2XNCA

Crystal structure of an engineered ferredoxin nadp reductase (fnr) from pisum sativum
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
287
structure length
287
Chain Sequence
SKKQDENIVVNKFKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGIVPDGIDKNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRVPDGVCSNFLCDLKPGSEVKITGPVGKEMLMPKDPNATVIMLGTGTGIAPFRSFLWKMFFEKHEDYQFNGLAWLFLGVPTSSSLLYKEEFEKMKEKAPENFRLDFAVSREQVNDKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSLAAKDGIDWIEYKRTLKKAEQWNVEVYW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN--NADP REDUCTASE, LEAF ISOZYME, CHLOROPLASTIC
publication title Swapping Fad Binding Motifs between Plastidic and Bacterial Ferredoxin-Nadp(H) Reductases.
pubmed doi rcsb
source organism Pisum sativum
molecule tags Oxidoreductase
total genus 92
structure length 287
sequence length 287
chains with identical sequence B
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2010-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2xncA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2xncA02
3G4SB 2ZITA 2C78A 2YWEA 1DDGA 4RD6A 5AN9A 2DEUA 1E62A 3U6BA 1KK1A 4RJLA 1W2BB 1B2RA 1GVHA 5TR9A 2BV3A 1EFTA 1G7TA 2RC6A 4LC0A 3SJZA 1VQ8B 4U9UA 4AF6A 3W2IA 4C0SA 2HMAA 3P27A 2OTJB 3OJXA 2OK8A 4YAUA 2BVNA 3CMEB 1YJWB 3CCJB 3WNDA 1VQ5B 4TN1A 2CNDA 1J9ZA 1GO2A 4H9GA 3AVUA 3WYAA 2PMDA 3WNBA 1WDTA 2OTLB 5TY0A 1ZM4A 4G1VA 4YAWA 1QVFB 4B3XA 4ZGNB 2D74A 2R6HA 1JA1A 1CNFA 2OK7A 3B8HA 4F7DA 1OGIA 1IJFA 1EXMA 4M0LA 1Q82D 4PC3A 1ZM3A 1JB9A 1QGZA 1M90D 3CRZA 2E1RA 2GPJA 1KK0A 5DSZA 1R5NA 2PLFA 2NPFA 1G7RA 1E63A 3JQRA 1TUIA 1XE1A 1NJID 4LBVA 3WBKA 3J81k 4HE6A 4FN5A 1U2RA 3AGQA 4IW3B 1EWYA 3CCUB 1SKQA 1YI2B 4AF7A 3CB4A 1JJ2B 3MHPA 3B82A 4QFMA 1QH0A 3PENA 3JQPA 3ZZUA 2B5OA 3G71B 2QMUA 3W2FA 2PIAA 4ZV4A 4AC9A 2VZLA 3FJOA 1D2EA 2AHOA 4YALA 3CCEB 4WQMA 1H85A 4P3YA 4N3GA 1KK2A 1Q7YD 3QFSA 1ELOA 4TMTA 3CCMB 3AVXA 3VNUA 3OZUA 4G1BA 3ZBTA 1KJZA 1NDHA 2BSAA 4RD1A 2QTLA 2BGIA 4B48A 2HDNB 2QN6A 1ZM9A 3AVWA 1K9MD 1SM4A 3VMFA 3CCQB 4J0QA 4P6VF 1EFUA 4PC1A 1YIJB 4C43A 4FWTA 1QG0A 3OW2B 3VO2A 4LBWA 1VQ7B 2GQFA 3FPKA 1B23P 1UMKA 1F20A 1TTTA 1BJKA 4TMWA 4B44A 3LVBA 3LRXA 1BX1A 3ZZ0A 1Q81D 5EMNA 2YWHA 1VQKB 4ACBA 1AIPA 4MYUA 3ZBUA 3MMPA 4Y9RA 4ZCLA 2QTZA 3WY9A 1EP2B 4PGOA 4TMXA 1QGAA 3CCVB 5GV7A 4TMVA 1VQPB 3OJWA 4RCZA 2QDXA 3W2HA 1ZUNB 3W5UA 2CRVA 3I55B 1VQMB 2QA4B 5HXBA 3WBJA 2B7BA 3W5VA 3OZVA 2BPOA 3W2GA 1TVCA 3WNCA 1KK3A 4Y9UA 4ZCIA 3CCRB 1EP3B 4M1KA 3I1FA 5H5JA 1OB5A 2BN4A 1D8TA 2YWGA 1S0UA 2XNJA 2VNKA 4B4DA 1FNBA 4B43A 2XEXA 1VQ9B 3AVYA 2VNIA 1S72B 4QHYA 1G7SA 3AVTA 1XB2A 3I56B 4BPRA 1A8PA 1GR1A 4ZGQB 1D1NA 4N3NA 3E20A 3ES9A 1TLLA 1YJNB 3A1FA 4G5GA 4LBZA 1OGJA 1ZM2A 3ZC3A 1K73D 1DG1G 1KQSB 2BM0A 3QFCA 1QX4A 3CD6B 4YAFA 1VQNB 3AVVA 3OZWA 4RD3A 1CQXA 2DETA 1FRNA 3VNVA 2BMWA 1CNEA 3G6EB 1Q86D 1FRQA 3CC7B 2RC5A 4M4SA 3CPWB 4TMZA 2J7KA 5KSWB 1GAWA 5THXA 5GV8A 1M1KD 2BM1A 1H42A 3QFRA 2X3UA 3LYUA 4MYTA 1KTVA 2DERA 3ZZTA 3U2QA 1JA0A 4PC2A 4M53A 2QEXB 1IB0A 5FA6A 4B47A 1QFYA 2HCJB 4EH1A 4YAOA 2B7CA 4PC6A 5JBQA 1YHQB 1K8AD 3JQQA 3CW2A 3MCAA 3QE2A 2BGJA 4UAJA 2DY1A 4DQLA 1QUEA 1AMOA 3W2EA 2C77A 1QFJA 3P26A 3B78A 2DCUA 2YWFA 4RD0A 4NCNA 3VO1A 1IJEA 1EFCA 3QSYA 1F60A 1E64A 3CC4B 2VNHA 1KC8D 1GJRA 4YHBA 4DQKA 3V76A 4HE5A 1FNDA 2VYQA 3CCSB 1DARA 1QFZA 4RD2A 4RCYA 3E1YE 3QFTA 2BF4A 2EFGA 4R71A 1FDRA 3LO8A 1YITB 4ZCMA 1KRHA 4LBYA 1YJ9B 3CXCB 1N0VC 2VNJA 1W87A 3CCLB 5TV2A 3CMAB 2FX3A 1VQLB 1GAQA 1R5OA 1I7PA 3AGPA 4K1XA 3WXMA 1VQ4B 1R5BA 1N0UA 5H59A 4RD4A 3CC2B 1N8RD 2EIXA 4PC7A 3U6KA 4ACAA 1BQEA 1W35A 1VQOB 1BX0A 3W5HA 1QVGB 4NBSA 4FK8A 1JNYA 1DDIA 4Q7JB 1FNCA 4M2LA 1OB2A 1VQ6B 1FNMA 1QUFA 1W34A 1G7CA 4Y7CA 2XNCA 1KD1D 1EP1B 1QGYA 1HA3A
chains in the Genus database with same CATH superfamily
3K9WA 3NTUA 3E5HA 1DTWA 3PITA 3S5UA 2X86A 5ADUS 1ZHFA 3A2NA 5LDGA 3CNNA 3KEMA 4LUCA 4BP1A 4YH1A 4DBZA 2VN8A 5IEBA 3LL4A 5CB0A 2BFBA 1Z4KA 2PBLA 3QEKA 2BV3A 3C1UA 3COZA 2VUHB 4H0FA 4PX5A 5JY6A 5LIRA 1JHRA 1L1EA 1LSSA 1T24A 3EFEA 4CV2A 3VNQA 5FFFA 1FL9A 2V5UA 2CWWA 3D4NA 5KJ1A 1WMFA 1J0CA 2ODWA 1RAFA 2PSSA 3S68A 1GU0A 2OCLA 4GP9A 4C0SA 5JZVA 2F6RA 1N9GB 2HLNA 2XMBA 4UUAA 5F23A 1R0YA 1RLTA 4IJWA 4I6EA 3N8IA 4YRAA 3EXHB 1QF9A 2QMYA 2Y9PB 4PGFA 5DYWA 3I2YX 2OK8A 3DCYA 2Z3ZA 1ZD8A 3KYDA 3VKFA 1LPSA 1PLKA 5HR5A 4NMHA 5KOJB 5IVHA 3QWHA 3UTCA 3O2NA 1A9PA 1FA9A 1DAOA 3R5KA 4FW9A 3F49S 2AN3A 4PGGA 4F92B 1HLGA 3VH1A 4IUDS 4R2IA 2GM4A 3LPDA 5LUAA 4JJ4A 1BDJA 3BZBA 3FWPA 5B6JA 5KTOA 4MV1A 1OI4A 5C80A 2RB5A 3KKPA 1NXTA 4NH4A 4LHVA 1POWA 2XGJA 2DFNA 4D1YA 3WYAA 4J6FA 1PS9A 1GYRA 4URFA 4F72A 3T34A 4F3RA 3SKVA 3WI7A 1QG6A 3BWBA 2NU9A 1QOZA 4E2YA 3L84A 3MFQA 3OMLA 3K9LA 1IY2A 1DL5A 1Z7GA 3QVMA 5DGIA 4B3XA 5IAOA 3ND6A 4DQDA 1EKXA 2PM8A 2CVQA 2VH2A 3JWHA 5ADWA 4HWSA 4REMA 1QQ7A 2HA6A 1H1DA 3ZU3A 1V8FA 2R8PA 3ROXA 4W9RA 3L1UA 1XVTA 2GCNA 3LYAA 9LDTA 3ZHRA 1FSFA 1U2EA 4OHYA 3E7PA 5EJGA 1M6NA 2EZTA 2GZ2A 2Q0QA 4GKAA 1XEXB 1AV7A 4U2KA 5C5IA 3DO5A 1D07A 4YBRA 5FKJA 3HJNA 1GSOA 4MZXA 1HVXA 4OI4A 1T8WA 2CHVA 3MCTA 1QB7A 3HK2A 