CIPA 4G5HA 1R4NB 4ZQHA 2EDCA 1DIHA 4DMKA 1H8ED 2HFKA 5ENZA 3KBBA 1WR8A 2ESRA 4W9RA 1LJLA 4FD3A 1IJBA 1GARA 3VZCA 3WRYA 1Z39A 5LP6A 4R2KA 3PF9A 4UM7A 3KJGA 4IJQA 1OX4B 3R23A 4QJIA 3TEJA 4BOYA 1FNNA 3MELA 2A1TR 4AJ9A 3RHZA 4N3GA 4BQOA 1K7CA 2O05A 3BH4A 1QHNA 1RYZA 5KTSA 2FYTA 2XT6A 2XB8A 3A1NA 4IJKA 1E9DA 4LQLA 2IFTA 1SC3A 4PZUA 2WV9A 4QPJC 5E6SA 3TE7A 1HG1A 3JZFA 5FTWA 4TSFD 3DLAA 2GBLC 1UBFA 2VNIA 2VJYA 1Q81D 4XFKA 3JARA 4ED9A 1XMIA 2JFYA 5K3SA 2SKCA 3NIDB 4PYQA 4AKEA 3OPOA 1NLZA 3FR8A 4MQEA 2PBRA 1VMAA 3BGWA 4FR2A 4QXRA 4TKLA 5E6UB 4PSAA 2FX3A 3OZUA 2OWEA 1LFDB 3KYJB 3RSZA 1NT4A 2PMDA 1QHSA 4I1SA 2Q3BA 1TLTA 2VA8A 2AN9A 4P2GA 1SVMA 3VC1A 2YYZA 1HSOA 2R6FA 1KJIA 1PGQA 3AR6A 4P0PB 4G5QA 3LF1A 3DUFA 4E5NA 4YECA 5LIPA 5EHQA 2ZZGA 2RGDA 3AR9A 2BUBA 3DKVA 3ZWNA 5EC8A 1ULHA 2QNIA 2NU9A 3NATA 3QKRA 3EK2A 2CWDA 3AUYA 2B0CA 1UEJA 4N54A 2G70A 3T6KA 5FI1B 4B79A 1USKA 1YFKA 1KXJA 3ZVNA 1ZM3A 3LXXA 2PNFA 3NJ4A 2R8OA 3IAHA 5F21A 4CEHA 1XCJA 4KL8S 3BF7A 3DDNA 1JHOA 1WG8A 4MV3A 2UUAB 3H5TA 2YQZA 5ENDA 4BCDA 1DTWB 3PVCA 1KYTA 3S1AA 3FOWA 2ZI6A 3AL0C 3W90A 5HYVA 1LNSA 5KQPA 5A4MS 1QXSA 1NPTO 1J4AA 1Y7PA 2DJ5A 3BUSA 3DOEA 4MVYA 4ZAZA 1SNYA 1H6DA 4RLQA 3U4QB 1YVRA 1I4DD 1EMDA 4DIDA 1E2JA 1JXQA 4V0ME 4WLVA 3MN1A 2I1QA 1OI2A 3MD9A 1BG6A 2AOUB 1DOZA 2OOSA 4KQWA 4D9GA 3H11B 4DHWA 5TRDA 3QNMA 4LMPA 1GTL1 2PKEA 3WNVA 1P0PA 5AP9A 5EZYA 1CZNA 2IHVA 1BH2A 3OOEA 3GLIE 2VTBB 5L4NA 4Y9UA 2QEQA 5HRAA 4I4NA 1T10A 4KOEC 1E3JA 3PGKA 3ZGNA 1Z9BA 4A0GA 4B0OA 2WJYA 3UEOA 5F1OA 5JJIA 4MQ5A 4DGQA 2DOKA 3ITKA 1DUIA 3PHHA 4M1QA 8GPBA 4HAWA 2IUTA 5ISMA 3ER8A 2V31A 4BMXA 4D57A 2C5HA 3SR4A 4LOIA 1MIHA 1WU7A 2ET6A 3DAOA 4FSDA 4ZGGA 3CJTA 1KBQA 1W9HA 4RKYA 1Z4OA 3SM9A 2H6EA 4DXAA 3HKDB 1K8ZB 3QVMA 1YE8A 3NM6B 2X85A 2NU8B 1T9AA 4JYPA 5I8PA 2C99A 2FGJA 2C7RA 3OZSA 4P26A 2GSWA 4R0NA 5AOVA 2TMGA 4L73A 1YIJB 4IXNA 5B6PA 1DAFA 1X0VA 4WZAA 3FTDA 4FSHA 1B8PA 2VCYA 3T1NA 5HKAA 1PZFA 4RSHA 2I6GA 1X0XA 1THTA 4KXLA 1P1KA 3GFVA 4ZOLB 3UHJA 3KK0A 1M6WA 3WLHA 2EARA 1RAFA 3E4CA 2WJ6A 3GFRA 3K9NA 4JVNA 3T06B 5IKOA 3U4DA 1IMOA 4PN3A 3R3UA 3U1VA 5DHFA 1E6WA 1NVBA 3D8HA 1F38A 2ZJZA 3HKBA 3LXUX 3OX3A 4NFHA 3CLVA 5B53A 3B36A 3UAGA 4IJUA 3BRWA 4C6TB 5C8VA 1U3UA 1JVSA 1YZ3A 2NSHA 2R86A 4V0RA 1G4UR 2IU4A 3VISA 1NDQA 1FPQA 2PUVA 2H4JA 2RHWA 1UQTA 2HLHA 1DC7A 1OTYA 3HBNA 1H6CA 2JIPA 5I9TA 3UQYS 1AUOA 2A9FA 3WISA 4WBNA 1XJ0A 2GLUA 5CVEA 3SSMA 3K6SB 2GK4A 4R5MA 3L8GA 3JQBA 2C2XA 1ZWKA 3K0FB 3LVQE 3NRBA 3OCVA 1XLWA 2F1MA 3GP5A 2WMOB 3TGWA 1CJSA 1QIFA 3AO0B 5IKPA 3ONEA 4S24A 1OXSC 2I55A 4PHGA 1XPOA 3M6VA 2Q5FA 1RZRA 1G5RA 3E53A 1Y9ZA 3HDYA 4KV9A 4MPTA 4L8WB 1V11B 5ECWA 1JAXA 3QFCA 3C5CA 4J0FA 1M0EA 5B7GA 3R0IA 4QUJA 4ZEOA 1WUTA 1NBMA 1T2NA 3E18A 1Z0DA 4INJA 3SLKA 4A2QA 