2XODA

Crystal structure of flavoprotein nrdi from bacillus anthracis in the oxidised form
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
118
structure length
118
Chain Sequence
MLVAYDSMTGNVKRFIHKLNMPAVQIGEDLVIDEDFILITYTTGFGNVPERVLEFLERNNEKLKGVSASGNRNWGDMFGASADKISAKYEVPIVSKFELSGTNNDVEYFKERVREIAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Crystal Structures of Nrdi in the Oxidised and Reduced States: An Unusual Flavodoxin
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Flavoprotein
molecule keywords NRDI PROTEIN
total genus 43
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2010-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07972 Flavodoxin_NdrI NrdI Flavodoxin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xodA00
1XT6A 3OJWA 5LJIA 4N82A 3FX2A 3NLLA 3GFSA 1YCHA 3NHLA 3EDOA 1ZWLA 2FAXA 3HR4A 3QE2A 2WC1A 2OHHA 3L9WA 1CZUA 1C7EA 1GG5A 5A4KA 4U7FA 2N1MA 3NHRA 3NHFA 4U7GA 4ZVNA 3F6RA 2ZKIA 5TGZA 2FZVA 4QOFA 3OWHA 5EA2A 3S2YA 3U7RA 1H66A 1I1OA 4QOIA 3UXEA 5FX2A 1DX9A 5B3LA 2M6RA 2BF4A 1J9ZA 1RLJA 2X2OA 3OX1A 2FOXA 2Z9CA 3OX2A 1XYVA 4M0CA 4BMPB 3W79A 3FW1A 4Y9RA 5NULA 5ULLA 4CF6A 1YKGA 1FTGA 2FZ5A 3NHYA 4LTDA 3TE7A 4C0XA 3W7AA 1YDGA 4ICIA 3ZHOA 1BVYF 1T0IA 3NHUA 1V4BA 1YRHA 3HA2A 1D04A 2QMYA 5LBTA 4BMOB 1YOBA 3NHSA 3OVMA 3O2NA 5F51A 4NULA 1AMOA 3GFQA 5LVAA 4LA4A 1KBQA 3EYWA 3GFRA 4C14A 1WSBA 4Y7CA 1XI2A 2QX4A 2FCRA 2Z9BA 4J8PA 3F6SA 1BU5A 3ESXA 3FJOA 3R6WA 4GR9A 4H6PA 1E5DA 2QX6A 1YCGA 3KEGA 1RLIA 5LBUA 1J9EA 1CZRA 2HNAA 3GAMA 3TZBA 2GSWA 1AKRA 3D7NA 1FLVA 2ARKA 2BZSA 2XOEA 1FLDA 1ZWKA 1VMEA 2FDXA 2MT9A 1OBOA 1AKWA 3B6KA 1NNI1 3LCMA 1ZX1A 3K1YA 3N3BC 3NFRA 4YAUA 4PU0A 2Z9DA 1CZHA 4C76A 3NHWA 3ES9A 1FX1A 1DXOA 1SQSA 2QWXA 4QOGA 1C7FA 4YAWA 1AZLA 1CZKA 1XYYA 5LMCA 4FX2A 4N9QA 4QOEA 1FUEA 4H2DA 2F1OA 4QOJA 1FVXA 1CZNA 1CZLA 2Q9UA 2BPOA 2BN4A 2QX9A 4HEQA 4GI5A 3RPEA 4C0WA 2FLVA 1TIKA 2R97A 3ESYA 3O73A 2RG1A 1QBGA 1TLLA 1RCFA 4ZVMA 4CETA 4DY4A 2OHIA 2QMZA 1AHNA 2QR2A 3U7IA 5JROA 5F12A 5EMNA 3NHPA 1AKTA 2BMVA 1CZOA 2V5UA 3K20A 4FGLA 4LAFA 4YQEA 5NLLA 3LT5A 4D02A 2KQUA 3NHKA 4PTZA 4FGJA 4ZVLA 3SVLA 3G5MA 4ZVKA 1AKVA 1QRDA 3TEMA 4LTMA 4YAOA 1J9GA 2KLBA 2XODA 3N39C 4QODA 4QOHA 1J8QA 3B6IA 2OHJA 1JA1A 3B6JA 4GQIA 3W78A 5FA6A 4NLLA 4DIKA 4FGKA 2FVXA 5F4BA 1OBVA 3UXHA 4DILA 1RTTA 1WSWA 1SG0A 2Q62A 3KAPA 4R81A 4YALA 5BUCA 3N3AC 1D4AA 3L9XA 2V5VA 3QFCA 1H69A 1B1CA 1T5BA 3F2VA 4LTNA 3F90A 5FUQA 1QHEA 3ESZA 3KLBA 3NHJA 3KAQA 2AMJA 3P0RA 1KBOA 2MWMA 2QX8A 4HS4A 4N65A 2R96A 5EAIA 5B3KA 5LJLA 1D03A 2W5UA 1AKUA 3OX3A 4F8YA 2M6SA 3W77A 1OFVA 1AKQA 1FLAA 4U7HA 3FNIA 1F4PA 4ESEA 4PTYA 3B6MA 4Y9UA 2MOKA 2V9CA 2Z98A 2B3DA 1FLNA 3OJXA 1YCFA 2FX2A 2MTBA 3JSXA 4OXXA 4YAFA 3FVWA 5LLDA 4XDHA 1DXQA 1AG9A 1JA0A 1X77A 2X2PA 3HLYA 3OWXA 3QFRA 6NULA 4XDGA 2HNBA 2HPVA 4S24A 2D5IA 1QR2A 2OYSA 2A5LA
chains in the Genus database with same CATH superfamily
1FTQA 5LJIA 3TJRA 4XD7D 1F8UA 1KS9A 5G1OA 1C1HA 1UKYA 2QZPA 3OKPA 1I7DA 4KQWA 1T5LA 4CODB 5HMMA 4J6EA 4U9UA 5BYBA 2C3YA 2QLMA 1SO8A 1T9HA 3EISA 3R3VA 1G16A 3IQFA 4HJRA 5JCOA 3RWMB 3CHYA 3CWQA 3RODA 3RQSA 2FPKA 1K98A 4M0UA 2EQ5A 3PDJA 4OXNA 4BRZA 4LE2A 3O75A 4EARA 4HP8A 3KT8A 3RSCA 4F2DA 1ZJJA 3D6JA 1VG8A 4CF6A 1SKAA 1JHYA 3B8HA 2CXHA 4O8CA 4NMHA 4BNVA 2BMEA 1QYVA 1XZDA 3QU2A 1BDHA 4JT2A 3RS3A 2GLXA 2RDMA 3KR2A 4HHEA 4B82A 4ARCA 3T9EA 3BMCB 3U9SA 5AM0A 1WSBA 1QPBA 1U2GA 1JHXA 2DG2A 3I9MA 5FDFA 4Y2PA 4B34A 3VHRA 1JHQA 1DHRA 4Y2XA 4EA9A 2I34A 3IO3A 3ZD9A 2BCEA 4X8OA 3K9FC 1LDMA 1GCUA 4NDAA 6YASA 3QLUC 1YZTA 2OOKA 1E79A 1N5JA 2QZ9A 3JWPA 3PDWA 3RAGA 1WL8A 2J4CA 3QPWA 4MS3B 2VF8A 3E8SA 3JRXA 1GILA 1QYWA 4BVJA 4IVNA 2VSQA 4U8HA 5LA6F 2X0NA 2ENWA 2EZ8A 1C7FA 4H31A 4CPDA 2QYHA 1P7ZA 2ODTX 1UP4A 2X8BA 3TK1A 5JQGF 4ABYA 4OTZA 5ALQA 5IBCA 2E48A 3MBIA 3TNLA 4RPIA 3I5MA 1INLA 1UQRA 3VM6A 5LKAA 2D1YA 5LOVF 1Y3HA 2D6FA 1TQ8A 4BNHA 4DY4A 4X97A 3SOPA 5IH7A 1NVVQ 5BSUA 3H2IA 3ECAA 1ZZGA 4CBVA 2ZM6B 2C61A 3O4FA 4B31A 2FEMA 3VNRA 3GEGA 3QFTA 1WSAA 4NP6A 1M9NA 2YJGA 3BG5A 4AMZA 2ZS9A 3LVQE 2HO4A 3W1EA 3SVTA 3FCAA 1O7JA 5D7BA 2ZSDA 3DE7X 1QR6A 3PENA 2H3EA 2IYSA 4WKCA 4ZT6A 5GP1A 2FSPA 1MTZA 2WI8A 4PZLA 5L3RA 4BEVA 4NLLA 5BT8A 1H4TA 4BWFB 2AJTA 2A5FA 1QLHA 1MJHA 1N5IA 3X2SA 2HWWA 3ZN2A 4WW0A 3BICA 1YTUA 5BUCA 1DRUA 3VR2A 3K32A 3UA4A 4E33A 3DE3X 2AYXA 1XL0A 3EBOA 3PUHA 1PDWA 3DCNA 1U5AA 3PZBA 3QMVA 1QH8A 3D0KA 2P2ZA 1A5SB 2ISSD 1OE0A 3R4CA 1DZIA 1NAIA 1UOQA 4UVEA 4YP9A 2P4UA 1QHGA 5FFMA 3EAFA 3VZBA 1OJ7A 3TRIA 3WLAA 1WDKA 1YBMA 2ZRDA 1G8PA 2NO7A 4NNOA 1R5JA 3P71T 3JD4A 4PYIA 4N7RA 1NLUA 4M3NA 1QVAA 2A5JA 4C0HA 3FYUA 3H1GA 2M9MA 2A9KA 2Y2UA 2ZRJA 4PGHA 1C1XB 3ZS9A 5JSHA 2FWMX 1BCRB 4LDQA 1WD7A 3VSAA 2WOOA 1TLTA 1MB9A 1CWUA 3DT8A 3L06A 4L4UA 4GX1A 3NTRA 3NGXA 3D7KA 2H1SA 1M2OA 3R0VA 2H5EA 4KQHA 3ZJ4A 4AT1A 4DJJA 3G1TA 3KPUA 1KXJA 1V3UA 1GKLA 4AXXA 3KELA 4Y0NA 1BZYA 2O2HA 2VYFA 4RHCA 4DG5A 1N0IA 2KM1A 1QPGA 3L49A 3DPSA 5JXJA 3SX0A 3WXBA 3ZYZA 1GG5A 4DMCA 2PEZA 2YOHA 4EY7A 1JU4A 3BEOA 4YEDA 4BNZA 1KQGA 2ZBFA 3MGBA 1LD3A 2DBRA 4QQNA 1ZCZA 4KYIB 