4I1YA 4U39A 1F2VA 1L4EA 1GQOA 2BW0A 1WIWA 1JDJA 2RH9B 5LJIA 3FGPA 1FSGA 1QOPB 2RI6A 4MKFA 1KK0A 1V0JA 2NU6A 3JQAA 3OEED 4EHKA 3H4VA 4LXHA 2GCOB 1XZPA 1OLSB 2Q7XA 4KIGA 3IMEA 3STWA 4HN9A 5L4NA 1N3LA 4B31A 3MS4A 4Q0MA 1YVDA 5TGZA 3WBKA 3J81k 1ULHA 2Z8ZA 1NF2A 2EDCA 2ZUUA 1X9IA 3INYA 1DWQA 2XX3A 3MF4A 1RI5A 5LC1A 3L40A 4MJLA 5B3KA 1YVRA 4LZPA 4N7JA 1H3EA 1QO0D 3RVSA 2MT9A 3PNVA 2ALJA 2Q1YA 3H5OA 2P69A 4IIXA 1YONA 1D3AA 4TWAA 1JJBA 1S3FA 3OX3A 3Q87B 1RJFA 3QI2A 3CF2A 1JU4A 1WXIA 4PTYA 1OZAA 1DNPA 2NZXA 1O1YA 4LOJA 3HA7A 1TMYA 4WERA 4WA8A 2I2DA 5FFMA 1TU4A 2FCRA 1QJCA 3VPBA 3PXUA 2H3EA 3NVAA 5I7AA 3DPUA 4TKOB 4MVJI 3WLAA 4OB6A 3QBJA 4DSZA 3QLUA 3REQA 1EHIA 5AKIA 4XB1A 1PS8A 3QLUC 1A69A 1X8LA 3LUDA 4NY1A 5GONF 5JYBA 4OK3A 2EBUA 1Z7WA 5ERXA 4D4GA 1JG7A 1G55A 4MR7A 4BOYA 2WNHA 2HYIC 4DCSA 4Z99A 3B60A 3B1FA 1NUSA 4YFYA 2UZIR 4NCAA 1OXSC 3N58A 5T7BA 2PSJA 1QR2A 1GGJA 5JAPA 2O07A 2XKBA 3AVXA 3CMCO 4AY5A 4LJLA 1Z4NA 3P2KA 1T43A 2ZI6A 2GM3A 3KL2A 4CETA 1V11A 5CBPB 4JFRA 5FI3A 1E9BA 3I9V1 1F2DA 4ND6A 3ZBTA 1K08A 4O0LA 4WH0A 5DHSA 3PDIB 3WV4A 1J70A 4H7JA 3IKLA 5GM1A 4MZDA 2PLRA 6NULA 4FFWA 2JLAA 4IVRA 2QN6A 1FS4A 2B1RA 4RVNA 3SYKA 4YRQA 4HVAA 2H57A 2R96A 2GAOA 3TIVA 3OBBA 4U7PB 4UNPA 5IYZB 5K8VA 5CT4A 3CP2A 1P7YA 1TL7C 2Z09A 4HB2A 1JDVA 4IJ5A 4E14A 4BNJA 3JPWA 3H9EO 5JS7A 1UJ5A 1FVHA 2FHPA 2B92A 3U4MA 2HU5A 2NU7B 2C0PA 5AQ1A 2EZUA 4LBWA 1P1KA 4XOTA 1MDBA 3H1FA 4YP6A 3EGIA 1I5OA 3EZ9A 3A8JA 4MVXA 4XQCA 3C70A 1P62B 1Y37A 5D5HA 2Q2NA 4DEXA 3M6VA 3S1LA 3KCNA 4E4YA 3M9WA 1BE0A 3L43A 2C54A 4YCBA 4KACA 1E2NA 2JCSA 4WK0B 3LZCA 3IVXA 3LDUA 4O4LB 3GIDA 1CV2A 2Y4OA 1QVVA 4L95C 2GJKA 2BKVA 3C15C 1FC0A 4IDOA 3VHXA 2AT1A 3OCCA 1T8YA 3ER8A 2O2YA 1JEDA 1HM5A 2VP3A 4GRAA 1JR4A 1QKKA 3T52A 1JHQA 3ACCA 4S0ZA 1WPCA 4LK2A 1VG0B 4EZBA 4W5OA 3Q6QA 5CX1B 1A1VA 5BNIA 2NXJA 2EXXA 2VTEA 2E85A 5ALYA 2UUAB 2D00A 2ZZGA 1CXZA 2FOLA 4RJIA 4DNPA 2JLZA 2GMWA 3SBXA 3L02A 1Z0JA 5CR9A 1EFRD 1WP6A 5GPBA 1N2XA 4WL0A 1G5FA 1L8OA 1VL0A 5F2OA 4ZCQA 3E5MA 1MB3A 3ET4A 3ONDA 4J2OA 3SEZA 3VV2A 2F3UA 1XRQA 4HJXA 4UMVA 1XF1A 2GHRA 3OMWA 3HKDB 5AYVA 3VYWA 4BEWA 4PSKA 1E7SA 5K99A 4DLRA 3NC0C 3ZDXB 3W2HA 3BIOA 3CLRD 2IP2A 4MWZA 1BKDR 1QHNA 1ISRA 2VBSA 2A9PA 3BCHA 4DQXA 4K46A 1FU4A 3NTVA 4LYHA 5EMMA 4FDAA 4Q7EA 1MENA 4RHUA 5JCXA 4RLSA 4ENVA 1BXZA 3EMBA 4A16A 2PJRA 4EPTA 4JA2A 2B7BA 3LXUX 3Q98A 2IYRA 3BX1A 3D8NA 5EAIA 4FTWA 1C3OB 5TNXA 4ZJPA 3BS4A 3TSWA 2CSXA 1ZGAA 2Z8YM 3FSEA 1X9HA 1ZD1A 2GR9A 4NRDA 3GRZA 3S8MA 3VR0A 2GPWA 3O75A 2BEVA 4Y9UA 1O95C 2VPWA 2WT4A 2Z9BA 3CUKA 3OA0A 3H9CA 3USCS 3BFJA 3C45A 1ORWA 4LX8A 3LLMA 1K7FB 4XUDA 1WUTA 3ZGZA 1PR3A 4KMMA 3PGA1 2OQIA 3ZWPA 4WD3A 4JBGA 3FSGA 5DM4A 5P8WA 2PMKA 5F33A 5JSZA 3SLNA 1E59A 4G5XA 1XRJA 4NV3A 4R1TA 1K88A 4FZ3A 5KTMA 2ZYUX 3ZVMA 1YZNA 1ADGA 4HX5A 5F7XA 3F5QA 4B43A 2I4LA 3U3XA 4EGAA 1EK6A 3QE4A 4B6RA 3WMRA 3KTDA 4MP8A 2V6GA 4N7MA 1DFGA 1L7MA 3DNFA 4OFWA 1C8BA 5GGXA 1PE0A 4KODA 1X7ZB 1HYGA 3UMMA 4J1NA 1N1EA 1N05A 2ROQA 4M86A 1WXEA 4MIOA 3U44A 1QIFA 4UMDA 2RBKA 3I01A 1NB9A 2P2CA 2YQZA 4IJQA 5AXBA 1G7SA 5DK4A 2FX5A 1NYQA 1SR8A 3AG5A 5AKHA 5DLDA 4KPYA 5JG7A 1GR1A 5I9IA 4NOKA 3D3NA 2EARA 2JCBA 3BMOA 5KSYA 2A9QA 1DKPA 1I10A 2JIRA 1W5EA 2XECA 3FHCB 2F90A 3ASYA 4MDYA 4Q12A 4C29A 1DC6A 4U2DA 3FJYA 2ODQA 4PV7A 4W63A 1Z88A 1GLVA 2OZPA 3M7IA 4Z9XA 4CQMA 3OOHA 1W49A 1F6WA 4IYRA 4N49A 2K2WA 1NUTA 2R1VA 2V5AA 3DEJA 3MINA 1MA3A 4IZ6A 4B9AA 1VTKA 2FW7A 2YBDA 1WKVA 4TWZA 1QNFA 1KQSB 1XVVA 3DL0A 3GNLA 3LI2A 2LIVA 1RRMA 3TCKA 1QQBA 4BFCA 1J8QA 1QX4A 1F3OA 2DYKA 1E1QD 3EVTA 4MV3A 4BYMA 4XYMA 4Y6PA 1SCUA 5K3FA 5BSRA 3W8FA 3WOHA 3QXSA 5FBVB 1Z4QA 3NOOA 2Z4RA 2V7QD 5FWDA 1AS0A 1NV9A 4KMSA 4RD3A 1GTMA 1AA6A 3MIIA 2Q6VA 1RAHA 3EMDA 3NIGB 1N4AA 4D9BA 3RSQA 3PQCA 2WKSA 1PJ4A 2I29A 2VRBA 3DP7A 5EZSA 1CNEA 4X7EA 2R2AA 1EA7A 2V96A 1JILA 3B3JA 3G0DA 3I34X 3MT0A 3PFHA 5EWLB 2ZRCA 3LVFO 5ARDA 3NXKA 3GZJA 1XALA 3FR8A 2Z95A 1HL7A 1D0VA 3BGVA 1QHHB 3A6GA 3O1IC 5D5QA 4CUJA 5CDTA 5JI3E 4S1WA 5JTUA 1HT0A 4B3MB 1H6DA 3VMMA 3HJFA 5F78A 3KXLA 2F43B 2WD7A 1JDBB 2UYQA 2V6BA 1Q44A 3A4NA 4WW0A 2XH8A 5H82A 2C2XA 2IF2A 2P8JA 5EFZA 1A77A 4YP0A 3LYUA 4BJ1A 4BZQA 2XBUA 3EOZA 3LFHA 1NPDA 3QUTA 3T4XA 1SVMA 4UCWA 2GXUA 1XU4A 2VSXA 3FCOA 1DCMA 3RBXA 2AEEA 1IXKA 2AMVA 1MVOA 4AG6A 1Y9DA 3V80A 4UEJA 1TCCA 4EMBA 5FA6A 2PUAA 3OM9A 2HCJB 2CY0A 1NRKA 3B85A 3BAFA 4MX8A 3VYSB 2JI9A 3SWWA 5IKXA 3AFNA 3AUAA 3KJFA 4EYEA 5IWCA 1UD5A 2JJ1D 4HB0A 4RH3A 4ABTA 3IOYA 1L4BA 1W19A 2XHEA 4RVFA 1JQEA 1U0RA 2ZQ5A 2PD3A 4Z8YA 4GXTA 1ZIYA 2C9YA 4Y2YA 5FT9A 4RZQA 4LDRA 1JLSA 3FPAA 4JKIA 3VJKA 2VJNA 3WIBA 1N1MA 4KQ1A 3ZLUA 4R7TA 3C7CB 4P86A 3RC7A 2JGNA 3TG8A 1PR5A 3CWZA 1I7SB 4MQ5A 3TLXA 2P77A 4BB6A 5JALA 3OPYB 4TX1A 3QX3A 3L7YA 5TPWA 2IDJA 1FFEA 4JXZA 3AB3A 4FR0A 5EVCA 5EWJA 1NZDA 2C9MA 1GRNA 5FQNA 5SV2A 1ARZA 2YWJA 3AKZA 2QM0A 1WUIS 1NMXA 3O9ZA 3K1ZA 4R3NA 5DCYA 1UDWA 3GRYA 4YHBA 1K6IA 1O4VA 3LSYA 2D1QA 3PVZA 1KF0A 3OCZA 1QZZA 1CUAA 3NBAA 3HJHA 1C7QA 1UBNA 2IOHA 3LLVA 2QN3A 4Z4SA 2ORVA 3JVVA 4LRUA 5U9CA 2AKYA 2WWRA 4KN6A 1H1LB 3KXDA 3MTQA 5CM2Z 4DTIA 3OZGA 1FP4B 3K5HA 4PHTA 4ML3A 