1K89A 1L4EA 1OI7A 3UFXB 4EFLA 1V2HE 3RTCA 5DEIA 1GJRA 1M34B 1KC8D 3H6KA 2JIQA 1CDOA 4QFMA 3HA5A 3HCDA 2RHRA 4IRMA 4G65A 4N49A 1MEEA 2AN3A 3W7AA 4IKOA 3DDYA 2A84A 4OP1A 3ZNNA 2XGSA 3ZVRA 4ZZIA 4QYWA 3CH7A 2ZIUB 3N7AA 3KWMA 4LV6A 4S1OA 3SQWA 1WOOA 4WLOA 1CZOA 3C1TA 3E5RA 3OMWA 5A06A 4Y2JA 3QX7A 2J87A 5YASA 1J23A 3VMFA 1GVNB 1MH1A 3UA4A 3MUNA 1ZK3A 4G36A 1PEYA 2VHTA 4MGIR 1ZLYA 4QTTB 1BWRA 4IIXA 3P9PA 1L0BA 4R7TA 4S1NA 3VA7A 1PJAA 2QQEA 3Q88A 4ZAFA 5L3SB 1N8SA 1H1TA 3BTVA 3WBFA 2FY8A 4XIFA 1I4OA 3HYSA 4DY4A 2Q9CA 1PNOA 3N53A 1II8A 2XGGA 1UD8A 2BONA 3TKYA 1E43A 3H65A 3OEED 5BP7A 4TMZA 1FYWA 2OCAA 2RHBA 2V8BA 3H2HA 2XOKA 1RZVA 4Q1CA 2Z3ZA 1GGKA 5F77A 4Y2XA 9ABPA 4HPXB 1IBCA 1YZNA 3C70A 1G3MA 4G5XA 1Y9AA 4H6VA 5FAKA 4L95C 2IOYA 3UK1A 1SD1A 2PUAA 4ZVRA 2PFSA 1WSBA 1BOOA 2ECFA 4Q3KA 2RC5A 2BKUA 3U49A 3QU5A 4C7OB 3L1KA 3F4BA 1JYFA 2XAAA 3LE8A 4JITA 2GXUA 5ALMA 3DHVA 3FBWA 4D3ZA 3G0HA 2Q29A 1L4GA 3LUGA 2J85A 1DT5A 1XU9A 1V5GA 2AI1A 4EKGA 2PMWB 2G9RA 1NV9A 1V7ZA 1BGWA 5J9FA 1KEEB 3WE7A 2B61A 4E3ZA 2IZ1A 1DV1A 3L05A 3INYA 1DRVA 4F4FA 3KFXA 2OHVA 5JANA 1U7DA 4MA5A 2D4AA 1A9XB 1DAKA 4AXBA 3RIGA 1ESNA 5CU7A 2Y1KA 4J76A 3M4XA 3JQ7A 5K8TA 3HWX1 2GM4A 3IBSA 2PD6A 1KFJB 4HLDA 1X1QA 3AWDA 1JLMA 1SZPA 4AO8A 4EA8A 4GMKA 2PQ2A 2FUEA 3MOIA 2I9PA 2B3TA 2WF8A 2QTZA 1CFZA 1R5JA 4JL8A 1NUSA 3QIVA 4I9HA 5EXPA 2YV3A 1HH4A 1B23P 2CL5A 3JYLA 2BJVA 4WK6A 5E2IA 5IJAA 3RTAA 3SX4A 3OI7A 1XIVA 2PE3A 4AX8A 5HQJA 2IYVA 4B9EA 4BX9A 2F43B 2O3QA 2B36A 3LUJA 1RACA 4AVZA 3AVQA 3DPIA 3T7SA 5B7PA 1WDLA 1Z07A 3VKVA 3NHZA 4QLAA 3EUAA 3UWDA 2A5YB 3II6X 1Z36A 3N76A 4JGIA 4EDFA 1M10A 2UZIR 2AXNA 1UJ2A 4WNIA 3WGOA 3WNCA 1NGSA 5IZCC 1ZDMA 4FNMA 4KP7A 1CR0A 1J9ZA 1UFVA 4EUHA 1N9KA 3A7EA 3ONVA 5IBCA 4MQLA 1KYXA 1KQGA 3T3OA 4H7EA 5JD3A 5JSUA 5A6SB 3G88A 3ONYA 5JE8A 4B3MB 2OLJA 2W2XA 4NQRA 4IF6A 1TGVA 4YCBA 5E95A 3RRBA 4O2BB 4P7FA 4F2DA 5AW9A 4BRWA 3SBOA 5FWYA 4PXAA 4F4IA 1GZ3A 3TW8B 4HN2A 3F6PA 1P2GA 1W0JD 2OZLB 1D1QA 2LGJA 3UUGA 3R3HA 4OGLA 3T5GA 1C0KA 3A9WA 4GE0A 4TV9A 4RX1A 5JVDF 4R1SA 1IXSB 4Z7NB 1FVOA 3AW8A 4CV2A 1AD2A 1RLJA 1RWWA 2ABWA 5B6IA 3M5PA 2ZBQA 4LI0A 1QK4A 1QONA 1YC5A 1L5RA 2O3JA 4I6JA 1VQPB 3JR3A 3PUJA 2ZRAA 1ORIA 4IFBA 4OP3A 4TRJA 2DR2A 1TADA 1DQPA 1WVIA 1PFKA 3FFBA 4JBLA 1WMSA 1Y8RA 5BSTA 3U1BA 1K4KA 3L6RA 4OQXA 3NNSA 1JBEA 3SE0A 1SCIA 1GPJA 2N1MA 1XTTA 4TS4A 4LX8A 3I2IA 2HQRA 2WNHA 4XXHA 1IPHA 2O8CA 1ZJ5A 3I9NA 2OO7A 3C6MA 1IQ0A 3R0XA 4A0SA 1KI3A 1Q7YD 1JDBB 4TKUB 1TAQA 4COOA 1Z73A 4DR2B 2X8WA 1VFNA 3FTNA 3L92A 3MTEA 2BKVA 4Z1MD 4HAOA 1AC5A 1PQUA 2JB9A 4C01A 2P79A 3NJRA 3KQNA 4IGKA 4KLCA 1SM4A 1VJCA 2HUNA 1K4MA 2JD1A 3D5EA 3GLKA 4US0R 2FW1A 1P9NA 4RM0A 3I56B 3MMNA 1JVNA 3UVEA 3RPEA 1YQTA 1F17A 2Z5GA 3NTVA 4ARVA 4DSOA 3QY0A 