2XODA

Crystal structure of flavoprotein nrdi from bacillus anthracis in the oxidised form
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
118
structure length
118
Chain Sequence
MLVAYDSMTGNVKRFIHKLNMPAVQIGEDLVIDEDFILITYTTGFGNVPERVLEFLERNNEKLKGVSASGNRNWGDMFGASADKISAKYEVPIVSKFELSGTNNDVEYFKERVREIAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Crystal Structures of Nrdi in the Oxidised and Reduced States: An Unusual Flavodoxin
pubmed doi rcsb
molecule keywords NRDI PROTEIN
molecule tags Flavoprotein
source organism Bacillus anthracis
total genus 43
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2010-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07972 Flavodoxin_NdrI NrdI Flavodoxin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xodA00
1CZOA 1YCHA 1SG0A 1T0IA 4QOEA 2BMVA 4U7GA 4YALA 3NHRA 2FX2A 4ICIA 3K1YA 4FX2A 5EAIA 3P0RA 2KLBA 2R96A 4PTYA 3GFQA 3OJWA 5NLLA 2FOXA 1AKWA 2ARKA 3TEMA 2OHHA 4D02A 1T5BA 3QFRA 2XOEA 4ZVNA 1CZNA 5JROA 1BU5A 3HA2A 4QOGA 3FVWA 2HPVA 1I1OA 4GI5A 3ES9A 1FLAA 2FVXA 3OJXA 4PTZA 3OWHA 1QBGA 3OX3A 1KBOA 3FW1A 2QMYA 2KQUA 1XT6A 2QX4A 2V5VA 6NULA 5FX2A 4HS4A 1JA1A 1QHEA 4QOFA 1H66A 1D4AA 2Z98A 2QX8A 4YQEA 4C0XA 3OWXA 3U7IA 4NLLA 1ZWKA 2A5LA 4U7FA 5F12A 3S2YA 4GR9A 1YRHA 2B3DA 2FDXA 2Q9UA 3NHFA 5LMCA 2HNBA 3EYWA 1AKVA 5F4BA 1J8QA 3U7RA 1YCGA 1AKUA 3L9XA 1FLDA 4QOHA 4FGLA 3NHKA 4N65A 4CETA 4FGKA 1FLVA 3NHSA 1OBVA 2R97A 4LTDA 1AKTA 4HEQA 2FCRA 2OHJA 3W77A 1RLIA 4XDHA 1NNI1 2FZVA 4QOJA 1AG9A 4H6PA 1C7EA 2MT9A 1D04A 4N82A 5F51A 5A4KA 1ZX1A 4BMPB 3FX2A 1AKRA 3LT5A 1J9EA 3OVMA 2MTBA 1SQSA 4LA4A 1J9ZA 2XODA 4ESEA 1VMEA 3W7AA 1E5DA 3GAMA 4J8PA 3O73A 1DX9A 3HLYA 3TZBA 1RTTA 2FAXA 1CZLA 1TLLA 3JSXA 4YAOA 3N3BC 5LVAA 2HNAA 1YDGA 5BUCA 3F6SA 2X2PA 1F4PA 3W78A 4R81A 3L9WA 2MOKA 2W5UA 5NULA 3NHYA 4S24A 1RCFA 3NLLA 1AZLA 4LTNA 3QFCA 4YAUA 3NHWA 1X77A 3O2NA 4ZVLA 2GSWA 4U7HA 3KAQA 3G5MA 3D7NA 1CZRA 2Q62A 1QR2A 3UXEA 2M6SA 2BPOA 1KBQA 4FGJA 3F6RA 2BF4A 3GFRA 3KEGA 4Y9RA 4Y7CA 1H69A 2FZ5A 4C14A 1FX1A 3SVLA 2Z9CA 3OX2A 1YCFA 4M0CA 3FNIA 3HR4A 2D5IA 3K20A 4C76A 5B3LA 4GQIA 1FLNA 2FLVA 3F90A 1B1CA 4F8YA 1GG5A 1AHNA 3B6IA 1QRDA 3FJOA 2V5UA 4YAFA 1DXQA 1XI2A 3F2VA 3KLBA 1CZKA 1WSBA 3LCMA 4C0WA 5FUQA 1JA0A 3NHPA 5EA2A 3N39C 3UXHA 3ZHOA 3OX1A 1J9GA 2ZKIA 1WSWA 1RLJA 3NHUA 3TE7A 3GFSA 1YKGA 2QR2A 2M6RA 2MWMA 3W79A 2BN4A 4DIKA 3R6WA 1ZWLA 5ULLA 1TIKA 5LJIA 1D03A 2QMZA 2QWXA 4NULA 3B6KA 5TGZA 4XDGA 1C7FA 1XYVA 3QE2A 4H2DA 4PU0A 2WC1A 2X2OA 1AMOA 3B6MA 1V4BA 5LBTA 1DXOA 4CF6A 4QOIA 1OBOA 2OYSA 4DILA 5B3KA 4QODA 3B6JA 5EMNA 3ESYA 3N3AC 4ZVKA 3RPEA 2Z9BA 1FVXA 4Y9UA 1FUEA 1CZHA 4YAWA 2QX6A 2V9CA 2QX9A 3NHLA 2F1OA 5LLDA 1CZUA 2RG1A 3ESZA 3NHJA 4LAFA 1OFVA 4N9QA 1YOBA 3EDOA 4DY4A 2Z9DA 2AMJA 4BMOB 1AKQA 5FA6A 2BZSA 4OXXA 2N1MA 5LJLA 3KAPA 1BVYF 3NFRA 3ESXA 1FTGA 2OHIA 4LTMA 5LBUA 4ZVMA 1XYYA
chains in the Genus database with same CATH superfamily
3GO4A 1W5SA 3AR5A 4KG7A 1DHTA 3VR4H 4BZXA 4CQMD 1ENPA 1GUZA 3A37A 5H1YA 1O54A 4R40A 2AJDA 3OAAA 1MNQA 4GS5A 3IAS1 1DNPA 4JA2A 4Q02A 1KH2A 4Y30A 5KOHA 1J2YA 5D84A 1J99A 2IXFA 5A06A 5HUJA 4PZUA 1Y6JA 3CLUC 3RG2A 1KP2A 2P90A 1UDBA 4JQOA 1OB2A 3RYIA 3FPCA 4RCZA 4ZCRA 3WB2A 1M72A 1H4SA 2Y67A 3VOSA 2QZ4A 3HCBA 1XIVA 4ZP1A 2I6SA 1T3ZA 2OHHA 1THMA 3DV0B 3KWFA 1ZK4A 4GZ3A 2Q1TA 2G8LA 2HWXA 3E9EA 1X1TA 3LZDA 2AN4A 2GN8A 4I08A 3IQWA 1TRHA 2PGIA 2IZ1A 2YJ4A 2VZEA 3QP9A 4JBLA 4MP3A 4ZVNA 4K2AA 3VTZA 5GONB 4PN3A 2N0SA 1MABA 4XWWA 3EEYA 4ZGGA 2Y1CA 3L7KA 2A5DA 1ZP6A 1SCNE 1RMQA 3T3OA 1QGAA 1G20B 1ZRSA 1TQ2A 2G5TA 5DP2A 3DF9A 4JUCA 4R0NA 3EGXB 3WWZA 1JVNA 3NC1C 1B4DA 3RK0A 4HXGA 1NR7A 2H06A 2LCQA 3V8MA 5LUBA 3H75A 2ZTHA 1ADYA 1CEXA 3S8MA 4C0HA 3CEAA 1MKYA 2DTEA 1TMGE 1Y7HA 1GYRA 3A9VA 3CNEA 1DJPA 3HPRA 5AKJA 3IE0A 1LI7A 2IV3A 3T1HB 2WMOB 2O5VA 2ZVPX 5EP2A 1UEXC 5JNWA 4RHEA 3Q0EA 4AURA 6REQB 4E2YA 2XWPA 4PEVA 3NAQA 3U7GA 1R8SA 3HG7A 2CFIA 4EX6A 3FHLA 1JQEA 5HKOA 1QC5A 2RHMA 5LQMA 4QVIA 1P81A 3OJEA 5JBNA 4IIEA 4TMXA 1I7LA 1QV7A 5BQFA 6NULA 1JSRA 4UNNA 3JTMA 4WNIA 3WTBA 1YD7A 2WVAA 2A0WA 2OV2A 4MQFB 1EH5A 4C6RA 1Y1RA 3DE6X 3TCKA 2RIRA 1J42A 1WLYA 4MR8A 5DWDA 2C95A 1E3WA 3E7FA 1HE8B 1NYQA 1UQRA 3JQEA 1KZYC 1R5NA 3NP9A 1U90A 2PX3A 3WIBA 2GJKA 2DQYA 3BTOA 1YH3A 2Z04A 1B7GO 1ZLYA 3ZV5A 1QE5A 1PG0A 1M1YB 1XF9A 3DOEA 4DLAA 3QPCA 2AOTA 3D43A 1S0UA 2VP9A 4LYEA 5BY2A 1VPWA 1G0NA 4LNHA 3IT1A 2G7MC 4DJAA 4FOTA 1Y1QA 2X9NA 4G6ZA 7AT1A 1A9XB 4V03A 1XTPA 1REQB 1LBIA 5BUZA 5I8WA 1KJJA 3Q4GA 1WVGA 1ZI6A 3UWDA 1UEJA 3GFBA 1GPUA 2PUAA 4Q47A 2TYSB 1SXJB 5CD1A 1SO8A 2ZPTX 1JEDA 5LCXA 3IBGA 5A4JA 1WOYA 2NTNA 2WG2A 3D31A 4QARA 3S55A 1Z6YA 3UAYA 3V2IA 1JPJA 5JAIA 3QNUA 4XPIA 1K63A 4QQ8A 1XZBA 1COWA 5DHQA 5MN5A 1A9PA 4OV6B 1S01A 2MMCA 3GGGA 1ZK2A 3CRVA 4TLAA 3K5HA 5TGTA 4A10A 2AMYA 4FYIA 2EHDA 1RZRA 1ORWA 3AW8A 4CGYA 3TZCA 2PG3A 3OO0A 2PMDA 1PVDA 3HRIA 4U2KA 4W1PA 3PSAA 4NV1A 3FCUB 1BHJA 1LI5A 2Q5JA 4LYAA 4AKTA 5IAAA 4R31A 1DT5A 1RLIA 4MYTA 4EQZA 5HZHA 2HF8A 1AK9A 3IOCA 1QX3A 1KRHA 5JSFA 4ZQEA 3DC2A 4ZO6A 2CJFA 2EL9A 3DHEA 4EFNA 3WGGA 1KZ9A 2WD7B 