4TLDA 1RCFA 4C6TB 4DXHA 1D7OA 2WY2D 1QFZA 1YZFA 2EOAA 4RZXA 1PT9A 2GRAA 1RVDA 2LGJA 3S29A 3DAFA 3VC3A 1A95A 1WUYA 3ROGA 4AX8A 4EG5A 1F4VA 3LX5A 3LDFA 4WEQA 2FWRA 5I7UA 3IJPA 4QICA 1JDNA 3KKKA 1KQPA 2MYUA 2PGAA 3C8HA 1RFLA 5TGTA 2C3OA 3AI7A 3LT2A 2WP0A 1Y8RA 1I6LA 2A1UB 3AR8A 1U94A 2CBZA 4CLDA 5F2NA 3GC6A 1RSZA 1O6FA 1UWLA 3TVTA 3LHIA 4INPA 5EP4A 1TJYA 3EEBA 5DM1A 1U7PA 1VSBA 5A71A 2GX6A 2VLIA 3LYHA 5JAHA 3A2LA 2D9RA 1CB0A 3KWLA 3IIJA 3AHEA 4RF5A 2H6EA 3RR2A 3HBMA 1Q92A 1C2YA 4J2HA 5AO9A 1GFSA 4GW3A 2Q9BA 2IIPA 2B0JA 4HUJA 5HIAA 3EXEA 1NXWA 4EY3A 4Y9SA 3GUYA 3I2GA 2LVBA 1RRCA 1GM5A 2P2NA 4XDZA 2I3GA 2FW1A 3T38A 1YT5A 1XDUA 2XB6A 3SGLA 3RTAA 4L2IA 3BIXA 4I55B 3KV1A 4CKWB 2O20A 2GGSA 1C9NA 3AQIA 1PK8A 1Y1LA 5EE5B 3OC6A 2AXEA 4G9GA 5BVGA 2OXEA 3PNMA 2WM3A 4MWDA 4O3FA 1SEVA 4OPMA 5H68A 5TQ2A 3ZCUA 1L7BA 4X24A 5AICA 4L74A 3ZLTA 2IFTA 2GPAA 2JD1A 2VDJA 3OF5A 2AZ4A 2VH1A 2X5KO 1KVQA 2JASA 1G3IA 1U7UA 1HNZB 3KZNA 4ESOA 2DBYA 4G2NA 4YIKA 1KQ3A 1NWCA 2V98A 3ZWCA 3DVAB 3DYBA 4Q00A 1Z45A 2Q3FA 4BNMA 4H59A 4P53A 3B51X 4Y1FA 1EP1B 3L4SO 3N7TA 5JPCA 2D3NA 1GKYA 1M2HA 2Q2VA 5E6TA 1JIJA 5IM5A 4A1FA 2ZBFA 4OY3A 4K40A 3LWDA 1RM0A 3HCFA 1A4RA 4KGVA 3CLSD 4TKUA 4V0SA 2GK6A 5AN9A 4XFDA 1AU9A 4B83A 4NZPA 3A9UA 1DRWA 1H8HD 3GEGA 2CMGA 3GSIA 4A6DA 3PNLA 4YV2A 4HC4A 4RW0A 1XQBA 1N9ZA 3CTAA 1CUVA 4LQLA 2IL1A 3QWBA 4FE4A 2OFFA 3B9RA 4WOJA 1O7JA 2AUTA 3IMGA 3OI7A 3LE8A 2DRIA 5I9SA 2Q5JA 3G0IA 4TL7A 5DGTA 3RLIA 5JWRA 5KWEA 1KWGA 2SKDA 1WXHA 1BHO1 1V7PC 2XKAA 2CDNA 1R4AA 4YJFB 4UHEA 1Z0IA 3K70D 3DTVB 5AUOB 1LSUA 1LLQA 1D4FA 4QEKA 4Y1RB 2QVGA 5K03A 3T61A 5JEDA 1CJCA 3E27A 2VHUA 4E09A 4Z9FA 1BYUA 1M75A 4BP3A 1YRQA 3DT8A 1G8GA 2Q5LA 2F59A 3IUQA 3TOXA 4KIUA 1S5PA 4Z4VA 1NYLA 5FO0A 3LG2A 3BN3A 3L07A 3SQWA 1Q20A 1E9FA 3GEPA 3H1TA 1V5IA 2PRSA 1NVTA 4KLZA 1WEKA 1XQ1A 2WP8J 2RAFA 3AY0A 2NYUA 5LBUA 2AHRA 1LU9A 1JDTA 1QX3A 3LA6A 1ANKA 2PN1A 3DMYA 1MW9X 2Q99A 4UCXA 4WXYB 2GXAA 4WSOA 2M32A 1J9ZA 2B4KA 2QLNA 4WT7A 5LVAA 5FWYB 5JSHA 1BYIA 1KJJA 1ODKA 3W5JA 1FMLA 3I9V6 1MX3A 3WLHA 4WZ6A 1LI5A 2OUIA 3SS8A 2YJGA 3K8QA 3WKCA 1RYBA 2AOVA 4IHJA 3A9TA 3L93A 2H0QA 1NATA 1RHRA 4KXFB 3QU4A 3TPFA 5JROA 1N3BA 2J9FA 1Y3DE 2A0XA 2W00A 3ZI7A 1DKLA 1KFBB 1OILA 4NMXB 2BHLA 1BFKA 3E9QA 4RE5A 5FRDA 5LQSA 4DC1A 4H1WA 5FPQA 3VR3D 5CG1A 4O29A 4KQ2A 4H0NA 4PAMA 1ENYA 3W1EA 2KS6A 4Y2VA 5IMBA 4BB5A 5C3MA 2WU4A 1R12A 4KDRA 2FE4A 3T94A 2GZRA 3IRVA 3BTSA 1E1KA 4F7DA 3C3AA 2R8XA 5K0CA 4DK1A 3GZ4A 1SGWA 1M1UA 4TKLA 4G6ZA 3V00A 5KKCA 4KX3A 2K7ZA 3OJCA 5DM0A 5KWSA 1ZM3A 2FQYA 2QMHA 1GSHA 3D1LA 1PO7A 3L9WA 4FSXA 4WTOA 3RIMA 4A8JB 5A7FA 1T8PA 4F4CA 4ZJYA 5E0OA 2O2XA 5CFNA 3AI3A 1C7JA 3UJCA 4KAXA 1L4YA 4WLFA 5J47A 4I5IA 4HT3B 2QRNA 3OIFA 1DCKA 2ZSJA 5JARA 3D2BA 3C6MA 1S3IA 3PFIA 1MZVA 1IXYA 3H3JA 4MULA 1ECPA 1R8XA 5K3SA 2YIVX 3KSMA 5CT8A 4MUYA 1BVHA 2JFPA 5DS0A 1Q91A 4EGSA 4ETNA 3LBAA 1FJ2A 3AV0B 4RHYA 4YIHA 1XZHA 2CXHA 3UJ6A 2Z83A 3RRNA 4YUZA 3VI3B 2NTJA 3G8AA 1AK2A 3DLAA 2JFZA 3N3BC 4L9WA 3VKWA 1G64A 2D5BA 2J08A 3IAHA 1JIQA 4AF7A 4HWGA 3TRHA 4C01A 2WQ7A 4A7PA 3DSRA 4TV9B 5EXSA 4BQPA 1LWOA 1QK4A 1U8UA 3M5DA 2ECPA 4PXAA 4B6PA 4QT4A 1TK3A 3AF6A 1R1DA 2XSZD 4H0CA 3MJCA 4A0SA 1R64A 5CGQB 4HTFA 4C7MA 4JH0A 4XM2A 3ASQA 2OQRA 4OOEA 3TUIC 3AM1A 1Y0BA 2VJCA 4OI2A 1MQAA 2X9GA 2DECA 4PSDA 4HDNB 5BMOA 4LE1A 4YUXA 3P4YA 4OSEA 2V7WA 3TDKA 3ZXXA 4ZV4A 1P4AA 4YAIA 4PYMA 3KKOA 2ZPUA 3O0DA 1C9YA 1D2EA 1EH5A 3O4JA 5D2CA 3SD7A 4DY4A 1N9KA 1KQFA 1ZY2A 1PZMA 2CLHB 1OKKA 3BXOA 5CFLA 3L8DA 4G8JA 2C5FA 1EQAA 2P79A 3FGNA 3PJRA 2CLOB 2Z6UA 1PYDA 5C51B 3LPAA 4KCGA 4BRWA 2G9QA 2VXBA 2Q4OA 3IT0A 4OU5A 3VR4D 2POCA 4MQUA 4YGXB 3R3YA 1T4CB 1TT5A 1MTOA 2VI5A 4Y1GA 1IE3A 4ESEA 1SBCA 5K0SA 4G0WA 5FOSA 4IQ0A 5PGMA 2G28A 4JT2A 3RI3A 3GFBA 3G0GA 1JG2A 4GOND 5LPNA 1K7YA 1UOPA 5F64A 4R3UC 1WCIA 2VJLA 3NTXA 4P34A 2BMDA 2NO7A 1NXOA 2W6PA 3TZHA 1ADJA 3F5MA 4X1IA 4LF8B 1VE7A 4U02A 1VIDA 5FJJA 1K9MD 2YXLA 1XZ8A 1ZI8A 2GPNA 1ISFA 5BOVA 5EQDA 3RANA 4URXR 1DUSA 1YS9A 5CNKA 2Y66A 1RI3A 4PC1A 1Z83A 2P6OA 1VC2A 4GHWA 4Q02A 3NHLA 4XARA 4YJGA 1BMDA 4IS3A 5GOZA 3G2PA 4L5CA 1E2IA 2Q1UA 2R84A 3TEMA 1H4QA 4GI5A 1YF3A 3R7BA 4G1EB 3SIWA 5LFAA 1MD9A 2I67A 2KVOA 1CZUA 3PXEA 4L5YA 5KQSA 1OMOA 1QRTA 1UMKA 3QVOA 1LPOA 1N6RA 3V7NA 3VR4H 1WR8A 3UK2A 2J3IA 1AQJA 4BO3A 4E22A 3M4NA 2VP0A 2FPLA 1K3FA 1ZPDA 2VAPA 5I4KA 3EULA 2FPPA 3BRQA 4UXIA 2OHHA 2G25A 2H52A 4J16C 5SYMA 2FSIA 3KQHA 1ZD3A 1LDMA 1FFDA 2GBCA 4O2AB 5GZ3A 5KWVA 2A9OA 3VSCA 4TGLA 1N2SA 5CFPA 1F7VA 5CAEB 1ZGJA 2GWHA 2I55A 5H4HA 3CLKA 2D3TA 3S6JA 3EUAA 3JD4A 5AK3A 2H2HA 3GRVA 1JVNA 1H3FA 2HCFA 4WKPA 2XT9A 3TSYA 4CQLA 3MRTA 1RYNA 4EFNA 1FZQA 5K45A 4ZI3A 4PX2A 3UFBA 4JBYA 5E1DA 1IBSA 1KY3A 3ZBUA 1O5IA 2R0QC 4ZCLA 3EODA 5GONA 4YQZA 4MCJA 4TMXA 3WGUA 3TTVA 1RBMA 1JZQA 3ODPA 2WWIA 4BLPA 4D42A 3VKUA 3TQIA 1Q1AA 2QB5A 5C46F 4R2WA 1MHPA 3N76A 4MYSA 1WCV1 2ESRA 3RKRA 2PMEA 1KETA 2SCUA 3RS7A 2QDXA 2XIJA 3ZV5A 4OQPA 4AWBA 1LVGA 2WVHA 3W5UA 3UGJA 1L5LA 1BXKA 3LZDA 4AT1A 2E4VA 2VPXA 1N3YA 3G68A 4FYHA 4JXKA 3O26A 3ZJ4A 1RHUA 1L7DA 2EZ8A 2FZCA 2YZMA 2N1BA 4G4SO 4I6JA 3R8CA 3BHIA 3FWNA 4BLUA 