2XOEA

Crystal structure of flavoprotein nrdi from bacillus anthracis in the semiquinone form
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
118
structure length
118
Chain Sequence
MLVAYDSMTGNVKRFIHKLNMPAVQIGEDLVIDEDFILITYTTGFGNVPERVLEFLERNNEKLKGVSASGNRNWGDMFGASADKISAKYEVPIVSKFELSGTNNDVEYFKERVREIAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High Resolution Crystal Structures of Nrdi in the Oxidised and Reduced States: An Unusual Flavodoxin
pubmed doi rcsb
source organism Bacillus anthracis
molecule tags Flavoprotein
molecule keywords NRDI PROTEIN
total genus 41
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2010-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07972 Flavodoxin_NdrI NrdI Flavodoxin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.360 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xoeA00
2QX6A 1J8QA 1YCFA 1XI2A 2BZSA 2QX9A 1SQSA 3OX2A 3GFSA 1WSWA 4YAOA 4YALA 5LBTA 1AG9A 2QMYA 5LLDA 1AKQA 3SVLA 3KAQA 2QMZA 1FLAA 1KBQA 1QR2A 1V4BA 1X77A 2MOKA 3D7NA 5TGZA 3W77A 5NULA 3TZBA 3UXHA 3GFRA 1QRDA 4YAFA 4BMOB 5LJIA 2A5LA 1ZWLA 4U7HA 3LT5A 3LCMA 1CZLA 2B3DA 1C7FA 2M6SA 1CZHA 4LTMA 1FLNA 5F12A 3NHPA 1FUEA 1AKVA 2QX4A 3NHSA 3NHJA 3O2NA 2FX2A 4H2DA 4N65A 1F4PA 5FUQA 3GAMA 4H6PA 4YAUA 5NLLA 5FX2A 5LMCA 3QE2A 1OFVA 1D4AA 3UXEA 2FOXA 3K20A 3B6KA 3N39C 2FZ5A 3F6SA 1KBOA 2QWXA 2V5VA 3NHLA 5B3KA 3U7RA 1H69A 1AZLA 4N82A 3F90A 2OHHA 4FX2A 4M0CA 3FVWA 5EA2A 4DILA 2V9CA 1YDGA 4YAWA 5JROA 2M6RA 2R97A 1CZOA 1CZUA 5BUCA 2RG1A 4N9QA 1YKGA 3EDOA 3OJXA 1GG5A 3ESYA 2F1OA 3G5MA 3OJWA 3W78A 1FX1A 3GFQA 1FLDA 2Q62A 1T0IA 2X2PA 2ARKA 4XDHA 3O73A 1DXOA 4LAFA 1AKWA 1RLIA 1ZX1A 2N1MA 2XODA 1AKRA 4HEQA 4Y9UA 3L9WA 2OYSA 1VMEA 2HNBA 4FGLA 1AKUA 3FX2A 4PTZA 3OWXA 1BVYF 3FNIA 3NLLA 4ZVKA 2FLVA 4U7FA 1C7EA 1J9EA 4PU0A 4D02A 3P0RA 5LBUA 4QOFA 2Z9DA 3QFRA 1TIKA 3W79A 3B6MA 1AKTA 2D5IA 2HNAA 3FJOA 3HLYA 1XYVA 4DIKA 3KLBA 3FW1A 3HA2A 1J9GA 3ESZA 3NHUA 1FVXA 4QOEA 1DX9A 4QOHA 2MT9A 4C76A 5LVAA 3B6IA 4U7GA 3TE7A 3F2VA 5EMNA 3RPEA 1YCGA 4LA4A 1QBGA 2FVXA 4NLLA 3OWHA 4CETA 3HR4A 3R6WA 3QFCA 3NFRA 4GR9A 5F51A 3TEMA 3ZHOA 3KEGA 2BN4A 2GSWA 2MWMA 1OBOA 5EAIA 2ZKIA 3JSXA 2BF4A 4Y9RA 2KLBA 4ZVNA 1QHEA 1DXQA 4FGJA 1XT6A 2QX8A 4CF6A 2FCRA 4XDGA 4QOJA 2FZVA 5F4BA 1OBVA 3N3AC 1AHNA 1CZKA 3U7IA 3EYWA 3NHYA 3OX3A 4ESEA 1E5DA 2Z9CA 1WSBA 4C14A 4QOIA 1RTTA 2AMJA 2MTBA 3L9XA 2OHIA 1J9ZA 2W5UA 4PTYA 4C0XA 3F6RA 1D04A 1H66A 5FA6A 6NULA 3ES9A 2QR2A 4DY4A 5B3LA 4GI5A 4C0WA 1YOBA 2Q9UA 4NULA 4YQEA 1D03A 1CZRA 2OHJA 4ZVMA 1RCFA 1YRHA 1T5BA 4OXXA 3ESXA 2V5UA 3KAPA 2FAXA 3NHWA 1XYYA 4FGKA 1FLVA 2HPVA 2BMVA 1BU5A 5ULLA 4QOGA 4LTDA 4QODA 1RLJA 3NHRA 4ZVLA 4BMPB 5A4KA 1JA0A 2X2OA 2XOEA 1B1CA 3K1YA 3S2YA 1CZNA 4Y7CA 1SG0A 1JA1A 2Z9BA 3OX1A 4ICIA 1YCHA 3OVMA 4S24A 1AMOA 3W7AA 1FTGA 2R96A 1NNI1 1ZWKA 2Z98A 1I1OA 3NHFA 2FDXA 4GQIA 4HS4A 4LTNA 4J8PA 5LJLA 2WC1A 3N3BC 4R81A 4F8YA 3NHKA 1TLLA 3B6JA 2BPOA 2KQUA