4IOLA 5HKKD 5G1OA 4UMDA 3HN6A 1T1JA 3PYMA 4PBSA 1L7MA 1AKRA 5EOVA 3EZ9A 4BNXA 4DG5A 5IVHA 3VU3A 1RWBA 3GHHA 3OM1A 4RXMA 2NU8A 2H6EA 3T4PA 2DE0X 4FFLA 4NZYA 3HXQA 4IEIA 5KNCH 2C0PA 2NU6B 3G9ZA 3WKDA 3Q9SA 4X7BA 1U4OA 4CQLB 1YB7A 2Q9AA 4K88A 2XNDD 3W34A 1UUFA 1OC4A 4I81A 1ZCZA 3ZHCA 1YIOA 2XQJA 5CT4A 3BWYA 4N6NA 5JSZB 4CCAA 1C1YA 1WUIS 3EXAA 3SR3A 5IKEA 1T35A 1O96A 1RC0A 3B1YA 3BD8A 3EK2A 4XRRA 3U80A 4CV0A 5IJ0A 2EOAA 2SBTA 1VJDA 2RKOA 3F6CA 4YTEA 5AK4A 3ZGLA 3WDSA 4EF6A 2COEA 2I2XB 3ANLA 3EIWA 4NCHA 3O3NB 4YPFA 2DCUA 1AK2A 4CFSA 4QGSA 5FUXA 4ZV9A 2RHLA 2IE0A 3COJA 1ULHA 2ZW9A 1TJ3A 1ISHA 1WCWA 2D59A 2GCEA 2I03A 3I3SR 3KU4A 3DMHA 2NW6A 1Q1BA 4EZEA 2ETVA 3PENA 3IP6A 1G5QA 1XA4A 4I1PA 2VUTA 3GIWA 3HVUA 3RI3A 4OAOA 1UXGA 2HGZA 1PNQA 3MCUA 5KDOA 1CQZA 1YZYA 4LJYA 2ADFA 4UE2A 5H82A 4E3WA 4E31A 3I5YA 3ND9A 3PUIA 3WMGA 5KHLB 4DIOA 2JRLA 4E0BA 2HNAA 1KJIA 3NONA 2B8NA 4YXWD 3MTGA 4JNCA 3VKWA 1N2JA 4GR5A 5LQKA 2SNIE 4EHFA 5DYIA 1OTHA 3PT9A 5FUMA 4BZZA 3WXBA 2CXUA 3I6BA 1E2PA 1S8AA 2C1XA 3FNHA 3L9WA 4OLHA 3AF6A 4UUPA 5NULA 2BBSA 3V1YA 2VFAA 4M0UA 2VTKA 1SG6A 2R6JA 3KUDA 3QPAA 4MUEA 5A7HA 1EUZA 4PZZA 3HFRA 4BVLA 2I4LA 3O8DA 4UATA 5SZJA 3PDJA 4BWFB 2JA2A 5KTMA 1DIBA 1JHDA 1GKKA 1PHRA 1Q3TA 1X8XA 2Z43A 1ORHA 1X9GA 1L7AA 3T1TA 3VO9A 1BVRA 4V0QA 1VKJA 3EGEA 4A7PA 1C0EA 4E5NA 2RJOA 3G23A 1AQNA 4N7RA 1YFLA 2G9VA 3DE4X 1UQUA 2V7EA 1AUOA 1OZHA 2ZGVA 5GQSA 3F4BA 2HDWA 2NZUG 5CK5A 2ORVA 1UPAA 1E63A 4D97A 1FTYA 4HNUA 1JFFB 4F56A 2I87A 4FWIB 2PMCA 2JA1A 3ABQB 3TSOA 4PWYA 4J0KA 2O8FB 4D0LB 3K0CC 1W5BA 4DLLA 3GZNB 4NMLA 5AW9A 1K97A 1XCGB 4HUQA 3UXEA 1HLFA 2X42A 4IAOA 4YJGA 3S2EA 3ZY5A 2IPNA 3DHNA 1U7UA 5B1DA 3GUYA 2I0FA 2P9JA 2ZCVA 2BR5A 2DWQA 4KRGA 4OQDA 4FSHA 4LFBB 4D56A 1H69A 3LY8A 3IE2A 3PQ3A 1DKNA 1HQYE 3EF1A 1FDOA 3QA9A 4O4HF 4WNAA 3L6CA 5BYAA 3ZWXA 4AZWA 4EBFA 3F97A 1G9TA 3IQZA 5FH9A 1FB5A 2JKYA 1MH9A 2BFBB 3ZBQA 2IODA 4Q7MB 4DV1B 3LHFA 1ZBDA 3SS8A 1MQAA 1UOPA 1ECJA 3QEOA 4MWDA 5GZ3A 1KMHA 2I4TA 1ICIA 1BA2A 1MQ9A 1SM4A 2Y0PA 1PTJC 1ZIDA 1TDJA 2JFYA 1EVZA 3L43A 5BORA 4XJVA 5I7WA 4FYHA 2CXTA 4JXXA 2Z6UA 3ZN2A 1YBAA 2ZSAA 1KPHA 3ILXA 3GEGA 3QI2A 1Z6AA 1Q1AA 2KI5A 4MQ4A 4O2BB 3B52X 3W6ZA 3AG6A 1MP0A 4B34A 4YT2A 2CXOA 3DZFA 3G8BA 4C7KA 5LQAA 1SK8A 1A7AA 3KR1A 4N5NA 1FMLA 1X7WA 1NW9B 2FLWA 2MSCB 3UJ9A 1MBZA 1JQAA 3AUUA 4J49A 1C1DA 1Q74A 4YO8A 5FRDA 3MTAA 1FTQA 1H4TA 3OPVA 2K87A 4Y6LA 5DI3B 1KGSA 4CDGA 1NJ5A 5EE9A 5BSWA 4HZIA 3WA7A 4BEBA 1W0JD 1C3OA 1US8A 1XTBA 3D8BA 4HEA6 2PXHA 4YI5A 3VMFA 4OQEA 1SD5A 2PZBA 5BN5A 3F3MA 3BCUA 2HY7A 4FXOA 2O2DA 4TLLB 1J70A 3DFIA 3ICVA 5AESA 5UKDA 3ZHXA 3SQDA 1RRKA 1MXFA 2OV6A 4WW0A 1ZFNA 1VECA 3V4PB 2VUUA 1B1CA 2H92A 2WA1A 3FGZA 2E0IA 1JWLA 4S2UA 3RVKA 2AI2A 4ED9A 4QU5A 5J4VA 2D0DA 3G1WA 4RZ2A 3V4LA 3EPKA 2JI6A 3I3OA 3IUNA 2YNMC 4GP9A 2W2LD 4EHJA 3Q7EA 2YJTD 3BREA 3MB5A 1JX6A 4WN9B 4Y1FA 5AW7A 1N6NA 1YRBA 4YJFA 2PMBA 4LJ5A 2VPXA 4N3CA 2H5LA 1CUBA 4ZDJA 4FI3C 1AIPA 3UMMA 3AFHA 1V8BA 4IIBA 3UG6A 4WBNA 3EQ8A 5FUBA 3JAWB 3ROTA 1QH1A 2DM6A 4MW9A 1RPTA 1Y3HA 2OLKA 3FUCA 1K6EA 3ZGVA 4BKRA 4CT5A 3O1IC 1U1EA 2VRNA 1ZJYA 3AQIA 3LBYA 3PFCA 2EP8A 5CNKA 1HLDA 1OYWA 3JD0A 4OQMA 5L4LA 3SC2B 4QG3A 4B83A 1T6BY 2AEMA 2OO5C 4MS4B 4M55A 5C7IO 5BR4A 4YRPA 2P9GA 4C0JA 1Z6XA 5T8KC 2QVYX 4X64B 1NASA 3L05A 5LPNA 2AKEA 3OOEA 2G67A 4FHDA 1F3OA 4E22A 4DB4A 5COAA 1R5BA 4WA7A 1YHNA 3AMVA 3FFWA 2O2HA 5A9TA 3W2FA 1RU3A 3HCRA 1PSDA 1XAJA 2FFHA 1GG8A 3KOYA 4FKMA 2ATVA 4R3NA 3UV3A 3V8RA 5BYJA 3IEKA 1KI2A 4C4XA 4E4RA 3ETCA 1QVVA 3HA3A 4M6WA 4WEQA 1IN6A 2D2XA 1SVWA 2QJOA 1VJRA 2X8LA 7REQB 1EFAA 4ZHQA 2WT9A 2PKXA 3ZGYA 3SC3A 2WTAA 3L3BA 4X8LA 1XQXA 4QJ3A 1QSGA 3K1JA 1NSTA 2D1SA 2PJZA 1TD1A 3PCRB 2XD4A 3GEIA 4HCJA 4NECA 5YASA 4QLOA 3K4QA 2EERA 4US1R 4Z9AA 5KSWB 1I2BA 3SZRA 1XFAA 4QEZA 5L3VA 2C1EA 5GINE 1XL0A 3IERA 4F9EA 4LOAA 1EZ1A 5C8YF 2BUAA 2VAWA 2BEUB 4U02A 4XWYA 3TE6A 3GX1A 2I6GA 4TXMA 4F86A 2MSNA 5JCPA 1KOGA 3U0VA 2EQBA 3A1UA 4PX9A 1X13A 4G0UA 1MN6A 3MCAA 4UTZA 4M3NA 4NZMA 4QXOA 4Q1BA 1Q92A 2EIHA 3LU1A 3P9CA 1DQSA 4EI9A 4PN7A 1NJFA 4F85A 3RIGA 1C7QA 1O4VA 3WX0A 2YOHA 1I8TA 1SJ9A 4HYTA 1XKTA 2VOJA 2I8LA 3O8OA 4HNSA 2RAFA 1QQ5A 5ALVA 3VR0A 2WM9B 3EBOA 4QUDA 4OHKA 2Y1EA 2H1WA 3FCXA 3N3AC 2JIZA 2P5YA 2H9AA 5JMPA 3BHMA 1XD2B 1Q44A 1XZPA 3EOZA 4RZ3A 5AWFC 4HFMA 3T7KA 4FCTA 5BWMA 3F73A 4OOEA 4ZGBA 4B3RB 1Q12A 1TVKB 4OB7A 5CVVA 3NU1A 5DWVA 4AZTA 4D79A 1DE0A 2OORC 1JLKA 1ZH0A 4DSUA 2GARA 3WLAA 1UZLA 2PWPA 3L7AA 4YHHB 3PQ7A 5AUPB 1YQUA 3GAZA 4QHSA 3WZMA 1E4EA 2D8MA 1SXIA 2HK8A 2QTMA 4LYGA 5A4AA 2G1AA 1Z08A 4BU0A 4E5SA 3I34X 2ETXA 3UATA 1X1SA 5JLJA 1J90A 4ZHQF 2RG1A 3UK1A 1TKCA 4ZHSA 4ZMRA 2FW8A 3ESZA 3K94A 5T4EA 1TL7C 4BLWA 3K8YA 2JJ8A 2FWIA 3EWIA 3F6YA 1XYGA 2CZQA 4DLYA 1WB9A 4OP1A 1XCLA 2ZRGA 5IM5A 1KYIA 3IHTA 4B4OA 2XOXA 3S40A 1IPFA 3ZY6A 3KT8A 1KSFX 3QBTA 4UEQA 4NKRA 5IZ4A 1NKSA 2PZ8A 1Y8QA 4UU8A 1P4JA 4DSOA 3ENKA 4FGZA 1P7WA 3OLQA 2I4OA 5B4VA 2BGUA 1U0RA 1JPVA 1PHPA 1DO2A 4AECA 1UK6A 3NG1A 4I0WB 1L8AA 3CO5A 3TNFA 1G6HA 2JAUA 3U37A 1P6XA 4L28A 1OU4A 4MVXA 1N7IA 4IFEA 1DQYA 3LDGA 1WZCA 1L3CA 