1PNTA 1US8B 1J9ZA 1PHRA 1O9HA 2E4AA 4R1NA 2H8KA 3KKNA 2A35A 1AGPA 4Y9TA 4LX8A 4DLXA 5L51A 1OH6A 3OHMA 3T7IA 3R9KA 2WAYA 5JXHA 1MG5A 3RIYA 1Y5IA 1J0XO 3RIXA 1H2ZA 3PPWA 2FJ0A 2H1VA 2G9VA 1R8YA 3D6TB 1IB0A 3PUVA 4MVCA 5FV7A 2HQBA 4C30A 3IP5A 1ZGCA 4FI3F 5EJ5A 5L6LB 2ON6A 4KIUA 1FRZA 3TB6A 1FZTA 3UMGA 2QVZX 3PLAE 1T91A 2Q50A 3H75A 1YIDA 2OBBA 2QV7A 3AWIA 4LYYA 2WEKA 4QDZA 1FLVA 4XDYA 5CJPA 4CIYA 3OTOB 4G5YA 4MVYA 1JQDA 3PPXA 3I9KA 4UREA 2YJZA 3LY9A 5JXWA 3PXGA 4GZMA 3EUEA 5G53C 2A67A 3PR2B 4J1SA 4QBIA 4DLSA 5C8VA 1UANA 3GRVA 1Z6QA 2MJLA 4I36A 2FCAA 3NTUA 3DQZA 3KOZA 4RIFA 2WSSA 1NXPA 3UTCA 5C51B 4LV6A 4IQ8A 5HMLA 2QRVB 3BZWA 3TI9A 2QGZA 3KQMA 4WBNA 3OJCA 4XE5A 4R2JA 1N7HA 2IEBA 1DKUA 4ZQCB 3P9ZA 2V4ZA 3CUWA 3D7LA 2DU8A 4FS3A 3MUNA 3GU3A 3C0KA 3HNPA 4J0FA 2O52A 1F8GA 3G5MA 5CK4A 1EGHA 3WNBA 4XGQA 3BB3A 1QH9A 1X9GA 3NVMB 1C3EA 4NMXB 4HQRA 5BN5A 1S3IA 3MWFA 4G65A 2IQ5A 4IDEA 4I4IA 3FOEC 1IFXA 1VFPA 2ILTA 2QQEA 2ZCVA 3NUZA 4PW0A 4V39A 3RSGA 3A1CA 3KSMA 3NTQA 4J4HA 5E6UA 3V1TC 4Z6KA 1W36C 4H16A 2F3PA 3FNRA 4D3XA 1UDCA 2VP6A 3DO8A 1U2TA 3JWGA 1GAEO 2OY0A 3FNEA 3L9XA 5KAPA 5WRFA 3PIIA 3CN9A 3WBBA 3A8TA 3PKIA 3ESZA 4A2WA 4KQEA 1WXXA 5K0FA 3ADPA 2C7PA 3QTLA 5A3JA 1NRWA 4LJYA 4RTMA 1LXCA 1NVXQ 1UBOS 4HXFB 1NBWB 3H3FA 3HJTA 2RH9B 3LJKA 1QHFA 4CXMA 2B92A 4KUGA 4P5PA 3JQAD 2JZNA 4P86A 5JU6A 2ORED 3AK4A 4KX5A 1SURA 1U98A 4ZEXA 1UCFA 1VC2A 1Z22A 2FR0A 3F46A 3RRZA 4BTEA 2PUDA 3Q9NA 3MELA 4JC5A 5FI3A 2Z98A 3ISJA 3QBVA 5K8CA 2MINB 5HPYB 3S44A 1M2VA 1PS8A 1X7DA 2JD2A 1WCIB 3SSNA 6ABPA 2AX3A 4MVJG 4HXEB 3DZFA 3S2EA 4DYVA 1FNMA 3WRVA 3G79A 5CPBA 1J0DA 1DWQA 1K9SA 2A5LA 1FTWA 1IJEA 3ND9A 4BNUA 3OQIB 2XUOA 3H4IA 1TPYA 3S2SA 2Y1DA 5AVYA 5JCJD 4O2BB 1A50B 2JFVA 3KFLA 4EW2A 4F3KA 5LYJF 1SXJA 2EG9A 5M34A 3NTVA 1XLTC 2PMKA 3WJ7A 4II7A 2P5YA 2RJOA 1T9ZA 1ZU5A 3QMMA 4B32A 3HABA 1FYVA 1R5OA 2DJIA 3BAZA 4QDUA 3T1HB 2O8CA 3JQDA 1WP4A 1Z8NA 1KL7A 2X13A 2XMZA 2VJMB 2PMBA 3OPYB 4ZO4A 4A27A 1L0BA 3Q3HA 1XXLA 5LLSA 5NULA 3TLMA 4EYEA 2QD1A 4RIHA 1CY8A 5CFZA 4QL3A 4HBZA 1YOVA 2Y66A 5E6SA 5AD1A 2WAOA 2GZRA 3UK7A 4C9BA 3K8ZA 3ROFA 2HFKA 1WXDA 4XWAA 4UAJA 3OI7A 3JW8A 2AUTA 2XIQA 2PIAA 3HDJA 2VR1A 3EJ6A 4QPJC 4X41A 3SBXA 3U56A 4HD8A 3LXRA 2J5XA 3UFBA 1UJBA 2Z6AA 2WJHA 2VHEA 1C0IA 2FQYA 3F5MA 4FGZA 2V1XA 4QFDA 2B9VA 4FDVA 2YY5A 2ZKLA 1RXSA 1YZNA 3HC7A 4PBTA 3WG9A 4MXDA 4OQNA 3DV2A 4CZ2A 1S0UA 1WVMA 4IJKA 3VNVA 3DFMA 1AY0A 1GGJA 3ESRA 2I4LA 3IODA 2FPPB 4RA9B 2C5BA 3MW8A 5FHRA 2O57A 4YPVA 1HQDA 2F1RA 2OXEA 2HA4A 4DCSA 1XTUA 3HB4X 3HFJA 1IHXA 4JY7A 5FBZA 4M1ZA 4LMRA 4J90A 5A05A 1FFCA 4B5KA 5LMZA 2XCLA 5AIAA 5LOVA 4MUKA 1TC1A 2MU1A 4FSHA 3JQBA 3AILA 4YROA 5D01A 2OBNA 3R3XA 5H8WA 2NUTA 4DDUA 4PG6A 4IKEA 4CIXA 3RJMA 2O7QA 2HXGA 3G88A 4D8YA 3AUYA 1T5DX 1TJ3A 3JCZA 3IAEA 3F6CA 5EHIA 1U9IC 5TS2A 1CDOA 3SDZA 5EMNA 4AULA 4EJ0A 1SCKA 3HDGA 5HF9A 2ZUFA 1HPLA 3CLRC 1FTYA 2WV7A 4F3RA 2W37A 3LKDA 1U28C 4RFSB 1S8FA 1XDUA 2OXFA 2QZZA 4OF4A 4OQ4A 5DCWA 4RJKA 3RWBA 5AW8A 2GN6A 2HF9A 1E61A 3BBPA 3HSYA 4IXWA 4MW0A 1M7GA 3QXCA 3I01A 1BMFD 3TFOA 1P2UA 1X39A 1DQYA 3SS7X 1RYEA 4FHZA 4NK4A 3HKDB 2AHRA 2ASVA 5HKBA 5C5IA 2PS3A 3U3XA 2N1BA 2X3FA 4DWVA 2JIBA 2D2XA 1R5BA 3H04A 4G1VA 3X1ZA 4MKHA 4YDRA 4WCVA 2Z4TA 4B6RA 4FFRA 3V33A 4EO7A 1ESMA 4XX0A 3H86A 3IOEA 5H9WA 5EMHA 4LRTB 3LA6A 5MN4A 2PY6A 3K2QA 1M5UA 1GKYA 3HVHA 3VJLA 2QKYA 1Z47A 4F12A 1NC1A 4C3ZA 3DZGA 3AC0A 4DRXA 2C98A 1HFWA 2ID4A 5H7XA 5A4MS 4MPTA 5DIZA 3T1OA 5FADA 4CMIB 2JH3A 4MKIA 5BY2A 4GOKA 2B78A 3O9MA 1JILA 1AZTA 4OUDA 3WQQA 3OWXA 1ITZA 4KAFA 5DW3A 4YPFA 4AJJA 4Z4EA 1VBFA 3I9LA 1B43A 3II6X 1Q16A 4PPQA 5A3VA 3SYNA 2CMHA 3C3BA 4QUHA 3KTFA 1AQNA 3VA7A 5AM4A 3RK4A 9ATCA 1YONA 3IQZA 3WWEA 4AZ3B 5B7QA 2CK3D 5E4YA 1QHYA 1XTVA 4RVFA 1TPZA 2WWHA 1QNFA 4IKPA 5JVDF 1R0RE 1R0ZA 1Y37A 2XADA 4LYJA 3IO5A 1ESCA 4TMYA 2BC9A 2FQXA 2YHIA 4ENWA 5ITZB 2GKOA 2XE6A 2QUAA 3FLAA 3O21A 3PGLA 1QB7A 3QY9A 5FTKA 1UXIA 2E3JA 3TNFA 4AROA 3VKHA 3LWBA 1DX9A 2WU0A 1AK9A 5CT4A 1X7WA 1N3LA 2BISA 2Q8PA 2XQIA 2VH1A 3ASVA 4NCJA 1DHTA 1KMHB 3DE0X 5EHZA 4RGYA 5KQGA 4URFA 5AI9A 2B37A 1AU9A 1G7TA 5I01A 5JNTA 1NNEA 4QT4A 2O0JA 2QXTA 3OM9A 1KFKB 3E3LA 3O5AA 3FOFC 1XN1A 4BL5A 4BY9E 2ZTUA 3M34A 3EF1A 2XRMA 4GM0A 2EFHB 2HCJB 2YMQA 1Y8CA 4GNKA 4RXUA 4E07A 1M75A 2CVQA 2QDKA 4CEIB 1MQ8B 3DLIA 4ZDJA 2CBGA 1M76A 1Z5OA 2D1QA 4LJSA 2C9ZA 1V45E 4MLDA 4E4TA 4PYQA 2OVFA 3W6ZA 1GG8A 2Z8ZA 4BVLA 2JLZA 3DCJA 1X0VA 3IESA 2IYRA 1ZDMA 1WETA 2AS0A 4H7JA 4FT2A 5J40A 3CX8A 2WIDA 3EJWA 4G81A 4C76A 3OPQA 4LNUA 1TIBA 3ZZ1A 4BP8A 4BNLA 3DYIA 3PIRA 2QROA 3V8EA 3ZWDA 1N5MA 1N2CE 2AJCA 4HNGA 5I7WA 3QEKA 4X66B 4BV9A 1Z6GA 1O97C 4ND6A 1U11A 1ODSA 2ZYTX 1XZIA 1QF9A 2FRDC 3GT0A 4NS4A 1NQWA 2JGAA 3GBSA 4HNTA 1MUUA 3IRVA 1VRWA 3KNZA 3V3KA 4RF3A 2AD1A 2V7VA 3JAMA 1SUAA 2VDVE 1CRPA 4ALIA 5JHGB 4HQ0A 1QVZA 2IP2A 4KODA 2YNMA 3K09A 1OX6A 3R3HA 1Y6RA 1B0PA 1RYDA 2FN3A 4S12A 1JUDA 1LEHA 1J0EA 1O57A 3AEKB 3GT7A 3LHDA 4TL6A 5T6MA 3UCXA 1U3VA 3V2IA 1ZD4A 4EG1A 3GLIE 1X7ZB 1SQFA 5J4KA 3PNOA 4OXQA 3EGDB 4B3XA 3C3EA 3O82A 2N9UA 3OQHA 3FN4A 2JL1A 2NAFA 4GM4A 4KH1A 