chains in the Genus database with same CATH superfamily
1CF9A 4WESA 4LSZA 2WA1A 1ZN8A 1FJGB 3VHLB 1X7YB 5CVVA 2JAXA 1W4BA 1YU9A 1H4VB 4KIUA 3D81A 4PZ0A 4D8WA 4F5YA 1R9GA 3DMYA 3JQAD 3SKYA 4EKIA 3RBZA 2XV1A 4B31A 2FEXA 1WXGA 5DGCA 1OV6A 2MOKA 1Y3DE 5DM2A 1MQAA 5IJ9B 5EIXA 3LTEA 3SHWA 3I2IA 3W8EA 3Q2IA 5HM6A 1GN8A 1V1MB 2YDXA 3BF8A 1AURA 1GUDA 3BB3A 1Z6QA 3UGJA 2PT6A 3HN2A 1IN8A 4NICA 5FD8A 3RK1A 1JFTA 1WZIA 5JVDB 4PGAA 3X2FA 4JLWA 5SYNA 1SHJA 2PSJA 4F4JA 1SAYA 1N1EA 2OV1A 1DAHA 1KDOA 2FOXA 5EJ9A 3AM4A 2CMDA 5LB4A 1QO0A 4TPKA 5ILOA 1NQTA 4RM3A 5AUNB 5AKXA 5AJYA 2WTNA 3TUZC 1OIVA 5H81A 3Q9SA 4GGMX 5D51S 2EEZA 3DS8A 1MN6A 3AEUA 5U1PA 5IASA 3SFVA 1FFEA 1F7VA 1TQ2A 1JFFB 2ZU6A 3JWHA 3L4BC 3MPOA 3T5GA 2DRIA 4BJ3A 4M9RA 4U2DA 4U5QA 4RSMA 5IX8A 1D0SA 3LBYA 4I99A 4PQGA 4QFCA 1V0JA 1W88A 4MOWA 4QBGB 2FW7A 5KOHB 1VB5A 4LJ5A 1XCBA 1GUYA 4PWZA 5DH9A 3D0QA 4G0YA 2EGGA 1PJBA 3B12A 3D1VA 1L9KA 1NLFA 1Z7WA 4L0QA 1Y5NA 1EXWA 1Z26A 4GR5A 3SS8A 2XMQA 5I47A 1U3CA 3ZU4A 5BT9A 3I9NA 4YJ2A 4LV6A 4EKEA 3KV1A 2FN7A 4B84A 5K6AA 2I3GA 3JV7A 4MGYR 1I7SB 5ELLA 1HNWB 4PN3A 3EUFA 3KL2A 2XVXA 5CR9A 4OI4A 2XYRA 3NO4A 3VKUA 1Z82A 3O4IA 1AQJA 2LCQA 1O89A 1JB1A 3JWGA 4X95A 4DSUA 3R6WA 1I5OA 1JFLA 4R84A 3TIXB 4DQLA 5AW3A 1JAXA 1R0SA 2P0YA 2V9PA 1AF4A 1EWRA 2NVOA 3BHMA 3M9XA 2DWCA 4FGJA 1XZMA 1M1UA 1QH8A 1OAOA 3UB3A 1KNQA 2UZAA 1M66A 3WICA 3WWEA 4CEIB 2GZ3A 3ASYA 1ZHFA 2ZJ4A 3OQHA 2IUTA 3CFYA 3KZ1E 4C3OB 1AY0A 1VI6A 1JI0A 2PGNA 2R86A 1RJWA 4P2BA 1VPDA 4U39A 5LMNB 1TLFA 1FCJA 5JXWA 2R6JA 1F0PA 2Q4RA 3B3AA 1R8QA 5KYVA 2HU2A 2WAMA 4BJ5A 4WBNB 2QNBA 2QZ9A 2VH1A 4L5JA 4CEHA 1YRHA 4CLXA 4KO4S 4FDTA 1LSOA 5EWMB 1Y89A 5BN5B 2VNAA 2RH5A 3FSRA 4NIMA 4MP6A 1FNNA 1GRVA 4C9BA 5JRZA 3CSSA 1ODJA 2FQYA 2Z6AA 1CUCA 3OHSX 3I62A 1BD4A 2BGNA 3CF4A 3KTAB 4AZ3A 3AQ4A 1T8PA 3B78A 2PKEA 3EQ2A 4MIYA 3DMGA 4C5CA 5AVQA 2J0EA 2BRUA 3T94A 3T3DA 5A4MS 1PP4A 2W2XA 3IJPA 1XMXA 2FJPA 2O0HA 4R81A 4NTZA 1VYTA 3QE3A 4HDSB 1ULSA 2XWPA 4P0TA 4R1PA 4TYQA 4Q4JA 3IOYA 3ZCQA 4E14A 4TS4A 2E4YA 3BQMB 3P9YA 3I5UA 3BVPA 1VTKA 3HCNA 2WUFA 3DEIA 4ZHSA 1ORTA 2Q2OA 4WZZA 2VJOA 4RKWA 2W48A 2NXJA 3IP6A 3T7CA 3VI4B 4KDCA 3OFND 3WWYA 5DZSA 1UP4A 3KB6A 2HMVA 2FPUA 3I01A 4IVNA 1L5GB 2WWVD 2QYSA 4HFMA 2PD4A 2P35A 1G60A 3FUVA 4YRTA 4DF3A 4DIMA 1Q7BA 1TJNA 3QBTA 5THXA 1N1GA 3EPPA 2AG8A 3RTCA 2JKVA 3NHSA 1HDZA 1W85B 2QTZA 1NMEA 2HA6A 1Y4SA 4L8LA 2QTWB 2VSFA 4ZVUA 3TD9A 2YVLA 1EM8B 4S1OA 3VGPA 5FUQA 5KTOA 2Q1WA 1E2QA 4ARAA 1VIVA 3D4OA 1VHLA 1OSNA 3MS4A 3F1KA 4RMIA 3Q3HA 3KLNA 2VDNB 5FP0A 3T7DA 5KX5B 3I72A 3LWBA 4YP6A 5F98A 1O5IA 1RVDA 3NIWA 1XN1A 5ESRA 2DETA 3ETNA 4YAWA 1PNVA 3JVUA 1UXOA 1YS6A 2PJUA 2QRPA 2WP0A 4HQOA 3R5XA 4I1VA 4EQ6A 2AT1A 1G8JA 2B61A 4XDHA 1N6RA 1ZJ6A 5JFOA 1N34B 4B3GA 3MTBA 1CUBA 3L7JA 1VL6A 2XMRA 1SU6A 4P4NA 5TJ9A 5JATA 3R0ZA 2OLJA 1OTXA 1T36A 4JB0A 3AILA 4RMHA 5F1YA 1UMKA 1G7TA 5F76A 3KJNA 5AW2A 2BTOA 1QLJA 4ZQFA 1GFWA 