2SICE 3OX4A 1XDUA 5FHQA 3WYEA 4F2HA 3DL7A 5LQRA 1IBLB 5FOXA 3MCZA 2CVPA 5B3JA 4Z1OA 4YAKA 1NUTA 2ZJ5A 1ETUA 3AEUA 1N5KA 1UDCA 1OLUB 1EE9A 4YRRA 5LQDA 2DULA 5DYYA 4KXLA 4UVHA 1S2OA 4PSAA 4KFUA 1S02A 1T24A 1TJ5A 2GNPA 1LK0A 2RHHA 3DE0X 5EHIA 5JNVA 1L8XA 1VLHA 1QOZA 2ONYA 2OHFA 2Q2NA 2QENA 5U9CA 1S1CA 5FUYA 2WWYA 3TVDA 2HZ7A 1GJRA 2RH4A 3HKEA 3PL1A 1Z16A 2VTBB 1PNRA 2JGIA 2EWWA 4X3PA 4D6PA 3E53A 5BV7A 4LNAA 1Q0UA 4OHRA 2PTHA 1OLSB 2CNWD 2E4UA 1A4UA 4MEBA 1H2XA 1E0DA 3JD4A 3Q98A 2GEBA 2YRXA 4LV6A 4B0OA 2YS6A 5TF0A 1M10A 2BMFA 5JZ9A 3PB3A 1C4WA 3KWJA 5DM4A 2XYVA 2XECA 1FS4A 4IXWA 4KL8S 4UXJA 3TLEA 3LFHA 2O1XA 5DTJA 3VJMA 4JD5A 6CHYA 5KYYA 2DG2A 1E92A 4MUKA 1NL3A 4CYMA 3OURA 3EARA 4WVLA 2PMWB 1TC1A 2R8ZA 4W9RA 1WDKA 3WKEA 3N7TA 4GI5A 4C03A 2OM6A 4EB3A 1DADA 1S3SA 1SC1A 3H2KA 1M5TA 3HB1A 3TB6A 3UGKA 1PG5A 3LX5A 4GX1A 4AS3A 2E6UX 4RFLA 4U6SA 2ZZMA 3I8XA 4KN5A 5TQJA 1UBNA 2CBXA 1YONA 2R7NA 2HIGA 2XUZA 3RUPA 1AZSC 1GZ3A 2JI9A 2C59A 5HXAA 4JS0A 4YJ2A 4YMIA 4RWZA 2YIDA 1IQ0A 5KKAA 1SBNE 5CIQA 2C9ZA 3OJLA 2P3LA 2E1RA 5CA1A 1EU1A 4IGEA 1SCKA 3CNNA 3S1AA 1NNLA 1PL6A 3C6KA 2CJYA 2QTAA 1BRTA 2JIRA 2Z6VA 3CF4A 5I7UA 1GQ2A 1TVMA 2FPIA 2YWGA 1FMTA 4K0KB 2H5EA 3A3KA 4M99A 3V55A 5HKKA 1WKCA 1RAFA 2G7ZA 3F5DA 4C4TA 1TECE 4QOFA 1IHXA 3TIFA 3SZGA 1N6LA 2DSNA 1WHTB 2JFZA 4OSPA 4CI0B 4TV8A 4J16A 1KMNA 2QX8A 1P74A 4ZIRB 3WNZA 3ESRA 1N0IA 5AQEA 2G25A 5FD8A 1QP8A 5BMVA 5IZCC 1VKNA 2XE7A 2PXXA 1P31A 5E9QA 2X58A 3AESA 3QLEA 4K9OA 4LBVA 1F4VA 3DVQX 3EIQA 2EBWA 2H54A 3CW8X 4XFJA 3IV6A 2DBQA 3IPYA 4I1IA 1R9JA 3LHSA 4F72A 3X1XA 3EEOA 2DSTA 3P2OA 4KO1S 4HBZA 4XWAA 2ZSDA 2W83A 1ZGZA 3EW9A 1RIIA 3QJYA 4I5FA 4D4MA 2Y1LA 3UFXB 4ROSA 3MT9A 1U2DA 3MW8A 1YZTA 2JH8A 3AR7A 3O21A 4X9XA 4TKMA 1ZKMA 3EXFB 2IYSA 3VAAA 1G21E 2CKMA 4MYUA 3JQQA 3UB3A 3K35A 1KQ3A 4GKAA 1GRCA 1VI2A 2VQ3A 3N28A 4W4TA 4BBPA 2PS3A 3KWLA 3MHPA 2NQ2C 1QS0A 3G59A 3DZCA 4JNKA 2HU2A 4QYIA 5B1SA 3T3MB 1V5GA 1I4TD 5BQ3A 5I9SA 5DTIA 4GMDA 5F2KA 3K2EA 4I9NA 5EIWA 2J8ZA 4JL8A 1W9MA 2O3QA 1MX3A 5C1PA 4B4KA 3MRSA 5C5IA 2FH5B 2BFNA 3ZU3A 4HAUA 2UDPA 3EN0A 3PIIA 4R41A 4YXWA 5I4CA 2R97A 1GCIA 4LTDA 4TKVB 1XCMA 3G8CA 3ILYA 4H1UA 3G9TA 4RYDA 5CA1F 2NP6A 2BBTA 3B9QA 4LYDA 2W6NA 5KJFA 1VJGA 5CYFA 4DY6A 1SB9A 3WQQA 3C3KA 3HO6A 5DE3A 1VCOA 5ITZA 4L08A 5EPOA 2W6MA 4TROA 4LOKA 2C92A 1NBMA 2D1FA 4XE5A 4ZQFA 4Q3AA 1Q15A 4X5OA 4NH4A 1F9EA 2ZRKA 4HTFA 1SEVA 3GCZA 2I29A 4KPGA 1LLFA 4TV8F 3PDHA 3E35A 5EUMA 1CJBA 3LT5A 3UQYS 4IHJB 4NP6A 1KJ8A 5BMVF 4L5CA 4E88A 3UMFA 1R16A 3X44A 1XDWA 4G2TA 2XTAA 3ZIAA 5I4IA 2QK4A 3TIVA 3SSOA 2YN0A 3IIEA 3FJYA 5IJ9B 2ZBFA 4B8YA 4WJLA 3HCDA 1NYLA 3PX2A 4G0YA 4LECA 1AJEA 3PEEA 2Z5FA 2PM8A 5BW8A 1E3JA 1K8XB 2GFHA 1RYBA 2AWOA 3A11A 2GRAA 3TW4A 3AVTA 4J3FA 1J0CA 4DUGD 1L0BA 2ZYAA 3K6RA 1DG1G 1F3LA 4KWCA 3RS8A 2Q5QA 3W6UA 3F3KA 3RF7A 1IM2A 1WULS 2PQ6A 2ZYRA 4FYKA 1Y8CA 4TMVA 3HJFA 2ZQYA 1T0UA 1K86A 4OYRA 2QP3A 4TOIA 3MAAC 3MS4A 1XCBA 7YASA 1UPCA 1ZCFA 5LA6A 2JFQA 3HP7A 4NE7A 4G9BA 4O2AA 3TFWA 2XXBA 1T6ZA 5F1YA 2PQ2A 1K27A 1WDLA 2V6MA 1V48A 1D1PA 2Q6IA 3CB4A 3LCJA 3IYLW 3M3HA 3BL5A 4G0ZA 3THYA 3WG9A 2DWOA 5JNLA 3U9LA 2GN0A 1JLHA 3H6HA 3FB1A 4LXYA 1IE3A 3BXFA 3RS2A 4DFDA 4D0NA 3EVTA 1JBEA 3MCWA 4II3A 5BVHB 2GAFA 3D8RA 5LYYA 4P4GA 3AINA 3A3OA 4UAGA 3DXXA 4C4AA 1UWCA 2C5GA 3AETB 1BCSB 1JKMA 3HADA 1LDYA 2X22A 2VSQA 3DDSA 3IELA 2IS6A 3N3BC 3SM9A 4P3OA 4H7IA 4HWSA 1L1QA 2RGWA 3OEHD 4M87A 1JKFA 2LGJA 4OM8A 4MRMB 2IXEA 3KX2A 3GLHA 5GOZA 4X3CA 4F71A 4YRZA 4DSZA 1TZKA 4LHXA 1B15A 2Y92A 1E20A 1N0HA 1I6WA 2IUEA 1ZYUA 4LMPA 4Z1MD 4OUDB 1N2EA 2GXQA 1CTQA 4K6FA 4KTTE 3QEAZ 4G37A 4V0MA 4GQBA 5JOQA 2QD3A 4RZIA 3OF2A 3AFOA 2X2FA 3NHYA 1MA3A 1TYZA 5JW6A 2OWDA 1CS0B 4A2PA 4F6RB 2B83A 3V4SA 4MS3A 4QM7A 4DA4A 1YB1A 1VHQA 5DYNA 1QKIA 1GTG1 4I5DA 3ZPXA 3BFXA 3ZCQA 3C85A 1ZOSA 2F90A 3I42A 4I4NA 1C0PA 1MJ5A 1XWFA 4QNRA 4CUKA 4ZQBA 4A91A 1E5VA 1P19A 3TFQA 2VK4A 4KMMA 4XD7D 1P5RA 1QH8B 4IUYA 3NDJA 3GDGA 1I1NA 2NZ2A 4H9GA 2Q1SA 4XM2A 1D0SA 1G2OA 2WKQA 2FPXA 4X92A 4CTJA 4X8MA 2QDKA 3PC7A 2PT6A 1XTVA 3RVNA 4D5EA 4LY3A 1E60A 1TCVA 3EX7C 3EUAA 4JU9A 1X9IA 5H16A 2UUAB 1FFXB 4ZKEA 4AYXA 2EBFX 4KV9A 1K8YB 1E9DA 4KO3S 4ETIA 4QREA 4QT0A 3A1WA 1TM3E 1CDOA 2X5XA 2C5EA 4R68A 3UIEA 1XKQA 2ZI5A 4KAXA 2GB4A 2V65A 3FTNA 1ABEA 4O4JA 1DINA 2LD4A 3SK0A 2JGAA 2FQWA 5A0FA 2VHYA 4JCCA 5AKIA 4XUCA 5DN6D 2BR3A 2IYEA 4P4UA 3KYCA 1HZJA 2TS1A 3EGOA 4LVOA 5ELMA 1FW6A 1U8YA 2XVXA 1GPKA 3IPXA 3K4HA 2GBPA 4UHHA 2VP0A 4KYTA 4W9MC 1K7XB 4DZZA 1Y1LA 1NMSA 4J9VA 1A5SB 5FTJA 1M8JA 1RZ3A 1QWSA 2ZXUA 4DOMA 5CCXA 3OU2A 2GXUA 1IQRA 4HWTA 2JAQA 3P32A 4F5EA 2Z9CA 4P4TA 2A9OA 1PLJA 2DWCA 5EWLB 4A5OA 1UXIA 3W3AH 4JJEA 1AQ6A 3WBFA 2CEKA 2WABA 2Y3IA 1U2ZA 1TF5A 3CRNA 4OBEA 1MMFB 2OBYA 3BDIA 5T4BA 5TQ0A 2O14A 2Z2IA 2D2VA 5E3IA 3SMQA 4LCBA 4MLZA 1VHTA 4DV3B 1N78A 4GGPA 5MHTA 1OFUX 2OAGA 3IIIA 1SA0A 2D5IA 3MT7A 2Q5OA 1FFAA 4F5WA 1EWKA 2CSUA 4XRGA 1QHXA 2WHPA 2CNKA 2V98A 4FYMA 4QX6A 3FRIA 3G13A 3BH7A 5HSGA 2I3GA 4PHTA 4W99A 3KUCA 5FB3A 5ALDA 1JHOA 1ZK0A 4DDWA 3BMOB 3GMDA 2EJUA 1X7GA 2AVDA 2DJ5A 2QTLA 1W4ZA 3FR7A 