4I50F 2WIBA 2B1IA 2ZVPX 1E63A 1HEYA 1SG0A 1TVKB 2ZXEA 3COYA 3BDAA 1BFDA 3FR8A 4JLVA 2PUFA 2O8DA 1H8EA 2Q4EA 2BH9A 5EZ5A 1W4BA 5I9BA 4C07A 5J47A 1UM9A 4G9BA 4UDXX 3QXHA 5HUQA 4FP9A 3IP3A 2UYQA 1MOPA 2IODA 4PPGA 4E4RA 2YJNA 4XDZA 3ZZ0A 4G0YA 3HXMA 3HI6A 3RO7A 1YZYA 3L40A 1FLAA 4U7HA 2PT9A 3UAXA 2D5LA 4DIUA 2B4KA 3KL2A 1NN3A 4DSOA 4YMLA 2VZ0A 1UPTA 3DE4X 2GM4A 1EFKA 3QU5A 4CM9D 4TTSA 5LQKA 1VJRA 3EZNA 5FLEX 4MTLA 2BZ1A 3SBEA 4CM3A 1ZN2A 1Z4MA 2H18A 2VNKA 5JEDA 3KO8A 4F6RA 3W2FA 4EY6A 1L4NA 1QU2A 1X14A 1ADJA 3OOJA 3WGMA 4LYGA 5LWHA 2P0EA 3GHYA 4CEJA 3UAOA 3DL0A 5C1BA 5KU1A 4K6CA 2PR7A 4H0CA 3AM5A 4QIHA 5IJ0B 3S8YA 2PZAA 1VM6A 3FMIA 3M89A 4ZN6A 1XU7A 2ID8A 1CIVA 2EX4A 1P61B 4E94A 1AUXA 1L4HA 3G3EA 3FWNA 5IJWA 5JLJA 5MHTA 5JSQA 3V1KA 4LDAA 4WMLA 1R0BA 1QKIA 5IT5A 2VP4A 4P34A 5K4HA 1KO1A 3LLCA 4MQLA 1LPAB 3UB4A 3ZD7A 2L82A 2EFJA 2OLJA 1JAYA 1CP3A 1JEQB 2X8JB 3LU1A 3V3TA 1SBYA 4AICA 1QHNA 2GHRA 3IFSA 1XDZA 3PR1A 3WDKA 1QFMA 3X1DA 4D9BA 3LT0A 3QK7A 4PYKA 5CFPA 3OU2A 3ZU2A 3DH0A 1XP5A 3RSFA 4FEGA 2RHLA 4KRGA 2QQGA 1FMFA 4INAA 4RTJA 3F8SA 4ZV9A 1W30A 1SUBA 3FKJA 1KMIY 2HHCA 2GKSA 3PXAA 1VLJA 4JBXA 4LZPA 2PGAA 3D8TA 4PPNA 3RSLA 3VTZA 5PGMA 5KOJA 1QAOA 2WNIA 4JYMA 4I4TF 5EGNA 2ZVJA 1LVGA 1OBOA 2NZWA 4Y30A 2QN1A 3K1YA 3LBFA 1VBMA 1QCDA 3HFGA 3AIOA 5BSMA 1QIGA 4XRGA 5KVCA 2YXBA 1C3VA 3WP0A 2C0CA 1DEOA 2GI4A 2YQ5A 3FPGA 4V0OA 1OV4A 4Q6BA 3N0VA 4MUHA 4QOGA 3TVDA 3ZHUA 4TM8A 1C30A 3HCEA 3HCRA 1D2RA 1K7EB 5FUYA 3ZNQA 4GZ3A 2ZWOA 3VPDA 3UMBA 1T0PA 4M1MA 4ODIA 1DLIA 1PQWA 4J0EA 5FYDA 2R44A 4Y2YA 1XP8A 5H3HA 3N6VA 3RRNA 4FN4A 3AKYA 3HJRA 1B7GO 1FDTA 1TTPB 2BBSA 2ZANA 3T3NA 2FSSA 2PRJA 3SZMA 1LPNA 3DHYA 4X1YA 4C0JA 4LFAB 3K9BA 3ZWAA 3H4VA 1HFJA 2OFXA 1A8HA 4CU5A 4Q37A 4TKUB 2Z6UA 1QRDA 4EKDA 3UJNA 4FLMA 1MX9A 4P3PA 3HDQA 2ZJ5A 1C4WA 1GPWB 2VAMA 1YO6A 4FD2A 2OHJA 4JGBA 4IHKA 4QU5A 2IS4A 3AV0B 3ZV5A 2MR5A 1N6KA 1PWXA 1QONA 3EFOA 4GP9A 3BX1A 1Z73A 1TAGA 3KB1A 3KYDB 5KYNA 5KC8A 2NSHA 3B48A 2IE0A 2VHUA 4JEMA 4QEKA 2AMFA 1VE6A 1D4ZA 2WYIA 2DSTA 4CM4A 4EGJA 3UMRA 3AOGA 2BT4A 1HE4A 1XTSA 2XIJA 3NNSA 1NKSA 5KQSA 1FS4A 2JFHA 4HWGA 3UJDA 4AF7A 3R5FA 3T35A 2H85A 1KYIA 2PD6A 1Q84A 3E05A 4MWZA 4CKEA 5GIOE 3JSXA 1YVRA 1RWQA 4NV0A 3WMGA 1V16A 1M0WA 2GTPA 4NEQA 1AG9A 4Z53A 1HI9A 1U8YA 3ER8A 4EG6A 4RVNA 2Q29A 1JEEA 4XTRA 2NZ2A 2WJ4A 4H4EA 2QUZA 3T5MA 2ADFA 2J87A 2ZWVA 2R7AA 1IBMB 4J0KA 4U7WA 2XCOA 4AURA 2QLFA 3LQRA 1V26A 3BQNB 1KJJA 3R76A 1OA1A 4QDJA 3VDMA 4YPOA 2J8ZA 2JLAA 3KYDA 4HO1X 2ZKIA 4J0DA 3U17A 2FX3A 4PLGA 2P2CA 1A4RA 3ZS8A 4L4XA 3IR6A 4KN8A 4B3SB 1Z7WA 3FUVA 5B1YA 2CLEB 2WDZA 3HEAA 1O1YA 3WLIA 4E2WA 3F47A 2O14A 5KNBH 5K4GA 1RLOA 4ICIA 2ZIXA 3BL5A 3F5FA 4XI9A 2RMKA 1GFIA 3DJYA 3CLHA 2ID7A 1Q0QA 1ESEA 3L7IA 3TGLA 3D02A 2W2OA 3DBLA 4Y7CA 1XI2A 2LTAA 1U4SA 3QBTA 1BU5A 4L5AA 2D5BA 1EDOA 4RZIA 3SM3A 4YAGA 1CBUA 2VAXA 3MNFA 2F3QA 1Y1KE 1TTHA 2Q9AA 1H9AA 2H29A 4F4IA 2G40A 4QSHA 1EE9A 5HKOA 1WXHA 5LXTB 1BG6A 4M1QA 1P9WA 4ENSA 5C2JB 1IPFA 4BNFA 1L5LA 1SA0B 4RZXA 2ZYVX 1M3SA 3E8XA 1W1UA 3K0HA 3IKVA 4FQ5A 4YAJA 4YUWA 2IH4A 1RWNA 1UWLA 3CKMA 3KHUA 5E1OA 1WKVA 1DELA 4MQ5A 5CG1A 4FX2A 4RFVA 3WFJA 4QXRA 5JJLA 4NECA 1FFXA 2I55A 2XD4A 3RSSA 4KMRA 3KKOA 1TO1E 3I4LA 4M0PA 2V7QA 4LECA 1LGYA 2QRGA 3ABQB 3LBYA 1ZD2P 2R6AA 4AUMA 5JDIA 3AKDA 2H11A 5KNCH 3V2GA 2ORWA 5F23A 4ANFA 1ORIA 3DTNA 1RRCA 2IHJA 4YBZA 1H0KA 2ZEJA 3UWMA 2DR3A 3RTEA 4DT1A 2XKKA 5CGZA 1V5IA 2BJHA 2LVBA 1IH8A 1UUFA 1RXUA 5BW5A 3E3OA 4I50A 2XNDA 2ZIAA 1LU9A 4G0XA 5EUQB 2CLHB 3JYLA 2O48X 5FAXA 2I03A 3P26A 3MJTA 4Z7QB 4F11A 2O2YA 3D4OA 2NO4A 2ZJFA 3DE6X 3VH2A 4JAVC 3RTAA 4MDFA 2NO0A 4FNGA 2AK2A 1BO6A 1P1KA 4JA0A 4LYFA 1KAMA 2H7VA 1M0TA 1P0PA 3IP8A 3O7MA 4GPIB 2WRZA 1P2TA 3PD0A 5EXEA 3DO5A 2M6LA 4HFRA 4LTNA 1UK6A 1UC9A 2JCXA 4ZT7A 5HF6A 2EKBA 2QMUA 1C8KA 2IBMA 3ZXUB 4OYLA 4F92B 3JVUA 1ZN8A 3IB3A 1E8MA 1XDGA 3PPIA 1XE3A 4IICA 4YRPA 3W6NA 1E4YA 2J6HA 2V7EA 3NC4A 3A27A 4F1JA 5TQ2A 3BFXA 1CG6A 3WVNA 4ESEA 4X8MA 4UHHA 5H9VA 4BMYA 2D54A 2G1UA 4FFVA 2PJDA 1ZZEA 2E89A 2BFNA 5L53A 2JH9A 4REMA 2DR2A 1BHO1 3OZVA 4JV5B 4C2AA 2M32A 4D6XA 1US8A 4CLXA 1BVRA 1N0UA 3RYFB 2EG5A 3CVUA 4FOOA 4JB2A 5JSZA 1KFEB 3CRW1 4OM8A 5ITZA 4EFDA 1IB6A 5HGJA 1T6ZA 2BEWA 3NRBA 4G0NA 3M6VA 3ILVA 1Y80A 3V1UA 1PL6A 4R51A 2H5JA 3EXHC 3G0HA 2HSZA 4JB3A 4W99A 1W4LA 1LQTA 5JI2E 1LDEA 1YIAA 1NR7A 1SUEA 3EGEA 3CCCA 2G6BA 1GUZA 4IIXA 1LNZA 2EIXA 1PO7A 1CULC 4RA6A 1P7PA 3OA2A 4U2GA 1S8OA 2BHLA 3SZUA 3VISA 3DOUA 5JNLA 1TRHA 2O7VA 3V6MA 4CIDA 3ILXA 1LRJA 4FT4A 3FYUB 2A5DA 2R25B 3EASA 3QGMA 1TD1A 1Z6TA 2IXEA 1OXXK 2QLNA 1OASA 1Q6YA 2BFOA 2PMEA 3S68A 2X1VA 1OAOC 4C4YA 1NVAA 3NKFA 4BV3A 1UBNA 3IA7A 1ZN9A 1PUXA 1V35A 5AJTA 2DTXA 1XC7A 3O8NA 5KJ1A 4DLAA 3GLTA 1VE7A 1XEAA 2ZT5A 3EIFA 3UK1A 1TU4A 1L7RA 1ZVJA 3WY9A 3DMTA 5HIAA 3RW9A 1MRZA 1E5DA 3U0VA 1PZXA 1K1EA 2M98A 1W49A 4GKBA 3L7AA 1PGNA 4ZHQB 2H1LA 2Z1MA 3FVRA 1UDRA 3B6KA 5ECWA 4JCCA 1QBKC 2LCFA 5CLQA 5GPBA 4NU6A 3GPCA 4H7PA 5C5CA 3RFFA 1JZQA 4AMVA 3GUYA 1JNYA 5DE3A 1KK0A 5JASA 3HK2A 2OAP1 1SQ0A 1DXOA 3ND6A 3FH0A 2AKAB 2VZ9A 4FFNA 3VSEA 3KQHA 3M3PA 