5C52B 2ZUFA 3WWDA 4KE6A 3EW9A 4N6OA 2WWHA 4ZO9A 2OHFA 3OHSX 3SSNA 3WYCA 1KU6A 3TN7A 3W1EA 4EVRA 3E7PA 3GZ4A 4Q0MA 4QNNA 3KAKA 4RIHA 3TIXB 2ZIWB 1CKEA 2DBRA 3FAZA 1Z4KA 3UATA 5EIAA 3E35A 3UK0A 2O6LA 4CMEA 4FS3A 7REQB 2ZDGA 5JD5A 5CFMA 2AN1A 4G09A 3FLEA 5IJZA 1DDOA 1FTWA 4IEIA 3L9XA 4TN1A 1QANA 3ORRA 2H0RA 3G2NA 2I67A 4F6LA 5JEEA 1VECA 1TCUA 1ZUNB 3EPJA 1EUDA 4X8HA 1YZFA 1H3NA 1R3UA 1FFGA 2HJGA 3E1GA 3A1EA 3DLHA 2NADA 2QTFA 3HXTA 4HB2A 4NU0A 4BMCA 1ZUWA 5LYJA 3PUYA 3D8NA 1YS1X 4UEJA 2UZ1A 1KC3A 3TUZC 5JU6A 2D2FA 1Z8FA 1SUPA 4P6YA 3KC2A 3UOWA 3EGXA 1IG0A 3HNOA 2EJUA 1U9JA 1T0PA 2PG3A 1P5FA 2XE7A 1I4TD 3ZWMA 5FUBA 4PZLA 1UCFA 3CQ9A 2GJAA 2NO1A 2BE9A 2C7VA 3WMFA 2HJHA 3OJWA 1NTRA 2OV6A 2HQOA 4P7BA 1HF3A 3BN3A 4TM7A 3UBMA 1QO0A 2JLCA 4G0OA 2I71A 2YOGA 5A9TA 3SIWA 1PJBA 2ETXA 3SZGA 1FOEB 1KYZA 1XTVA 3MGCA 4EUSA 3GLRA 3L18A 3F96A 3M1YA 1A98A 3ZWOA 3L4KA 3N8NA 3MXTA 4DWOA 1Q1BA 5IYWA 3R7FA 4YYZA 2QZJA 2HXGA 2C4HA 3DBHA 3A2MA 5DPMA 3D3NA 4PAAA 4Q24A 4QA9A 3LL7A 4ZALA 4W7HA 1NYQA 4AMBA 2Z1DA 3SZOA 2IPAB 5A1TA 4X7MA 3Q5EA 4M9ZA 3P9XA 4KI0A 3RAGA 5LIRA 3QTBA 4IDFA 2NZ2A 3KV1A 2XNDD 4LYDA 3DWIA 4LS3A 4XD7A 1DI0A 1X38A 3FVRA 1I3NA 3P5BA 4E94A 4LE2A 5KW9A 1N2IA 2YXDA 3C8DA 4ZOQI 2H8KA 2QF7A 1MC8A 2PLNA 2Y6UA 2ORYA 1IXZA 4BMNA 1EHCA 1V3VA 2V03A 3A6DA 3VPSA 3BNWA 2H2AA 2PJDA 2VT6A 3EQZA 3LC2O 2PO5A 4MR8A 4OUDB 4Z1OA 4RTPA 4WUVA 4UU1A 1VQLB 5IX8A 4PX5A 2PGDA 1ID8A 3DAHA 5FWAA 4IQ4A 4BFTA 1FP4A 5T3UA 4XOUA 2QOEA 1D6SA 1Y1RA 1NKTA 2VC2B 3PQEA 4X00A 5CITA 1FEZA 3TTXA 1QDLB 3PEVA 3U9SA 1PBNA 1A5ZA 1CJCA 1SUAA 3CLUD 3N2NA 4WKNA 4GKAA 5F73A 1GUBA 2YV5A 2VQDA 1WMEA 3SQNA 4EMUA 3MBOA 1TYAE 1KOJA 3C6YA 1GDHA 3KEQA 2XUIA 2FI1A 3Q2IA 5CXXA 4CLOA 2J31A 3KPVA 1ST3A 1KTVA 3FPKA 1N4AA 1IXRC 1ND6A 2IXTA 3TRKA 1G8JA 3W04A 1GPDG 2HF7A 4RQAA 4YQFA 2G7MC 2GWRA 2FJ0A 4IUCS 4J0IA 3H2SA 4FYWA 1STOA 5C7IO 5K8UA 5HXBA 4Z4VA 5KEIA 1YULA 4D46A 3TZLA 1FFXB 1SGWA 1TJNA 4P98A 4MVJG 1RFGE 3EARA 1EK0A 1JSRA 3IE2A 4I5FA 4DJFC 3M34A 4HO1X 1B43A 3NOVA 3IAS6 2FFRA 2NXWA 4BQRA 1W36B 4YRGA 1G55A 4GNKA 3KPUA 5JZVA 4KTTE 2ENWA 5E6RA 5ALUA 3UV7A 2H1CA 2JJYA 1J5PA 2I3DA 2X15A 3MLBA 3AL3A 4GGPA 1GKIA 4EX6A 3BIOA 3BFXA 3LCVB 4TX1A 2K5UA 1RYBA 2IU3A 2JFPA 3K92A 3WQBA 4DC9A 4DQXA 2G25A 4FKMA 1KFBB 3H2IA 5T67A 4C78A 4DS3A 4UULA 1GSOA 1M33A 2ZPAA 3RADC 4ZOLF 2ZBPA 4RLSA 3KB6A 5EJ6A 4PPGA 2B3DA 4FFVA 2ZRLA 3AQ4A 3ZCQA 3B1XA 1YZUA 1Z13A 3R3WA 4TQGA 2CHQA 2YWRA 2ILTA 4JJAA 2FMTA 2PQ6A 3IBYA 3IMKA 2AH5A 1QCYA 1NXTA 4N6GA 1X42A 3BMCA 4OTZA 1B42A 1U8EA 1V6AA 1XCBA 2WP0A 3JWJA 3L4BC 5ITVA 4KQIA 3HC7A 2W2NA 3UT0A 3X2EA 3KXDA 1ENPA 3FOAA 5FUMA 4FXPA 2HA5A 2PJZA 4V1CA 5EZ6B 1H2WA 2WTBA 2DT5A 4M9XA 2OYRA 3WIDA 5GIOE 1JDBC 3G23A 4YP1A 3Q6IA 1S96A 2EQBA 4CKXA 5T41A 2XYPA 