5KYYB 3EC1A 4MMXB 1GGFA 5T64A 4C78A 5LLTA 4IJ6A 1J6UA 1VCIA 1VM6A 4B17A 3LGSA 3S7TA 1ZMBA 1IHDA 1XLTA 5LBTA 2VJKA 4D98A 3WSWA 4EA9A 1U5CA 4A6PA 1JDBC 3BA6A 1Z2NX 2GEUA 3NI2A 2H08A 4M1KA 2V97A 4K26A 3IAAA 4EBBA 1I2BA 2CFCA 1NBMA 2XNKA 3WL3A 3H2KA 3HCCA 4LA4A 1SHZA 1U9IA 4WKNA 2RGBA 2O2EA 2VXCA 1U9IC 3NM4A 1UBHS 3K5IA 4Z0HO 2GNAA 1KVSA 2OEPA 4PYOA 2AV6A 4DLXA 2VH5R 3CYFA 3DDCA 3OQIA 3MUEA 1MJNA 2ON6A 4B4DA 4YBZA 1ODIA 1ZESA 2J9GA 1KORA 4J4BA 4QXOA 1EJ6A 2OOSA 4HPJB 1OX6A 4PINA 4LJ7A 4Z1MD 5K0FA 1BWSA 3L8GA 2OYNA 2L18A 3UMFA 3PUMA 1CZOA 4DDVA 1UFVA 1RC1A 2JKYA 3OTGA 3EPKA 3A58B 3K7EA 2QTMA 3IIKA 1ORVA 1FFCA 1XCMA 3AO0B 2C31A 3WLLA 4AMUA 5H7XA 4QXQA 4XLZA 2D3WA 3SHWA 1YGPA 2B6HA 4GAEA 2X3FA 3C6ZA 4IDCA 1PR0A 1SHLA 4XQ9A 4IDGA 3PPYA 1X1CA 3N7UA 2P4UA 1D1NA 1DAEA 1OVGA 3TDNA 2GJAA 2CNWD 2IUFA 3GRPA 4KRGA 5T4EA 2MWMA 4TM8A 3UFXB 3W2TA 4RTSA 4NS4A 2UDPA 5BN4A 4G5GA 4IY1A 1VG1A 2QW1A 2GZAA 3H2ZA 3RSLA 1OGJA 3VYRB 2XZPA 4RV9A 5JECA 5HPYB 4XWOA 4BNXA 5G0VA 3HH8A 4RZ2A 3WRWA 2ZYVX 5I7WA 5D84A 2PKXA 1YMUA 1OJ7A 4BN5A 1HFWA 1MQ9A 5IJ0A 1HDIA 1G3UA 4WOPA 4X7RA 1GYQA 5EZYF 4CKXA 3RODA 4YLGA 4M7RA 5BV2P 1DQSA 1E3MA 1GUBA 1OBOA 1E1RA 2BJVA 2E21A 3NUGA 1BCSA 1F14A 3P4XA 5B55A 3DPIA 2ZJ1A 1CZLA 2D0PB 2DETA 2UVPA 4JZKA 3RHTA 1DIAA 4FHEA 3OSZA 1TYEB 4EI9A 3QUSA 2EQ5A 1QCDA 3GRAA 1T2NA 1J39A 2P67A 4KR6A 4KV7A 1A7JA 3F46A 2CVZA 2ZJ4A 3EVCA 2VP2A 3I3OA 1J5PA 4N4AA 4BUCA 3T1TA 1Y6FA 3GIWA 1LI4A 1L7NA 2AH5A 2R6JA 5AT1A 2BFMA 4BO7A 3H13A 3EDRA 4JKOA 2D1TA 4DIEA 2FN8A 4RESA 2ZXIA 2H9IA 1FYFA 1QIEA 3OPNA 2RIPA 1VPEA 5L4LA 1ZKMA 1CCWA 1A2QA 3LY9A 4M0MA 1KFKB 3LQ6A 1WY7A 4DTCA 4J0FA 3DM9B 1HMPA 5DNWA 3SYMA 4C89A 4RTKA 4G97A 2AG1A 1D1PA 1OBHA 2JIPA 4QNNA 1J5EB 1E9AA 1U3GA 2XW6A 3CPHA 3SQOA 5C7IO 4PTLA 3C85A 1G9SA 4J0CA 2FW6A 3R77A 4NMMA 2NO0A 4ZPJA 5JAQA 5LZ8A 1QP7A 2V7TA 1U7ZA 2J7PA 3TO5A 2O23A 3N05A 4W8GA 4RJKA 2BGJA 2F8SA 1SJ9A 1XZFA 5DDIP 3K92A 2W8ZA 4HN2A 2WAXA 2BKLA 3UJDA 3IDFA 5TDHA 3ZNPA 4DC9A 1D0IA 1QF6A 1EXDA 2JFXA 4OHKA 3UK1A 3VNRA 3CE6A 1DJNA 1KZLA 2JIQA 1P45A 4Q1DA 4BNTA 3H94A 3SKYA 2F55A 2PUBA 1CUGA 3KZCA 4JP1A 4WOBA 4KXMA 1O3YA 2HJHA 2NLOA 4ND7A 2C77A 2WVJA 3P26A 1VJRA 2I76A 5HIIA 4QAQA 3H2YA 1PUJA 4RSRA 4D0RA 1LEHA 4G7XA 1HG1A 2CLSA 1IJEA 1VHOA 2YNMD 3EA4A 1VYHA 4JI5B 5A0VA 3C24A 1BXRB 3FNRA 1DJMA 3JQBA 3R7DA 3BOSA 4GICA 1N2OA 2XNDD 4NQZA 4LPSA 2XYQA 3O8LA 4GPBA 5LU8A 3PR2B 3KEGA 2PKQO 4AI6A 2GFQA 4DQKA 1SMKA 4MKGA 5BSTA 1IMOA 1GA6A 3I6QA 1RXYA 4ZREA 3BQJA 3V46A 8ADHA 3DE5X 4EMTA 3DDSA 4DR6B 1YBHA 2RGAA 2HGZA 3A3BA 1F8GA 5FULA 4E5YA 3FOBA 1T6ZA 3HHPA 3AW9A 5C2JB 5KNBA 2XPCA 1OFGA 4OAPA 3CTMA 5BW4A 5FBQB 1K86A 3EB9A 3DR5A 3HXTA 4GX0A 5D51S 1CY0A 3UGQA 3WGHA 2P4EA 1KIMA 1PYOA 2QN8A 1Y6JA 2BF4A 2FW0A 2GN9A 5BPFA 4DBVO 1T2UA 1PTKA 1E1DA 1Z6GA 3QKIA 4LZAA 3U4CA 2L17A 2YJNA 3RUHA 4A5SA 3RRMA 1KNQA 4JC5A 3TX6A 3HSYA 5JNUA 1K4MA 4INAA 4TSRA 2FSFA 4NS1A 3HU5A 4XDHA 2V7VA 3KWFA 3PSHA 4XR6A 3R3XA 4BBAA 2JLYA 1IPFA 2C2BA 4RPJA 5E6UA 5EIFA 3WNQA 5KYNA 1UMBB 5HF6A 1F0KA 2Q0SA 2YYYA 4QU8A 5F76A 1G2OA 3CZAA 4WKGA 2ZIUB 1CZHA 4EUKA 4YRMA 1KZHA 3KYDB 4FNGA 2HMSA 2IYFA 4BATA 2UXCB 3NOXA 3DEFA 4RKQA 2CV0A 1Z06A 3EGDB 2H2FA 3KUXA 1YRWA 3PKIA 3Q3GE 4WXPA 4QARA 5LB4A 3C16C 5I7FA 5JCPA 4QRHA 1YE3A 1DRJA 3HJCA 1RJDA 1II8B 1UM8A 1XJ5A 2ODBA 4PC7A 2PUHA 3ONUA 3KOYA 2H1LA 2YFYA 3CW8X 3NJ4A 3PD7A 3OEHA 4PYRA 4UAUA 2IY9A 1URPA 4MRVA 4E6EA 4C2UA 3Q8LA 3DR3A 3YASA 2GBLA 4JY7A 4AF8A 1HZJA 1UADA 1BX0A 3LQEA 2GBLC 3I2HA 3K2EA 3RRYA 3FPPA 3HMQA 1AK1A 4DR3B 3MUNA 1NG1A 1KQGA 4OXKA 2B35A 1VBMA 4XPIA 4Q7JB 3DM5A 4Y6SA 2MTBA 1UC4B 3FYUB 4OGLA 4K6MA 1UKAA 1WB9A 2FN9A 3NLLA 4JUIA 5FPYA 5KUTA 4FGUA 3I1YA 1OLUA 5DW3A 1SZPA 3EHDA 2PVSA 1PNQA 2WB4A 4FFRA 2AC4A 4DJAA 3EF1A 1DBVO 2YV4A 3B2QA 3F6SA 4A8JC 1E3QA 2YXBA 4BMVA 4E32A 2XNCA 4P4SB 1XL0A 2D8MA 4YWJA 1DX6A 2J3HA 3A6PC 4QQFA 2PZBA 4Z4RA 3DF9A 4KK3A 2R751 2WILA 3G9UA 2VK8A 2X9QA 2EKZA 2ZITA 5REQA 5I8ZA 3LFTA 4JELA 1I2DA 2PL1A 4P3NA 3PE3A 3RS2A 3VR6D 3OVMA 4XUGB 1CJUC 1R3UA 2Y2VA 2WDZA 3LLSA 3NHFA 1YE5A 3KJQA 4PO3X 4REOA 1KK1A 1NRXA 2VLBA 4HYQA 3K2IA 5TF0A 3A1DA 3W6UA 4K0RA 2QU8A 2XRMA 2TMYA 1GVHA 4CLHA 1H9AA 3ED5A 3K70B 4R8VA 3RSFA 2ANBA 4RS3A 3O5AA 3HG7A 4NZOA 1E9CA 3KLNA 2DUNA 4TOIA 1DPGA 1TYZA 4X92A 3LQQA 2MYPA 2IU3A 3CWQA 2OHOA 2BAGA 4OHOA 5G1OA 1VA4A 2GDJA 5T3YA 3BJZA 1JSRA 1QH8B 1N5JA 3EDCA 3NM6B 1S8FA 2I2AA 5LD2B 2W98A 3C4JA 1RBZA 3R7NA 2SECE 1H2AS 5IT0A 2UZ3A 3JZIA 4UM8B 4YI5A 1WSBA 3BL8A 4BZPA 1N78A 3OWXA 4PLYA 3MAAC 1S8AA 2XMZA 1H2XA 4C6RA 2GFHA 4FYVA 4QO7A 3SHVA 3VR6H 3HL0A 2DFLA 1YQEA 3CCJB 3TRKA 3NHPA 4YROA 2VR1A 4MP6A 2P0EA 5CW1A 4Y67A 3T3NA 2CDCA 5ENDA 1RCUA 2ISCA 4EPRA 2C92A 2EC5A 3KALA 3FRHA 3CCBA 3JALA 4KN8A 5CG2A 3LGAA 3QOXA 1GIAA 3AQ4A 3OMXA 2ID4A 2LBPA 2Y1CA 2Z57A 3CXRA 3EH1A 2VP4A 3AVOA 4W7HA 1QZUA 5D5PA 3R4CA 3ADPA 4OO3A 4XR4A 1IC6A 4CNBA 5CLJA 1QVFB 3D6JA 4I50B 4F97A 1ZHOA 2JEZA 3ETDA 2Y1LA 1XTIA 3CESA 5HF5A 1CB7A 4J29A 1HYHA 4R69A 3JQ7B 5FADA 5L51A 3ZVLA 4JC0A 4MI3A 1YNSA 2XJ4A 4ZCRA 2X85A 1NJ6A 1N07A 2OO5C 2WZDA 1D2GA 4GOXA 4P5EA 1TU3A 2QX8A 3R4VA 4NFLA 4FIDA 1NI3A 2TMDA 