4WH0A 2J9FA 1Y3FE 3PNMA 3FPSA 2VDKB 3WAKA 2DGDA 1UF9A 2R1UA 4K3UA 4CQMB 2X86A 2COUA 4A1OA 3FAZA 3G2QA 3LECA 2GF2A 2YJGA 4QWMA 1Z4KA 4MUHA 2O7SA 2ENWA 2R60A 3AHJA 3IT3A 1I2DA 3QQ5A 2XADA 2IIVA 4GWGA 3KTFA 3DF7A 4QPDA 4Q4AA 1O5IA 1VYVA 3OF3A 1QRDA 3FJOA 2RHWA 4O4JF 1HFKA 1U7HA 3HFGA 3I28A 3UMCA 3N75A 2AG6A 3GJSA 4QYWA 2YASA 4NABA 1DWUA 1YJQA 1P45A 3CZMA 3JU3A 4IDCA 2WA2A 4DJ5X 4C0WA 4TVKA 3QYPA 4AMUA 4KKVA 3TD6A 4RPLA 1E1NA 2B8TA 2A3NA 4MPDA 4D9JA 2MU1A 2IF0A 3UYLA 2HYDA 2B1IA 1BH6A 3PUKA 4JJGA 2YXPX 4OIFA 13PKA 3KBBA 3KT0A 4ZO7A 2ACWA 1MEOA 2WPNA 3HBLA 3ZWBA 4B2PA 5DM60 2DKFA 4YAIA 3OF5A 4M9CA 1DAHA 5KVAA 2Z1MA 1SCIA 3TM4A 4FGUA 4OMDA 3UH1A 2YHBA 1ESMA 1XRRA 4RO0A 1NW5A 4CKWB 1J9GA 3AF3A 3L0YA 4C0SA 3K0CA 4GR4A 5AM2A 1RLJA 1OX5A 5JTTA 3FF4A 5FFFA 2IPXA 3TE7A 3ENVA 1UZAA 1XQYA 4OLJA 1G8JA 1K6IA 4XM1A 1M6VA 1YRAA 2XLCA 2VRBA 3ZD8A 5DHRA 2VPZA 1KBZA 2I67A 2JDIA 1ZN8A 3EPPA 4OOFA 3OICA 5ALLA 2M6RA 5CDGA 1X80A 4J0CA 1CD5A 1JAYA 2CXQA 4JQSA 2VS1A 5DOZA 4C0QC 1VTKA 4PIPA 4I36A 1RMYA 3C3AA 5E4JA 2Q21A 2WFLA 2HXGA 3TQTA 1SCUB 2K7FA 4FYVA 3SNHA 2QMZA 2ZR8A 4KMRA 4X1OA 3MG9A 1PR9A 1VYTA 2GYUA 2IHTA 3FYUC 3IODA 3MMPA 3U4HA 4KPEC 4GLOA 3PEYA 2JGDA 1NBWB 2O1EA 4MRAA 5TVKA 4KLNA 4Q7EA 3WFJA 3NIWA 1X7YA 5KDLA 4D82A 1Z06A 1PTJA 1NAHA 3HHPA 1M2GA 4D4JA 4ANFA 5KQPA 1W0KA 3SE0A 4NCAA 2GN2A 2GKOA 4LE2A 1QONA 1PLKA 3N8KA 3QLVC 3DB2A 5AK3A 3PFFA 3PR1A 2LCIA 1KZ1A 3HSKA 1EDOA 4WBXC 3U62A 1G7SA 1Y6RA 3V7YA 5DNUA 4RDXA 1LLCA 3AM3A 4RVOA 4IX9A 2EGUA 1HLGA 4KW7A 3RAEC 2WF5A 1YB4A 1ZVQA 3A10A 4MVJM 5AOCA 1MX1A 4CKCB 3P97A 1XEAA 3TEFA 5A04A 3T3EA 3S8YA 4YRAA 3NKFA 4QTTB 3RTDA 1ZEMA 2FUG6 2OBNA 4MR9A 3AL0C 3QPWA 5HQJA 1NZDA 2FPPB 4B2IA 4DUPA 1S8OA 3O93A 2ZRBA 4CF3A 2D3WA 2MYPA 3X1WA 2D2FA 2IDJA 2JKVA 3AERA 3VR3D 1G41A 4FHEA 4V1CB 3VPXA 3JALA 4PO3X 4ZOLF 1EFLA 3WL5A 1SXQA 3W05A 2ZJYA 4AF8A 2EHJA 4JVNA 2YNMA 3NEJA 3V34A 4JOBA 3KDAA 4Z4FA 3HFJA 5G0WA 4WMLA 1L9XA 2Y4OA 2QMHA 5DXAA 4UARA 4W8OA 4QBIA 3ZIDA 3FPFA 4EJSB 3S1SA 4ZA2A 3L1VA 1DFGA 4F46A 5HKAA 1G59A 1QG4A 1W36C 4K9DA 1LBHA 4MJLA 5FBZA 3UJAA 4BKOA 3UJ6A 1TM4E 1G18A 1A5TA 3AZPA 3J81A 1ZRNA 2AFHA 1GSOA 5EHQA 3WYGA 1KFEB 2CNBA 5AVYA 5JRDS 2R00C 2XB6A 3KJFA 4GI2A 1Y7PA 3JTEA 4AUEA 2YZ7A 4YCCA 4KUHA 4HQ6A 2JANA 3KDSE 2XCLA 4DG8A 1GN8A 4POAA 3IUEA 3SF0A 4C87A 2OO5A 4TWAA 4YRDA 2P2GA 4BVAA 3C8UA 4R0MA 3GMIA 4P31A 3WIVA 1IPEA 3INRA 1JH8A 3NEAA 3CKLA 3DT8A 4PE5B 3OLVA 5T8KA 1FYDA 1LDGA 4HJXA 4CLOB 3SX4A 4ILEA 2HJGA 5KOYA 4WK6A 4KPUB 1SVIA 4BY9E 3B82A 3EXG2 4FFVA 1G4HA 2CNDA 2R4UA 2C4TA 3TQOA 1WR8A 4HKTA 2QZJA 3ZHQA 3CUTA 3B51X 2QJTA 4W6ZA 2QRPA 2PHZA 4F45A 3IL2A 3HP4A 4HYEA 2FVYA 1ZN2A 3OPYB 5A0TA 4RK0A 4YK7A 2P75A 2A9KA 5CR9A 3ROKA 5K0CA 1QG6A 4MUYA 1JU3A 1N2ZA 3HN7A 1FP7A 4DIDA 5C4MA 1NBHA 4FWBA 1O6GA 3M1AA 3PC8C 3DOJA 5I9IA 4MNTA 2GRJA 3SR0A 1SHJA 4O3MA 5CCDA 3JQBC 3X1ZA 2NAFA 3NCHA 2PVCA 1OKKD 3D4NA 1W0CA 3HNRA 4BO0A 4DW8A 4U7GA 4X45A 1PL8A 1NNSA 2FX2A 1Z74A 3CBGA 4KGZA 2DPYA 5JNRA 5GIOE 3K1YA 2VT3A 8AT1A 2V6FA 2AJLI 4FW8A 5A4MS 4HATA 5LNK1 3ONFA 1GGNA 4Q1VA 1N33B 1FQOA 3ZG6A 5F5LA 3K6SB 1IWPB 1J2UA 1ZM4A 1ZXXA 2WLSA 1UPXA 4LRXA 3KYDB 1UAAA 1AN9A 4EW1A 3SOPA 5ITVA 4FI3F 2BEWA 1UJ6A 3GB9A 1PDVA 2XA2A 3BGDA 3KP1A 4CL0A 1ADFA 4ILKA 2OMEA 1ULBA 1DARA 1W4AA 2HPHA 1SOMA 4KE7A 2ORIA 3U3XA 5CFMA 3R7WB 5LXTB 3I1JA 4PCLA 4Q3LA 3BMCB 3HY6A 3ZWKA 4I4TA 4G97A 2QVGA 3BJMA 4HAIA 4JBHA 2Z30A 3LC7O 3T9FA 3VDMA 3OEWA 5ALEA 4M8KA 3BQMB 3HFSA 2Q28A 2PANA 4MUGA 5TF4A 5AW3A 1KAOA 1SOVA 3O8LA 1V3UA 4RD4A 4RTLA 3O0DA 3I6IA 3ZK7A 4N7BA 1FLAA 2OORA 2YXDA 1ESEA 1Y6FA 4KSBA 3EE6A 3L4BC 4Z7QB 1VZ2A 2PBZA 2QLJA 5CA0A 2LRHA 1QHHA 1UKYA 4LWPA 1RJWA 1XEXB 2HBRA 5SYMA 3WJ7A 4DQLA 2EDCA 1MJNA 4Z3OA 5C32A 5D6OA 5CB4A 1ZJJA 3NV9A 5IF3A 3TR0A 2PZAA 2PUEA 1XMQB 1EFRA 4G8DA 4ENUA 3DMTC 3C97A 4L4RA 1IUNA 3AJEA 3CCCA 2OSVA 2ZVQX 3BMXA 2Q5HA 5JXWA 1DU4A 4MQ5A 1EZZA 2ZB2A 5K8CA 2G9UA 2Q0SA 5HFNA 2VDQB 4MIOA 5ESRA 5IPFA 2Y2UA 3RVJA 2JLVA 7MHTA 3QUAA 1PT5A 1UMDA 4YR7A 4ZOAA 2YV4A 1RBYA 3U7IA 3WMXA 3WQBA 3E1SA 5LMZA 4MR7A 2ZI9A 1XJCA 1PP4A 1KO4A 3Q85A 3QGMA 3A6GA 4RF5A 4CFYA 4L76A 3C6XA 5FBRB 3TW6A 2ISQA 4ZC1A 5CUQA 3UG7A 2QIPA 1H6DA 5K0FA 3SVTA 4OQFA 4OXRA 1QYWA 5ILQA 1TT5B 3ANXA 1U3WA 5G1NA 4ACBA 2BHLA 4IDOA 3ZI0A 1DX6A 1OA1A 1R4AA 2J0UA 4AO7A 1KDZA 5CFZA 2Q9UA 4O5AA 4OQLA 4OFBA 4ZT5A 1J0DA 4OREX 2Q5FA 3O2JA 2BGRA 1B0PA 4JGGA 5EMHA 4IGFA 5BYBA 1MAUA 2X0KA 3MB8A 4NFSA 1J2EA 2ZCUA 1EEHA 2WF7A 3SBXA 5KOJB 4R98A 3DZ8A 2XD9A 2W90A 1KTIA 3UJCA 2AQKA 4ZEVA 3L4SO 5I5GA 4JLOA 4RY0A 3FTFA 4FFMA 4PYKA 3TSWA 3FLAA 4PG7A 1JJBA 1KK2A 3C7AA 4MYCA 5F9FA 3IS3A 1KEZA 2OCBA 4R1OA 4BASA 2DFDA 4LRYA 3RLFA 5EJ5A 3GAAA 3M2PA 1K7SN 2CFOA 3WGOA 5HQTA 4N65A 1W88A 1JYSA 1HL7A 2WDPA 4KNVA 5F7JA 2LP4Y 4YLYA 5KQRA 3IQGX 4LPSA 4D96A 3G2IA 1RYZA 3FTQA 5GVRA 2NU9B 3OCCA 1EE1A 4CR7A 4D9MA 3FRJA 3PGLA 1EHYA 9LDBA 2JCXA 4DA8A 4G4SP 4J1SA 1AKEA 1F0KA 1I1QB 1P9WA 2GASA 3DYVA 4WT7A 5EJ8A 4CEIB 1QU2A 1O57A 2H29A 5EXTA 1EMDA 3C3MA 5EHGA 2NZJA 5IVIA 3QF4B 2O0HA 5AI4A 4UBOA 2K6GA 1PL7A 3LQRA 4N0QA 5AOBA 4DDTA 3TTXA 3RHZA 4YCNA 