4A1FA 4RH3A 5AR1A 3CRNA 3BWCA 3C39A 3OZCA 4WA7A 2P3LA 3EXFA 3LLSA 3WJ2A 4Y1RA 4JWTA 3ZPXA 1D7AA 3RIMA 3WYAA 4PZEA 4OJTA 1BSVA 2R4QA 1X1TA 1A82A 4JODA 1V8PA 4KFUA 4CNBA 4OSEA 2KW5A 2ZSFA 2QN9A 1Q0PA 5F52A 4ZU3A 2C4NA 2WIKA 2YJZA 3FLBA 4D8VA 5FTLA 4Q4HB 1Y3IA 1OB5A 1P2DA 3SZGA 2FR0A 2OV2A 3L7LA 2DLNA 3Q12A 3A9RA 4N8EA 4TKUA 3O4FA 4JQYA 4M4SA 4GSKA 1A2QA 4E70A 1T6BY 3KP1A 1BDBA 4YXWA 1KPGA 1L7QA 3T35A 4DV0B 3ZLJA 1Z37A 5B3LA 4KWCA 1ORDA 3HWRA 1CSEE 3PJRA 4MS4B 2ZJOA 5H1YA 3ICOA 2I4IA 1BGXT 1HETA 1GRRA 1OD6A 1W52X 5JDCA 1QJCA 1MJGA 2V5UA 1POXA 4JEUA 3TQHA 3WL6A 2ILVA 2P1RA 3ANXA 1I0IA 3CQ9A 1A9PA 1DQYA 1RPJA 1UKVY 2II6A 2VOJA 3KVYA 3L8GA 2CV1A 4IF6A 4LTDA 3P7MA 1E2NA 3GFGA 1U9CA 4ADSG 4BNHA 2CV0A 3ADBA 3VISA 4FYJA 1K27A 3OUZA 3RFXA 3RIEA 2PD3A 1EFLA 3MWKA 4S24A 2RI6A 3V33A 2H31A 2IU3A 2YZ2A 3K32A 1TMYA 4PBSA 1MBZA 4IV8A 3TRJA 2CSUA 2W7TA 5JO0A 5K3OA 1NVVR 3GK3A 1T3LA 3AVUA 1KEVA 3EC7A 3B82A 1ZQ1A 4L8WB 6YASA 2G1KA 2AX3A 4ZQIA 3SIRA 4FBLA 3QEMA 1ZH2A 3P71T 3VJLA 4BAZA 2H7CA 2ZZKA 3NG1A 3UV6A 4D3DA 3N6XA 5A7GA 1F8UA 2ORIA 1XLTA 1P5FA 4X1KB 4LYEA 3SQLA 3CIFA 5CYOA 1Z8FA 1GZHB 3GAFA 2P9EA 3P9PA 3RYIA 3U3RA 1U0BB 1M2KA 1KP2A 2ZRBA 1CQJB 2QI9F 1EUQA 5B2FA 4MEJA 3PZBA 5DM4A 4Z9FA 3RM3A 1O2DA 1D2NA 3P2JA 3QOYA 4RKFA 4KITB 5EQTA 5KNCD 3D0OA 3DWFA 3BTSA 2J9YB 4BNWA 1JG2A 3MCVA 3S1AA 3I5AA 2D8MA 3PGJA 4JXXA 3L0SA 4BZWA 2HSWA 2YRWA 2ZSKA 3I73A 4NZZA 5ENDA 1BH6A 1EESA 1RI5A 1OT5A 1EWKA 2A0YA 3BXZA 3EY4A 1WUHS 2ZQ5A 2JEZA 1ZJ4A 3GCWA 4KXMA 3WNZA 3OTOB 3GW8A 1JEYA 3F90A 4ND5A 1U8YA 2CK3A 3T8YA 1JQDA 4EEKA 1MTOA 2O23A 3H1EA 3OJXA 1RBYA 3VR5D 2BFWA 2FSVC 3MINA 5JPCA 4CKZA 1V8FA 3O73A 2C4UA 4YDHB 3A1NA 3T54A 5I48A 4XD7A 1P1JA 2DKOA 4PGHA 3ZDAA 3O0TA 1ZNXA 2HNBA 4B4OA 1KJYA 2EJVA 3A36A 4K6OA 3R23A 2ANCA 2H29A 4HB4A 1JEYB 1S2NA 1SUWA 2I6SA 2X7XA 3KIPA 4NZ9A 4AG5A 1TZ2A 2Z9DA 3JVIA 1E3WB 2DHCA 4KX5A 3TW8B 1WZCA 3QK7A 2RHTA 3AJ8A 3LC0A 4HUQA 3LUAA 5F33A 2XCSB 3E0XA 2Z8YA 2B1IA 2B7CA 3GBSA 2Q7OE 3ZQUA 4CQLB 2JKZA 2XMSA 2FP4B 3TQRA 1NYTA 3OZTA 5KJ6A 3FTFA 4PHHA 1YQGA 1JJFA 4PZCA 5FORA 1T9ZA 2WQZA 3D6FA 1JIUA 2G80A 4PYOA 2EFGA 5EHGA 3HJFA 2G8LA 5DTQA 1XXHE 3PHCA 3LU1A 2C2YA 2PV0A 2VKTA 1U2TA 2I3DA 2O4CA 3EXEA 1FYVA 2OLEA 2XB9A 2ZYRA 3A3PA 4BMXA 2OHFA 1JR3A 2PSHA 3K8YA 1NF8A 1TE2A 5DHFA 2B6NA 3WFIA 4ZV4A 2X3YA 1XVLA 3GWZA 4KQ9A 4RPKA 3IA7A 3U1BA 3AY6A 3X43A 5DNYB 2FNAA 5BV1A 5BSEA 4XFJA 4G1BA 2XCRB 2ZIVB 4W7IA 3H2JA 1U7HA 3GLGE 2C77A 4L6CA 5KDOA 1NR7A 3MBIA 4GGOA 4M36A 1F5SA 3ZQJA 5EGNA 4EENA 4RPJA 1A95A 1RHQA 1N7JA 3ZU6A 4ABYA 1U94A 3IB6A 3DHVA 4MR8B 5CW2A 1GZSA 4PEVA 4G0QA 2G0TA 4X7BA 1OLXB 4Q3BA 4B7UA 4AICA 1XTRA 4TS9A 4AN4A 1V25A 2NAFA 3HR8A 3P0JA 3DAPA 5HPYB 5JZVA 3W5SA 3TGPA 3MCUA 1RZUA 3KJGA 4PSKA 1RWMA 2G83A 2ZSBA 2Y1GA 3DVQX 3TZKA 3Q85A 3QU7A 4UFOA 3M49A 1OWPA 2PUBA 1Y5LA 1N2HA 3MT7A 2JCSA 2QUBA 1YRYE 1T15A 1YSCA 2EZTA 2LRHA 4RABA 1K7XB 1ULBA 3NBUA 3D6JA 2HHLA 4Z4GA 1WMDA 4Q12A 1UBOS 