2QX7A 1E5DA 1WP4A 4M6WA 2XYGA 4DCJA 2WLTA 4FNMA 5E9WA 3OH8A 3D5EA 2WTXA 2QVBA 2QXTA 2G7MC 1EFPA 4H4CA 4L4UA 4UULA 4XVHA 3TGWA 2IIBA 5CDUA 4JROA 3WGQA 1ML4A 3PVDA 1UKBA 4H7KA 2HWKA 3CR8A 3IUEA 4PPQA 1UXHA 3M4XA 4NR0A 4DV3B 4YMSA 4CGYA 4A5OA 4XASA 1WU7A 3E6AA 2B1QA 3K6KA 5A5FA 1R9MA 2I03A 1T35A 4COKA 4UUQA 5H8WA 2YUIA 3GMIA 4L7QA 1QYIA 1XAIA 2BGRA 1E5XA 2PWAA 4FN5A 2DVMA 3H5TA 5EZ5A 3TMKA 3KOXA 1ODJA 2P90A 3GOHA 1PN3A 1EWYA 1NT4A 1QNLA 2JFYA 3DEIA 1CS4C 1KR2A 4D4IA 1SKQA 2BFAA 3S2IA 4LG1A 4OP3A 4BVLA 4LGYA 2BFCA 5DMXA 3H8JA 4ATNA 3VHXB 3OEEA 3A6JA 4J1TA 1R0CA 4M1WA 2W6ZA 3R3HA 4MSUA 2IXGA 2A84A 3UHJA 3TXXA 5IBPA 4HFNA 1Z0DA 1TTQB 3NWJA 4PZPA 3PENA 3DHWC 3EDMA 3GYBA 4OHMA 2IPAB 4G3XA 2ZL6A 4D3ZA 3R6JA 3IQGX 5BSFA 5EIXA 2C2ZA 1M2KA 4IOKA 1N2JA 3LC1O 4YXWD 4BEVA 1O0CA 5H81A 1ZA2A 3AUUA 3OLYA 4G8BA 1QO0A 2OYSA 1M33A 1RXCA 3K3PA 3L7MA 4BLTA 2DQYA 4JCCA 3F6YA 2AX3A 3O83A 3GNTA 4KIJA 2WHXA 3HU2A 1IOVA 4XX0B 4YALA 3EGCA 2FYTA 1P81A 4LY0A 1OX4A 4E07A 2XWJI 4PGMA 5AW5A 2ARKA 3PHHA 4UOZA 2VDKB 2OL4A 2CJXA 2WJHA 2BDTA 4DBLE 2XTJA 4HGRA 3R7WA 2MMGA 4X65B 4JR1A 2DR2A 2PUTA 2QTWB 4BFXA 2X8KA 1REQA 4FONA 3LT1A 4ZAYA 1N6NA 4N47A 4D4HA 3D6MA 3H8WA 2X15A 3G23A 3EIQA 1XD8A 2OPHA 1VHWA 1ADFA 3ZLJA 1EVZA 1QC5B 3S8YA 4JI2B 1C4OA 3DMRA 4RD1A 4WK2B 2XUZA 3CTPA 2L82A 4HRAA 1KMHB 1PFUA 1L5NA 4R2KA 3AB7A 2QHXA 1DO0A 3RWOA 3FTDA 2HQRA 2OOKA 4R05A 5EERA 5KOHB 3QFFA 1HO3A 4GXRA 2X5JO 3AESB 3QNUA 5E8RA 4K3UA 1IK4A 2CDRA 2ZUCA 4EHHA 1CY4A 3I4CA 5B5SA 1UAYA 3A9WA 4G0YA 3OTHA 4AY4A 4AKHA 3OZFA 1C9JA 1H94A 3R23A 5IDVA 2EKDA 3ZQ6A 1EZZA 4A8TA 3G0HA 3TOSA 4FR2A 3G02A 4UTPA 4JK3A 1P9WA 3D7RA 2FFAA 1OTHA 3OLWA 3TLEA 5HSGA 3CH5A 3UUWA 3VHRA 4YLEA 1JFVA 3CLTD 4WIAA 3REGA 4B44A 2RAVA 2PV7A 4KTTE 2BCJQ 4HOYA 2IU0A 4DZZA 3EQ2A 1J2EA 2VKTA 3K6RA 4UBIA 1YJ8A 4OQQA 1ZO8A 3NH9A 5A6SB 4G86A 4QSMA 3BC9A 3X2EA 4S05A 2KQUA 1GUFA 3PT5A 2I2XB 1NC1A 2NVOA 3HKBA 1NF8A 1VMIA 3CPJB 2C2YA 3QG1A 3CUSA 4RQAA 2VF5X 1TK2A 1JYFA 2DKOA 3OE1A 5ILOA 1II0A 3N2IA 1XQ9A 2ZGVA 2VWQA 3D6NB 3NZEA 1ZVVA 2BKXA 4L4ZA 1XX6A 4CGZA 5BR8B 4XIYA 1XA3A 5JSYA 1GL6A 2YOHA 5CH3A 5EJ2A 1I0IA 4WJKB 2NU8A 1MXHA 4TYNA 1H65A 2F64A 3C5VA 3IP6A 4L8GA 2X8LA 4IIVA 4XD7D 1SHKA 2IX9A 3MWEA 3WNZA 4QDXA 4YB8A 4EYSA 2IU4A 2V6IA 4RDCA 3DYIA 2QD3A 5AKYA 2H0RA 1YU6A 4N9WA 4RACA 1I33A 2I0FA 1VE1A 3DFZA 4CQMB 4F8YA 4TMVA 1ZMOA 1FF9A 1SVOA 2DOKA 3JQGA 5EJAA 2WVGA 5DN6D 3PPWA 2EAUA 2R1VB 3TQQA 1Z07A 1T0IA 3MINB 4ZZ0A 3ZOZA 1XKQA 3DAHA 5G4KA 4AO7A 2YV5A 1XT6A 2FP4B 1RLIA 4UDOA 2RAUA 5FBZA 5IVDA 2VDWA 1XN1A 2QR5A 4X94A 2AOUB 5MFPA 2X1HA 1EFRA 1KI2A 2WTNA 2VJOA 3MS7A 1X7XB 2NG1A 2ZR8A 2IUSA 1CR2A 2MSDB 3CR3C 5HQ3B 3O7WA 2RGNC 4BNHA 4D4LA 1GCAA 3T1QA 2W83A 2JLSA 2BCGY 2IDZA 3GN2A 3ONVA 4MVCA 1VBFA 1ZINA 4OCZA 2C7BA 4Q1BA 3WDKA 1XFAA 3CLRC 1RXUA 1A5SB 5EI5A 3X43A 1VLHA 4YCMA 4WGFA 1CIJA 3RF6A 3QWFA 3UK6A 4EIWA 4FHCA 2IRWA 1NQ5A 3PQEA 1OIVA 3I64A 1JG3A 3M6FA 1T3LA 3NVMB 2HMUA 4C30A 3CZ4A 1GQYA 1IZ0A 3EX7C 3KTAB 1YDWA 2Q3CA 1Z16A 3DOHA 4LTNA 1QHFA 1YCGA 2CZCA 2D2FA 5AD1A 2I8LA 3OJOA 1ST3A 4KSYA 4PS1A 1BXGA 3VR5D 3UMYA 3E3OA 3RF7A 3CZQA 3GVPA 4EB0A 3LM8A 1CUBA 1QAOA 4Q5IA 4EJSA 4RFSA 2VDOB 2RHHA 3K9GA 3ND8A 1TAQA 4PIPA 1QQ6A 5F4JA 2QYOA 5BSUA 5KX5F 1X1RA 1UDXA 1A8HA 1CY1A 1YCDA 2FZEA 5FCDA 3EF3A 1RLJA 3HE3A 4BO5A 1XEWX 3BMXA 3THYA 4ES6A 4TV8B 1OAAA 2G88A 1ZP6A 1MH1A 1ECJA 2QG4A 2HA7A 5KAMA 3WIEA 3A2KA 2WSMA 3I2FA 5D85A 2ZE7A 4B2PA 2ONCA 3A2MA 4E5DA 4DQVA 1DELA 1O9HA 3S2YA 2VATA 4GOKA 1JQKA 3FUTA 3ZK9A 1Z6QA 3KOWA 2C2HA 4Y6GB 5DM70 1UBRS 5ABPA 1HETA 1T0BA 3MELA 4BVHA 1FFYA 5CB4B 1R15A 2WWTA 2QI9F 2Q3EA 5GWXA 3VR5H 4UCQA 3VRHA 1DU4A 1KJ8A 1UM9B 3M5PA 1KIFA 3ILYA 1W2HA 5EWJB 4Y2UA 3DHVA 1J0AA 1R8QA 2I8AA 3B3FA 3PC4A 5B57C 3AERA 3NPMA 4MV9A 4JVSB 2HO5A 1Q0LA 5JZMA 2NSYA 3ICQB 1W85A 3FZYA 3NRBA 3GDWA 3QVGA 5CDFE 1J8FA 1W6UA 3VPGA 5ECWA 3W5SA 3MMSA 4E51A 2FGJA 3FKSD 2VNSA 1VHTA 2C9CA 3AR2A 3P32A 4Z4FA 1V1MB 1WOOA 3L0SA 4B4OA 4W8OA 2BZGA 3FAZA 2ZK7A 3LK7A 3LUFA 2H5IA 4CCSA 4M4SA 2HK9A 4QLAA 4QOIA 4X93A 3KWJA 1E1QA 3OP4A 4ARVA 1ONBA 2IVZA 1AHHA 4FOSA 2I8CA 5KSWB 5AK6A 4LZJA 3TZQA 1XHLA 4IZOA 2YZKA 2IYOA 2EGHA 3ZE2B 3QA9A 2V7QA 1SC6A 3E70C 4DUGD 5THXA 3M4YA 3AWDA 4J4HA 2PA0A 1K5DA 3AHCA 3IVAA 1VLVA 4XM1A 4ZO9A 5EYPB 1P61B 3D8UA 3OIGA 3PGMA 2F1MA 1XJWA 1YMQA 3KVOA 4G85A 1M2FA 4PWZA 2H2IA 1IQUA 4BMOB 4BLWA 2RHJA 1DAFA 2QK4A 2YUTA 3ESBA 4NG5A 4XVCA 2H00A 1ZH2A 3N3AC 3VZDA 2Q6KA 4PXSA 1YRLA 1G21E 4X44A 4P1ZA 1GNVA 4V24A 2R4UA 3RAGA 4KXWA 1LA2A 1HH4A 3C8ZA 5AM5A 3ZCXA 4RY2A 1JTFA 5EQTA 2FWAA 4AULA 2CGEA 1K8AD 3JQQA 2OUKA 4X1KA 2HNBA 2PANA 2ZRHA 4JOCA 1KBOA 2PKCA 3FYUC 5EMJA 2Z43A 4Y2RA 2DY1A 2A8YA 3CLUC 1XNRB 3I53A 1P74A 2BZSA 3ROFA 3ELYA 1SURA 2WYRA 3GLQA 1HE8B 4F5DA 4IVQA 1G8SA 1HDYA 5BVGB 1WL8A 1A0OA 1QUEA 1RM4A 1WCXA 4GI7A 3RUFA 2FKAA 3RIYA 4R0VA 1VB3A 4YP9A 3SICE 3PFKA 2FG7C 4C5BA 4ZCTA 3HRHA 3IT1A 2WK1A 2JJ1A 1JKMA 3BEDA 3QPCA 3B7PA 3VZQA 2PS3A 1C3EA 3LFUA 4DWJA 1KFJB 4LQDA 4E2ZA 5CX4A 2CMFA 4CUZA 2FPGB 5EZYA 4GRDA 5FA5A 5BWLA 3QKTA 2RHLA 1K8QA 1SOMA 2VSQA 3SI7A 2AKEA 3QZUA 4NC9A 3WBFA 1S1MA 1P80A 2GEJA 2XLCA 4Z7JA 