2YTZA 5B3JA 1M2EA 1NRKA 1GSAA 1NOJA 4GBJA 3R0QA 4Y6QA 3OQHA 2FW0A 3T7TA 3OPYA 1NW9B 1W2BB 4CQJA 4A16A 3QLJA 3HR8A 4QASA 3O9MA 4JUAA 3V2UA 3VU1A 1TAHA 5KB3A 3LDHA 3GLGB 3NHKA 1BW9A 1M0WA 1NU6A 1UT5A 1XZLA 1HYGA 2F2TA 3GCXA 1QQ6A 4TTIA 1EM8A 4FQ5A 2NNLD 3SCZA 4NOLA 4YT5A 3MB5A 5GM1A 4RGQA 1QX3A 5REQA 5TS2A 5T64A 2C58A 2BM9A 1GTG1 5I47A 5CD1A 5J5CA 4F1JA 2NZWA 1VJSA 3COZA 4HDRA 4M7PA 4QG3A 1ORWA 4HDQB 1E9BA 3IEXA 3UJPA 3BSYA 4JR2A 4ZVSA 1RKXA 3CCQB 1Q44A 2YWGA 3GMIA 2Z9DA 3AFNA 3CISA 3IJEB 3BD7A 3OEYA 3KUKA 1BC5A 2RHCA 4R54A 5LUBA 3RYHA 1YS9A 5JSQA 4X90A 3WLLA 1MHTA 2VYVD 3JZAA 1PZHA 1XQ6A 3QVGB 4I50A 1L5FA 1QGUA 1RAIA 4JB8A 2PUFA 3RIEA 4BX2A 3AEXA 3R6KA 4XRRA 5HIKA 2XVYA 1OD6A 1UXGA 2GBLA 4XB2A 4ZDWA 1BN7A 1WHSB 4ADSG 1Y1QA 3ISVA 1X7YA 1GQOA 4G4SP 4YAIA 1DUSA 4YP5A 3OICA 3LCJA 1YA4A 3LA6A 2I29A 1U1CA 4HY3A 1T3SA 4WZAE 1CR4A 1CJMA 2Q8PA 3H2GA 3MYYA 3AF5A 2DVMA 2IU6A 3V4SA 1FFAA 3TAUA 5FDFA 1CUYA 1YQUA 4FGWA 2FZCA 1X70A 3M1IA 1N3YA 2ZXIA 1P2VA 2OM6A 1SPXA 1ZKDA 4PPNA 5E1OA 2VWGA 1OGYA 3MWEA 4I08A 3FFWA 2Y67A 1PYOA 3IA2A 4E4TA 4MDEA 3STUA 4I3FA 5F5LA 2VZ0A 1R5BA 3GBVA 3A1VA 4R8LA 3KQUA 2SHKA 3HCBA 1HWYA 1Z4PX 2D1YA 1E3ZA 3RSSA 1QC5A 3IAXA 4XOIA 4EO7A 4ZDJA 5C1PA 1ULSA 2EKBA 4WGGA 5DBHX 1B73A 1M7GA 3KQPA 5EESA 4JI6B 4CEJB 4K9RA 3DE1X 2I0FA 4ES6A 2OQRA 3E3MA 2I4MA 2B99A 3BDAA 4MCAA 2G9QA 3K2QA 4RKWA 3NGXA 4IQGA 3V4PB 1NONA 2FJUA 2LDXA 1KDRA 4QARA 3DVLA 3D54D 2WA2A 3VHLB 4DABA 4EMBA 3KQHA 1FUEA 3GNTA 2HA6A 1NVEA 3MT9A 2YN0A 4FMDB 4KZKA 1HDEA 3URMA 4DLKA 4UW9A 1G0NA 4YUYA 4NYMR 2JC3A 4EUNA 4RY2A 1M8GA 2O50A 2VCHA 5ALXA 1YQGA 3WJ1A 4TXMA 3OZWA 4ZYUA 3AEUB 1LBHA 2ISSD 3AEKB 3STYA 5DI3A 1EFHA 2UV8A 2HDNB 2QYHA 4UCFA 1E2PA 2FW9A 2ZWAA 3PU6A 1U0HC 4P5PA 2EWVA 1RJFA 2J3QA 1PFVA 2A7QA 5AKKA 3CTPA 5AKJA 1E1YA 1UT8A 2Y1LA 2Z6BD 5F3RA 1OBVA 5LA6B 3ILHA 3GNQA 3VC7A 1MU0A 3WA6A 3HO6A 4KUEA 3IESA 4IRUB 3VVLA 3U5ZB 2X8JB 1AQYA 5I7SA 1UBNA 2M6LA 3FRJA 1YJ5A 4UBIA 1CZRA 1OFIA 5DCWA 1KKLA 1F8XA 5JROA 1XVUA 1EHIA 1FQOA 2NQTA 5HFJA 3V3KA 5FPQA 4AUKA 1VL1A 1GUAA 1R64A 2J4FA 2YXLA 1RE0A 2FOLA 2WYIA 3HADA 4O2BF 1ZNYA 1O94A 4MW4A 1TIPA 3EPPA 4P32A 3LP5A 3VQTA 1C81A 2GFIA 3V6MA 2WZBA 4LRUA 4GKVA 1Q83A 2BUAA 2DSTA 2AR0A 3K0AA 1FRNA 2EAUA 3HZHA 5K0NA 3AR3A 6Q21A 2QG4A 4BYMA 4HNAB 4CI0B 1G98A 3H5IA 4GXRA 5AJXA 2GGSA 2JCYA 2L18A 1YNOA 2KM1A 5FJIA 1DX9A 1U4OA 4ZCRA 1TQ8A 1ODJA 3GA5A 4X6UA 3O4RA 2B2NA 3FM9A 2AZ4A 1NA5A 1W36C 4PAWA 2JGNA 3OOJA 4QPNA 4BQSA 3S28A 1IATA 3TRHA 3RYCA 1LS1A 3FMVA 2QORA 3VYSB 2WY2D 3TMKA 4ZC8A 5C3UA 4A6EA 2R7KA 3PJRA 1QO7A 1OT3A 3NCHA 4AWBA 4DOMA 3HK2A 2VDQB 2WWRA 1BMQA 2XDWA 1E2DA 1UMBA 4E46A 2GYWA 1UBUS 5LNK1 2L82A 3KVOA 4WESB 1D3AA 2HK8A 3MD0A 4OU5A 4AMVA 2O1SA 1KWKA 1XZGA 3J80A 5F64A 1FJXA 5K0SA 