4CKYA 3T54A 2ZUFA 2M2IA 7MDHA 1B3BA 1AZWA 2P41A 1L5KA 3ZWPA 2QL5A 2VDWA 3TTVA 4ZYLA 3BGSA 3QA3E 2IZ5A 1XNRB 1YZ3A 3SI7A 1MHTA 1GV1A 4H4DA 1EUCB 2C2HA 1O8CA 2RI1A 3CSSA 3G2MA 3ZTTA 4CU5A 1T1RA 1U3DA 2Y9PB 1ZNXA 4WZ6A 5IBRA 3NVMB 3WWDA 1OH8A 4DBLE 4HP8A 1P1HA 2FA9A 5IKOA 4GXRA 3A9UA 1WO8A 3C87A 3F3SA 3M3DA 3LA6A 4ZZ2A 4N3NA 4TSFA 5A6SB 2QYTA 2AUNA 2RHGB 3MMNA 1J8DA 3NBFA 4GPTA 4YFVA 4U2BA 4FEGA 3W4KA 2UUCB 4YDRA 1J0EA 3GRCA 2W6ZA 3TK1A 1KO7A 1UMBB 1DX9A 2XNHA 3OQVA 3HLYA 3PFGA 2EX0A 2VUSA 1ULTA 4FILA 1JF8A 4RPGA 2WSYB 3E58A 4LK2A 2GK7A 1X38A 4ABTA 3RW9A 1GSAA 2A5YB 2XB4A 2O59A 3YASA 3TX2A 5IZCA 5FR2A 3CW2A 3TQSA 2FEPA 3LC1O 5FCDA 2Y1XA 1GGKA 5F76A 3OEED 3WHPA 5C1DA 3DWFA 4TWJA 4UNPA 2R1TA 4KDRA 3RRXA 4LBZA 2Q4EA 1YI1A 3AY0A 5E7QA 2OXFA 1EDEA 2BJVA 1JHQA 2X1LA 5MN6A 3RU3A 5BR8B 4JAVC 4HRAA 3RAFC 3ZEIA 2VHJA 2PT7A 3AHEA 4YEDA 1F4PA 1R0WA 3EIHA 3PD0A 1DC7A 2RHTA 4QTUB 5K0EA 2EBHX 2ZJ3A 4B4WA 5LN1A 1QIJA 2CK3D 4UTRA 2H11A 1GKUB 2NUBA 2PXCA 4MVYA 1VL2A 3P4XA 2BFDA 3QVGA 4EUEA 4O59O 3GLQA 4F1JA 3I5MA 1F8GA 1LJUA 2NXNA 5A4IS 3FA2A 4MUJA 4KH0A 2Y99A 3AVWA 4NCNA 2RDMA 3SWWA 3L0PA 5IT9A 4LTNA 2H31A 1GDDA 4R1PA 4IQ0A 2P6RA 2VK1A 3BXZA 3QQPA 1KIMA 3U7EB 1GZSA 2EX4A 1JAZA 1M2OA 2DFKB 1BW9A 2RH9B 4I7EA 5FPHA 1R3UA 2FZGA 3WA6A 3L7JA 2VDNB 1KDTA 2HBZA 5K3OA 2C7OA 1ZUHA 4KKXB 2O6HA 3H8WA 5AW0A 4U0KA 2PUTA 3RHSA 1B8OA 1TK2A 2A4MA 2LR0A 3KPYA 3LT4A 1DKLA 1SUEA 1V3VA 3IHKA 3QOWA 3RIMA 4QLBA 3PRHA 3R76A 3WYFA 1VBNA 2W2QA 3TVTA 3K5WA 2F1HA 2YN2A 5DXFA 4LGCA 3C8MA 3V4VB 1E79D 2C3PA 3MT0A 3WK9A 6LDHA 5EZ6B 4BX8A 4BEWA 5IVKA 4HHEA 5IJXA 3NWOA 2W6PA 4BP9A 1NY6A 3F2IA 3ZY3A 4MK4A 4EUNA 2DR0A 1RBMA 3JD2A 4G84A 3ETLA 3G02A 4ODIA 2C31A 4HSEA 5AKEA 3DMFA 1Z82A 2QRKA 4NWIA 4HLCA 4KSCA 4ENSA 1EX1A 1Z8FA 4OH1A 3R5JA 2JFXA 3PQEA 2PGJA 2VN8A 2YZNA 4L4XA 4C14A 3ZZNA 3C3DA 2JLSA 4L0CA 4LKOA 3H9CA 4JT2A 2VNKA 4P80A 3L1JA 2REQA 1V6AA 5JJ5A 2UZ3A 1E4YA 1LXCA 1P44A 2HA7A 4ZDWA 3TR6A 4BTEA 1GTZA 5ILGA 3UMSA 1E8MA 4B33A 1P2TA 4NFHA 4O1MA 4U2CA 2PKYX 1JEYA 1SBYA 2H2IA 2I7XA 3OT1B 3KVOA 1UK9A 4E5YA 3SSNA 4ZCLA 3C7TA 2JBWA 1CY7A 2P4SA 3FPJA 4NQRA 3L6OO 4UM9D 4Z53A 2EVWX 4PR0A 4E08A 3CUUA 1PFVA 2HCFA 4J0JA 5JRJA 4UPDA 3ZQKA 4YMSA 1ONOA 4MDFA 1V37A 3SS7X 3HY3A 4NBSA 1NSYA 1B6GA 1WMEA 2G09A 3UHOA 3NXSA 4F4FA 4GLLA 5G4LA 3TKAA 1Y1KE 5C4GB 2E85A 3M1YA 3DBRB 2XSZA 1U2SA 3DFUA 2NUPB 2C5SA 3AR3A 3DTVB 3QY0A 1BXRA 4LC9A 3FWPA 4PLZA 3LO5A 3OPNA 2KB0A 1M6YA 3UK2A 1HXHA 1Q11A 3CWCA 2Z5LA 3LP5A 4PLGA 4PYNA 2HRRA 2WE7A 4WY8A 4TT3A 1NM5C 2BLLA 1JG1A 4XWTA 3R8CA 4B7ZA 3UAVA 5EIXA 1UP7A 3GGSA 4NMWA 1O08A 5C31A 1JDJA 4URFA 4H17A 3EWSA 1JRLA 1TEXA 3VC3A 3RIYA 1HE4A 1PFYA 3G0HA 1OZ0A 4IX1A 3NATA 1J49A 2I7VA 1N9KA 5EZYF 4V0OA 3WWCA 4IV8A 4L3WA 5FTWA 3VDNB 1TGYA 3ROGA 4IMIB 5SICE 1TCBA 1DXQA 4YREA 1OGYA 1YVUA 1G2PA 3B3JA 4XPZA 2D2EA 4PYJA 3VNQA 3PRKE 1DQZA 1U5BB 1WZEA 2VRCA 3Q3HA 5HUQA 4MV9A 1GAXA 2Q5LA 5L95A 1SNYA 2HMTA 4PTLA 2ON6A 1IAQA 3OTIA 1DEXA 1IEXA 2CYBA 1X3SA 3BJZA 3ICWA 3M4JA 5HZMA 3NWEA 2RG7A 4OJNA 1DOZA 2W6IA 4LDRA 4Z4CA 4BFYA 1UAGA 3PQDA 3OHMA 2PUDA 3QU4A 2I9PA 3RGGA 4K6GA 4IIFA 4BO6A 4KODA 3EPJA 3DMDA 5KYXA 1I4WA 3KEOA 4PSCA 3ZDYB 1B14A 5LZ2A 4TVBA 5K09A 5TQVA 3IBCA 5HK9A 3GP3A 4X6LA 2BGTA 1EE2A 3FDZB 3HS3A 2IV7A 3DEYX 5KCZA 3KOMA 2VBFA 3STHA 2D13A 1P7YA 2B0CA 1Z47A 3IBFA 5FADA 2QR2A 1PWZA 4AY5A 1XTSA 1RABA 3A9CA 1TB4A 3PQ5A 2HNKA 4FLFA 1SHLA 1V35A 3CO0S 3MJEA 3TZQA 3KZNA 3BDVA 2O2IA 1K98A 4HTAA 3D4PA 5KAMA 5ULLA 1C7JA 4YUYA 3S2GA 1Y7IA 1ELOA 3PDIB 5EKTA 4UU1A 1LKZA 4CEHB 4CWAA 3LJKA 4GBJA 5KNLA 3NIGB 4GM4A 3EHDA 1Q7GA 1NMXA 2D1QA 3UHFA 4JLNA 2CD9A 3MLEA 3KZOA 4S1PA 5EQJB 2EDAA 2WMNB 3LDAA 4OQ4A 5I9TA 2XMRA 1T8WA 1TO2E 1Z3CA 4Z49A 3BTSA 4LSWA 3RFVA 2J3KA 3WMFA 4QBKA 2O9JA 2BFEB 1RHUA 4MHTA 3ROFA 2C0CA 3G8AA 3GFGA 4FT4A 3TRIA 1W2WB 2HDNB 5C3UA 4LGMA 3T3NA 2BKVA 1JLSA 4P84A 3ZJ5A 2BDUA 2XI4A 3MWEB 3E3AA 1LS6A 3DE3X 4YROA 2FN9A 2BFCA 4IIYA 2BHSA 3B6MA 4PX5A 1E1RD 3PLNA 4O8CA 2YOFA 1QGZA 3E2MA 3IAHA 4AXXA 3A28A 4M0MA 4ND1A 5J40A 4CF6A 3PXEA 4DRXB 2D0OB 4MEJA 2CHUA 2CZGA 4Q03A 5HPYB 1ECCA 1YQQA 3BXXA 3E5MA 4N0DA 3RRJA 3ENNA 4OX9Y 2OB2A 3KSDO 2UUBB 2YUIA 3AW9A 2ZIXA 1N8SA 2NM0A 4XYGA 3JWPA 1OYYA 2Q3EA 3GEDA 4IY1A 5D3KA 4LF5B 4C4SA 3KRTA 2R8BA 3E7WA 1SPBS 4N9WA 1V8DA 4X95A 1C8LA 3WHKA 4BDTA 2B7BA 4L8WB 3ZY4A 3LQKA 4NXMB 1D0IA 3STUA 3DO8A 5K2MA 1FYFA 1VHDA 2PK3A 3AUYA 5FLXA 1ZL0A 3IDQA 1LI4A 1ZW6A 2DZDA 2FPGB 2QJRA 3W1EA 2YWBA 4GX5A 1V1MB 2G83A 1NXTA 4PXAA 2FWJA 2IYFA 1QIDA 4DNXA 1ZU4A 1XRJA 1A9ZA 4IV0A 1THZA 4L0MA 2NXJA 3GRKA 1YZKA 2F1OA 2ZYTX 4LSMA 2BFMA 1D2MA 3I92A 3FN4A 2JI7A 3HN2A 5DGHA 4JYCA 2CHVA 1CDDA 3FM9A 3B5JA 5JDIC 3F46A 3AVVA 2WHQA 4KK3A 4NHOA 1QCYA 5E6RA 5CPBA 1T2UA 1E7MA 1EYZA 5IF9A 3N8DA 2FSHA 4M0LA 4D57A 3JYPA 3KEFA 1DMRA 3AJ9A 1V0JA 2GKSA 2QOEA 4GMKA 3ZHUA 4ENWA 2DFTA 1XU9A 2P1DA 2WU4A 4OP3A 4KXYA 6YASA 3IP3A 1CEYA 4GMHA 4MW4A 5C18A 4PONA 2ZR0A 1O6FA 5HQ3A 3IAFA 4YGXB 3PKJA 2PS0A 3ZD7A 4BFTA 1NGSA 3H5AA 4MRPA 2IKSA 5IFKA 1FK8A 2QTRA 3Q7RA 1G60A 1TO6A 2NQ8A 2OQIA 2NUAB 2Y05A 3ZX5A 5LKAA 5K0JA 4W5OA 4PPFA 3CVUA 