4X20A 3SF0A 4WUVA 3C3EA 3S0JA 5AVYA 1FSSA 2Y67A 4LX0A 4CM4B 1J0EA 4LJ4A 4K81B 4W7SA 5CTAA 4H6VA 1PV1A 1KDYA 3ZDRA 1T6YA 4DA4A 3EPPA 2AYXA 4ESVA 1NF9A 2GLXA 3R6TA 3JAWA 3B13B 3PHJA 2OQVA 5A5DA 5LXTF 3UAYA 1MOPA 2GM9A 3GLHA 2CFTA 4B8YA 2J6BA 3CS3A 4F1KA 5C37A 5HKOA 1FXWF 4Q47A 5DSTA 1TM2A 3EFOA 4UVHA 2O0LA 5ED0A 3K0SA 3WV5A 1XKXA 1HPLA 1A5ZA 1GL3A 2RJOA 1CT9A 2EWVA 1YL5A 4CXMA 1IUKA 4UMFA 5HA5A 1EPUA 2QYTA 5BXYA 1JLLA 2IU6A 3REOA 3TLZA 4ENUA 4YAGA 1RQ7A 1QPBA 3RFXA 4G5SA 4QHTA 1VBNA 3SIRA 2Q0HA 2X5NA 3CNBA 4OATA 1HI9A 5FOUA 3ZWDA 4DM7A 5TVGA 3AP3A 1YBVA 3OPQA 2MSKA 4PQFA 5BOSB 1OH7A 3STUA 4M0FA 4RIFA 5IS2A 1CKEA 2YFHA 2B69A 1N0UA 3B70A 3ZK8A 2PGLA 4ZKEA 4BU1A 1BW9A 2CMKA 3U31A 1TUGA 5IYQA 2J0UA 5C1OA 5EHZA 4BXOA 3WLFA 3CLVA 1FLAA 1XZQA 4MDEA 1L0BA 2FEPA 5JLJA 5DGDA 1RAAA 1PNTA 1W75A 1N2CA 1PZHA 2OCBA 2QT0A 5HHTA 1TRHA 2R00C 1E2EA 1T2VA 1A9XA 1PZGA 5HP4A 3FCUB 3FW1A 3IUNA 3AIMA 5D7BA 1LRJA 2GVNA 1PP4A 1U7DA 2IP1A 3QBDA 4FCWA 4MUIA 4TMKA 5CTJA 2GD0A 4MB2A 1O6CA 3C4QA 1K2WA 3DBOB 1GLNA 1KJWA 3PUYA 3ANTA 3TKYA 3WLMA 3TLYA 4M2LA 1U65A 3BMCB 3GAMA 3AH8A 1XCJA 2YDXA 4V0ME 2F3SA 4IMPA 1EINA 2JGFA 1SY7A 4ND1A 4QFCA 1JI0A 3MA0A 1KSGA 3LPMA 3OQJA 2J3EA 4IDQA 2W2OA 1EA5A 3ZE9A 4BE4A 1TZMA 3ZVKA 4DLWA 3KHSA 1Y33E 4JYPA 3UMCA 1P2GA 1ZMXA 2DOGA 1FFAA 4NBTA 4Q3KA 3SFTA 5BW6B 5JY1A 3OPMA 4IFBA 4FN4A 5DU2A 1PNVA 2HU7A 1ZD2P 1W0CA 1ZK0A 2YY7A 4W9NA 5C8XA 4RZHA 4W9NC 2EGUA 4ZOCA 4ZEWA 1Z6YA 1A76A 4DRXA 4QTUB 5AKXA 3WR5A 4OGWA 1XO1A 3HYTA 4GYJA 3W34A 4AZWA 4ZYXA 2D3LA 1DG9A 4FXOA 2Y6VA 3DMGA 2ZSAA 2ZWOA 3KUKA 4AUMA 3DFKA 3O90A 1LJ8A 1SXQA 3KSZO 4C0JA 3P4UA 4QLOA 5I4CA 1ZIXA 1Z6PA 3CX6A 2E4ZA 2HUPA 3NHMA 5AJHA 4YUYA 3V34A 3CLSC 4P3KA 2BKUA 2C96A 1H8HA 4IIJB 5JQGF 2H54A 1WQ4A 5CMLA 4MW2A 4RDJA 2W7TA 1EMDA 1UFQA 3TCXB 1NW3A 1XSEA 3L4EA 2FEMA 4RCVA 2V7UA 1USUA 2YMMA 4J0EA 5JS8A 3VSDA 3ZPNA 1RJGA 3B6KA 3HBAA 3QWIA 4HTFB 3S1AA 1WNTA 4EQ6A 1P8AA 3DFMA 4DB4A 1YI0A 3MTGA 4LJKA 5FQOA 3TD9A 1YJWB 7ABPA 4EGQA 4R16A 3J81A 2GF0A 2P1RA 1F48A 2C88A 1YJBA 3ZWXA 3K70C 5FR1A 2B8JA 1DKRA 1U3WA 4E4RA 3QXXA 4TWIA 5LZ5A 4EQZA 5LP6A 4GPTA 4MGKR 4HXYA 4DJFC 1CF2O 3WNBA 1GZ7A 3SZOA 5AVTA 4HBZA 5LQRA 3UJAA 3UH0A 5MDHA 2VQDA 4HKTA 3JS5A 4K2HA 1E3DA 3K94A 4YI3A 1E61A 4IXWA 3RT9A 4D8YA 1NDQA 2JI8A 3MEQA 4ZGNB 4RVGA 3G2IA 4RVSA 2P6NA 5KNCD 1E3ZA 4XWTA 2N9UA 4AXXA 1NXQA 2VBGA 1SBTA 2QN9A 2FSUA 1WCIB 2Q29A 4RZUA 1UFRA 1VI5A 1OGIA 4RKFA 4WDRA 5CCBA 1IJKA 2I66A 2KM1A 3C5WP 3BQMB 3R2JA 4X1IB 2FZLA 4L8JA 1XZMA 2ACEA 2EWWA 3JQ8B 4B8WA 2JLCA 2BJHA 1QGZA 1M90D 1X87A 2ZCVA 5CDFA 1L4UA 4JEMA 4YJGB 2MCFA 2P68A 3NBUA 4H4EA 4DQ0A 1N1DA 2B78A 2DMRA 4US2R 3RRJA 5DSZA 1R5NA 2PH3A 4TTTS 5KYUA 4I81A 4A0GA 4PIMA 4F3TA 3IVMA 2P1DA 1U3UA 2VEDA 1B15A 1TECE 2AGVA 2JH9A 3CF4A 3D6UA 3FRJA 4R7ZA 4CLRB 3Q85A 4QXMA 4C0XA 3L82B 4FYKA 4GRIA 5DX0A 1XUOA 2FF7A 3MCZA 4XFKA 1N5LA 3PDJA 3ROKA 4I9FA 1Y7IA 5D6NA 3WGJA 1U2RA 2JGAA 1JZSA 4FS3A 3AFIA 4QOSA 5YASA 1I6KA 3ZWKA 1X70A 1NTRA 3UW3A 2IHTA 3V7WA 1U7XA 1A9TA 2IZ6A 2UZ4A 4RPDA 1K66A 1Z7EA 4C0BA 3B7WA 1XK7A 1L5RA 2VHWA 4R8RA 4LHWA 1NBIA 1JEYB 1JWBB 2G9ZA 1J9GA 2ZJ3A 4A10A 1CF9A 1KPHA 4G36A 2PGNA 5L40A 1G5QA 4TKVA 1MAVA 3DBRB 3GT0A 3R7SA 2XMPA 5GJCA 1S2IA 3RJ5A 4L51A 1YHNA 5F2KA 4BWVA 3RAPR 1YJXA 1WHSB 3NCTA 5AXAA 4FSHA 4D81A 1GPNA 2PTHA 3FNFA 4PRLA 3E9ZA 1OWOA 3A7DA 4EECA 3EAQA 1KS9A 3BH4A 1Z6AA 2WNSA 2XSZA 3D26A 3FDZA 4AU1A 4E12A 3IP5A 4F11A 4U2FA 4S1NA 1Y4DE 3G7SA 4WEOA 3F4KA 4PZDA 3W77A 3LC2O 4DG9A 4A82A 1DSSG 3ZWMA 2VTBA 2O8DB 3KETA 1G42A 2OM6A 1LBSA 4Q24A 2QD2A 1GZSA 3JV7A 4I0WB 1GD1O 1PR1A 3QOYA 3OPVA 4FQ7A 3T9DA 3TSAA 3PX3A 1NX6A 3PX2A 2GPYA 4O33A 1OXKB 5HGJA 1GXSB 4RLZA 4IINA 3E22A 2M5SA 4J7UA 3TINA 2YZNA 4UD2A 1MXFA 1PD1A 4KW7A 4WNYA 4JOSA 3NFYA 4O0MA 4RX1A 3L7DA 5KKAA 3UK7A 5IKMA 5JSFA 5K3BA 3T9BA 3VMFA 1II9A 2WWHA 3FYHA 4QPJC 3VR4A 5D8DA 1LD3A 2IXEA 3PXXA 4W1QA 1SUFA 2QG9A 1G6HA 5CH5A 3TZLA 5EIWA 1QORA 2KMLA 2YXPX 3DEYX 4X1OA 5CPFA 3AV3A 5JNWA 3TECE 3NYQA 4MYCA 5KQLA 2IHZA 4MR9B 3NNDA 1AUXA 2RKWA 4CIXA 5BYJA 3ZJYA 3UPUA 3DOFA 3U4QB 2GQFA 1NZFA 3ZWYA 1PGQA 2I2WA 4JB0A 1BJKA 3N0WA 4JFAA 3ZI4A 2IKQA 3N0RA 5BN3A 3HO8A 4QO8A 2F1KA 2XQIA 5ALSA 1I01A 5FL7D 5C8VA 2PV0A 3G1UA 3QVTA 2EJBA 1A2KC 3GGJA 1QF7A 3C7KA 1GTRA 1C8VB 4Z4HA 3ZZ0A 1V8PA 2DBQA 5JNSA 4S04A 4BRZA 2PH7A 1FMFA 4BX3A 4KSBA 3F90A 3O8QA 1CBUA 4MO2A 1SCKA 1MNAA 2PX3A 4MUGA 3RREA 4Z2YA 2ZWPA 2BGMA 3C8DA 1Y82A 1QHXA 3TK1A 2ET6A 1FSPA 4A8HA 4Y6RA 4JLPA 4NABA 3KPUA 3A1PA 3RYIB 2VZEA 4G5QA 1TQ8A 3GF4A 3UV3A 1K97A 2D1FA 1HTTA 2W0MA 3O1LA 4GI3A 2FZGA 4K9MA 2CLLB 4M8NE 4HNUA 3S81A 2JJ8A 1DZIA 3EZNA 4CEIB 1XTKA 4DADA 2VT2A 1TA9A 5JFGA 4CDMA 4PGOA 1DWOA 1F2UA 2JRLA 3R5FA 1UCFA 3HB1A 4LHEA 3B12A 3WLOA 2DLDA 2WMDA 3R40A 3COVA 4NZZA 4QUHA 1WETA 1E7RA 4G5FA 4HX2A 4PLGA 2IV7A 1R0BA 4UHCA 4XB2A 1PR2A 3DZCA 1IY8A 3SS9X 1AO3A 2C8VA 3IE2A 1VQMB 1YIDA 3OOJA 4MW1A 3SBDA 1KMIY 3NNSA 4ZIRA 1Y48E 5A4AA 5K0ZA 1U3FA 2AG8A 1LNZA 1KRXA 2PNJA 1XFOA 1BWQA 5A4JA 4CMHA 1NUUA 3ZJVA 1PAUA 1CJVC 2IS1A 2E6UX 4YS6A 2P9QA 4YRGA 2UVPB 2W2MA 3FETA 4MQFA 4AMYA 4KRYA 3VU0A 1S2MA 4XOPA 3CVOA 1U9YA 2CJYA 