1MCZA 2Q7DA 1VI2A 4GHWA 1NJGA 3DEYX 4R01A 2WWVD 2ZLBA 3F8WA 5F21A 5EP2A 2D2VA 4XPZA 1WDMA 5CLHA 2X0JA 3TKAA 5B37A 3I9V1 1KYVA 5J23A 3C3CA 1K0UA 3QBEA 4MS4A 3QX3A 1FJGB 4OMDA 3M3HA 1QRUA 3OPYI 1M2EA 5I47A 1ZM7A 3AL0C 1VIAA 3HB0A 1J22A 3JWEA 3Q15C 2NSDA 1CUXA 1PX0A 2DVMA 4P3OA 3ZY2A 5HM8A 3FVVA 2O8BA 1EZ1A 2IEZA 2OO5C 3DP9A 2JLBA 4JLUA 3MMPA 1HT3A 3Q12A 5AFSA 2PKWA 3RHFA 1U8EA 2X0RA 2A88A 3V1MA 2PGLA 2EX1A 2UAGA 1EXWA 2QE7A 1Q0PA 3UAWA 2OD9A 3H2HA 4JL8A 1Q1NA 3R24A 2ZSEA 3MQ4A 1Y7LA 3PDUA 1DIHA 3PYLA 4DDMA 1ZLXA 1H2HA 4XARA 1XTTA 4TM7A 5JJBA 2CL6X 4HFMA 1TTQB 1GYPA 3DYBA 3RU3A 1IN1A 3IUQA 1JI0A 3EQ6A 2C0PA 3JWHA 5CDFA 4TTJA 5CAEB 4BTVA 3STVA 3M4XA 1WBBA 1M34A 3OD5A 1W73A 2D1RA 2W6QA 4ALNA 5AJYA 5AW1A 3DUFA 4RYLA 5FL3A 4ED9A 2GA9A 1DWOA 3U4MA 2J0UA 4PPYA 4LXIA 2GEVA 1J7JA 1FSSA 2V9CA 1XQ1A 3QUBA 5CFLA 3VBEA 4M1WA 3LNTA 4R8LA 2QGFA 3N8IA 2VQSA 1UBMS 2B5WA 5DTMA 3ZV4A 4TYNA 1ADCA 1TW2A 3P96A 2AG6A 3ZXXA 1YAJA 1M2WA 1Q7BA 4M8LA 2G9UA 5JRJA 2PTHA 3NC1C 1Q5PA 1PYGA 1ATZA 1ZUNB 4DQKA 2XMDA 2ZUSA 4B44A 1ULSA 4AJ4A 4C4SA 3HN7A 5H82A 2VCHA 3QRWA 4ROTA 3S1AA 2GWRA 5FA5A 3BFKA 2ZRCA 3NP9A 2OC4A 3IKJA 5J63A 4LHXA 1G5HA 2ZAMA 2GNPA 1UZMA 2D2EA 2NU9A 2BI8A 2C4MA 3D2AA 1A98A 3EW7A 4D25A 3FF1A 2FZ5A 1ZW1A 2RARA 1QYCA 1GNRA 4KX3A 3EF0A 1R9NA 4EHIA 4CKWA 4Q4CA 2JLVA 3PGMA 2DFTA 1H3NA 4F8EA 2QG4A 4X44A 2J41A 4F4CA 2JFGA 2CB9A 4A26A 4DDWA 4M0DA 2XUKA 1WTCA 3F6EX 4AJ1A 1BW9B 4KN5A 1K8ZB 4OP1A 4J2TA 3A2NA 4R0MA 3GRUA 1U6IA 2B8EA 2JIMA 3ANLA 4EGSA 2DUMA 3AB3A 3A31A 1U8FO 3QY0A 3TZLA 3L46A 3DBRB 2QAGC 1DAFA 2AZMA 3GXOA 1TJNA 4E5DA 1J8VA 2DCUA 5GADl 1PVOA 3CZRA 1KYYA 1HR0B 1VL8A 1MRSA 2XPCA 3MPUA 4D0LB 4RENA 1GPUA 2IYAA 4TVBA 1E6LA 3AVWA 3CLUD 5AIBA 2VOJA 4ZDKA 3IERA 3T7SA 3QI2A 4FDAA 3WIDA 1FYXA 2BPOA 3AM1A 1D6MA 3BWMA 4Q39A 5IT9A 3LECA 1Z6XA 2RG1A 2FSVC 2BMWA 1VJTA 1L5HB 3TDKA 1JG1A 2ZJAA 4UBNA 4J3FA 4JI3B 2PT7A 2Y77A 3HE3A 4PAOA 4UVIA 3RANA 2V8OA 2HCTA 4DCMA 4UUQA 5B1DA 4JLMA 3RC8A 4WZZA 2UYGA 2WMYA 2XE7A 1UPFA 1JG4A 3K0CA 1EIZA 1D2MA 2HU2A 4HVTA 1YV9A 4A73A 1E7RA 4JC4A 4ESHA 3ADOA 4L9WA 1N3YA 1Y81A 5EPEA 2P3OA 3G2KA 4L4YA 4NBTA 1O89A 4ZMSA 4CEHB 2EP7A 3E9DA 3C3MA 4U5QA 2NADA 4K6FA 4F4DA 5CCXA 3V7UA 3JPWA 2CXXA 5CH8A 4UU0A 2AF4C 1LS1A 2OT3B 1GLGA 3P2OA 1DOZA 3BKWA 2CJPA 1BQ3A 2CVZA 3NOQA 1GKUB 1T5BA 3H5AA 2H16A 4O4LF 1IXKA 2GCOB 5CA0A 3CCFA 4PSAA 2ZSBA 3OE4A 1A3CA 4HQNA 3EH1A 1GU1A 1A72A 3W5AA 2PEYA 3U39A 3ZE7A 4JOBA 1GRRA 1TU0A 4GI3A 4UBOA 3QE9Y 3BRSA 4ZREA 4IQ4A 4L8FA 2H2WA 2RBKA 1G17A 2YV2A 3GVXA 3LPAA 4PAQA 5JAOA 5P8WA 4OX9Y 1JFRA 1PFGA 3IVMA 3FUUA 2PRYA 3N2IA 1H6BA 2DF8A 3NBYC 2H2FA 4PCUA 1R0SA 3LSYA 4BU1A 1P3DA 2GFHA 2WUEA 4HT3B 4L72A 4YR9A 2OV4A 5C81A 5TDHA 5K9ZA 1J5EB 1MDBA 1DBIA 2ZSFA 5EERA 2H4HA 4D96A 3GJYA 3MGCA 4JS0A 2OCPA 2XCIA 4EHBA 2F62A 2G4CA 4C7VA 4AQDA 4TLDA 5BW6B 2V7TA 1LSJA 4HAIA 5K3FB 3KR1A 4LJKA 2CNWD 3WK7A 5JQGA 5CA1B 8ADHA 3ZTWA 2PMWB 2OCAA 5CPFA 5B36A 1M5TA 4HX5A 2PL3A 4HEA1 1YWGO 1EVJA 3EZLA 3T3IA 1IZ9A 2VNJA 5ULLA 1QG0A 2VPXA 4XB2A 2HXSA 3P7MA 4NFYA 4M1YA 3DFZA 4BQSA 5LU9A 2GDZA 4P84A 4RD1A 2VDKB 3JQ8A 2Y05A 3P27A 1S2MA 4KPYA 2FSIA 3LLSA 4R1MA 4PLVA 3L8EA 4MHTA 4TTRA 2XBUA 1G8GA 5I3ZA 3ZWBA 2DECA 2D59A 3TEJA 4BO0A 2A1UB 2X40A 4FOSA 4MVJH 5JSKA 3E0XA 5FA8A 9MHTA 1ETUA 1JQKA 5DCYA 2NAPA 3A6DA 1ORWA 5DEOA 2ZE6A 5CVJA 3WMRA 5LNK1 1JZSA 4YRCA 3I1FA 5FPSA 3HP1A 4EZBA 3BD8A 4RXMA 4WOPA 3TLGA 4KJXA 4QBGB 2JC3A 1U5BB 1NHWA 3O2QB 4Q34A 3ZY3A 4LISA 1XYYA 5M7EA 1Z7BA 1YS9A 2HF2A 2B1QA 2FF5A 3DMFA 3M5DA 2IPLA 3HKCB 2AD5A 2HWUA 1MXFA 3DVRX 3GRPA 1E6EA 1QAQA 2DFLA 1QO0A 2W0SA 1DTSA 1UPXA 4XPIB 3O1LA 2Y67A 3U7IA 5I8WA 5ALLA 5I9MA 2XYHA 5FNVB 4IZIA 3VOSA 3GCZA 1Q3KA 4HWTA 1Z2CA 3VC3A 1N5OX 1SK8A 5IC4A 4YMIA 3EG9A 2IPNA 1UFOA 4IXTA 2P2LA 1XAGA 3QHPA 4MHSA 1I3LA 1J1IA 3AUAA 2LE0A 4ZZ2A 3WL7A 3AHEA 5EY5B 3FOZA 3FCCA 4F86A 4QYIB 3A9SA 5FOQA 1FFEA 4GM1A 3K1AA 2O0KA 1TL7C 1Z5PA 1JVSA 1TLFA 2WJWA 3Q10A 4DLUA 4QFMA 4U7PB 5DI9A 1WWKA 5D5PA 5FUVA 2Y1EA 3SFVA 5BNZA 5EVJA 3EFBA 2W4QA 1UPUA 3U0BA 1JT2A 5E8JA 2Z6QA 2PFSA 4OX9B 1RYHA 1MOSA 2MDTA 3ROZA 1FU7A 3LBAA 1FUYB 2F1KA 3F3YA 4EMSA 4ZV4A 2P6MA 4MWBA 1Y63A 2G3YA 3PXXA 1IYZA 5AJXA 1F1JA 3U3MA 2GD6A 3TLJA 4DIEA 1LBHA 3C4JA 3D59A 4JJ6A 1A7JA 1VKNA 4N5IX 4NY1A 2VHXA 1F2UA 4H0NA 3ZWYA 1DQSA 1L4YA 4NAHA 2E6KA 3D3QA 4HNAA 2FWAA 4NZNA 1U2EA 4OHXA 4QTXA 1NRIA 1BAPA 4D45A 5B2EA 2D7JA 2XNCA 3ZLJA 3MOSA 3F96A 1NLYA 2FP3A 4ZXPA 5JO0A 1SXHA 5K0CA 4P4NA 3SC4A 1U9ZA 2FOIA 3L43A 2VBCA 1IOZA 4NZ9A 4TMVA 4CEJB 5ETJA 1RWMA 1NF3A 3IR5A 1LVUA 3TBFA 3TZ6A 1RWVA 2INGX 3EDOA 3GJSA 3FYSA 4Q00A 2IUUA 5HZGA 3PD1A 3JYQA 2PD3A 5G40A 3AZPA 3VNSA 4H3HB 2BEUB 4I8IA 4RF2A 4M0KA 1TUIA 1MHTA 3OPVA 1M2VB 5HJEA 1LK7A 4ZGWA 3CIFA 1FP4B 4ZYWA 1VXRA 1E3SA 2FOXA 2PKXA 3LF2A 1LDBA 1RAHA 3PC8C 4LXTA 4CM9A 4ERNA 4QGSA 1Y89A 3FYHA 2G1PA 3T9BA 5H68A 5KHAA 3IP1A 3KQYA 5ICFA 3W7AA 2CUKA 3TW8B 3VZDA 4LEIA 5FBWB 2B1JA 3TBKA 3CUTA 3L4EA 4P98A 4FGWA 4WXHA 2VPWA 2XUJA 1GO2A 2ZR0A 3CBQA 2QOEA 1E5VA 4HDNA 4EQ6B 2VYQA 3KETA 1EFVB 2GUWA 3H9QA 3N8HA 4P08A 4D9HA 4JSTA 3SHFA 5C7OO 2WMDA 5CB0A 