3GOHA 4JKYA 1ZM4A 1E63A 1QB7A 1U3VA 2XOXA 3O6VA 2C2ZA 4KDFA 1EFRA 4MS4A 4HT3B 3PXAA 4ZT5A 4ENWA 1M1NA 1PDOA 4GFDA 2UVDA 3KEFA 1ZUHA 4UVGA 3EISA 1UPAA 2JBAB 4G9EA 1IBKB 1RNLA 3KAQA 5CX1A 3WB1A 5ES3A 4BNZA 3TR6A 2QRHA 2OO5C 1MABA 1N9GB 2I6UA 4OXKA 1NOIA 3SC2B 4GSKA 5JQWA 3TKAA 1IOWA 2I62A 4CG0A 1J1ZA 1NUTA 3FSEA 3HB1A 3OZXA 3QVSA 4NPCA 2V55B 4DB2A 2YW9A 2VPPA 3ZHUA 1VLMA 4KO2S 3PGMA 4CCYA 1GQYA 1Z12A 1MA3A 1F0NA 4RVGA 1WOPA 2AMLA 3F2VA 3R4VA 4RA6A 4F46A 2CHFA 2XQIA 4L9RA 3RS0A 4NU8X 2R1VA 5MFPA 3D31A 1YJCA 3HB4X 3OJ0A 2FPGB 1ZJJA 2XUQA 4P8RA 2PX8A 4K46A 2VHZA 2ZYGA 4NCXA 4F1WA 3VSEA 2V1UA 1R4NA 1IPEA 5B58T 3T3GA 4KSBA 2O1EA 4M99A 5KJ1A 1EHYA 3DHWC 1OWNA 5DYWA 4ZO7A 2BF4A 3K20A 3QHQA 1BLIA 2E1BA 1UWVA 5AI0A 5CFOA 3ZHZA 2F62A 2GJRA 4C21A 4XL9A 4H7KA 1OX4A 4P86A 2JDIA 3K32A 4RAQA 1XD2B 3GHHA 3OJCA 1LSUA 3A32A 3ILXA 3CF2A 4U7JA 4XX0B 3ZBUA 1AB5A 1N1MA 1E1QD 1QZ3A 1J6UA 3P2JA 3ZWPA 2ZUVA 4DB4A 4FMPA 2HW8A 3O4FA 4HWGA 5D5QA 3UXYA 2WJAA 5JAIA 1A2BA 2DWOA 4ND1A 4CV0A 4EHFA 1KNXA 1VKRA 1WZ2A 1CXZA 2IL1A 1M2VA 2V74B 4OLJA 5F51A 3U4MA 2HBRA 4OFWA 1NUPA 5E6UA 1SUIA 2V4DA 2VR1A 4C05A 5JIBA 2GZ1A 2Z0MA 3F6EX 5EIBD 2WWYA 4EI7A 2J9YB 3CNLA 1RQLA 4QJ3A 5J43A 2CKDA 2HTEA 3LC1O 1UBEA 2BCEA 1WPXA 3FSGD 3T7JA 3ZQKA 4CV1A 3EIUA 1XDZA 1KO8A 4Q5IA 1QF6A 4TKVA 3MRXA 1PT5A 2RH8A 2QGZA 4WCFB 1JLLB 4F2WA 1L4MA 3VDQA 2Q7XA 4RKRA 4HX2A 4QO7A 3JW8A 3GPLA 3L06A 5MHTA 3I61A 2Q3MA 3ZNOA 2AUMA 3HNRA 5G2OA 1WW2A 3VTFA 4PG8A 2ZI5A 2ZTVA 5DNYB 1SUWA 4LRXA 4QQRA 2O8EA 1QWOA 3FLMA 3JY6A 4FFBA 4EJ0A 2IEBA 3ODPA 3WGYA 3UCEA 2REQA 3N6RA 1NRJB 3U13A 4Y6GB 4DQVA 1ZM2A 3LZ6A 4N65A 2PTHA 5HKOA 2FW8A 3U4QA 3UWKA 1DKNA 2DPHA 5JJLA 3H9BA 2ILVA 2OHJA 4EY6A 2XZDA 4AJ1A 3KSAC 5ICCA 2EZ9A 3H11A 3JQAD 2PSDA 2NQ2C 3WJ7A 4YFVA 4C04A 1C3EA 2A1UB 3W79A 2CCKA 5KCMA 1B8VA 2E37A 1YF3A 4JKOA 3H5AA 2Y1XA 1XZIA 1OZ0A 1Q0ZA 2VTBA 2FX5A 4JUDX 5TB5A 2DQZA 4UU8A 2XA2A 3O3OB 4JLOA 4MEBA 4BO4A 4E33A 4M36A 4P82A 3W5DA 2HMVA 1EZ4A 2R8ZA 3HL0A 3TLMA 3VR5D 2VOJA 2VDPB 4OJTA 4AB1A 3VKGA 1RYDA 2XV1A 3OOSA 1AA6A 3KR1A 1BCSB 3CF4G 3FDZB 2C54A 4WLFA 3ZS9A 4EL5A 2UKDA 2VZEA 1NNI1 2DUNA 3RU2A 3SI7A 3KB2A 3VNRA 4DLTA 1RVDA 1FBTA 3C5HA 3Q7SA 3RJTA 2YZNA 3S8EA 3HKDA 5KQLA 3CCUB 2BEKA 1PQYA 2I4NA 1JNYA 3JVIA 4JJ8A 1GTMA 2NU8A 4Q1BA 3FPGA 5DTRA 2QJFA 1L4BA 2CHUA 2ZJ1A 2J3EA 1W9XA 4XJSA 3EPKA 1PK9A 3JWHA 2RGCA 4E5DA 4RSGA 3GH1A 3WNZA 2G67A 3JSAA 4DTCA 1AZWA 1Q50A 2AX3A 3V8QA 2JJ1A 4Q3OA 1FBNA 2D0DA 5ILQA 4D92A 4EJMA 3AY7A 3B5JA 5KYGA 1D7OA 2FWRA 1B2LA 3AFMA 2X9LA 4UUNA 3ZXUB 2BZ1A 2WUGA 2ODEA 2Z2KA 1CF2O 4B17A 2B1QA 3WYBA 4C3OB 3RQIA 3SVTA 4ZAGA 4L6CA 3RVPA 2ZPUA 3PWKA 3PP8A 3N2IA 2I22A 1G291 4C6TA 4DWVA 1MPXA 3GJ6A 1GNQA 1QX4A 3ZQJA 4Z4YA 1QQTA 1YXMA 3IMFA 4QC2A 3LRPA 4UCQA 