3SF8A 4Z7NB 3BF7A 3L0SA 4UU7A 2NXWA 3NFRA 1E9CA 1FTGA 2IELA 2YVLA 3PHGA 4GPIB 1B74A 3PGA1 2PMFA 3AONB 4K1LA 1OAOC 1XYYA 2O2XA 4RZXA 4QA9A 4U6QA 3UUFA 4ZZ1A 1H65A 1U11A 3EDMA 5L7TA 1EXWA 2IOFA 3O8CA 3X1MA 4TPKA 2QY9A 3FYUA 1H0RA 2FV8A 4Q1CA 1TJPB 3T7AA 1W44A 1J7JA 2JJ1D 3H4VA 3JS5A 4DV0B 3X0DA 4AUNA 1XPOA 1XUOA 4UC0A 1FNSA 2G77B 4FEYA 4CM8B 1JH9A 1LWOA 2M9MA 1JEQB 4QU8A 1T5LA 5J4HA 1QAQA 1Z73A 1UT5A 3R0XA 1PWYE 3AUXA 2YWJA 2R96A 4PTYA 3QLVA 4BFVA 1DTEA 3ESQA 2BFWA 2NV0A 1AKWA 3JD3A 1Q0RA 1N5IA 2WNSA 2HPZA 1WQ3A 2Q27A 1UT6A 3FWNA 3H3FA 5BVGA 4RF4A 3SN6A 2ZJBA 3L84A 4FC7A 5DLPA 4WACA 1U04A 3DPUA 3GELA 4L3OA 5JVDB 2A30A 3DEJA 4RKWA 5K8UA 3ZUPA 4RTNA 2FHSA 4O1HA 3HA2A 2D1RA 3Q7PA 4WFQA 5DNVA 1NI4B 4ER0A 3LWDA 1MU0A 5CFNA 3FVWA 1XQ9A 5CURA 3ZE2B 1C8BA 1K5DA 3R6GA 5BNTA 4XQEA 4FMBB 3VOTA 4ZN6A 3THWB 1V7PC 1PFQA 1GGMA 4E2XA 1XSEA 1YA8A 3MYYA 1W75A 2QGNA 3K5PA 5F21A 2UXDB 1P3JA 5J2UB 4P81A 4K6KA 1KI9A 2IY8A 1EVYA 5IJAA 2C99A 5CLFA 1RXVA 2HJRA 4ZQHA 3KSAC 4L7VA 1AU9A 3W4JA 2JZCA 3O38A 1I7NA 1MEJA 5CT8A 2IBSA 1MNAA 1OX4B 4KJZA 2MINB 1YIAA 1IQPA 2PGOA 4H3HB 4JUBA 1QPBA 1W581 2HO5A 1CT9A 3E7XA 3LT0A 3NT5A 5K0NA 4RZQA 2EFCB 2YDYA 3EG9B 1GL7A 3I8SA 3TL3A 4EHAA 4LK3A 1NE7A 3AEQA 2AZDA 3MJTA 2AJCA 1TYDE 2ZG6A 3A31A 5BSRA 1EM8A 5CW1A 1S2NA 2ZR9A 4XTRA 4JI6B 4DREA 4AYTA 2O8DA 3I5UA 4JCOA 4RC9A 1TK3A 1UK8A 4E14A 4BXOB 3LX8A 4CUJA 3U7FB 2R00A 2IS2A 4IF4A 4GWLA 3KQVA 4CI9A 5LSAA 2EFYA 3T52A 2CNNA 3V00A 4BX2A 3GJ6A 1EUDB 3PKZA 3QVXA 1QGOA 1R10A 2IHZA 1Z5WA 2NO6A 2POCA 2QYSA 3UWKA 3I8OA 5KWSA 3ELDA 3GXBA 5F2EA 4X44A 3RYTC 3PS9A 2O1SA 4C0XA 5INTA 3CPSA 4HX5A 4OG2A 4A2CA 4KMOA 1PGNA 2VNHA 1Z0AA 4AZ3A 3QKRA 5DLEA 2P67A 3KXPA 4LKRA 2YQ5A 3T5CA 4XYEA 4XGQA 1U9YA 4MS1A 3ZCSA 3DFKA 4RVCA 2O54A 3DH0A 3U7QA 1L5SA 4UZSA 4F91B 5KREA 2OMKA 4KR0A 1E1KA 2XEXA 3VSBA 3RTEA 3EB9A 1W85B 4BNLA 4BUZA 2DUMA 3D8TA 4CNBA 3IQIX 1EJBA 3IE1A 4C20A 1WQ4A 3QE0A 4YECA 1N6OA 2IU3A 2J7PD 2P5TB 4UE6A 3PC8A 4FDLA 2M98A 5JXJA 5HMMA 5G53C 2C8JA 2E49A 2Q1UA 1AKVA 4YJHA 1IRXA 3JQBA 3OCVA 4H0NA 5FFMA 2X19A 3QU7A 1QFXA 3C6BA 2G9RA 4RH3A 1M8KA 3A1CA 3HR8A 1QTQA 2EC5A 3UMBA 2QUKA 2C2GA 4P4SB 4RPHA 2ZSEA 3G6WA 2YFKA 2D5LA 4QECA 4MQLA 4C22A 1RLTA 4DLWA 1M8FA 5AJXA 4EY7A 4DC0A 2AQ8A 3IBSA 3H4TA 3NHZA 4Y67A 3VV3A 4ID9A 1OIWA 2J9ZB 3NHKA 3G7SA 1NMEA 4H27A 2N46A 1MAWA 2VJOA 4AICA 4CM5A 5L51A 1K0UA 4TYYA 4OGWA 1QP7A 4MB2A 5JU6A 5T4FA 4DYHA 4HAWA 2FPUA 4P53A 4RSGA 4B44A 1RP7A 2JHFA 4QQRA 3SKYA 3EQZA 3WNQA 4C7JA 1GU1A 2DBZA 1T13A 1Y48E 1T0BA 2BMDA 4K6CA 5P21A 4XIIA 4OYYA 3VR5A 4MGIR 1DC5A 2XHZA 3I9KA 4FJ2A 4L5BA 2IUTA 2OCIA 3A8TA 4TTJA 4GMFA 1R74A 3H1AA 5J5VA 3CGGA 3SYNA 4G9EA 5LR6A 1P72A 5B1EA 1RI5A 1D04A 5BRNA 3RAPR 1ZUNA 1XB2A 1IRIA 3P9PA 4PHHA 5LP6C 2YC2C 2I91A 4BMPB 1ESCA 2Q46A 4TLCA 2O3JA 4BWYA 1KK1A 4BLPA 2VXYA 3OVMA 4KYUA 4UQOA 2ZUVA 3L4BA 4NTZA 4BO7A 4E2WA 4EB6A 4ESOA 1EFPA 1T2VA 3F4LA 1R0ZA 1FUUA 3MMXA 2G9ZA 1YDEA 3WP0A 3F8TA 4PZEA 1ULSA 4ESEA 2QMOA 3C5CA 3KKKA 2HRZA 2WSIA 3WYCA 3WIDA 1CUSA 5BW6B 4ZGWA 3HUDA 5JC8A 4KO4S 4QXQA 2V9PA 3UM9A 3RWBA 4B3GA 3ZIUA 3SKXA 3DBLA 3EMBA 4TMYA 2YWFA 2OL4A 1HYBA 2WT8A 3DMTA 1UMCA 4KR2A 2I2BA 2KX7A 3HKCA 4LJKA 2P8SA 2FFBA 4RDIA 2G17A 2PGDA 3SZUA 2C4KA 3N86A 3E1KA 2HHAA 1G98A 4RV9A 3RIXA 3HNOA 1XTIA 2G0AA 4WXEA 2HT6A 4UUAA 2I3AA 2FG5A 2E55A 4MUFA 3ZDBA 4ZCTA 1E3LA 2ZRIA 5KYTA 3U4QA 1SVKA 1M7BA 2PL1A 1OQAA 4LOHA 5K3CA 5D85A 1CV2A 5D8DA 3TPFA 5HHTA 5J2TA 1TCAA 1LQUA 1LBSA 4LCJA 1V5IA 3GZ4A 3OWOA 3MQ4A 1YTUA 4A15A 2WWXA 2ATEA 5TPZA 1I6LA 2D54A 3HCPA 3I5AA 2L82A 4OIMA 4RSMA 1V25A 4H4CA 1RCUA 3BD7A 5ESXA 3QBVA 1O94C 2IHJA 4P1ZA 1XXHA 4P98A 3QEBZ 1LWNA 2XMZA 4XGKA 1VPLA 4A6EA 3CU5A 4L5AA 1DDGA 1E5XA 2WYIA 4U7JA 4D3SA 4DQVA 3T7EA 1F2VA 1Y7LA 2MYUA 3AFMA 3B7WA 5EERA 3EZ6A 3ICCA 2YV2A 3ZV6A 3QX3A 4KHPB 1ODJA 3RYIB 3KS9A 2O2EA 3T1OA 1PKXA 2NLOA 4EA9A 2AG8A 2P5UA 1PS9A 1Y3CE 3AO0B 2DR3A 2Z8ZA 3MBIA 1O9GA 4EGAA 3HVIA 3PPXA 4DQXA 3OA2A 1RQGA 1VFNA 1NJSA 3JX9A 5BN4A 5JS7A 1CZRA 3RS9A 4P36A 5JSYA 3DE5X 3U26A 1G6Q1 3BXOA 1E2BA 3WRVA 6AT1A 4C3ZA 1F8YA 3G6KA 1NDHA 1JXAA 2X41A 3IP9A 3LV8A 4X00A 2QUIA 4J6FA 1HYGA 3DVLA 3EFOB 5T41A 4C01A 1Z4OA 5I7SA 3HB4X 1NBIA 4OL0A 4CM4A 4DJTA 2R6HA 2V7GA 4YY3B 5DTQA 1YB5A 3OH8A 3DZDA 2YKGA 3UXYA 1PQYA 1VMAA 3X43A 1I3MA 1DOAA 2HTFA 4JELA 2VXOA 3EA4A 4P7KA 4G3XA 1OYVA 4XFDA 3RFXA 5J2TF 2GZRA 2FKNA 5ARCA 1PNOA 5JNTA 4OQYA 3NM5A 4GW3A 2NTVA 1JR2A 2Q3FA 1OCEA 1OLXB 2Z2KA 3K09C 4HDMB 4MVCA 5DN9A 4YP6A 2AK3A 4BFWA 4DL9A 1YR7A 3GT3A 5CJPA 5C5DA 2VH2A 4X6YA 4HDCA 3TPCA 3R3UA 3W5CA 3BSFA 1QC5B 1CJKC 4IIHA 3T1NA 1KU6A 3WSTA 3CC8A 2LUOA 2BELA 3I2IA 3OZUA 1AV7A 2GEVA 4LZZA 1ZNQO 5AJZA 5A5DA 2D4AA 3H5TA 3VPDA 4N39A 3LHKA 3JATB 4ZAGA 1MOZA 2XKAA 5HJ5A 1MG0A 1PJSA 5CLLA 4RE6A 2X40A 1Y9ZA 1VIDA 3HR4A 4MR8B 2XOKA 1XROA 1RHMA 3A6DA 2B4AA 3A0RB 4A82A 2CE7A 4WZAE 4YAGA 1LTKA 4BLQA 4F3NA 3GLGA 4GP7A 3W5HA 3S2SA 3AZOA 5B3LA 3TYXA 1NC1A 1KWGA 1KAMA 2QW0X 5E4FA 3UJDA 1HDYA 5E4YA 1UC9A 2FX3A 5JBIA 1K8RA 1X1EA 2ZIFA 1YWGO 1N1GA 2OCYC 2X1MA 5SY4A 2QZ9A 2SKCA 3EVEA 1ML3A 3GEMA 5CVJA 3CG0A 5LB2A 3RUFA 