1HQKA 2V6IA 3GDGA 4Z0TA 3RSHA 4OJKA 1UXJA 4OXRA 3DKKA 1EYZA 4TMZA 1RJEA 2HNAA 2CYAA 2IUFA 1CJUC 2NYAA 1G5RA 2B5VA 3VOAA 1ZUHA 4IQ0A 3WNZA 1Y4ZA 3UOGA 3Q8XB 5I45A 3BWCA 3KDSE 3BL6A 1A8UA 3MTEA 1RZRD 2YV5A 3C43A 3AVUA 3DF9A 2VDJA 2L69A 3L82B 1W6RA 2BJWA 5JE8A 3MFYA 4PVDA 2TS1A 5D5QA 2I22A 1XF1A 3WRXA 4JEIA 2ZXUA 5ALGA 1PT5A 1DUSA 2O2XA 4NU0A 4NZZA 2YV3A 4MWDA 3WAKA 3R7FA 2CJWB 4Q7LA 3EHEA 5G0UA 4WVFA 2QRQA 3JARA 4P83A 1NA5A 5L3QB 3ADDA 1JG6A 2A1TR 2G1JA 4FMCF 4G9GA 1N9GB 2ZATA 4G5QA 4IR7A 4RX1A 4ZVLA 2K2WA 1FX0B 1GEGA 3AFMA 3GN2A 4CMHA 5A4FS 4BMSA 2ZJBA 3HA5A 3OLCX 1I3OA 1PEYA 2O2ZA 2JK0A 3AR8A 1YDHA 4UTOA 4JUCA 4QU9A 3WHKA 2P4HX 5LP6B 3EULA 4G67A 3WMXA 4QUJA 2AV6A 2FB9A 3QKSA 4CLOA 3D4BA 4NJEB 4I55B 1I4OA 3ELYA 2PD4A 3RU7A 4ZT5A 2C8JA 2JPDA 3A10A 5AXBA 5GOTA 3ZY4A 2OZKA 5KWSA 3COWA 1GT91 1M1YE 2Q6LA 4FDLA 4M76B 3EPRA 2G77B 4GDMA 2WLSA 1KAHA 4K8OA 4O2RA 2RGRA 3NGMA 1KORA 1SCBA 4OUDB 3ZV6A 2AG1A 2JDID 4JSYA 5C5DA 1CRZA 1DIRA 1NU8A 4YRQA 2Q45A 3QJGA 1JDPA 2CB0A 4BVEA 1BXRB 3IBCA 1K88A 3EDQA 2PQ0A 2VK2A 5CEJA 1LK5A 4P7JA 4PGAA 4BGUA 3VHXB 3R5KA 1XVLA 1WZCA 1YJ5A 3IULA 1ZNWA 4FCTA 4G26A 2ES4A 3IILA 3N70A 4PQFA 1JA0A 2QN7A 4PG5A 3SHOA 3UJ6A 4P53A 1GR0A 2PKQO 4UVGA 1DAIA 2HPVA 1P9LA 2XUPA 4XX0B 5F3RA 3HJHA 3I8XA 4GSYA 3UGKA 3CXUA 3CUEF 4EKIA 4B79A 1JJVA 2I78A 4AB1A 1SBTA 5JCJA 3QELA 4DJEC 1YL7A 2OKGA 3LDHA 5HNKA 1FXSA 5GZ3A 3IV9A 3UB2A 5SYMA 1QO9A 3HEBA 4UNPA 3P2JA 1N5KA 4JMLA 4JR2A 1MGOA 4P4TA 4CLRA 2HQSA 1JH9A 1PCXA 3DEZA 4IGFA 4J75A 1E1RD 2HF7A 3FUWA 4M7WA 5FULA 4XYLA 3VPCA 1Z38A 3U7JA 4DXAA 5EL0A 4CNQA 1R0XA 1SKYE 5TQVA 4QTZA 4D4MA 1KJ9A 2W2QA 4CL8A 3ICVA 4GLLA 1FSFA 3HM2A 2VT3A 4BOYA 1MVOA 4CR8A 4AJLA 3GFQA 3ICEA 3ZZNA 4YONB 1XTRA 1IZYA 1V5EA 1MH1A 4B17A 1VZ2A 1CS0B 2YTZA 4Z4QA 3KM0A 3D8HA 1N1MA 1ADYA 3DFUA 4OIMA 4WOKA 4XFKA 3MJVA 2HBZA 3SDBA 1T1GA 3SC6A 2IWHA 1X1TA 1JTVA 3EZ7A 1VHLA 1Z6ZA 1IXSB 2O7SA 3EH2A 3K73O 1IN6A 3KCNA 3QUTA 2NU8B 5JUWA 5D1HA 3FWYA 3L01A 4B47A 5JTTA 1MD9A 5HTOA 4KFCA 2AIRA 2W2VA 5T4FA 1SA0A 3RC9A 2GWHA 3E3MA 3HYLA 1SH7A 3TWOA 3UYLA 3F4KA 1Y4DE 4RLHA 3T1YB 1RPNA 1XA3A 4UFOA 4PRYA 1MHPA 1QE0A 1V6AA 1O4VA 5DN9A 3DEAA 1UMBA 1YVDA 5HRCA 1H6DA 3EHDA 3VR5D 4GC5A 1HF3A 1YB4A 4J49A 2W2NA 4TLLB 3ZDZB 3SC2B 3ESYA 1UBRS 4IRXA 2ZBQA 4N3AA 1HYHA 3GRCA 3QWBA 2CXSA 3EXIB 4G6ZA 4N5HX 2ZI5A 1HV8A 3DBLB 3G68A 1Z16A 2V98A 4MLZA 2VPYA 5DWQA 3R5SA 4DEVA 3WGYA 2FRVA 1F5NA 3H1EA 2I76A 1UAAA 1QF7A 3ANXA 1D6SA 3GYGA 1IWBB 1WVIA 3NATA 1DKMA 3E2MA 4DEXA 1NY6A 1K75A 1PQPA 1R0KA 5HQJA 4HQ6A 4B6SA 2QRLA 4FE4A 4GKKB 1U3UA 4BCDA 5CMLA 3L7OA 3ILYA 4K9OA 1IQ0A 2XVAA 5LKRA 4CDMA 3IV7A 2GN0A 4LOIA 1JIVA 1P1IA 2EQBA 3JQGA 3C87A 3EWNA 3JYNA 1ORRA 2RH4A 2J45A 2AUNA 1IZ7A 2V7XA 3LGAA 4YLEA 1WPQA 2A1IA 2WK1A 1M2KA 3BFPA 4RD0A 1KI2A 1LRLA 1MORA 2R3SA 2EHJA 4GRIA 4KAXA 1NQTA 4AKEA 3AR5A 4BJ3A 1TA4A 3B78A 4EABA 4ZQGA 1CR0A 2QTHA 1B41A 3AP3A 3QA9A 2CNNA 3MWYW 4BRSA 1OAAA 2B82A 3H97A 4U7TB 5ED4A 2JGDA 1NOIA 2WAAA 2VK8A 1A0OA 1K5GA 2LBPA 4HN2A 1AXEA 3CEHA 5ER9A 4B09A 5IKMA 3QE3A 1R0YA 5T57A 5LM3A 4DUGD 4RJIA 5DLPA 3ENNA 2YKGA 1U7ZA 1ECBA 4EHJA 4HNUA 4L5CA 1P45A 3GBVA 2JAOA 2VRNA 3IYLW 4RORA 3ZV3A 2DKOA 1KRHA 3JZAA 4Q9IA 3JVEA 1DTEA 4RELA 1E2HA 2J3JA 3OZEA 4I3FA 3HWWA 4BASA 3WL4A 3DFIA 3FWPA 3VFDA 3PFIA 1JJBA 4MW2A 4WLVA 3SX2A 3ZW9A 5K3FA 4UTZA 1U1CA 4X5OA 3UT5A 3W5DA 3L8YA 4LXQA 3D1JA 3P94A 4QQKA 1WQ3A 3V4ZA 4E6EA 5DP2A 2WC1A 3LRTA 3ER9A 2GN4A 1JB9A 3LPLA 1VPTA 1E1CA 1WULS 1F3LA 2FWRA 3FHOA 1V1MA 3QPDA 5E3JA 5GV7A 2VSFA 4RW0A 3OWHA 4O2BF 3EUWA 2XB9A 2YS6A 3HXPA 2NQ8A 3NYIA 1J8MF 1YB5A 5C8ZA 5KVQA 2Q8QA 3ANSA 1L7EA 1U0NA 3KQOA 5K0BA 1X19A 1OTXA 1GGMA 3QXJA 1YQXA 5DM60 3IE2A 4IDQA 5IXJA 5CVVA 3QLEA 4MA5A 4MO2A 4NQZA 5KSOA 4OHZA 2W2KA 1MB0A 1KBQA 2NW6A 4GMKA 1U2SA 4RGQA 2RGWA 5KVAA 3WGJA 1E3WA 5AW6A 5G1PA 4GUAA 4UAVA 3QYAA 1VGRA 4P82A 5I8ZA 3DDZX 3QITA 5DDIP 3S4YA 3M1YA 4UNNA 1ESNA 3BJMA 4YCDA 1IUKA 2V8BA 1E1RA 3HB9A 1SCUA 2I0FA 3FCUB 4MCHA 4XOIA 4P4GA 4FFOA 1ZUD1 4X0EA 2B30A 3H11A 2P9BA 4I55F 1YQQA 3KAJA 5FH9A 1GA1A 1SU8A 2VPPA 4Q9LA 3VI3B 1PLJA 4RSMA 3ZLVA 5JFOA 3LFHA 5LP6F 1PGQA 2OWDA 2VHCA 2NZYA 1WPGA 1XNGA 2L18A 5FLKA 2O19A 5AK0A 5K6TA 4WK6A 3SZLA 2HK6A 5H4HA 3RG2A 1WF6A 3WGIA 3RS5A 4OI4A 3Q9UA 4BLQA 1N2EA 2QU7A 1BXGB 4NMWA 4DREA 4EW3A 2GEUA 4HDSA 2JASA 4WRRA 3QQ5A 4BO1A 3DOJA 3WISA 5TXGA 3T9FA 1EGAA 3R9IA 4CJXA 4UBLA 2O2GA 3CG0A 4IWXA 3SQWA 1RE0A 5ALUA 4UTRA 2FK8A 3G8BA 4HUQA 1G5PA 3DUWA 1M74A 4AG5A 3QKTA 5LQNA 4NI5A 1P0MA 3BXHA 3PSAA 3OIWA 4KQ9A 3B36A 4MQMA 4HNQA 4GPZA 2BVNA 1KZHA 3W4IA 3R5HA 5T3UA 1R6TA 4EBBA 4JBNA 4N76A 3IUMA 3TAUA 1I7PA 3HLKA 1QXSA 4H7KA 1XFAA 2Z43A 4AJHA 4BJ1A 1I2BA 1KEUA 1ORHA 2EKDA 2EW8A 2G8NA 3QVXA 1F3OA 2WUWE 4ZD6A 3ZX4A 3NHZA 4CQMB 5FI5A 2E6UX 1GTRA 1JLLB 3O4JA 1ZFNA 2FE1A 3EIUA 1G8JA 5DYTA 4LK3A 1QVRA 4FIZA 1F8XA 4LMAA 4RH3A 3WGVA 2ZETA 4FZ5A 4RKWA 5BQPA 2LDBA 4UAGA 2J5BA 3HR8A 4B73A 1FX0A 1AMNA 2PX8A 4PIMA 1VYVA 2WFLA 2J0VA 4XDHA 5IXYA 1EUDA 2HQOA 2Y2VA 4GBMA 5J4YA 3Q5GA 5ARDA 3UWDA 3FOCA 4S24A 4TKVA 2AKYA 4TV9F 1KMQA 2Y1XA 3Q5EA 2JFOA 5DTIA 4K9DA 1L7MA 