2PM8A 5LBTA 3NDBB 3Q6NA 1AG9A 2BP7A 2VZ0A 4CKEA 4EEXA 3WLJA 4US2R 3Q5GA 4NATA 1DLIA 4LZNA 4EHFA 4KPYA 3UYLA 1RQLA 3PHJA 2VK1A 1Q83A 4KB5A 3FYUB 3PUWA 5CFZA 1N5JA 3O31A 1QMGA 3GP3A 2NZWA 3LF2A 3OZIA 4H0FA 1XDSA 4KAJA 5T3UA 1C7IA 3CLUD 3RFTA 4D41A 3WMEA 1A9ZA 1QGYA 3NIDB 3A70A 1RZRA 1WOYA 4JELA 3G68A 2ZJFA 5J40A 2X8JB 4EARA 1X8LA 3JWPA 2JIRA 3E70C 3D1JA 1W44A 4DS3A 3FDZA 2QXUA 3JD1A 1P62B 2VRWA 1JQ3A 4GWKA 1H42A 3ZWMA 1QVRA 3KOUA 1X9GA 2RCNA 3NHLA 4N6OA 2FX5A 3NAMA 3CS3A 2YV3A 4CMGA 1X74A 3W5BA 1ZYUA 2COKA 1G7RA 2A78A 1PFQA 4IUCS 3WRYC 1BW9B 1G16A 3KQOA 3B38A 2F7SA 2CNDA 1IATA 1TAUA 1O96A 4F7WA 1WULS 2P5SA 3CUEF 3BRWA 5DRTA 1JU3A 3BIXA 3LQ2A 5G0VA 3RYIB 2E4ZA 3IAUA 2QLLA 3RJ5A 3T4EA 4AECA 1XTSA 4KBYA 2PBRA 3FDZB 4NOJA 3N2KB 1YXMA 3UH1A 1K2VN 2XQIA 2X2FA 2ZR8A 2P3OA 2PGIA 3BHJA 3R0JA 1U0TA 3F0TA 4QJBA 3STUA 1RCUA 3HN7A 4EFDA 1T0UA 1R7RA 3E4CA 2IUUA 4D26A 4I9HA 4DM7A 3FOAA 4FN4A 2IU0A 2XRZA 1R4ZA 4MYHA 1U2EA 1HC7A 2YOHA 4QVGA 4Z99A 5JH7F 1LC3A 4YJFA 1SCUB 2H8GA 4UAJA 3L02A 3RHSA 2M6LA 1T8UA 1XEWY 2BZ1A 1B2LA 4NZOA 2R6ZA 4ME6A 4P32A 3DWGA 4H1UA 4YJGA 4PSAA 5T7BA 3CCCA 2XDWA 4ZU6X 3OC0A 5FL3A 4ESHA 1K3UB 1UZMA 1QKKA 2FSIA 2AN5A 3LVQE 1CRPA 3ZGXA 1P72A 2R1TA 1AHNA 2R8RA 1LGYA 3FMIA 3NHYA 1VSVA 3OF5A 4NBVA 3X1YA 2DBVO 4DE5A 4UOEA 4YHHB 3O8CA 1YB6A 1ABFA 2J32A 3IDQA 3O4JA 3K7EA 2CDNA 4KOAA 3IX7A 3U19A 1WDMA 1L4LA 3QF7A 1SPBS 4M9XA 4Z7JA 5GV7A 5C7LO 5J4LA 2QR2A 5D01A 3N0XA 4LNUA 4WZBB 3EC2A 3K6KA 3MTJA 2IDMA 2OAGA 1O9GA 1KAMA 2G9ZA 3ITDA 3DOJA 3T5CA 2GD2A 4QRDA 4D3XA 1WKBA 4X1KA 2Y66A 4D25A 3QYFA 2IX3A 1LLFA 1R00A 1U4SA 2MYUA 3UJPA 1XP8A 1ODCA 4EBBA 2PGJA 1W4RA 3P4UA 1JG7A 1V41E 1M1NA 1Z6ZA 4M1EA 4X1IB 2VDJA 3U09A 3DAYA 4OH1A 1F3LA 1MPTA 2B20A 4GXTA 1TUEA 2IS1A 1VI5A 4WW0A 1PGNA 2CHUA 1YMVA 5JI2E 3VYWA 2HUPA 3I2FA 4EI2A 1W34A 1ZGHA 5IK2A 5DYGA 3RVMA 1SB9A 3QXXA 1L7XA 3OPNA 1I7PA 4DLLA 1U8ZA 1U2PA 4X66B 1ULTA 1WCIB 4JQCA 2F8MA 1CS0B 1I10A 1XRJA 3FWNA 2FH5B 4WLEA 1RE1A 1TT5A 2C2HA 3SMQA 1Y6JA 1C1HA 2XCIA 3A05A 3LDHA 3A6KA 3PL5A 3L4SO 1PRYA 1YB5A 3UHFA 2R0QC 4UD6A 3TZBA 1X15A 1OBHA 1E3EA 3QXCA 2OV3A 4G0OA 3WWOA 4AMYA 4HSGA 4GYYA 5BUQA 1LF0A 4KWEA 5EIWA 5BN4A 5HNKA 5CA0A 1OI3A 1TRKA 1XQYA 2OORA 2CVHA 4MV9A 3O83A 3FVRA 2X19A 4ITVA 1JG6A 4XM2A 3HBFA 3RU3A 2LE0A 4BDSA 1MAUA 5BV7A 1RIIA 1XXHB 2R5NA 4NFSA 3TL6A 1DRKA 2C2KA 4CLDA 5A5EA 1E5TA 1FDOA 1V39A 3VKVA 1CJBA 3WQBA 3B6KA 3F3YA 4AP9A 1B23P 1WBJB 4J43A 2QG9A 4QUKA 1WHSA 3GJQA 1C1DB 2C4MA 1K6EA 5FRDA 1P5JA 3QLUA 1PT7A 3KUKA 5AK0A 5I4CA 3EF1A 3KJHA 4HXFB 1OY1A 9ABPA 3WGZA 4K3UA 3T1QA 4ZI7A 3RYHA 1E1RA 1DINA 5FLXA 1EFUA 3E7FA 2WYVA 1N2EA 3WK9A 4KNWA 3Q1KA 6GPBA 1G2QA 2DR0A 3UPUA 1H8EA 1AXRA 1E0DA 3IUYA 1KZYC 3Q7TA 2YJ3A 1NPTO 4IEFB 2H1RA 4Z0PA 2AI3A 4V2IA 2AE1A 3IVRA 3OICA 3PRYA 1P60A 3P0RA 1Q1QA 2R3SA 4IJUA 5LBUA 5C8ZA 1N75A 2QTLA 4MVXA 2P9ZA 4F84A 5I4IA 1Z17A 4UASA 4KLNA 3HA2A 3I83A 3OLVA 3GVHA 5DBFA 2GCGA 4BNUA 4P2GA 5FBVB 