2RHGB 3D6UA 1Y81A 4WZZA 3OLQA 2FAXA 3W8NA 4G1MB 3T1HB 4Y1FA 1X7DA 2G88A 3DOFA 1GNSA 2X6RA 4FYKA 3AVUA 1FYEA 4LXIA 4O4LA 2EGHA 4TXJA 5L8VA 3IP5A 3ADBA 2W83A 3U2QA 2ZDHA 4TYQA 1DFIA 4ZK6A 1UJMA 2WFLA 4CKYA 2ID9A 2RHJA 1TVMA 1KDZA 1QG2A 3DQZA 2ERXA 1TLLA 3S1LA 4EGQA 4AQ7A 5EE9A 2RB5A 3LTEA 2HEGA 2ZAYA 1UMDB 3OIGA 3D7NA 3IT0A 1T43A 1SZCA 5EERA 5K3OA 2XYGA 2NPFA 1REQB 3UFXA 2F64A 1QTRA 2RHDA 4POAA 5ECYA 3QXGA 2DQ4A 4HTFA 2ZUWA 5NULA 4YLGA 4QKQA 4M4SA 1E9CA 3MLEA 4E07A 4G2TA 1G21A 4KXVA 2ZRFA 3UXMA 4BLSA 4B3GA 3HN6A 4LMAA 3EYAA 3WLQA 3B7GA 4PHFA 4JBGA 4QREA 1UBCA 2YN2A 4KXXA 1C1XA 1V4VA 1YONA 1FUIA 1V3QE 1YHYA 5AMXA 3PUNA 4Z4SA 3IBFA 3ZWBA 5EVJA 2ODWA 3AEZA 3MUEA 1GUDA 2DC1A 4FNAA 1QLHA 4LXXA 3QEKA 4ND6A 1J99A 1N5OX 4Q34A 3PNMA 5CNMA 3KNZA 3HUUA 3HVHA 4JAVC 3ZE7A 5L3SA 1OH5A 3QPUA 4F97A 2FZKA 5I7VA 4RADA 5JTTA 2JH9A 4CHGA 3LLSA 2AYXA 4MZDA 2CLLB 2QW1A 1OIVA 2R2GA 3LLMA 4D80A 4H2DA 3LV8A 3T9FA 3G2HA 2BEWA 2HBZA 2WIDA 2WG1A 1QVRA 1DXYA 3VR5H 1EUYA 4YELA 3HXMA 4PTYA 4IUBS 2XJ9A 2IZOA 4UOEA 1HMYA 4RM3A 4J91A 1SHTX 4P7KA 3DCJA 5DHAA 2R8RA 1P60A 1GQRA 3ZX4A 3U7HB 2UXCB 2EIHA 2CLEB 1HBJA 4H7IA 4A1FA 3W06A 2ZQYA 1BGVA 3ADDA 1YJQA 2YL2A 1KK3A 1T2AA 3FHTA 3ZH9B 4EMSA 4LTNA 4QDUA 3FTEA 4Y9TA 1MQSA 3BMNA 4TXLA 4FK8A 1E96A 5DDIP 3A25A 4I19A 3JQFC 5NLLA 1ONOA 3DFZA 3IBCA 1J7KA 2PBZA 2VAPA 4IINA 5FPHA 3E8SA 5F98A 3UOGA 2W98A 3WMGA 4NCHA 3KP1A 1A9TA 1EJ0A 5JYDA 4WEOA 5E7JA 4IIHA 3G89A 5K0BA 1U8TA 4MCIA 1ADJA 1HQCA 5COQA 5D7BA 2RHHA 2GBGA 1DCMA 4ZYTA 3D81A 3GGJA 4BS9A 1GDDA 1V45E 2MTBA 2ZIFA 3IOEA 4FMDF 4HXEB 3WAGA 3OH8A 1TA4A 3BS4A 4M9QA 1NBHA 3KL4A 3MS2A 4Z9FA 2VHCA 3CZPA 4WCFC 1RQNA 4OYRA 1GGMA 1VLHA 2IHBA 3KKPA 1M5TA 2BM8A 3D4NA 2F43A 4MGKR 2IUFA 3M6LA 3G0DA 5IN5A 3MIZA 3RU9A 1TZCA 3TYXA 1KEVA 3IUMA 4J0GA 1KQOA 2RHTA 3K9LA 2FH5B 1UZAA 4IOJA 5DHSA 1P81A 1RLMA 4FYHA 4UATA 4CUJA 1WZUA 3DOCA 1IN8A 5KU7A 1FFHA 4F85A 4N0EA 2F00A 3T53B 2FN9A 4DDVA 3AR8A 5LA6F 4MDHA 2XTNA 4GM4A 5A6SA 4IZ6A 5JJCA 3RVLA 5EKDA 4IYRA 3HCCA 4IVPA 4YMIA 4B5KA 1WTHD 1NVKA 1J1UA 2GK3A 2PY6A 4JXXA 3DEJA 1QHHA 1HY3A 1R27A 2VNAA 3GQBA 1JJ2B 3DA8A 1Q16A 2IPNA 4MW7A 5FUQA 4BVKA 3BAFA 1Q91A 1UK9A 3ONUA 2CUKA 2FRDA 3W8EA 4K0RA 1G18A 3B6JA 4MUYA 4LDNA 4YI5A 2WD7B 2UZ4A 4KVAA 4ID9A 4Z4QA 3OP4A 3RCBA 1T1IA 4CUKA 1VSBA 3DE4X 4EFNA 4X93A 3SEJA 1KMHB 1Z5ZA 1BRTA 2JCBA 4XN0A 2R7AA 4BLVA 1ZISA 2X0JA 3L4BA 1JR6A 3BEOA 5FA5A 4WXPA 1AKWA 3LUDA 3P1JA 1ESMA 5FBKA 4DK1A 4Q3NA 1HKHA 2WOOA 3I2YX 1N25A 1FYDA 3T3EA 4RU1A 2C57A 3M6AA 2NU7B 2CXQA 2Z2YA 1IY1A 3PNOA 1Z83A 2VO1A 4PYJA 4D4LA 1U8CB 2JGFA 5AW5A 2ZM5A 1ADFA 1UC5B 3HUTA 4XLLA 4L0QA 5CJPA 3ZJYA 5KPJA 1NW8A 1L5OA 2PGAA 3F1LA 1N5JA 3UAWA 2H59A 3U09A 3NH9A 4INAA 3K8OE 1QORA 4E6PA 4H4EA 1GKUB 3EBOA 1LY1A 1XD8A 2BZSA 