4Y9TA 1NJ2A 2F48A 3C2QA 3CE6A 1QIKA 2CFRA 2OQ2A 2ZOSA 4DXAA 4F8YA 1KKLA 3DHWC 4GVLA 4PLFA 1UDRA 2PGAA 5CVDA 3HV0A 5JJLA 4DMKA 3HDGA 5IK2A 5DCUA 3CHYA 4CMAA 1R0YA 1ZMBA 4OXKA 5FPYA 1NVEA 4YAFA 4ZYZA 2PPLA 3PWSA 1FYEA 2VWPA 1O95D 3BFKA 3FKSA 4PCAA 1NMYA 1G5FA 1IWBB 2WOJA 3KO8A 1Z68A 3NH6A 1XHLA 1H2FA 1KQFA 4CMIA 5KC8A 2WU0A 4GOKA 4NEGA 4D41A 2GZSA 2DHDA 3GT7A 4FYXA 4ZD6A 4DPMA 4M88A 4DBZA 1F20A 2CXPA 4MQMA 2P2YA 4MWSA 3VHLB 3U2QA 1M76A 3DXZA 4XJXA 1NF2A 3N2IA 2I4MA 2YIJA 4UE3S 3V1TC 4ND3A 2IHVA 1CYDA 2YVKA 4CG3A 9MHTA 1ZD4A 1ECBA 4EEZA 2PA3A 2BUBA 4HH3C 4ZXPA 2PSDA 1N25A 1PEDA 1QZTA 1YQWA 5KSPA 1AA9A 1K6XA 1RQLA 1CFZA 3ZK8A 3PEFA 4P2GA 2MDTA 1EX6A 3W79A 1G2IA 2IXBA 3RS4A 2XCRB 3R6WA 4Q3CA 1E66A 2HREA 4X1YA 5AJTA 1KMCA 3NI2A 2H7YA 3CIOA 1IBMB 1G21B 1W4BA 1D03A 2IXGA 2QAGC 1LA2A 1DV1A 1TFRA 3IEIA 3T4EA 4KBGA 4B9AA 4P38A 5GVSA 4XLLA 2GD6A 3C70A 3H8SA 4UFNA 5B55A 3C3BA 3VU9A 1SU4A 1YAJA 5DISB 4PO8A 1PO7A 3C8HA 4G1VA 3COVA 3V6MA 4HQFA 2DHRA 4I8XA 4ZOQI 1HC7A 4C7XA 1XYVA 3A9SA 3OFKA 4CM9A 3NXKA 3QVTA 2EAUA 3WK7A 4B3TB 1Y33E 1N5MA 5IBPA 1BMDA 2BMJA 1EAYA 4QKQA 1AMOA 1OREA 1UOOA 1HDIA 3JRXA 4KDEA 4YDHB 2B2XA 4C5BA 1YVDA 1BEEA 2GN9A 1WUJS 4PC6A 5LD2C 1N4DA 4EM6A 4OHBA 4UM7A 2QRMA 1JVSA 2XCIA 3EW7A 1YR1A 5JNSA 2R66A 3T7IA 1Q50A 5EQFA 2HQSA 2NPOA 3K9NA 3NZEA 2FPLA 3K0KA 2Z9BA 2GHRA 3HEMA 1XQVA 1AY0A 2RGNC 3UKOA 3S8EA 5B36A 1NM5A 1RAIA 1PI3A 2V7UA 4H6XA 2UYHA 4KQMA 4L6IA 3BKXA 4WFIA 3WNDA 4XJSA 4CLDA 1CRQA 4ZARA 3N05A 3OLZA 4K40A 4Y6QA 1TQ4A 1QB7A 5JFTA 3GLIE 4RV5A 2QTVA 4DIUA 3AVOA 1ENOA 3RSOA 3ZCTA 3CTPA 4IDGA 4UKDA 3WB1A 3PPYA 4BS9A 3FF1A 4FFDA 3UV6A 2Y68A 3L1UA 2Z57A 4WESB 3W0LB 2UAGA 5M2QA 1AQJA 4FZ3A 5CYOA 1C5KA 1CQIA 1NHGA 3TOSA 1YS1X 1YL5A 2DPXA 2PR7A 5EWJA 2LXNA 4ENQA 1XVAA 4J2HA 1A2BA 2JL1A 2YJ5A 4NXNB 1H5UA 3JYOA 5I3ZA 3I23A 4N8DA 5EZSA 3VNUA 4H18A 2X2EA 1FP4A 3QJ5A 1R0RE 2EKLA 3C4QA 3WO0A 1WEHA 1L5ZA 5TJHA 1GPMA 4AJ1A 4DQ0A 1TUBA 1PS8A 1G38A 2JVIA 4MW6A 1PJ3A 4X7MA 1BGXT 1O97D 4TZ0A 4R8SA 3E9NA 2XGJA 1AKYA 1QGUB 4ISBA 1P60A 4HUQB 3CNOA 1F1BA 1AGRA 3DP9A 3URMA 2YV3A 3FZEA 1HT3A 4LQ4A 1JLMA 4BLUA 3ZDCA 5F73A 5IG2A 1X8KA 1M33A 1B8VA 3O9MA 1XRNA 1USVA 2W8BA 2ZJ1A 2VHUA 3MWDA 3OESA 5LBUA 5AMXA 4MINA 3GUVA 3MSXA 4TS4A 3P94A 3UOGA 3PGXA 5KTTA 2H0QA 1F0NA 2A1TR 5BPFA 3NRJA 3QUSA 4IVRA 2QW8A 4W6QA 3P8ZA 5A6VA 1FP2A 3EQ6A 4IO0A 1U4NA 3ASYA 3INYA 1ESZA 1NI5A 3GQBA 3ROPA 4JKOA 1WPRA 4X65B 3VOBA 1ZD8A 1JG7A 1YVEI 2AYXA 3HABA 3HL4A 4IJKA 3ZE7A 4RTSA 2CUZA 1QHYA 2J9YB 2RGGA 1P0MA 3PTAA 5TT1A 1LNQA 2ZYDA 1PZFA 4H7DA 4QO7A 3SJUA 1RC1A 2GH1A 2REOA 4MYSA 4WN3A 4AO8A 4R5MA 3ZE0B 2RE8A 3KTAA 5EJGA 4UW9A 2GR9A 1ZM9A 3VI4B 2C42A 3LRTA 4KVAA 3WQHA 2OC9A 4W63A 2QEQA 3KJHA 3L8GA 3O4IA 3RSLA 3VSAA 2XUQA 3I6ZA 3VTAA 1BU5A 5EJEA 2OHXA 2B20A 1NONA 1EIZA 1LUAA 4MVJP 3GWGA 5CH3A 4RE5A 1FEZA 3N58A 4X8HA 1DG9A 2H57A 5BN5B 2RCNA 2IWHA 2EKQA 4QSHA 2FP4B 1EP1B 4Q21A 4EYGA 1KKMA 1PJQA 4FFPA 5LIPA 3DLPX 1PR0A 3GOHA 1EFKA 5HRUA 4WFKA 1XCOA 2NZVG 5JJIA 1OE0A 4QASA 3EVZA 1NXPA 4UJ3A 4LXTA 3HUFA 1TX4B 4URVR 1IJKA 1U7PA 4URXR 5JAMA 4NZNA 4GC5A 5LP1A 1I4DD 2TSYB 1NUSA 4B7CA 4U00A 1UL1X 1U7WA 3CJQA 2EYQA 1T4GA 3LVFO 5AM0A 4TVSA 2DFNA 1JLLB 2Q3CA 5IKXA 4KE6A 3FHJA 1E1QD 3F49S 4HN2A 3PNPA 1HDEA 3LPLA 4JN6B 4WBNB 4JK3A 5KNBD 3AWDA 4BNJA 5JDIA 4JI2B 5KIAA 1PJ4A 4URHA 1QH1B 1U9ZA 3ZBUA 4YRJA 2X4IA 3AF1A 4HS4A 5IYZB 1QHEA 3LHIA 3B2NA 4QU9A 1WXFA 1ZIYA 2PAFA 3ITEA 4KDFA 2WDZA 2VQFB 2W2VA 2B78A 2H8GA 3EEQA 4GHWA 1P0CA 1T29A 1JR3E 4RD0A 2AFIA 4AUKA 3R9XA 1UJMA 1OTYA 3JAKA 3J7TA 3H0EA 4IG9A 1DBQA 4B8WA 4L8FA 1MFPA 4MLDA 2ZT6A 4EMSA 1ND5A 1N3IA 4A26A 5FWAA 2A5LA 3EDCA 4ERNA 4KTVE 2VCEA 4JJKA 5CB6A 5JZSA 1J1UA 4KQKA 4HI0E 4EYQA 3P9ZA 3L2OB 1ZGBA 5B2ZA 4B40A 1G8FA 4COKA 2QJWA 3ELWA 5MDHA 1RQRA 1V4VA 2FLKA 3VZDA 1E1LA 1TJ4A 4EMTA 2ERCA 2XGOA 3ABIA 2F7SA 1OAOA 3Q87B 3RJZA 1XZMA 1G5IA 3CZCA 2F8LA 3JVEA 2YIVX 1ATIA 2P9TA 4ZANA 3TSYA 1U3UA 4YP5A 1UXKA 3EUFA 3ESDA 1YT5A 3IXQA 3NRBA 1J2RA 3PTZA 3PUXA 4EG6A 3HEAA 4NBVA 1PSZA 5B58C 1QQBA 1K5PA 2QG9A 3F1LA 4BO1A 2GCOB 4JODA 3JWIA 5IWCA 1MIOB 3DPSA 1QIFA 4I9FA 2P2CA 4QYTA 4XCQA 4ZO4A 1J97A 3E81A 3NTOA 5E1DA 3AIOA 4QAQA 3WLFA 1VSVA 3A6ZA 1PZNA 1WZUA 5ALJA 1DEHA 1YI0A 1JZTA 3P9QA 1FUYB 1JXOA 1UDAA 3TD9A 3TLBA 3LP8A 2O5RA 5BO5A 4UM9B 3JQ7A 3MTBA 3AB7A 3GW8A 4AZVA 4ZI2A 3PJRA 3R77A 3B1ZA 4XOUA 5IAGA 4CETA 5FWXB 1G8GA 3BWBA 4BGUA 4UBJA 3CLSC 5M34A 2OCXA 1KHTA 2I54A 3WGVA 4KHZA 1GM5A 1FPQA 4FDUA 4JC8A 3FPGA 3RK4A 3WYBA 3I9LA 2C4VA 3QUCA 3ZWAA 2GHIA 4NS4A 4J07A 4WI1A 4OLAA 1SKYE 2F3QA 2EG9A 1SZPA 4B82A 4HYQA 1M1NB 1C7EA 5DT2A 2N47A 1TUEA 1OXSC 1XFDA 1JDBC 2VF2A 2BI8A 3JQAD 3K2BA 1LDBA 2VTEA 3F1KA 4QLAA 5EVJA 5IULC 3K70C 4R1QA 2Q6TA 1DRKA 5EY5B 2JBAB 3KTDA 3HYTA 3KTOA 4G23A 4HEJA 1GRRA 3CURA 5IP5A 1V16B 1IZ0A 4H35A 3VDXA 4WNYA 1CUJA 5GGYA 1ETHA 3PGMA 4Q9IA 4N12A 3Q8LA 1VMEA 1GTL1 1E4EB 4II7A 2ZTSA 2OK8A 2OTCA 4M0KA 3L02A 3C6MA 1XDDA 1A4XA 3PFWO 3OZGA 4O4IA 3VPBA 4BNMA 2XYRA 4U0JA 2I7TA 3R0VA 3M9WA 5BQ5A 2R4TA 1VL1A 2MHCA 4U8GA 3PQFA 1JKJB 2JD0A 4TT8A 2RHJA 5J4YA 1KJWA 3L7LA 2WR8A 3W6NA 