1HI9A 3KTAA 5KYGA 3A6HA 3RFCA 3SVTA 5B58T 3UGQA 1BOOA 5CB8A 4URWR 2Q0HA 1RYNA 1JWLA 2PRZA 5C4IA 1TK9A 2I76A 3PR3A 3L41A 4KPGA 4EHKA 3B48A 3M70A 2D54A 4K9NA 5H8WA 4FMDB 3LBHA 3U5ZB 4UUOA 3W06A 5BVGA 2WIDA 3IHWA 1LK0A 3PI7A 5EEGA 3OX3A 3TG2A 3GC6A 1C4KA 2JAWA 2P7IA 2RJOA 2ISQA 3WGOA 4E2XA 1ZJWA 3ADKA 4MR7B 2VATA 3HO6A 4L9RA 1Q2XA 4G2NA 3SG0A 4WLOA 4JLPA 3UMVA 2OGWA 2ZI9A 4EY4A 4ZOLB 2WFZA 3IMKA 5I7OA 1UWKA 1YBHA 2ZYAA 3CZ9A 1WRBA 2KX7A 2ZJ3A 3LL7A 1S8NA 2JCBA 4UNQA 4EW3A 1ADJA 1NF2A 2YBEA 4KQEA 3U3DA 4TUYB 3JQBA 3FMVA 1HYBA 4FLMA 2OCXA 4W9NA 1Q7TA 5J2TF 5JTUA 3T6KA 2ID4A 1SKQA 3OU6A 2XGSA 1DGQA 5J23A 8ATCA 1RLJA 2OCDA 2QMQA 1U2SA 1R8XA 3E81A 4MVJD 3CH5A 4X9XA 4Y7CA 4AUKA 4S1VA 4L3WA 4I4IA 4KIGA 2XMPA 3PI6A 1OIXA 2B21A 2RHLA 3PE4A 4ZFNA 5D3QA 1JWAB 1TUBB 4LISA 1Y9DA 2UZ1A 4OP3A 1XQXA 5TNXA 4M87A 1O8CA 2OZKA 1OH7A 1Y7IA 3WX0A 5AKLA 3R5TA 3FSGA 1PGQA 2WI8A 4OYYA 4PX3A 2XWQA 2NSDA 2ZPUA 5ELXA 2QAIA 1ZD1A 5A4IS 2G7ZA 5J4HA 5TGZA 3NR2A 3RIXA 1N4AA 3CWZA 3S7ZA 5K20A 1ZP6A 2CLIB 3P9RA 3I52A 4CZ2A 3BH6A 3S2FA 2R751 3AFGA 1IHOA 3L8CA 3SWWA 1NQOA 1USWA 2HM7A 1SCNE 1C7ZA 1VL8A 2JD1A 4REMA 1CBUA 2YOGA 1F4PA 4OGWA 3GPIA 1IQ0A 4H35A 3K9NA 1WS6A 3GRKA 2PIAA 3EJ6A 1SBTA 2G88A 3GZ4A 4KN6A 4B6RA 4LF7B 1YZ3A 2Q6TA 3M4JA 1QO9A 1M2HA 4QG3A 2PX8A 5DWVA 3RTDA 4KPUB 2J6CA 5KWVA 4QUJA 5BN1A 2LVBA 1YAJA 2AYXA 1KI1A 1J22A 3B36A 3K0CC 2PO7A 4NFLA 4D0NA 3MRSA 1MEOA 2CNKA 3WISA 3AF0A 2JI8A 3NTVA 2GN8A 1XVVA 1YZFA 4UREA 1R3UA 4GQAA 3WHPA 2AFVA 4N1AA 3RO7A 2EBUA 3BSYA 4M60A 3SC2A 3VJKA 4H6XA 1GSAA 3WQRA 1DCKA 1E5XA 2A9FA 2Q2NA 5KKAA 4CKCA 1RMYA 4JI3B 3DMFA 4TQGA 1L8LA 5DLEA 3AHGA 1JLHA 1OMOA 3IV9A 1GZ6A 3QX9A 1Z15A 2HWKA 4KPUA 4WFQA 3TCXB 4BNIA 2ZJYA 4D02A 3PIRA 1XCOA 5K3EA 1HDIA 5ER6A 1EVKA 1AKTA 2D5IA 2NPOA 4F12A 5C37A 3FWKA 1V16A 4F72A 3R9XB 4TV9F 2EIHA 4UTNA 3SD7A 3CNBA 3ZQKA 3GY0A 1QBGA 3GLFE 2XSZD 1DEOA 3NVKI 4P53A 1Z88A 4KR0A 1VHWA 3VU9A 2W71A 1DXHA 2EKDA 1OR8A 3CN7A 1NW6A 1A77A 3H8JA 3WQHA 3TKYA 2DZDA 3KYCA 1QE0A 4BRSA 2AXPA 1VCHA 5INTA 1D6JA 4JLBA 2WG2A 5FPPA 4CCSA 2XDQB 5FXMA 2PUAA 4D9FA 3ZGYA 2MINA 4Q00A 4Z7QB 1OI4A 2Q3FA 1BHJA 3TRDA 3EXG1 1A50B 1JR4A 1XK6A 1KI8A 2XMDA 1UKBA 1IUNA 2OQ2A 4OHOA 4WN9A 5JSZA 3Q15C 1XXHA 1YOVB 4KK4A 5DLQC 1G9XA 2R60A 1YVEI 1Q3TA 1UOEA 3F4KA 1EX7A 3CZRA 5ABPA 3DR5A 4EF4A 3H87A 4LCEA 1GL7A 1KAOA 3WI7A 2OGZA 1VLJA 4RULA 3RSQA 2YZNA 4BLTA 1AVTA 2H0AA 3PK0A 2BUBA 2BUCA 1SBQA 1BMFD 1R3DA 2WD9A 3UIEA 1XL1A 3C8DA 3RI3A 4MUFA 5TARA 2EQ5A 4LHXA 4JJAA 1WXHA 4HXGA 2Z1MA 4QO8A 4QDXA 2VP9A 2Y0BA 1WVIA 1G20E 2GCIA 1LRLA 3KZNA 3QV1A 2X40A 4C01A 2VUUA 1OH8A 2RGDA 2XUGA 1RS0A 3LAWA 2DWPA 3MWLA 4DZRA 2GJSA 2D06A 2J30A 4K46A 1TQ4A 2G04A 1FYEA 1NRXA 2QL6A 4L76A 4OQFA 2YUTA 4LRUA 3TTSA 1WSWA 2YXDA 3WNQA 3SEAA 3JQAB 1KQNA 3BWYA 2HT6A 5AK6A 4B32A 4AN1A 1YZQA 3TKLA 4UCQA 3D7NA 2WUVA 4Q1BA 2RJNA 5BVGB 1XHEA 4DJDC 2WHPB 1X3LA 5DISB 4CMIA 2HMAA 3O3NB 2B34A 5FQOA 5HQ3B 1L5QA 4RVSA 4D44A 