4P35A 2ODBA 4M22A 2BEUA 4N82A 4YRJA 2B0JA 2A5GA 1E94E 4NZPA 4R1QA 3C4VA 5B4UA 2EKLA 4M99A 3HJUA 3HY4A 3KZXA 2PLWA 1Y6GA 1KAQA 1SXQA 3E84A 2C83A 1TCUA 2EEZA 3GNQA 3PSHA 4NQRA 5BP7A 3OZBA 2Z95A 2Q46A 1RVV1 2VJYA 4FN5A 1C50A 1HMYA 3INGA 3H0KA 3UYKA 1QFSA 2YIVX 3PFNA 3UATA 4FWTA 5EMKA 2AC4A 4LK2A 5J2TF 4FFDA 1AK2A 5SICE 3WLOA 4PGGA 2OORA 2ZFUA 3H1PA 3PNYA 3KRTA 4G0PA 3OY2A 1WQ1R 1OGJA 1T2UA 3PDIA 2B0CA 3FF4A 4KAJA 5EE1A 5JWHA 4BP1A 3AF6A 3LXXA 3DHVA 4NBSA 2GBFA 4NXNB 2P79A 1BX3A 1Z36A 1BRMA 4RKEA 4RTQA 3R4VA 4ALMA 3WJ1A 3KQVA 2I65A 1Q17A 2P41A 4D9NA 2VHYA 2CJYA 4I6EA 4MGYR 2YCLA 5DBFA 3SQXA 2W2XA 4H4CA 2WBLC 3ZIUA 2I2CA 5HP4A 1NPYA 2BZSA 2EBHX 5AVJA 2EDAA 2IDKA 3SPXA 5IX8A 3QUCA 2NMVA 5AR1A 4MMXB 4XUEA 1NBAA 1JR6A 4MP6A 3P0JA 3WQSB 1JPJA 4BHTA 3I5UA 5SY4A 4O33A 1BJRE 4MROA 2JLWA 1BDMA 4Q19A 2HC9A 2FR8A 4YJGB 4MYSA 1J2RA 5AW3A 4N48A 3GV0A 5J4LA 4JGIA 4JEUA 4I6GA 4QNRA 1LPBB 4E13A 3EXIA 2WABA 3IQIX 3RYIA 1J99A 3GQBA 2YHBA 1T4CA 4FD3A 1QO0D 4OGGA 4XTCS 3TD6A 2NU7A 1GZ3A 3WL6A 2FW9A 3KD3A 9ABPA 1YASA 2HDOA 5ELMA 2NVUB 1I5OA 2BUAA 3LC1O 4BWGA 2WWXA 4NF2A 4PCLA 5IN4A 5A6SA 3BSFA 1IAVA 3NM6B 3OLWA 2OQIA 3D4PA 4DDTA 4Y6OA 5LOVB 1Z56C 2QSYA 3B7GA 3DNMA 3D8RA 4BQPA 3JATB 2A0UA 1LTKA 4FEAA 3W4JA 4NJMA 5ITWA 2I7XA 2NTYC 3EEBA 4MIOA 3OJFA 2H17A 4RANA 2ZTMA 1G63A 1TJYA 3HKBB 1W44A 5C1IA 3RUHA 4EJFA 4NTZA 4UOQA 3ZE2B 1RIIA 1KKUA 2VNAA 5F2EA 2RB5A 1GSHA 1FDVA 1NBHA 7GPBA 3HL0A 2V5VA 5DOZA 4DPMA 3U1TA 1WUHS 2O2EA 4YT5A 1D0SA 3ZGVA 1MF7A 1NW5A 1L7QA 1XMPA 3BHIA 3IPYA 3P0FA 2C4TA 1I3MA 1K7SN 2ZRGA 2QTLA 1N6OA 3LRPA 3P5BA 3PQ6A 4OREX 2C5SA 4M2LA 4MGHA 3ZBQA 1TM1E 3OZFA 2WJAA 5AVQA 1FVFA 4KXFB 2DJ5A 3OOYA 3RS7A 4BPBA 1I32A 3Q41A 4HEJA 3BXFA 2IHTA 4LNUB 4BFWA 4HEA6 2MSCB 3I45A 3NC0C 2D62A 1DMRA 4G5XA 2RGYA 7MDHA 2QW8A 3KXPA 3BGDA 2DMRA 2A59A 4ECAA 2MOKA 1SELA 3O3CA 2XVYA 4HYEA 3WAJA 3RR2A 2Q3JA 4QASA 2UU9B 4AJKA 3EVCA 4PG7A 1GTSA 1DL5A 1PR1A 3OC0A 4ZQFA 4AWAA 2O0MA 5AVUA 3C6KA 2IYWA 5A6SB 1HFEL 2BM0A 2QTZA 3CX4A 2J3LA 4LDRA 2K7FA 2HMUA 2Y1WA 1NIJA 2Y9PB 3LW8A 2YR0A 4PLHA 3T3EA 2X6RA 1DO0A 3V9PA 2ZM5A 2YMPA 2D8AA 3LUDA 1UJ6A 4YACA 3KWMA 4BRUA 5AW2A 1F7VA 3QEMA 2HYIC 2Y27A 4FUQA 4UTNA 1MKYA 4G4JA 1RIFA 3FRIA 1RJDA 2VK1A 3BWVA 1QMPA 1OWOA 1DKQA 1WB4A 3C48A 4K8RB 1PGOA 4XJXA 3HUUA 3AHDA 1GCIA 3L6OO 2BGKA 3L8CA 4KQXA 3ESAA 5LZ8A 3TZHA 3SY8A 2O2SA 3ZWNA 1LW7A 3KHSA 2JGNA 4PHTA 4QEDA 4TWRA 3PEWA 5GOZA 5FWXA 4QDOA 3C5CA 2VP9A 2DE0X 5I9TA 3PFGA 1MW9X 2JGKA 1B4DA 4OFZA 4YWHA 1YQDA 1CQPA 3OIVA 3HA2A 4RZ3A 2PNJA 1RW4A 3ABRB 5E38A 3QA3E 1CNEA 3KJHA 1P9NA 2VJBA 1ZMBA 3U6BA 5IF3A 5C1DA 1Z4OA 4I5IA 5EJ2A 4CT5A 4XQ0A 1XRLA 4O6VA 5LFAA 2FUG6 3S2IA 4BMCA 4UEQA 3UXYA 3WB0A 3EA5A 4IXNA 3GPLA 3N2YA 4JELA 5EWMB 3DDHA 2O3SA 2C88A 2AEMA 5JPIA 3TZBA 4TL9A 4GYYA 4DHWA 1V11B 4NABA 3FPKA 1ZSNA 2H1CA 3UKOA 2EFDB 4WBSA 4KEAA 4LF4B 4FC7A 1P9OA 3AGQA 3I6IA 4HMQA 5KQRA 2IW1A 5B2ZA 4XIFA 3W5BA 2IOQA 3NHWA 4GMFA 1RC0A 4QQ8A 4G8BA 5I6DA 4CIWA 4B4OA 1YI1A 4ZVRA 1JIXA 5E0KB 5F98A 4L07A 4LWZA 5KCMA 2QX9A 2Z5VA 4OXYA 5FR1A 5IUNC 3HYNA 1BEUB 1QCZA 1RAIA 1V39A 2H1WA 2QTNA 2W2KB 2XYGA 4QAJA 1VG0B 3D6UA 1IATA 1X80B 3AVXA 1EVKA 1EM6A 3H8VA 4WBNB 2DH6A 1UBTS 2HL6A 2Q3EA 2VJCA 4CV3A 4E5UA 4HVLA 3FHTA 1O5IA 1B8NA 3KB6A 4LBZA 5A02A 3ZCXA 2AR7A 5ERXA 5FLYA 3G2IA 4RVDA 1MAVA 5EJFA 1LNSA 1PS0A 2HJSA 2TECE 1YMUA 2WIAA 3EEFA 2GZ3A 3EK2A 3KU4A 3OF5A 4I08A 4KBYA 4TVOA 4Z0HO 3CYFA 3I0NA 4KE6A 4N8DA 5K0LA 3UY4A 4BLOA 1SCQA 3QFHA 5L3VA 4PYNA 3VH3A 2JHGA 4HNVA 5AVZA 1XLTA 1IM8A 4YGYA 4GZLA 2ZWPA 1IOLA 2RHTA 4DR7B 4FGKA 1E98A 1TJ4A 3GWZA 5B1SA 1WSWA 1SUDA 2ZT7A 1LK0A 3LPMA 5LDGA 1OLSB 5JV5A 4LHYA 3T7RA 1D1SA 1NVFA 2J9FA 1OT3A 3ZDRA 2ID9A 2JGLA 5BW8A 1N0HA 3KDPA 4ID9A 3L7YA 3TOZA 2DQSA 1YI8A 4MTCA 4MR7A 1FSPA 2YJ4A 3MXTA 4Z9YA 4AJEA 1GNVA 5BSEA 2YUIA 4XD7A 1T6YA 1MT0A 1NT2A 2PZKA 3OT1B 5KAMA 3MVEA 2WQ7A 2BV3A 4JVOA 5REQB 1Z6AA 2AI1A 2O9JA 3OLVA 2ZAOA 3STYA 2J0SA 2PT6A 1T9DA 3NI2A 1QZXA 2BKUA 1GWNA 4HK4A 2QRPA 2BONA 8LDHA 5LLDA 1SHKA 4RNDB 1N2GA 2NYRA 3G9TA 3LOQA 8MHTA 4A8JB 4UFNA 3KSRA 3IIEA 3JQEA 2ONKA 2CKMA 2HSEA 4B6JA 2IYEA 5KYKA 4RQAA 1NNLA 5E4FA 1XNJA 3LFTA 3JU3A 3M33A 3VBCA 3GFSA 3TBHA 4DMGA 5KHOC 4YX9A 4CG1A 3DM9B 2AOUA 1A2QA 2PZGA 2YQZA 4MR8A 2IUTA 1U2QA 4PZ0A 2VA9A 4ZO7A 4QG7A 3TO5A 5KOYA 5J2UF 1SHZA 4MWOA 4AYWA 3IEMA 4LXHA 3CZMA 3WK8A 2YOFA 2NP7A 2JBAB 1YR1A 4P0QB 1JU9A 1VP3A 5COAA 3UWPA 4B7ZA 2MYNA 3IT1A 4CU2A 2JEOA 2Q5LA 3E2PA 1TEXA 3MTJA 4OOEA 3BMNA 3V4FA 4EYKA 5K0JA 3UPTA 3CMCO 3K70D 2PZJA 3PNQA 2WP8J 1MBZA 5ICCA 2G88A 4YCAA 2QL7A 1APBA 4UM5A 1TTTA 4OI0A 4YUYA 1Z0AA 1P5RA 2JS7A 3VDQA 1WNFA 1GHTA 2IIPA 2JA1A 3KK0A 5AI8A 1GPJA 5CYOA 1DG3A 3AI2A 3AY6A 3D81A 5EQDA 1PV2A 2QUKA 2ETVA 1RJ9A 1TZJA 4TTVA 3DJFA 4DLKA 2GK7A 1GUBA 2PXHA 5MGNA 1ESDA 4CKBB 4CHTA 4JITA 4RV9A 2HRZA 3GRYA 4INJA 1S1CA 2AKEA 1P5FA 2B7LA 1DC8A 5KSYA 1M1XB 1RWWA 3GI1A 4TXLA 1BXRA 2F48A 5HCUA 1PUJA 4FHGA 1XEFA 4FM9A 3H5NA 4K1XA 1HDXA 1SQ5A 2EZTA 4ISCA 5HF5A 2FSHA 3KOOA 1S3SA 2JBAA 4H2DA 4TZKA 4YBRA 5E7JA 3BWXA 4J0GA 2A7QA 2XTNA 3MLEA 4Y6SA 3ZXSA 2XMBA 3PRJA 4ETNA 1YJCA 