3NWEA 3WLTA 2IYZA 5DHUA 1VHEA 4XKVA 3OCUA 1Z5UA 1NN1A 2VCHA 3BM5A 5CVVA 5DRYA 1ZXXA 2HRDA 4ZVMA 1BA3A 2C3UA 2WPDD 1V9SA 1E2FA 1EB8A 4S3MA 1OB5A 4AQYB 4CV3A 4ARZA 1THZA 4I1RA 4JGGA 4KIWA 3MMXA 2VYVA 4NCJA 4Z8XA 1BU8A 4LW8A 1LVUA 2CZGA 3GPIA 5T4BA 2A0FA 5J2UB 4DYVA 1NVBA 3VO8A 4QQ8A 4UXHA 4KREA 4KLAA 4O4JF 4RNDB 3TR6A 2G36A 3E8SA 2YASA 4QU0A 3VR1A 3BVPA 4WUTA 4HDRA 3C41J 1ZW6A 1VSQA 1OXVA 2GN0A 4FCCA 2ZI7A 3S40A 1RKVA 2DFPA 1WOYA 2DQSA 3V97A 2OFXA 1VDMA 1OZFA 2DWQA 5F5LA 2C03A 4GSYA 4MNTA 1T3GA 2WG1A 3FTPA 5K3DA 5B12A 1TF5A 1LJUA 1M7BA 2OBBA 4G4SP 3SZUA 3N39C 1DEOA 2Y1DA 1PWXA 1J1UA 2H5LA 2O48X 2KW5A 3B6ZA 2VJMB 3H42B 2C94A 2DWCA 3WAGA 1T36A 1KSFX 1UDAA 1M6YA 4KQFA 5EP2A 5DX1A 1ZGZA 1Z63A 3NIDB 1QTQA 1ESZA 3V1UA 1WP9A 1EM8B 1XVIA 4R1MA 4Z1MA 3IHTA 4XJTA 5HRAA 5DHAA 1CR1A 3KXIA 3IPAA 2ZTHA 3A1FA 4H7FA 4YJKA 1WMBA 4R2MA 2QD1A 4JQZA 4G23A 4QELA 4V0QA 5B4TA 2Q0XA 1AHNA 1O54A 2I71A 4ZDIA 3WGNA 1MMFB 3ASVA 5BNZA 4MKZA 3B48A 3MCWA 1SVWA 3H1GA 1EFLA 3NP9A 5J4HA 1OQAA 1YRBA 2X9LA 3ZEIA 5JQWA 2I7TA 2W71A 1TA4A 5EGSA 4AVYA 4Z51A 1SVKA 1KO1A 2ZS8A 4KGXA 2ZBVA 2CNWA 4JJFA 4BVEA 4ZYLA 1V5VA 1W5AA 2XMDA 2IK8A 2ZT8A 5J3JA 1CTQA 4LXTA 3R3UA 5J58A 3IX7A 1P5FA 1ATZA 2VZ8A 3SC2B 2AI2A 2YWBA 1CQXA 3WAJA 5AVQA 4P2NA 3ABOB 4R9NA 2B4QA 4C9BA 4CKEA 1GOTA 10MHA 5G0WA 1VRCA 2I1VB 2B4YA 4BQRA 4FBGA 3QWAA 1HT2E 2FEXA 2OGWA 4B0OA 4MPJA 1R9GA 2O19A 5FLYA 4FILA 1A5BB 3K4QA 3NDIA 3RSZA 3S28A 3ZGLA 3M1YA 3T1HB 4FBLA 2A9RA 2EKPA 2IY8A 3HN7A 1E7YA 2EHDA 1XLWA 3JWPA 4ZQFA 3SYTA 3SY8A 2BEWB 5HZMA 2NO5A 4CF3A 3IKTA 1OD6A 3B1YA 3SFVA 2FPUA 5K01A 2O0JA 2NZUG 5IDQA 2VDRB 1CX9B 2TMGA 2DBZA 3NHUA 4RANA 4ZCPA 2AOXA 4AMGA 3JU3A 4MYTA 1GPLA 1TKRA 5M3BA 4JI3B 2G76A 4PC2A 2PXAA 1C9DB 4BNGA 2QEXB 1IB0A 2PUVA 4ZZ1A 2WM9B 3G1WA 2O5EA 1P3JA 2BR3A 4B47A 4RVHA 2J3DA 4YAOA 4PC6A 4PQRA 4PQGA 1Q9SA 1Q19A 2VF8A 2QM8A 5EWMB 1OIXA 3RSOA 4XVUA 4CMCA 5CDGA 4DILA 5KX5A 1QWSA 4D25A 4PY2A 2X53S 1UBJS 2UV8A 1J42A 4OHBA 4XGKA 4B34A 4ITUA 1UC9A 1ONSA 2A3NA 3T0IA 3C3XA 1J24A 4RA6A 2Y6UA 2I87A 1VP3A 1XZDA 5F77A 4UHDA 4CLOB 2AJDA 2ZJ0A 3DOJA 3K32A 4GLBA 3A4IA 3CV3A 4RK7A 1EGAA 3GG9A 1XZBA 2C1XA 3I5XA 3HVHA 2QM7A 3VV3A 2E5LB 4ARCA 1ZJ5A 4L08A 2JFWA 3C7DB 4NBNA 3PICA 5ARCA 3F3KA 1OLUB 2QI9C 4RETA 3VO1A 1E9RA 2R1TA 2QTNA 3CUTA 1Z5VA 4HUQA 1K8XB 1A8UA 1N0HA 4FM9A 4HB4A 4QDOA 2FWIA 4X5OA 3CX7A 5DBFA 2B7LA 2BI4A 3IT3A 3KQSA 5HG0A 1KE2A 5HKKD 4GBJA 1ISIA 1N6IA 4R2LA 3UTDA 2UZ1A 4HAZA 3WFIA 2YIJA 1Y34E 1UXGA 4JYAB 4KMOA 1Y1RA 3LSTA 3WL6A 2NXNA 4LNHA 4X90A 5EPOA 2NN3C 1GGMA 3GEBA 4G1FA 3GT4A 1X2BA 1SUEA 3AEXA 1TEHA 1ACLA 3CF6R 3OKCA 1H2HA 2YNMA 4QT0A 5H3LA 1M1ZA 2RKOA 2YNMC 4XLCA 2JI7A 4EVIA 2JHPA 1GR0A 2ZWAA 3DS8A 4IUCS 2XNDA 4RCYA 1M6VA 1ZQ1A 4DNXA 2HB6A 5K3EA 1H05A 3GARA 4X1YA 3OLQA 4R71A 4JT9A 4X95A 2C9BA 4D82A 1YITB 3DCIA 3DVSX 1ZN8A 2X8WA 4B0PA 4GI1A 3TLGB 2DBVO 4ZHSA 4QUJA 1IDOA 4JYBA 2HK7A 3R0IA 3NC1C 1R27A 1U6IA 2YVAA 3U3KA 1N0VC 3FVRA 5ALDA 5B7NA 2ATIA 5E3HA 2X58A 1QHSA 2OBTA 1YI1A 3GZNB 5TV2A 3PDWA 1OU0A 3EE6A 4B3CA 4LVNA 4QU9A 2Y05A 2ZIXB 4LDNA 3RO7A 2DU8A 1NRJB 5JJLA 2PKQP 4MVJP 4OD0A 2QL9A 3VDNB 2ODTX 2I54A 3CKKA 3IEUA 4O4JB 5ALUA 3TEJA 4DLNA 2VBFA 1VQ4B 1AUOA 2PCLA 4ME6A 2IYAA 1A8QA 4P7FA 4FYIA 1J25A 3GGGA 4QASA 4G6IA 3STVA 3IE0A 3AF3A 1UBUS 4LECA 4O2RA 2AFIE 3VTKA 4YRBA 3L0OA 1VGRA 2YQ5A 4LF7B 2EX4A 4OHWA 2HU2A 5C8ZA 4B3FX 4URYR 1X74A 3NHBA 2OMEA 1TJ3A 4D8WA 2PRIA 4AIRA 2WSIA 4LVCA 1DEXA 3L8EA 4QUGA 2J6IA 3GVXA 4R2JA 1D4ZA 1VIMA 2ERYA 3IEMA 4Q1EA 4TTJA 3DBHB 5L3VA 1I5EA 2QRKA 1Z28A 3O8RA 4EMUA 4FK8A 1ADBA 2BSQA 4ZGWA 3PC3A 3HJUA 1JQAA 1MTZA 1KJ9A 2LTAA 3V3TA 1AT1A 1MA0A 4G0QA 1IXRC 1GILA 3BSSA 3GXOA 4D0SA 4RADA 2JCYA 4R84A 3K9CA 4XE5A 5IT9A 1PL0A 5U4QA 4WE3A 3G5UA 2R7KA 3H11B 4LZOA 1Q7TA 1QVWA 3ZZMA 4YMTA 1A9RA 2P4HX 2UVDA 4WA7A 5A3RA 4L4XA 3NAZA 3SKXA 1G20E 1T29A 2MOKA 3SXUB 4DCNA 4RIEA 1Q50A 1XCPA 2C4WA 3DBLA 3EXFA 4JLMA 2I78A 1Y4UA 5AWFC 1PJZA 4BO9A 5HZHA 2H29A 3O93A 1JG4A 2R87A 1U2DA 3UCXA 4YJHB 4DMKA 5LXTA 3GJ7A 1Z13A 3WIUA 1B2RA 2JS7A 1FXWA 2R3SA 4D3YA 5C4GB 4ZK6A 2W6ID 4OQZA 4DZRA 5JNLA 1MIOA 2XR1A 1Z3CA 3F5DA 4L1KA 2BMEA 3H8SA 2RC6A 421PA 5F4BA 3IR7A 2A5FA 1JX6A 2W8BA 1O58A 4ARSA 3VR6A 2J9YB 2YVQA 1SKMA 4ER0A 4PPNA 4F9GA 2WE8A 4CI9A 4BLSA 1Y80A 4NIMA 4F06A 5A2GA 1V3QE 4PXYA 3NEYA 1SUSA 4WZAA 1TCBA 1TVKA 5IYRA 2OTJB 1UINA 3OJXA 1M2OB 1XCLA 2CXSA 4L8VA 3GAAA 2V6MA 3OE4A 3H05A 3ROEA 3S2UA 5HX7A 2CKDA 5BSYA 3I39X 2GM5A 4NJEB 2ATVA 3FPCA 4KVAA 3IKVA 3KC2A 3CMEB 3NYWA 3GNQA 3RYTC 1NU8A 4B73A 5BSGA 5L9AA 3CEMA 4P26A 1Z7YA 2ONZA 3WNDA 4ZRNA 1EUDB 3TBKA 3FGZA 4B7AA 1VG9B 2OG2A 1NY6A 3GJ6A 5AHWA 4YLYA 3O91A 1NJ5A 3ITKA 2ZUEA 1WVIA 1MEJA 1OE0A 3KAJA 3KU4A 1M2NA 2O0HA 3L8MA 5TY0A 3WWCA 2P9CA 4H16A 3Q7EA 4DCGA 4CM7A 3LCUA 2YR0A 2FR8A 3MZ0A 2PGOA 3Q72A 4M9QA 2I7XA 2FR8C 2CFOA 1E9DA 3OUZA 3NBQA 1KYTA 4X60A 2FMUA 2GO7A 3V4SA 1X7YA 4FI3F 3DCNA 3DXFA 1DIRA 2AXQA 4IDEA 3VZRA 1M6EX 3JD3A 4K9KA 3WB2A 1HTBA 4D96A 4OMCA 4B3HA 1W96A 1VL5A 2KLBA 1O0SA 2XCRB 5DM60 3ASZA 3MT9A 4DV7B 1O2DA 2QRQA 3E1KA 2XXBA 3CWCA 3FMOB 1GZ5A 1UDBA 1C7ZA 1NQUA 1Z56C 4E5VA 2F9FA 4KP7A 3CINA 