4EQZA 1ZUHA 3RU2A 2IF0A 3TNJA 4Y98A 1E99A 1PT6A 1L9XA 4PLCA 3PF8A 2I62A 4GUDA 4KEAA 4UCXA 1RAHA 2X9LA 2CEAA 2XNDD 3E2IA 3SXUB 3PV0A 2P78A 1WHTA 2W6PA 4GOMD 1X8XA 4JJIA 1R6DA 1EBBA 1MAWA 2PX3A 3KTOA 4AUEA 4DEXA 4CF7A 5FX2A 5KDDA 4NBKA 1C29B 1ZAKA 1HO3A 2R11A 3KSMA 1GNPA 2OBMA 3O4RA 3WQQA 3TOZA 3K2EA 2RGNC 3TTTA 5EA2A 3FYUA 1YQTA 4QFBA 3OY7A 3TWOA 2R97A 4U6QA 3BL5A 3RYFA 3TD2A 5CXUA 1G5HA 1IEQA 4GI1A 3O03A 1ISIA 4NBSA 3AJ9A 4I36A 4IEIA 2C20A 2PUCA 3V4OA 3FOFC 1P6QA 5DTRA 2LTAA 4N6GA 4B17A 3FDXA 2YJTD 2HMWA 4ZYLA 2I3AA 1RDFA 4FWBA 1KI9A 1AHHA 1P5HA 4QA9A 1U8EA 4ZV9A 2MYPA 2VCYA 2F1KA 1UDWA 1BU8A 4D3ZA 3ZJTA 1E9CA 5AIBA 6LDHA 1O6CA 4X20A 3H1GA 5FNVF 4ARUA 1ETHA 1QIDA 5B30A 5I9IA 4OTZA 4D4KA 2XUAA 3CJRA 4NNOA 4RLFA 3VRHA 2WBLC 2AG5A 3M82A 5KO2A 4XUDA 2X1HA 4UXJA 1UQRA 2CD7A 1Y3AA 3IQFA 4L51A 4PLWA 1R0ZA 2CZCA 4D9KA 2ZWVA 4F8JA 2HJ9A 3PJFA 1GQFA 3HBLA 4ZRMA 4MZXA 2HHAA 4UE2A 1I5EA 4ZWNA 2ES4A 4BTEA 3K70C 1QGUA 1S2OA 2BGRA 4S1TA 4YRIA 1RFLA 3LY9A 3LFUA 3NATA 4NCNA 2FTKE 4ZU1X 2YINC 4DL9A 4FEGA 4QELA 3FYTA 2VPXA 4KGXA 5CPBA 4JXJA 1U1DA 1U1IA 1ZZGA 3HWX1 3PQDA 4O1MA 3JYPA 2BLNA 3Q7RA 1VXOA 1SQ0A 5F5NA 1M2GA 1TECE 4PC3A 1NLMA 1CUVA 1GNQA 5I7HA 2Q49A 1ESCA 1E4YA 1LW7A 1EXNA 3CZAA 4K2HA 1QF7A 1ONOA 5DM60 2I78A 3D8NA 3BJIC 2ORWA 3JS5A 3AF4A 4ESOA 1IG0A 2MJLA 3G8AA 2JFFA 1EFAA 2IEBA 4OLHA 4GYWA 3BE8A 3M4ZA 4I1RA 4NMWA 2JH9A 3H8WA 2I3BA 3ZXIA 1JQLB 2XTAA 3PE6A 5CM8B 3EA5A 3UWPA 3MTIA 1K4YA 2QSUA 2UUPA 3M6XA 1PNQA 4KQJA 5JD3A 2O3SA 3L0PA 4ZEXA 3WADA 2B8WA 4AKTA 1T9DA 4F6CA 1QJ4A 4GECA 2JFBA 2Q2QA 4WBXC 3ZLVA 2B69A 3D6TB 3RRYA 3ZE0B 3B3QA 2F6RA 3H9CA 1M1ZA 3KB2A 2YZMA 4HLUA 4BBPA 2Z5LA 1C0PA 1THZA 1C7RA 3GEIA 3MSCA 3ML1A 3OX4A 4NECA 2EZUA 2Y93A 3ZE2B 4DIOA 4EY7A 2P2YA 4RDXA 2J7KA 2H6EA 4IMIB 4E0BA 1DKRA 7GPBA 2NUPB 2UZ0A 2VH5R 4K5QA 3ERCA 5DGXA 3N5KA 3H3XA 3MRXA 5J5CA 4BX8A 1HORA 2Y8EA 3C7DB 3KEMA 3MSXA 3DKPA 3AFMA 4RFSB 5TR9A 5I6DA 5CJPA 2W4IA 5C7OO 1MB0A 3SOZA 1FY2A 3HL0A 5EIHA 3PDWA 2PDAA 1F2VA 2Z4RA 1MDBA 3B8EA 2PT5A 3HWWA 1MXFA 3N0VA 2Z5GA 3LHFA 4KC0A 3P94A 5F2OA 3C5EA 3ST7A 2GGSA 1EWVA 3QVTA 1QWSA 4A8JA 3SBXA 4FW9A 2CLLB 3UAOA 3TW6A 4XRRA 5I7VA 1LTKA 5LSAA 2P9GA 3WXMA 13PKA 3ZIUA 3FPJA 3RYHB 1ZN2A 1T13A 2IHKA 3FUWA 3OCZA 4KV7A 3ZV6A 1KYXA 5BN3A 4KRYA 2J7PA 4KQFA 5G0TA 2GCPA 3UZUA 4JUDX 1D2MA 4Q47A 4Y0VA 2Z57A 4YMVA 1IJEA 1JYSA 1K88A 4RIGA 4XGRA 1K4MA 1MAVA 1Q0RA 1Z83A 2ZJ1A 3G02A 2VDOB 3NHZA 3E9EA 1H1DA 3O9ZA 4ISBA 5EKXA 3OCCA 2A6PA 3NKLA 4O2AB 4MW1A 1CEYA 1H0SA 4WZAA 2RHMA 1F0NA 4L3VA 4UD2A 1HKHA 5J47A 4MMYB 4YCMA 1XVIA 2J67A 5ALRA 3MWEB 2O1XA 2PZEA 1EBUA 4HTFA 4G5YA 4CEHB 3BTVA 3DQPA 3GUCA 1MENA 3P20A 5DNWA 3P9ZA 5G02A 5JJBA 4B0PA 4N0MA 3E8SA 3C3YA 1CDOA 3AEQA 1ZCZA 4FKMA 5ECYA 4EOGA 4WXPA 5P8WA 4ZI7B 2P79A 5E7MA 4LNHA 1VKHA 3T3IA 2F59A 1EDEA 4JJGA 4QXOA 1MB4A 1BX0A 2I6QA 2XNHA 1JEJA 2QL5A 4K9OA 3FFBA 2WU8A 2OOKA 3HY3A 3KXIA 4I6EA 4AYWA 1S02A 1KOGA 4RDCA 1QTQA 4OHPA 