2CHFA 2NUTB 3QEOA 5J59A 1Z0ZA 3WKCA 3U49A 3MT0A 4LRUA 2XUIA 3C3XA 3IMKA 3BH0A 2BELA 2W71A 3JXEA 2B4AA 1JEQA 3EWIA 3F1LA 4K86A 4D4KA 1GN9A 3GEHA 1YC5A 1EX9A 5ICGA 3IAAA 4F3CA 1KVTA 1B0UA 1Q0LA 2MINA 4LGVA 1WUYA 1J8QA 1H0SA 3VGJA 1DV1A 5I4CA 4K88A 3RFCA 1JLHA 3OAAA 3W8NA 4OI2A 2H92A 1YDWA 2AG5A 2BR5A 4ZGGA 3TG8A 2CLLB 4WY2A 2JFQA 2V54A 1L5HA 5IWAB 4JJ8A 4D42A 4PXSA 2NZJA 4JQSA 4BECA 4G0OA 1NI5A 2IXAA 2HR1A 2YDXA 4UJ5A 5BN1A 2VDWB 1Y3IA 1XTZA 4BFUA 1R6DA 1CLEA 3LX4A 4GOXA 1Y5LA 1O3YA 5LSAA 2UZIR 2KWIA 4C89A 1G5IA 5DGIA 5BUZA 2FFJA 4NZMA 3ZQ4A 2Q3CA 4PFSA 1OI7A 4YA6A 5IDWA 3N0TA 2ISCA 3GG9A 5B55A 2ODNA 1DCFA 1XD8A 3NONA 3BHNA 4HPXB 4ZYVA 3DXXA 5E2IA 5J5VA 2ZBGA 3BWBA 4GYJA 2XZPA 2OCXA 3AKCA 3LRXA 2Q1SA 2OHOA 2F3TA 2DBVO 2HB6A 3DGFC 3KKLA 3MB5A 4N01A 2H9AA 3T54A 3V55A 5EJ4A 1NRXA 3G0BA 4MUMA 5F33A 1VIMA 5DYWA 4GPEA 1G19A 2ZSIA 4H1TA 1G55A 3O1IC 1K63A 1TAQA 2MSEB 4GBJA 3ABOB 4HS9A 2OHHA 1NAHA 2CXNA 5BN4B 3TOCA 3A9UA 2GF9A 3OY7A 1YUBA 3DAPA 3PJDA 3PPVA 3TS1A 3AY3A 3V80A 5BSHA 2ZPUA 4DDVA 3ELDA 4RZ2A 1MA0A 1XYGA 4PANA 2YDYA 3FMOB 2IYYA 1JDJA 4LZLA 2LR0A 2OCDA 4NAVA 4LZJA 4I1PA 3KZKA 2W98A 4FBLA 1BXZA 1U8AA 4OHKA 3CGWA 3PNBA 2CMDA 2IIBA 3GLKA 5DV9A 3I9OA 4F56A 4X1KB 2PUAA 4MVJP 1ISHA 2OZLA 4WOCA 5CXSA 2IBTA 2X6TA 4P4UA 1H05A 2NZ8A 5T8KA 1O8BA 5DYYA 2UUPA 4S2UA 1PT9A 1YS7A 5AWFC 3TZKA 1T2AA 2CE7A 4AO6A 5JD4A 3LP5A 5JS7A 2WHRA 2WSSD 1L3BA 5E9JA 4RIEA 3JQ9A 4N18A 1HFKA 2GHTA 5G4KB 2Z83A 1NATA 1EJ6A 4W8OA 3L7MA 2CSXA 1LTQA 2FDXA 5AI6A 5ERYA 1ZVKA 4V0QA 4HG2A 3EY4A 3KZOA 2LD4A 2WD9A 4BNGA 1KEVA 5E3IA 4G86A 2V6MA 4GI1A 5G4KA 4WADA 1RPAA 1O6GA 2FOLA 3AEKA 4DUGA 3GNLA 1GXSB 2IEAA 1UDBA 1IHPA 2FMFA 3INNA 2ECKA 2HZ7A 5G4LA 2F1OA 3RS8A 4DT1B 3NBZC 2HREA 1ZIOA 3OUZA 4QJ4A 4KR6A 1T26A 3M83A 4LOHA 4EG7A 1OTHA 4ZMBA 1OFIA 2JFBA 3CX3A 1I24A 1Q15A 1CS0A 1J49A 4DLPA 4ZZ0A 1ZAYA 4N39A 3X1YA 3C45A 2JHAA 2OXRA 4PRKA 2RHOA 3RV3A 3T7JA 4IIJB 5H1YA 4EY8A 1EXVA 3L0OA 4D02A 2EL7A 2QXUA 4M21A 2GN9A 3G8AA 3OU7A 4MRNA 5H83A 1OB5A 1I2MA 2AMVA 2DPLA 2KLHA 4QHYA 5IFLA 1AJEA 2YYSA 3RASA 1KY5A 4Q48A 3C8UA 3H05A 1KRWA 1RP1A 2M1ZA 3C24A 4LG1A 1Y9ZA 3TLKA 4KLZA 4LZOA 4JHXA 1X1RA 3Q4GA 3UBMA 3FBGA 1L5FA 3JAWA 3PFCA 5JZBA 2JI6A 3O38A 1ZBQA 3CFYA 1JALA 1IZ8A 1M54A 4X63A 1L8AA 2I4TA 3DZJA 2H31A 3KQSA 4PAWA 1J90A 2PBZA 3NYRA 4FI3C 5BV8A 1YB6A 4HTAA 3EXHB 4W9NC 4LFCB 3HCAA 5CB4F 3RGGA 1WY7A 2F59A 2PLNA 4BVGA 3P4UA 3STHA 4N6OA 3RYFA 2PZFA 2K4MA 2QJWA 3CEAA 4EPTA 2OMKA 1T0BA 2PL9A 2ZI4A 4W8GA 1ZD9A 4KO8A 3GK3A 2YMMA 3QWAA 2OP1A 5G1NA 1S4QA 5DHAA 1NJ2A 1KAEA 3PGVA 1P0IA 3VO1A 4DTIA 1JFLA 4OCZA 2VRWA 3ULKA 3AUUA 1QR2A 3FTNA 4C0WA 1OROA 1MOQA 4M9ZA 2CJXA 4Z3DA 4EKGA 3B9QA 1ABFA 5EP1A 1JLKA 1SR8A 3QE2A 3D4NA 4G97A 4YMVA 4AN4A 2W11A 2GZ1A 3PRKE 2FG5A 4WASA 4W5TA 3F7TA 5KMGB 2B7CA 1ECPA 4URZR 1GPDG 1XA4A 4HCJA 3U37A 3EGDA 3PEVA 1T4GA 4MW7A 3IPCA 1MJGA 1VBKA 2NX2A 5DN6D 3EZGA 5IULC 3CISA 5KMGA 1JTFA 2A92A 1U0JA 1EKXA 1KZGB 2SKCA 2WD8A 3NFYA 2GK6A 3BIJA 4XKJA 1YD7A 1NOJA 3DSRA 3G23A 4LNHA 1CJSA 1XZNA 4R8VA 3TFWA 2BM9A 3TIVA 2C7OA 1CUGA 1F38A 2B6HA 4TLAA 3RFUA 4Q16A 1A9XA 4I1UA 1QCCA 1VJ5A 4Y2VA 3FKSA 4A15A 1X7GA 2DWUA 1S02A 1IVNA 3LIPA 1KI3A 4L4SA 2VDMB 4LRWA 4XUDA 5DM4A 5H4GA 5JDCC 2QQ5A 2H54A 4OBBA 1MN6A 4J7XA 1EFLA 3R75A 2JBWA 3I92A 2F9MA 5F7XA 3SJZA 3O90A 4L7VA 3TDMA 1I14A 3F4LA 4DLRA 3QHAA 3RIMA 3IAFA 4KO4S 3O1JC 4EZIA 2FN8A 1W25A 1DKRA 3JD1A 5IK2D 3DT6A 3TPCA 2CUNA 1R6VA 3AINA 4L1KA 3VVCA 1WF3A 3GLIA 4M98A 1Z0JA 5TQJA 3RK1A 2BMAA 1T13A 1V4NA 4BP3A 4LOKA 3KOXA 5H3CA 1YXMA 4F3TA 4KN9S 3R0JA 2HMYB 2K7ZA 4GLJA 5THXA 2DQ4A 3RBXA 4A03A 4DCNA 1FTNA 4JYZA 1GQRA 1Y8AA 4F6CA 1VJ1A 5KYTA 1USUA 5CLLA 3K9QO 2BGMA 1LV7A 1W8IA 3G7UA 2E1PA 2HIGA 4PV7A 1WBJB 1SBQA 1J07A 4C5BA 4C88A 3IXLA 1AGXA 5FD8A 4BLTA 2A94A 2SNIE 3KL4A 1ZRNA 2EVWX 3FGOA 4MS1B 3NHKA 4AP6A 1NZJA 4BQRA 4IIJF 4DV5B 1ONSA 1T3SA 3JVDA 4Y0AA 1JF8A 5DSXA 4P7GA 5BOSB 5L3SB 3IAS6 3F98A 4URWR 5DK4A 1UQUA 4QODA 2QJOA 3EVTA 3WGGA 4NZOA 2PN1A 4TT3D 1LPPA 1S1MA 4LPSA 2K6GA 3QF7A 1XHFA 2C84A 2DX7A 1RU3A 1DV2A 3FSRA 2I1VB 2COEA 4WXEA 1DRVA 1VLMA 3BF7A 4PRLA 1UADA 5EUMA 2ANBA 4NZYA 3F90A 4XGIA 3HXKA 4WK0B 1ESZA 1I4LD 2BHNA 3RNLA 3TVYA 3DE1X 3AY0A 3ONFA 3NBKA 5JC8A 4Q3KA 3CSDA 2E82A 3AQ4A 3U3KA 2RK3A 4Q93A 3UENA 1OFVA 1YOVB 2XMPA 5E6SB 5AYVA 4NFHA 5IZ4A 1OYVA 3A37A 3H8JA 1BRTA 2CF5A 3UHJA 2CNOA 4AY6A 3G02A 4TKUA 1GLNA 2FX2A 5H02A 2VJMA 1HURA 2HWYA 3K6KA 2OMEA 3RV4A 4PZEA 3STTA 3S1SA 2KHZA 3CRMA 5FR2A 1UK8A 1FJ2A 3S55A 4BNKA 4CQLA 1URPA 1KYXA 2C5LA 3E4CA 3NLLA 3TD9A 4NOKA 2DHDA 4CV2A 1ZMXA 1ZRMA 2Q21A 2Q1XA 4KQIA 3ADKA 3P97A 1N57A 4D98A 5F64A 5COQA 1HE5A 4RMNA 4WY8A 1Z0DA 4PQRA 1IK4A 1I0ZA 2CZCA 4HGPA 3SE0A 1QGUB 1RWBA 1EP1B 1W76A 5ILGA 3B1ZA 4RPGA 4BX2A 5JH7F 2DERA 3RIHA 2HRDA 2OK7A 1YNOA 3H18A 3HRIA 3N0WA 4OV6B 4RU1A 4J1TA 1MB3A 2FMIA 1NR1A 4XIYA 1MOZA 2O3JA 3GN1A 4KQ1A 1YRHA 5CH3A 2R84A 4J7AA 3UUGA 3UT6A 3WKAA 1A5BB 4D9EA 5JNRA 5LQUA 4AKHA 3DBHA 4R9RA 4U0KA 3TPFA 3S1AB 3UMCA 4OPMA 2W4MA 5LD2C 3EOAI 3ZE6A 4RY2A 1TK3A 4TZ6A 1N8KA 2RC6A 1YTLA 5EYPA 5KCZA 3OEYA 4MWEA 1LI5A 2PWYA 