2QGZA 3M1LA 1O96B 3VAZA 2XDQA 3V3KA 1ORIA 4PHFA 4AICA 3VTAA 2Z8YA 5CK5A 1VKZA 2X0DA 3WGMA 1CW2B 1XYVA 2JLVA 4NVRA 1ZNWA 2H1FA 2CYAA 5IM4F 3T41A 3GGSA 3UT6A 3AEKA 1WNFA 4FWBA 3KQLA 3ONWA 1GPH1 4FXUA 1U2SA 1NE7A 3LUGA 4Q4LA 4CMBA 3QXJA 2WQ6A 3HL4A 2EFYA 5JQGA 2MSWA 4ALJA 1M34B 5DBIA 4V1CA 1Z25A 3PDHA 2ZT7A 4QM7A 3TRJA 4KQ9A 1U4OA 3EFBA 2WHEA 3TE7A 1Z38A 2GHIA 1PX2A 3HKBB 1K3UB 1YQDA 4G8CA 2YRWA 1TAUA 1QH0A 2FUEA 5AP9A 3T7CA 1SBIA 4H3SA 2R6ZA 2VPYA 2JAUA 2PU5A 3U4IA 3LNCA 4FGSA 2VVTA 4CIVA 1FMJA 3GI1A 5JYEA 3W2FA 1RPZA 3S2SA 1K92A 5E4YA 3THOA 3U9TA 2YN0A 1EUCB 3P0FA 2AIRA 4LOHA 4EYKA 5KWJA 3AHIA 2GBIA 2AQHA 2VTKA 1GG2A 2ZRMA 4DMMA 2XA2A 5B1IA 1CVRA 4DIOA 2BMVA 1XAHA 4X84A 4Q9JA 2KWIA 2CUKA 2QAJA 3VU9B 2WSBA 3AJEA 1O94C 4YXWA 1IOLA 1YS1X 3K0FB 2E4YA 4FOTA 3TTSA 1VJ0A 1O5TA 4B3SB 5JS6A 4L76A 4OG2A 2BLNA 3VNSA 3ZV7A 2G6BA 2J07A 4JOQA 5FV7A 3UMRA 3KQUA 4F4JA 1XMPA 1E0SA 1I4DD 1Q3TA 1US8B 2GFIA 2O1EA 2PH5A 1WZCA 1SFRA 4RLHA 1DEAA 4YDSA 1SVSA 2BGIA 4B40A 2HDNB 2HBQA 4DPMA 2C7RA 3GFTA 1WS6A 2Z6VA 3I76A 2Z4TA 2IXTA 1RMTA 5HIMA 4KDFA 3MFYA 1WY5A 3S99A 1F38A 4E5UA 3VH4A 1RWNA 4DA6A 4DIKA 3K35A 3W79A 2J3QA 2JAPA 1C0IA 3IUMA 3CG4A 2JA2A 3TMAA 1QKJA 2B21A 2VQEB 3WZMA 2JIOA 3KL9A 2C98A 4M8SA 3D7NA 5BT9A 1MEEA 2CHUA 2XF8A 1RIFA 3E2IA 2D5IA 1B6TA 4NYJR 1VB5A 2C5SA 2BMFA 2UYOA 4RC9A 2XOKD 1HF3A 3RVOA 2VCEA 2X40A 3NTRA 3FB4A 3HA3A 3GV0A 3SOZA 3NDBB 3GNSA 3IQFA 4IRUB 1ST2A 3NU1A 5T41A 1QYCA 5J4VA 2IDKA 3THWB 2BEUB 1WSDA 5ICCA 1BFUA 1SBZA 3IB6A 2VO1A 4ZU6X 4EJSB 5JSQA 4NZNA 5L7TA 4RFSB 4LF9B 4OX9Y 2ZJZA 4DAEA 3AKEA 1KNXA 1WZNA 2GUWA 2IUEA 5IVKA 2XUFA 3HEMA 5MGNA 2Q49A 2JBHA 1C8LA 1OI3A 3ZTWA 3UAVA 1YQWA 4H3KB 5KDOA 4NAVA 3THXB 9MHTA 3ENZA 2W2VA 4EW6A 4EY5A 2Q07A 4INZA 1AZTA 2QTVB 2R6R1 3CUYA 3HLYA 1YZTA 3MM4A 3CLTC 4G0MA 1M1YA 3THYB 4MYUA 1E0KA 1H93A 5JO0A 3BCFA 4GYYA 5HCIA 3ENKA 3MRSA 3TSOA 2AFIA 3P97A 5DI3B 3ZDDA 3QRWA 5HF9A 2Z9DA 4AN1A 1HSOA 1P0FA 3PA6A 3KAQA 2AXNA 2VOEA 3U7GA 5ECGC 3OWOA 3RSCA 4M89A 2PAAA 4NU0A 1J2TA 3FVWA 3IAEA 4QDJA 4RH0A 2QRUA 5DXAA 3X2FA 4EA6A 4NAUA 3K9HA 3BJEA 2WT8A 3I55B 4DFDA 5CB6A 4YT8A 2VRCA 2HY7A 3D9QX 4H7HA 2AXPA 1LLUA 3GLKA 4XD7A 4R6WA 4OYLA 1ND6A 2AWNA 1CUEA 3MJ4A 3KQVA 1YDFA 2GJSA 1D4OA 4WKCA 4URUR 2OE2A 4JJ7A 4EY4A 3SF8B 5HUQA 1L5HB 1BEEA 1SO8A 2QXUA 4F5YA 2WIGA 1SUDA 1WOSA 5DN6A 3L8HA 3GJ5A 3QLTA 4FGZA 3CU5A 3ACBA 1I5RA 1OW3B 1FYXA 5E9JA 3ZHYA 2WQZA 1G20A 5GZ1A 1CIPA 2HQBA 3ZIAD 1JKFA 3FF4A 3KZMA 3X1DA 5L4SA 1JSCA 3I6BA 1OGYA 3I1FA 4X8LA 3F98A 1OBFO 5CLIA 2ACWA 5K8JB 3JQ9C 4LRWA 5LB2A 4YR9A 3LDAA 3H5AA 4IG9A 2ZUBA 1Q83A 3H2GA 2ZKIA 3KDPA 1BVRA 2ZZKA 3S55A 3FZNA 4EB3A 4F2DA 3A9RA 5D3MA 1K6MA 5A7HA 4Z3KA 1B0ZA 2G71A 3M3DA 4IR7A 4MCIA 2J8ZA 2BRUA 5IC4A 4DNFA 2PSDA 3AKDA 2GXSA 2BRUC 2XHZA 3HMKA 1EVLA 3NXSA 4YAJA 3R3SA 5HZAA 3V7AA 4TTPA 3CZMA 4OHRA 1PSDA 3EUFA 4Q3EA 1UJNA 1OHHD 2NUPA 2HV9A 5FPTA 5IF3A 1N77A 3PWZA 4JVOA 2WI8A 3QYAA 1E89A 2Y0EA 1PHRA 3C1AA 2PJDA 1W6RA 4MV8A 4ZMBA 2HA5A 4C0AC 2NYRA 2XCQA 2ZTUA 4K6HA 4MQEA 4TMFA 1UXJA 4BX8A 4ZOQI 1QP0A 3D4OA 2DJIA 2J1LA 1T4GA 2O1WA 3PLRA 3E7WA 1ONOA 4XJSA 5KU7A 2PAFA 2QTCA 4ZEOA 1EUZA 1MPXA 1XXLA 1ZCJA 3BK7A 2ZEJA 5F35A 3T9FA 2H5EA 2FZVA 2QX6A 1E4OA 4DCMA 3WSTA 1NBAA 2PH1A 4OB7A 2K87A 1JHVA 2DTXA 4U7TB 5IARA 3W6OA 4YY3B 1FRZA 4Q4JB 2VWHA 4H08A 2LCIA 4FKMA 2YHBA 1E5VA 1E43A 4KN9S 3DA8A 4MWGA 3ZY6A 4X6YA 1DAPA 2VPIA 3QYFA 5TIIA 4JR0A 3ULKA 3A27A 1AS3A 1M10A 2DZDA 5AW3A 2TRSB 1FDTA 5JAZA 4ZXPA 1XC7A 3FUXA 1DQYA 3HXKA 1NN5A 2PY6A 3GFFA 2V9CA 3WADA 4IFTA 2BGNA 3OWHA 3OOSA 4KPEC 4D9CA 1CG6A 2QE7D 3CSSA 1NW7A 4HAWA 4WCFB 3EOBI 5JPIA 3ICWA 4O4HA 1NHWA 3CNOA 5ITSA 1EK2A 3EJ6A 3F7MA 3QKSB 2DKNA 3T9CA 1K98A 2UYCA 2QL6A 2ZIZA 4OP2A 4KR2A 1JXOA 2JJQA 5LA6B 4XN3A 1AMUA 1V45E 4UZUA 2FMXA 2M2IA 2VEOA 4PCAA 3RCBA 2G04A 4DLPA 2Q28A 3MAGA 3ZK7A 4WESA 4LN1A 1UR5A 4ZOBA 5JOQA 3R7FA 4FFOA 4WI1A 3AUTA 5C7LO 3K0AA 4XSGA 5CNJA 4BNFA 1V25A 1ZC3A 5EKDA 3D8SA 5BWMA 3WL4A 4UOEA 1RYFA 3EISA 3N70A 3ZZNA 3MJDA 4Z7OB 5DCUA 5GV8A 1E6LA 2ZTSA 2BKEA 3MBKA 5K3CA 5K6AA 3VHLB 3G0OA 4DANA 3W6NA 1JNXX 2AR0A 2ZIEA 3K8YA 4E11A 1R66A 3ELUA 2I1WA 3FWHA 5J43A 4GLOA 3FMGA 5CEEA 3GK3A 3U2QA 4FEYA 4BV2A 4I9UA 3OF3A 1DHRA 2YJ6A 3C6BA 1IZYA 3EVDA 3PBKA 3NVDA 3U4GA 1BOFA 2QN7A 3LY5A 1P4JA 1SKUA 4RJJA 1MC4A 4DUGA 1ADYA 4LE2A 3IUSA 4DLTA 3T51B 1I24A 3QF4A 4F9EA 4BVFA 2FR1A 3CW2A 2NT3A 4NE7A 3WS7A 3D8HA 1YX2A 1L7XA 4B7CA 1CUYA 5FEMA 3ZZ1A 4BMCA 4RDXA 2QN2A 3WWZA 2FH5B 1JKJB 4RY8A 2CC2A 1WX1A 1HFEL 1QE3A 2V7GA 3SHQA 1UQTA 4KDCA 1JBQA 1XNGA 2ZRQA 4O1MA 3BC1A 1UJCA 2CFSA 3K73O 2OD2A 1FU8A 4ZOLF 2HUNA 3MQFA 5JWHA 4EAAA 3T5DA 1BS9A 1DEKA 1ZI9A 4HAOA 5ICGA 2WICA 1QAQA 4W5HA 1XQXA 3B78A 1K8RA 3PCTA 4TYQA 1ETHA 2NNWB 3I2IA 3UN1A 4CM5A 1B0AA 4LF6B 1WXGA 2AJLI 2XCLA 3TLCA 2VG8A 1MB9A 2ZBRA 4C7OA 4ZT3A 4AIIA 5LIPA 1H5QA 1NJ1A 1WPRA 2PDAA 4HDCA 4YRDA 4ZVRA 4EEZA 4PN3A 3IDQA 4BZWA 1HWYA 2AZMA 4RAOA 4EB8A 1NKSA 1PFKA 2IEAA 4JQSA 4KQIA 1O9BA 4QUDA 4XRRA 2QZPA 4BJ3A 1BKSB 1RLMA 4UVIA 3VC2A 1E18A 1I9GA 4LZNA 4HGNA 5IN4A 1UIMA 4XQ0A 3SJPA 2GJ8A 3UXYA 5LQAA 1J21A 2ZT5A 5CA0B 2P3LA 2QUIA 2HNAA 2J3MA 2IBTA