2CB0A 1Q95A 1XZAA 3R6LA 4IWNA 2JGDA 3N6XA 1A8IA 1VE7A 2XGJA 1PNRA 3DULA 1KJWA 1ATZA 2YHIA 3LYHA 2NT3A 4MO2A 4E11A 4URHA 3PUZA 1LK7A 3CE6A 1XFDA 1A82A 3DMYA 4C0WA 2WWWA 2CJYA 3WKAA 1BVYF 2JGMA 2Q3FA 4BTEA 3N5CA 3CM0A 1NXOA 4WWVA 1GV0A 1YUMA 4B6OA 5FYQA 4ER5A 4JI4B 1GOTA 4BGEA 2XDAA 4A7PA 4YIHA 2VJMB 1JU9A 2X4LA 2GREA 3VO1A 1ESCA 1H2FA 3EBLA 3O8QA 4C89A 1K97A 4XN3A 4FFSA 4HRXA 5BR8B 1E1RD 1EE9A 2FX2A 2C9MA 2GB4A 5DM0A 2ZL5A 1FDIA 2NPOA 3V9PA 4M22A 1CSEE 1FZQA 2B4RO 2HA4A 4QYSA 1C9JA 1CZHA 3C16C 4LOAA 1FFEA 2REBA 3FNGA 3EIQA 1Z37A 2QN9A 2VJIA 4NLLA 4O8ZA 3X2SA 2BELA 3HCWA 3LBAA 3HRHA 4AZWA 5B1EA 4JP2A 3I30X 5B3KA 4B3CA 4ER6A 1RXUA 2Q0QA 3VJKA 1S2LA 5B7NA 1KQFA 1K73D 1EINA 3WDSA 3D0KA 2VXCA 5DB4A 1HE8B 3T4PA 2PX3A 1ZINA 3DOUA 1DP4A 4MJ7A 1ESZA 4HN9A 4I9GA 4MW1A 2XT0A 4P12A 1OXVA 4EPTA 4F8JA 2JGLA 4HNVA 4ZVQA 1KZ6A 3KTOA 1E8DA 1LLQA 2XQJA 1Y34E 3B8HA 1ZRSA 1OJ7A 4ME6A 4ENTA 2AFIB 4DUGA 2GEBA 2AGVA 3RSFA 1C0IA 2UAGA 4WZBB 1IDN1 5G0TA 3U3ZA 4QFBA 3BVPA 4PSVA 1NIJA 2Z8XA 8ABPA 3RUAA 1U6IA 3EZ7A 3OWOA 5DLQC 1AG9A 1NN3A 2VHJA 2FSHA 2Z9BA 3OOCA 3EDQA 3ZQ6A 1VJDA 1XCPA 2W43A 2XCUA 4L5IA 3C48A 2BGTA 5G0VA 4Y1GA 1YVEI 4DR5B 3LOPA 3DTTA 5AKLA 5AD1A 4KKVA 1VYTA 3QPWA 2BFOA 1PTJC 4IZIA 3UT6A 4C06A 3WLPA 5BMVA 3UPTA 1NVFA 1H1LA 2XPCA 2B37A 3DP9A 3IKLA 1T0BA 2O06A 3PHLA 3W3ZB 2ZT6A 2BGUA 4FYVA 5KNBA 4OUDA 1AK9A 3BC9A 4GOND 1U3CA 4EG1A 2O7VA 2WEKA 3N7UA 3CIOA 2PE5A 2HMYB 1K08A 3L7LA 4UASA 1LLUA 3S2FA 1C3JA 1D6JA 2QUJA 3PE4A 3WK9A 4R1LA 1AO0A 2GPNA 2R5FA 1QB8A 3K94A 3REQA 2IZ5A 2WW8A 3E82A 1KK0A 2BHNA 4M98A 1AHPA 2C4KA 4HXGA 3H4TA 2IPLA 5AJHA 1E0KA 1VI6A 3I42A 4TTRA 1B3RA 4OV6B 2RK4A 5A7GA 2NUBA 3OF5A 5IMSA 3BWCA 4RHFA 1GGEA 3GLHA 2WAAA 2X0DA 1U7PA 3J81k 2YFYA 4KXFB 5AI8A 1E9FA 1JFRA 4GM1A 4KI7A 1HG0A 4WX2B 1JDSA 2VWPA 5ITZA 3W5IA 1ZK0A 1E1CA 3G79A 4A82A 4B6PA 3ZWDA 5FUXA 1K5HA 4HB0A 3I83A 3ZV5A 2HIAA 1FNSA 2ANBA 3E2MA 3O4VA 3MCAA 4PC6A 3T9DA 1FFXA 3H5RA 5FBRB 1EFVA 4JKIA 4PZZA 3AHIA 3TJZA 3ZIAD 4TSKA 4KBGA 2IRWA 1N36B 2B6HA 4RGYA 1Z47A 3E61A 5H83A 2ZJ5A 2HPVA 1SXJD 2JHFA 3PDIB 5K0JA 1H9BA 2VBVA 1AKEA 2V3WA 1ZLXA 4JI7B 3QFHA 3F9RA 3P9SA 1NJ6A 4FYPA 1FYVA 1E8MA 3QW2A 5GPBA 5EHXA 2XTZA 4GEGA 3P19A 4J2OA 5F4JA 2PS0A 1J22A 4YBZA 1TJPB 5JBIA 2BLLA 1X14A 1UOEA 3AF1A 4JOCA 3B1ZA 3SQDA 4ZC1A 5KHOC 4M9UA 3RO7A 2XUGA 4BEJA 1JL3A 3VR2D 5TC4A 3KJZA 1VRWA 2J5XA 2Q2OA 1L9KA 4QQKA 1X1AA 4YCLA 4ZJZA 3RT1A 5KOYA 3ORHA 1CTQA 2A5FA 1JPUA 1OTHA 3BKXA 3I1IA 4GPZA 4BFVA 3D7RA 1U8ZA 4DR4B 2YXPX 2XF2A 5KTTA 3LHKA 1F8FA 1ZIOA 3ODGA 4NJMB 4U5QA 5HGXA 1WTAA 3WTBA 5D1HA 1Z06A 2CMGA 1Z4MA 2C29D 1J21A 3JQ8B 4MWEA 5HBRA 4CIYA 2FZ5A 1YBMA 4NCIA 5HJ7A 2XUFA 2X4DA 1UKVY 1T5LA 4E08A 3RUPA 5JYBA 3C7DB 2H17A 4EB8A 1APBA 5TT0A 4QQ8A 3ZGYA 2XRZA 