1J2EA 1GL9B 3L92A 4PTLA 3V4SA 3ZHRA 4KR7A 1SXJC 4C2UA 1VMEA 2AYZA 3IPAA 5TLSA 1ACJA 2DUJA 4A92A 4D9CA 3PCTA 3PNVA 4S05A 3F8TA 1SWWA 1SOMA 2QTMA 3PITA 3EPJA 2X3UA 5AK4A 3G85A 3R3YA 2HUPA 4MV8A 3T7DA 3VDRA 3O95A 2ORVA 3EA4A 4FZVA 3OTWA 2R8EA 3E9QA 2YIDA 5ALKA 1SXPA 3ZCRA 1E7WA 5EZ6B 4MX8A 1AO0A 2FDRA 2Q5FA 1L5WA 1TK2A 3BRWD 4FC6A 5EFZA 4ZT3A 3WHIA 1CR2A 1JMKC 1RI2A 1OX5A 1EA5A 4DQVA 4D97A 3AUJB 1EDBA 2IYFA 2RI1A 5M04A 2VP0A 2QRJA 2WILA 5F7ZA 3NHPA 1OCEA 1YS6A 3A7DA 3DB1A 3U4DA 2YMLA 3LT1A 5CEFA 3PGJA 1Y7IA 2KQUA 1DO2A 3U7EB 3U9TA 3PI6A 3DDSA 1AQYA 1VP9A 1DS6A 5ARCA 3S2FA 1GRQA 3AF2A 2EERA 2GX6A 4TLEA 3CRVA 1JMYA 3GDHA 3U2QA 3R8CA 5F52A 1MW8X 4LDNA 5L9AA 2C54A 3L3BA 1X1EA 2Y0PA 1DCTA 2R8RA 3DC2A 3CH7A 1MIOA 3HVIA 4GO1A 4HOYA 5ERGB 5JBIA 3B70A 3VTKA 2WKQA 5AKKA 1U2RA 5ALOA 4F93B 2GXSA 2HMTA 4UFPA 3BMQA 4RK1A 1U0LA 1QB8A 3UHPA 1GZ6A 1NULA 1NXVA 1XUOA 2AMJA 5CGQB 4D8TA 3FBTA 3PJRA 4FOTA 5BN3A 1AD2A 1TYDE 2WIGA 2YUTA 4KO2S 5E9QA 3KZVA 5EJ6A 3ZE1B 4OBEA 1U8XX 3ITKA 2FA9A 1KY2A 3GCWA 1U94A 4AO8A 1T1EA 1M6YA 4TQ9A 1T0HB 1FMTA 3VR5A 2HCFA 1YBHA 4DIBA 1TOAA 1CCWA 4OSPA 4KITB 1G8HA 1NFQA 1XZMA 1ZLYA 2IYPA 2N3ZA 4U2CA 1WCYA 1CY0A 2RK6A 2Y0BA 3QIVA 1GFZA 3TTWA 3CF0A 3VNAA 2WG1A 3NKLA 1KI1A 1QANA 3G9UA 4MAAA 4R1OA 3W9BA 2WTUA 2LRHA 4XA8A 1QZUA 2HXYA 1QRTA 3ELUA 4BQFA 3KT6A 3I09A 2MSDB 3M5CA 5L7YA 5TQ0B 4EAQA 4QKQA 1J0BA 1QH1B 4OKSA 4F38A 1TVKA 1BS9A 1LX7A 4Q1CA 4UNSA 4ZVNA 4B5LA 3CUKA 2PWAA 4MW1A 4G0MA 3NMUF 4C0AC 5FX2A 1ZJ6A 3BK7A 2IJGX 2QPAA 1R9MA 4PLFA 2IKSA 1OU0A 5AXAA 2GEJA 2IZ1A 1AV6A 1YL6A 4ZI3A 2DQYA 2XHEA 1QH0A 1DLJA 2QA5A 2TMYA 3C2QA 3B60A 3ERCA 1XVAA 4N4AA 2JFNA 3PC7A 3VUFA 3GJZA 3W6UA 1SU7A 2GAAA 2HQRA 1DBVO 5J2TB 1T3TA 4EL5A 2HN9A 1C9MA 3EYWA 2H4FA 2RI6A 5EXSA 5AVWA 2VDUE 3A1DA 2NPFA 2XWPA 3H19A 5DJ5A 1JA9A 2H4YA 3BFJA 3FMFA 4CRWB 1NMZA 1TMGE 5JD6A 4AX8A 2XA1A 1HMPA 3KUXA 3D3EA 5AJHA 2J6BA 2FPXA 3OCYA 1R1DA 4RGVA 2C4HA 4KWTA 5IJ9A 2FMKA 5D51S 1BMFA 2H08A 2O0LA 1JQ3A 2C07A 4MDHA 3SXJA 3QKUA 1ZI6A 3QPBA 5REQA 2VTDA 3Q6IA 5CW1A 1TM5E 3VPFA 4IX9A 3HDVA 3EXHA 2X5OA 4RC9A 2FPMA 2WB4A 4JKYA 4JJAA 2P9FA 2JIZD 3TLBA 1ZOPA 2J5QA 1VZ3A 4HSGA 4ZVOA 4J3NA 3WYAA 1XR3A 3ZOKA 5ALHA 2PZMA 3N28A 4TYMA 3PG5A 1P0QA 4ZCQA 4FQ7A 5K99A 4ZPXA 5HFAA 3ZD6A 2IY9A 1QDUA 1OYOA 4F2WA 1CUVA 1GARA 3EEQA 3KZCA 1E7SA 1GG2A 2IYZA 1YHNA 3N76A 3QPUA 4R98A 2GPNA 2UV8A 3K0AA 1LSOA 3ZY5A 3BRCA 1CERA 1SBCA 5EXDA 3L8MA 3QX9A 4KZKA 2O3UA 4PYMA 2GF0A 1P8AA 1Y6JA 2JFYA 5K8TA 1EP2B 3HUDA 3R74A 3DV9A 3S7ZA 1C2YA 3AL2A 5KSZA 4CLDA 4R1SA 3SFZA 1NG1A 4H1HA 3O9ZA 4ZQIA 1Q0HA 3IAM1 3TGWA 3KV3O 3WI7A 1PT6A 1ORDA 1XU9A 4FK8A 2OV3A 4JH0A 4OHUA 4YWJA 4IV8A 1GDTA 1UBGA 2O07A 1Q2UA 4C7XA 4HUJA 1FDOA 1WABA 2Q5HA 2R2GA 1ILWA 3F2VA 4MMZB 2JLQA 2QUHA 1AA9A 1L7AA 3HI4A 4J6FA 1UPBA 5CW2A 4I5FA 4A7PA 3KKZA 4F1KA 5SV2A 4GBED 1WEHA 3WBFA 2PKQP 1HE3A 1RWKA 2R96A 4JBWA 2A9OA 1CUAA 4GOMD 4RVHA 3WGKA 4EHHA 2I66A 2WP0A 3AHGA 3GMDA 1QIJA 1S8NA 1D09A 3PRYA 5FPHA 2I3ZA 3W8EA 5J1SB 5IU6A 4E51A 2J59A 3GHHA 2GPAA 2G17A 3ONEA 5CXUA 2BHSA 1FP6A 2MSWA 1A97A 4GP7A 3OCUA 1U5CA 3AERB 1R2QA 3PYXA 4V1CA 3FVWA 3W9UA 1Z4KA 1Q7EA 2QL9A 5FNVA 1Z35A 1CY4A 4NAUA 2PNFA 3V4VB 1TQ6A 1U8TA 1JDNA 2D74A 3AU9A 5CR9A 2DULA 2WJZB 3Q87B 5ICEA 1T9BA 4CGYA 5HYVA 2FWBA 3A2MA 5GGXA 4O2BA 5KQMA 3GUZA 1X1QA 2GERA 3I73A 4EHKA 1WB6A 2RH5A 4IFIA 4QO7A 3GT4A 4ZIRB 3GA0A 1K8QA 4RFLA 1JPVA 1Q83A 1QHHA 1HWYA 2OKCA 2W2PA 4QGAA 4QYIA 3GJ5A 1A4IA 1W35A 4LZWA 1WCIA 2CY0A 3FWHA 4N0MA 3RC7A 4JVNA 3JQRA 3O8OB 4IYRA 1ODCA 1OI4A 2FN9A 1EFPB 3F5DA 3H87A 4REOA 3SKYA 3V8VA 2Q2QA 3CZQA 1KBZA 4CTMA 4KR2A 5H3LA 1AQ6A 3LQQA 4EA8A 2C1ZA 2XGJA 1CX9B 3CPJB 5DEIA 3MJSA 2ADMA 4HEHA 3A6PC 3FWKA 5GGYA 4BBZA 4ETMA 1SD2A 1GNLA 2QX6A 3BRWA 3IDQA 1D6NA 4M60A 3C6ZA 3TUJC 1A9ZA 5JCZA 5F9FA 3TQFA 4H35A 1ZOLA 4RTPA 4GRDA 1JIQA 4HAVA 1X86B 3BQ9A 4QUIA 3JD2A 2V03A 1CJBA 2BFEB 1NJ8A 2WWIA 3NBXX 4QZVA 2CNDA 5CA0F 1DI0A 4DDKA 2AR0A 1TQDA 1YZHA 2VHTA 1UOEA 5K0TA 5L6MB 2C7QA 2B9EA 1P7VA 1S01A 1U9JA 3D31A 5HIJA 2PUWA 1EWTA 1CZLA 3NKVA 5D6NA 1EAYA 3OU6A 5ALXA 5EMLA 5BSVA 4PBRA 1EXMA 3SICE 4RVCA 1ZGHA 5EZSA 4O0MA 3ZGXA 1L5SA 3URMA 4DBVO 1E9EA 4AMUA 1DEXA 4YC7A 1JXOA 1P7WA 2NPOA 3SXUA 4YQFA 2XGSA 2PAFA 4CV0A 3PDIB 1FYFA 1LI4A 2Q4TA 3WRYA 4RFSA 3DKVA 4Z0PA 4N0QA 2GCEA 5TNXA 4DV3B 1EAMA 2PWPA 2PUCA 3F0TA 2UYOA 2B8NA 1WZ2A 1ZM9A 3VR4D 1FY2A 2YN4A 1CETA 4MPRA 2DHEA 4DQDA 4KRYA 5F3WB 1Q1QA 4AK9A 2F9FA 2NU7B 3AIIA 3IVGA 3OFJA 1V8PA 3PUZA 4JL5A 3IX7A 3ETLA 1UFVA 3DBVO 4CN9A 1AKMA 2IPAB 1BTOA 4BO5A 3EQ2A 2PUGA 1HDIA 1NVWQ 2CZGA 2H1FA 4EHLA 4FKBA 1SC9A 4XYEA 5K8JB 2PSFA 3ECCA 1MABB 1E3QA 1QORA 5DO9A 3FRJA 4B3DA 3MM4A 3K96A 2FEXA 5IG2A 3QEBZ 3C1AA 2OZEA 4PYJA 2ATEA 1Y1PA 2RONA 4CMJA 2W6CX 3ASZA 3SN6A 5LDDC 3ICCA 1XVIA 1ZD5A 4RJJA 4GECA 1JU3A 2OVBA 3AXSA 3AWDA 4Q4JA 3ZK9A 3KEFA 4D79A 3QOFA 4YT8A 3TSZA 1T0UA 4XX1A 2CVOA 2ENUA 4YRRA 4CCWA 4IG9A 3F71A 5BRNA 4HLUC 2WU1A 3PR3A 3FSJX 2C82A 1UXHA 2GA8A 6NULA 4WOBA 2FRDA 4GYWA 1PFVA 1CE8B 2FDCA 5ESXA 3EDMA 4UBIA 1IRIA 3FD8A 1OW3B 4RY0A 1NP7A 5IKEA 3IUBA 4I2VA 4NCKA 4KDRA 3JQ8B 1OYWA