1N32B 1T9HA 2XNKA 1CVLA 2D1SA 3LT4A 3ROZA 4RMNA 1ZK3A 4GS5A 3LX4A 1TZMA 2ZKLA 1NBIA 1BA2A 2YHIB 1DOZA 1FTQA 2H4XA 2HGSA 1YIDA 3AY0A 2YIMA 1U7XA 4H7KA 1KL7A 2DY0A 2QT1A 2IYWA 4KTTE 5BOVA 2PRIA 2QMHA 4MWZA 4POOA 5ITZA 2AFRA 3F7OA 1Z4KA 5CFPA 1GPWB 1VKJA 2XA9A 3MB5A 2Q5HA 4Q1CA 4ZOCA 3H8VA 3OJ0A 1UINA 4AQ7A 2NOAA 3GLRA 4N48A 5AJUA 1Y4DE 2ZRHA 4GPBA 1UUFA 3VNBA 4A2PA 3AFOA 1A8IA 3IOBA 3AR7A 4K40A 1QAQA 4PO1A 2ACEA 4QT4A 1WXIA 3QUAA 4J3FA 4DUZB 4Z86A 4R5MA 3VR5H 1DTSA 3HDVA 4XX0B 2ZSUA 1Q7GA 5CBKA 2O0KA 2Y2UA 3UJCA 4TWBA 3V6MA 1NNEA 4DCTA 4ZDKA 1XX6A 5AYVA 5H70A 3RS0A 1ISHA 4KUHA 3L8ZA 3CVVA 3X1XA 4L8FA 1NVMB 1XCLA 3HPQA 2V7EA 4IYJA 4PPGA 4YJHA 5EKTA 5AVOA 2W70A 3HNRA 4FYVA 5IBPA 2YWJA 4ZOBA 3A2KA 4R6WA 2HJSA 2VHWA 4J07A 3ZN2A 5L40A 1HX7A 3PWZA 2ID7A 3G8CA 1N25A 2DR3A 3C15C 3SDBA 4PS0A 2GK3A 3QHQA 2ZM5A 4ETNA 2YWEA 2J41A 5E4FA 4ZHQB 3OT1B 1ISFA 2O14A 4J9UE 4ROSA 3UXHA 5AOAA 1NONA 1K2WA 1OWMA 4F3CA 1DEXA 2VNKA 3S70A 4EPVA 2BKLA 1FUUA 4N5HX 5HA5A 1NLZA 1ORIA 5T5QA 3DEHA 3W7BA 5JU6A 4RZ3A 3LTNC 2GZSA 3CE9A 1EZZA 3GUHA 1YR8A 5JNVA 2ZUUA 4Q48A 2EW8A 1UOPA 3LRPA 2R65A 4EAAA 3EJWA 5I8PA 3HRKA 2QWXA 1Q84A 4AY5A 3VKWA 2AJTA 5DCYA 3CLTD 3GDWA 1KORA 2BONA 4O4LA 3UT0A 2V9CA 4ARZB 1DFIA 4C0JA 3FYSA 2GN1A 4TSRA 2NU6A 1JL3A 3ANNA 4PBTA 4DC1A 3QKIA 4F9GA 1QK3A 3G1WA 5FTKA 3R7WB 4NEQA 1E60A 2XPCA 2Z3VA 3HO8A 3IAS6 4GZMA 2XODA 1WCWA 4OI2A 1H23A 1V1RB 3VAZA 2BH9A 2ECOA 1C30A 3ASUA 1JHZA 5TGDA 1ZVKA 1GKIA 2TSYB 3N6VA 3BX1A 5BQOA 4G8CA 1NI3A 1JG3A 5CFRA 1PR1A 4WJZA 5EIFA 3LDAA 1W9HA 1CU1A 1UAYA 3HVKA 2XUDA 4LV8B 1DCTA 3T1VA 3IT0A 3V9AA 4DJ5X 1OQAA 2A57A 1GSIA 1KKUA 4RIIA 3SK0A 4B3HA 4F11A 4AY4A 1HFKA 4YHBA 4U02A 2JKYA 3DTTA 2AUNA 1AV7A 1Y7TA 2CLCX 1YB1A 1OZAA 2QVZX 3PDIA 4FMCB 1BG6A 1PR3A 2Y1DA 4NH4A 3ICWA 3N59A 4YRKA 2AS0A 5I7WA 1NURA 1VFPA 2CLFB 3QUTA 1N8KA 4K03A 5CNJA 3FOEC 1V5GA 3HYTA 4MP8A 3RGGA 1HE2A 4C0HA 4JU9A 2P6OA 3LSTA 1M1YB 4BJ1A 4C14A 3UBMA 2H5IA 4PNZA 1XLTC 4IMJB 4BASA 2FQ1A 4D46A 5KS2A 1JPVA 2OFOA 4ZI2A 2AA3A 4J91A 2OXCA 4NYIQ 1DCFA 1LK7A 3LRTA 1T6YA 3GQBB 1ELOA 1FDSA 1XOIA 3DA8A 4XWGA 3RWOA 4Q24A 5IT4A 2BH2A 2OUKA 3PNBA 1BFKA 5AI4A 1ESDA 3GUYA 5K3DA 3LZ6A 3QKWA 1NXVA 2GA8A 1HUQA 1GYRA 1Z6XA 3PXEA 3ROGA 3W8DA 4H31A 1TMOA 4UDOA 3QE0A 4FYXA 2IHNA 2ZSDA 4M8SA 4G26A 3HB4X 3K1YA 1JIQA 1OGIA 1PV2A 1FRQA 1YS4A 4ND8B 3VO9A 4FD3A 4FI3F 1W6RA 2WNSA 3H3FA 4FIZA 3VR2D 1HNXB 3M6IA 5E0KB 3D8RA 2BGGA 1G55A 4IDCA 5DSZA 1SKYE 4XJSA 2HWWA 4X8OA 4Y0NA 3KB8A 2PD6A 3GJ8A 4WGGA 1U7WA 3BTUA 2QW0X 4R1MA 3U0BA 4EUSA 3P4YA 3PENA 1R4NB 4R8VA 3SJBA 3TLKA 5KNBD 2BBSA 5TF0A 1IPFA 4JROA 1E3LA 2NVUA 3O1HB 4LYJA 4DMFA 5JHGB 1PLJA 4OQEA 4X3OA 3F2IA 1ST2A 2RBKA 3KJZA 5JZBA 1KQGA 3FPSA 1BA3A 3EVZA 2ODBA 3L6RA 5K9ZA 2WHYA 2ZI4A 2J3KA 1EFKA 4J0EA 4IRXA 3ZUGA 1G8AA 2WNHA 1ADYA 2HDNB 5G4KB 1VG8A 3I04M 4NAHA 1PTJC 4TSFD 5FQNA 2R7NA 1QH8B 2IELA 3TPFA 2C2BA 4ZALA 3VU3A 3WLKX 1W35A 1UKEA 3ENZA 3W6ZA 1K6JA 1VL5A 2NPFA 