4GI2A 4P0TA 1CE8A 4IDPA 1WBJB 1JDVA 2Y1FA 2JAOA 3PC8C 4OK3A 3RS5A 3GT3A 5IDXA 2E4ZA 3N2GA 3K35A 2H5EA 3VDRA 4BFUA 1USWA 2BEJA 2HO5A 4R3WA 3IAM6 4XJTA 4ZRDA 1L8OA 1BXZA 1DKPA 4LJ8A 3C3EA 2PLAA 1NB9A 2PH7A 3EH2A 5C5CA 4QV2A 1VQ9B 1QHEA 1ZSYA 2WT9A 2XUPA 1ZH0A 4D1YA 2ICAA 1ST2A 1LTQA 2A8YA 1ZNZA 4IMIB 3QYAA 1QAQA 2I78A 1JQDA 2IEIA 2UYQA 4JBIA 1JR4A 2ZE8A 4BQQA 1CJUC 3MJFA 2XRMA 4K40A 4AW9A 5AW0A 3BXXA 5FEUA 3SLRA 2PUTA 4MRVA 3AUAA 1YC2A 5A9SB 1T0IA 2CXPA 1JPVA 4ZIRB 3UMCA 1YJAA 4L2IB 5J4YA 3VPXA 4A8JA 3ZXYA 5FBVB 1A96A 1RXSA 3LUCA 1OBCA 3FWNA 2R7NA 4LE0A 4NMWA 4KFRA 1RI4A 1L4UA 2GILA 3QKWA 4KO4S 3SSOA 5BORA 4XI9A 2BSAA 1W0CA 2NYRA 3DDZX 2Y9MB 1U5AA 3CEMA 3EXIB 5ALZA 4LYHA 1LBQA 3U4CA 2IS6A 1ZN7A 5F4MA 1YASA 2OWDA 3PIRA 2FXIA 1KDTA 3BGVA 3A8TA 5DTJA 5A3JA 4ZO4A 3A1SA 4OMUA 4ARAA 2NTNA 4GD3Q 2V58A 1OASA 2P0AA 2XNSA 5I7RA 2QDKA 3T7CA 1DS6A 2G4VA 3T5PA 1MX1A 2LD4A 3I37X 1RAEA 1Z6GA 3ES9A 2XHEA 1GEGA 3JQ9C 2WAMA 1VCHA 4NXNB 4CLOB 3DEAA 5B55A 4L08A 4D3DA 3DW1X 3ADKA 4O1IA 1RCTE 4XGIA 1WHTB 4D4MA 3A8IA 4JMLA 4GR9A 4EFMA 5CNJA 2DUUA 2NSLA 3ZTTA 2OG1A 4J90A 1ZGAA 1K7XB 3RROA 4H1WA 4I1PA 2P90A 4ZODA 3GEDA 4AUMA 1RHRA 3E9QA 1OB5A 1DQZA 2P2GA 3B7WA 5BN3B 5BUZA 2OV1A 3SOPA 3VJMA 2PX6A 2X42A 2IYFA 3V7NA 1ISFA 1G2PA 2O1XA 2P3QA 1EFTA 5TQVA 4DMCA 2X3YA 3N8IA 1G3IA 2HMSA 2HQ1A 4UEKA 5DXJA 3PUKA 2C03A 4J0CA 3HM9A 3FRHA 1CG6A 2F1KA 1IHUA 2YNMC 2RI1A 3K31A 1O97C 4ETIA 2XWSA 5F9HA 3AEUA 4YVFA 3L8YA 1ZYUA 1QH1B 1EP2B 2DUWA 1GU0A 5JUWA 1NRXA 5EHZA 2W2LA 5CT9A 2J0VA 3GRRA 3MJSA 2XDYA 3FB4A 3DPSA 1R8YA 5AVUA 3G05A 4X7RA 5FHRA 1JEQA 1QQ7A 3PL1A 4R6WA 4CN9A 2PLRA 4A91A 1OXTA 1G21E 1VIVA 2HA7A 2HNBA 4HBGA 3NKLA 1JHQA 2P4EA 2IF2A 3FYSA 1DEAA 1KRWA 2C3OA 2QZ4A 3L7OA 4MMZB 4TTJA 5JS2A 4I1OA 4ER0A 2WKQA 4X54A 3VHQA 5JW6A 2H31A 1LF0A 2FJPA 1FMJA 2GCNA 2X8JA 3EXHA 3VGJA 5CEJA 4JROA 1U7ZA 4P83A 3BGDA 4IKEA 4X1YB 1TUIA 1XZCA 2FQWA 5C32A 4QU5A 3M1LA 2JGAA 3IH5A 1CQJB 1M5UA 4H1VA 4WACA 4MNTA 4R81A 1DZIA 3N59A 4Q37A 2I2WA 4ALNA 2VSQA 1Y6QA 3U3KA 1T9ZA 1EVKA 3KKLA 4DM3A 3O47A 3OKXA 4EHNA 2E6KA 2JLVA 1QE0A 2D5LA 3CUWA 4EYKA 1N7GA 1NPDA 1PV1A 5EXXA 1JR2A 4EKYA 2VSFA 3HQ4O 1O95D 4K3UA 4OYLA 4MOWA 5KNCH 1AQUA 1VBMA 3TO5A 4CKCB 4HNAA 5IS2A 3TBKA 2TMDA 2ZSFA 1PWZA 3GIWA 1FSZA 3H83A 2FZLA 3ZWXA 3E4DA 3WO1A 3G4SB 3WP0A 3LUKA 4I1VA 4QYMA 1EFLA 1GLGA 1KFCB 1N0VC 1UJCA 1NUUA 5ELXA 3IHWA 3RS9A 3F6CA 1UR5A 2Y71A 2ZXUA 4IICA 4YXFA 2QLTA 1K0FA 2YYSA 1NWCA 1ZZEA 4V38A 3QHPA 5LDHA 4CMKA 4XNFA 4BMZA 4FLEA 2AQ8A 4BNDB 5AHWA 1K5GA 4L4SA 1ZOSA 2GWHA 1BX3A 3BL5A 2UYCA 1ZN9A 1YTUA 4KQ2A 3VYRB 1Y8CA 2FUG6 3ASUA 5JY1A 3O8LA 2QLBA 3RH0A 3D3EA 2UXDB 3PPWA 4QHSA 2XCSB 1NYRA 1R0BA 4AUEA 1J2RA 1NT2A 5AK6A 2HAEA 5KKNB 1Y8QB 1EM6A 5IU6A 3L6CA 2CCJA 1KY2A 1E7RA 4QYIA