5KVVA 3QG1A 3ZQ6A 5EKSA 2FAXA 1G7CA 1EDBA 3JQ8B 1CZLA 3Q7QA 4LE0A 3NOVA 4ENTA 1SCBA 3W5VA 5LOVA 1CERA 3HDHA 5AM3A 4P0QB 1VA4A 3SC6A 16PKA 4BRSA 1BFUA 2YN4A 1MOPA 1B42A 3WY9A 2PXAA 5BUQA 5I5EA 3BWEA 3PNSA 1ZXBA 1NF9A 1WCIA 3QFHA 4KE9A 5CVCA 4Z99A 4GAEA 3F5MA 4ZU1X 3PCXA 2CL6X 3IEMA 1N6KA 4TL6A 4R16A 5TMEA 3SFZA 1QU3A 3MF4A 1DSSG 3H2ZA 5F7XA 1UBLS 1YDFA 4NG4A 1N5LA 2LVBA 4JIGA 1Y42X 1YDGA 3DGEC 4AKSA 5JFOA 4Q48A 3JQCA 3D0QA 4NYMQ 5E0KB 5LIRA 4ZI3A 4E70A 4OBBA 2IQIA 4CF5A 3FPBA 1KAHA 2C2BA 2IIBA 1YE3A 4LV5B 4M54A 3BA1A 3S2IA 1SBTA 2J4CA 4XA8A 1DQPA 1UKVY 4YWHA 4MKHA 4Y2TA 1QQ7A 1AGXA 3GH1A 4YCBA 3AI2A 4IEEA 2GBIA 3CFYA 4AYWA 2AWNA 1G5PA 3JZFA 2G4LA 1RXYA 1Z26A 2EW8A 2NTEA 2QS9A 1QDUA 1SHTX 3SMVA 2QZPA 4HB3A 5AR1A 4DCPA 3JYHA 4ZEMA 1WWKA 2AOXA 2ZWOA 4ISCA 3ZE1B 3HA5A 5KNDD 3B89A 3L8CA 1OXBB 2Q3LA 1JFVA 3AF4A 4E2FA 4E7PA 4UVEA 3IPRA 3JASB 5TPWB 3LKVA 4XXHA 4HMPA 1GWNA 3W4IA 4LY6A 4PFQA 4A8JB 4YAEA 3RRZA 3BH6A 3I61A 3A27A 4BNDB 1A82A 4RD6A 2QU8A 5DX1A 5IC5A 3FMOB 4O4IF 3UQZA 4KREA 2RJNA 4IOKA 1FX0A 3Q3CA 3FSGA 4IQ4A 4JMPA 3FSEA 3PUYA 3AJ8A 3WK4A 1QR2A 1NP7A 3MUFA 2C5AA 2FWBA 5DHFA 1BYUA 3QLJA 1V8ZA 5LP6A 4INJA 3EEBA 4EFDA 1Z4IA 2B34A 1BXGA 1X7ZA 3UC5A 5FWYA 4Y9RA 2NZ8A 3V1MA 3OQMA 1FRZA 1E2QA 3ADBA 3JWGA 2FPSA 3K53A 1T8YA 1S4QA 4PNEA 1IAVA 1PJBA 3BB3A 5DTEA 5DMHA 3WP1B 4D4HA 2UXBB 1M3SA 5KCMA 4YJ2B 1ZOLA 1E9BA 3BIOA 4HH0A 3S7ZA 1OVMA 1NC3A 2AC7A 3Q2IA 4LHZA 1JXMA 2QLNA 3JCZA 3IUPA 2GEKA 5SY9A 1ZI9A 3H1PA 1SOUA 4P3PA 2ATIA 4Z7OB 4JJ4A 3BOSA 1VSBA 3LUDA 2JRCA 1JT9A 5JCJD 3LC0A 4DC1A 1ODFA 1HYQA 3IUYA 2CT8A 1CF2O 1BFKA 1GLVA 5TEVA 2IEYA 1XMVA 4BP1A 3CEHA 2HGSA 3ZDFA 2O8CB 4TV9F 1KJQA 1MRSA 1KXJA 3FIJA 5SZKB 5A2QA 5IDVA 1Z6TA 3K20A 3ZHVA 3SBDA 5HX7A 3W3ZB 2WTBA 3BL6A 2M6KA 2HLDA 3W8EA 1OWLA 4MGYR 3Q9NA 2VJCA 3RF6A 4EB8A 4DLUA 4B0PA 1JMVA 5K9ZA 1D8TA 4MSUA 4B6SA 3LKZA 4H77A 3HBJA 2NADA 2FW0A 4QDKA 1CQJA 5G0UA 1EG7A 2OA0A 3WXMA 1U2QA 1Z6ZA 3PWTA 3V46A 4NE2A 1QFYA 3HBAA 1Y1PA 2XEDA 1X6VA 2FRVA 4PAWA 3DZHA 3H3XA 2D1TA 4LQCA 4PNZA 5KWIA 3ORQA 5FPTA 3DDZX 4R84A 3GVPA 4V02A 4HQNA 3VH1A 2ZSHA 5DLQC 3Q6MA 2Q99A 3IAEA 2WWWA 1R50A 2QE7D 1O94A 4INOA 3ZXYA 4B74A 4IMRA 3LUFA 1WXGA 1TC2A 2GBCA 1AHNA 1P4RA 5TDHA 5DEOA 4EZBA 4J1QA 3MHTA 3WHLA 4B6OA 2GERA 4L75A 3H3JA 4ER3A 3SBOA 1GQOA 1R6BX 5LP6F 1CUXA 4FUQA 3AUJB 4QUKA 4QYIB 2OP0A 4XCVA 4YT8A 5ER9A 3TCXB 1WTAA 2IQ5A 1EQAA 2A4KA 1E7RA 3QVSA 3WBBA 3HUEA 5TMDA 4O63O 3MC1A 3HE3A 2Q3DA 1OSNA 4EF4A 2PUCA 5BQOA 4N5IX 2P9QA 3CEJA 3I9JA 4B3FX 2LIPA 2GWRA 3U4GA 4CHTA 3ACCA 3GC6A 4AY3A 1PZEA 1NZJA 3O75A 1P18A 3WGTA 1YMUA 1W29A 1WUHS 4B81A 4BVKA 2X8WA 2O8EA 4JC4A 4MOWA 4OFXA 4UDNA 1SBIA 1XQWA 3JQFC 4BAGA 4P0TA 5ICEA 4C3OB 3C41J 2G70A 2LDXA 5ALPA 3SDSA 3SJBA 3FNFA 4G8JA 2V7WA 4ZU6X 4DT1B 5HCUA 5ERXA 1A8SA 2H00A 4US0R 3MGBA 2RD2A 3IVCA 4ON9A 4ZQCB 2PKQO 2PWYA 5HM8A 4QBHA 4IGAA 3ZV4A 3B1WA 1NN1A 2Y9MB 4KXXA 1EPUA 4OMCA 5AVXA 2QWXA 3K09A 5T5QA 1I3CA 1X94A 3SQOA 4PRLA 4W5NA 2FTKE 2K7ZA 1WV1A 1T36B 5DIZA 3AP2A 4L8VA 4F06A 5LYJA 2QI9F 1YV9A 5CGZA 4FINA 5IS2A 5HF6A 2BFOA 4MQEB 3I01M 5DM1A 4KN9S 1Y37A 1IHOA 1ZDMA 3BWCA 1DEKA 3IDFA 3KKPA 4NI5A 3PT5A 1EP3B 4MTLA 5EKUA 4DLZA 2Q9BA 2X9LA 4EO7A 4MVJA 1KJYA 5LA6B 3R0IA 1ND6A 1UIMA 4HDAA 3WGMA 4KX5A 1P6UA 3UMJA 1X2EA 4RJJA 4DR4B 2VXBA 3QEKA 4QDZA 5AO9A 3R8FA 3I0NA 2X6TA 2WC1A 3ANNA 2IDMA 3AX6A 4LV8B 4TYPA 3FUTA 4C4PA 2RI6A 3ZW7A 4LVUA 4DDMA 2C2XA 1Z0KA 4WPGA 5F33A 1WUKS 4YJ3B 5JS6A 2A7XA 1H2YA 2VIIA 4YP1A 5AKLA 4Q3BA 4GOMD 2W6QA 1YZLA 1T2EA 2VYND 3I9MA 2B4RO 2G80A 3CVJA 4BB5A 4X60A 2ERXA 4PNHA 4NU8X 2DC1A 3DAGA 3FI0A 3AP3A 4Z2AA 2G40A 1M6NA 5JS1A 4GSLA 1T9HA 2WHEA 1F60A 5B4TA 1OJ7A 1F5SA 2BZ0A 3MOSA 5I7VA 3RBVA 4MLCA 4JT4A 4G24A 4ID3A 4YDQA 4AAYA 1B76A 5CTAA 3U60B 2W2MA 2ZB8A 1RLMA 3DUFA 2IL1A 4K86A 2ILVA 2JH9A 1FUEA 3R40A 1EDDA 3SEZA 1RBZA 3V7WA 3ZXUB 3ZWCA 2PVSA 5KQLA 4J0EA 3FCSB 3EF0A 4LYFA 4BMNA 4AKHA 2P9YA 3I5XA 4Q18A 3ZLTA 2PT9A 4KN8A 2QX9A 1Z0JA 2EP5A 4J03A 4MS3B 4ZZ0A 5KWJA 4TYNA 2OWEA 2NO9A 1WD7A 1JLRA 1GL9B 4CLRB 2ZETA 1WBDA 2NYVA 2WNIA 5REQA 1Q17A 3OIGA 4U3JB 2XUFA 1H2RS 3LBIA 1L4FA 2O0JA 3INTA 4LOJA 1AMNA 3IHWA 3UO8B 2A9RA 2P0AA 1ZM3A 1GSHA 2WAOA 4H7HA 1FP1D 2OILA 4QRIA 2NG1A 2AMJA 4O4LB 4EDFA 1Z62A 3PRJA 4KAFA 4BNVA 4OI1A 1YQDA 1Z39A 2XAUA 3TJZA 1E62A 2HQRA 4OAPA 1KL7A 5EFZA 1DC6A 2RGEA 4ITUA 5DCYA 2R6R1 1CHDA 1W25A 4PZ0A 3ENQA 4JLBA 3RC2A 1KFKB 5AOAA 1WMFA 3BXHA 3DO5A 4I55B 4IS2A 3UJ8A 1Z7BA 2PR2A 4KB5A 3WSVA 2EZ4A 4HO1X 3AHFA 4OQNA 1LC0A 1Z5PA 4X3OA 2JGRA 2V58A 3GT4A 4ZEXA 1TXGA 2I6XA 3DJFA 3KOUA 1GHTA 4FMDB 1YR6A 3HI6A 1GZDA 4MVWA 4L95C 4NNOA 5AJHA 2ODBA 2VBCA 1NF8A 4BIIA 2O57A 1YA4A 1Z0UA 4JLAA 1I2CA 1QVWA 2QAGA 2X5JO 3WDKA 1EP9A 1JG6A 3E9YA 1KJ9A 2NVUA 2JHCA 3VYVA 3L8DA 1KY3A 3NAMA 5ALIA 3NC0C 3UOWA 8ABPA 4QOEA 2VCHA 4BYGA 2R1VB 1E9VA 1TF7A 3I04A 3TIIA 3U4MA 5C2JB 4TLBA 4P7GA 3BCRA 2E4WA 2GF9A 3NHRA 3TUIC 2XB8A 4WDRA 4L07A 3N0XA 5BWLA 4PGHA 2WTNA 2QTFA 1XLUA 1GNVA 1IB6A 3FFTA 1E1DA 3ADOA 4HNHA 4HZUA 4NJMB 3W2GA 4AWBA 1ZR4A 1ZJWA 1QHGA 5ICMA 5IKMA 2ARKA 1Y6ZA 3CEPB 4ZAYA 3BE4A 2OK7A 3V7FA 1YVRA