1P33A 2ZR7A 5LQJA 4XGNA 1M6HA 4V0NA 3OEEA 1E2KA 2P9TA 4WI1A 3ADPA 4D4MA 3BFVA 4R1QA 4N3BA 2GPWA 3THWB 3BFKA 1VIAA 3IVGA 4JUBA 4GLJA 5DIFA 1RXCA 4M21A 4V3BA 3WKCA 4YP5A 3VO1A 4BKPA 4M6WB 4MV8A 1Y3BE 4RTRA 2WPDD 2GO1A 2FWMX 2J6IA 4FYIA 5FPQA 1FJ2A 1YZTA 5BNZA 4DHWA 1DFHA 1QFZA 4LAFA 2N1MA 3INNA 2DAPA 2NYAA 2JFUA 1Z4LA 2IYNA 3QBEA 4I1OA 1L4KA 1C8KA 2OORC 1G1AA 5KOIA 1ECPA 1MP0A 2ZUEA 2FK7A 2ZJBA 3I92A 4PPFA 2GJ9A 4PU0A 4GAEA 4DLYA 2H85A 2WVJA 3OD5A 3C48A 3QKUA 1S5PA 4JA0A 5JMWA 3UO8B 1EGAA 2I71A 1J21A 2WAXA 2IX9A 2O8NA 2DQZA 5JXIA 3VJMA 3ESZA 4HAIA 1VKNA 4PYJA 2RONA 2H2IA 3WGLA 1RXVA 1DUSA 1JLSA 3BMXA 4PPNA 2ZBUA 3FVQA 1KIFA 3AEXA 4O4IB 3IUQA 4KX3A 1Z68A 3JSXA 1GLVA 1C9JA 3T5DA 2JLZA 2QX8A 1SKAA 1I6MA 2Q5IA 1K0FA 1VL2A 4M0UA 4N9WA 2FZVA 5F5LA 3F3SA 2CNBA 2R6HA 4BO9A 5JISA 4UJ5A 4JB2A 5KX5F 1EAYA 1RLOA 3CUUA 4WLUA 1E61A 4IDEA 5AO9A 5H83A 4Q7LA 3ZU2A 3WRXA 3KUCA 5I7AA 2Y05A 3KKLA 1PR0A 2A14A 2HSDA 2PZBA 2ZBGA 2ODAA 3L0OA 3COVA 3S2EA 4OYHA 1E66A 5TPZD 1U8UA 3A4NA 4EW1A 4LUCA 3A10A 2BBWA 3GRYA 5DTMA 3LVBA 4JUIA 1JDJA 1CJCA 1YI8A 4B79A 3GH1A 3PUKA 1I3MA 2ZTMA 3WJAA 4MJLA 2GETA 1QVAA 5ALYA 3V4RA 1WZ2A 3EXHA 3FUUA 3GFVA 4Z4CA 1G6Q1 1TADA 1SG6A 2CXNA 3KVVA 5AUQA 2IHVA 4RS4A 3PFCA 4QXPA 3AONB 1F3OA 4LPKA 4ZYYA 4MINA 5IZ4A 3JQBC 2XTMA 1UJBA 3H17A 5D1NA 1DAFA 3PFGA 4BBJA 1V37A 4CIAA 3T52A 4RDIA 5KMGB 2ZETA 3GRRA 3ILXA 3JVVA 4R5HA 5GJVC 4B3SB 1I2BA 1M6VB 3ROXA 2IYQA 2Q28A 2HA5A 1P31A 1IN4A 1Y1QA 3LPCA 1HQKA 3OE7A 2JK0A 3TOCA 3DV9A 1XMPA 3EZNA 5I7EA 2PZFA 5JCPA 2CV2A 4UQPA 3W77A 4P9NA 3A1VA 1SRQA 4LXGA 3F78A 4L75A 3K70D 4OMDA 3EG5A 4R2WA 4O3FA 1DBVO 1PO7A 1JYFA 3KYDB 4LGYA 1DIHA 2X8BA 2QRVA 2MINB 1HH4A 2WIFA 2UV8A 3I9JA 5EZYA 1Y42X 4QIHA 3KCNA 3E35A 2XQGA 5H82A 3FSEA 2JIOA 1C7QA 4HX9A 3NXSA 2P7HA 3WJ7A 2RAUA 2ZUDA 2WWYA 1NVTA 3G3EA 1DARA 4JK3A 4ASUD 5ALVA 3WAGA 1ZINA 2QN6A 1PEKE 2X13A 4EFKA 1JHVA 5HJ2A 1X6VA 5DNCA 4NXMB 3PC2A 4HWRA 2W8BB 3D02A 3PRHA 1GV1A 3RSHA 4DR6B 1U0GA 4NJMB 4PVDA 5L6LB 5G3ZA 1YDGA 4W82A 4U9IS 5ARCA 1XZ8A 4CTJA 1SU7A 3G0BA 1B0AA 1M9NA 3P9IA 3VJRA 4TOIA 4ZT6A 1MC1A 4B6QA 1E7MA 3F7TA 2BMEA 3JY6A 5LZ2A 1YZLA 2Q62A 4EUEA 1EP2B 1JJIA 2XOKA 3B2EA 2I29A 4U9HS 3NUQA 4D79A 2Y76A 2QY9A 5BT8A 3R3SA 3AOEC 3EAFA 3V1NA 4F86A 2B99A 6PFKA 2AF3C 3OCXA 3GJ3A 1K06A 1GGJA 1YQQA 2I2DA 1FQOA 4FJ1A 4FOOA 2FPRA 2QUKA 4JYBA 1GTRA 5EZQA 3C3JA 3NM4A 2WSMA 3EDQA 4CBVA 2F90A 3NAZA 3OESA 2Q6IA 1LRJA 3F2VA 1JVBA 1NVUQ 3RU7A 5G41A 1CY1A 1Z06A 3HJRA 1OF1A 1GQQA 2BR5A 4PZZA 1EA5A 2W2KA 2H7VA 1E3DA 2QJWA 4BJ6A 4KQCA 1K8RA 3OO0A 3FN4A 3HJBA 3OEWA 4KAAA 4R1LA 2PX4A 1YBMA 2IEAA 3NUZA 2D1QA 3CXUA 2YXEA 3EYWA 4DBLE 1YT5A 3KJQA 3W5JA 1LFDB 4E1BA 2G9UA 4R1SA 1K9SA 1KYWA 2V6MA 2A9KA 4YUWA 1CS4C 1YHNA 2XT0A 4A3SA 3IUBA 4QUGA 1YTUA 4TWIA 3SKXA 1XYGA 1QG4A 1XDBA 3OBIA 3OI7A 1EI9A 1U7OA 4OQZA 4NCKA 4N6NA 4NULA 2ZS7A 1U7DA 3R75A 3V42A 3WK7A 1N2BA 2C9CA 3KKZA 1YVPA 5EE5B 3Q2KA 4E51A 3C6MA 2SECE 3I12A 1EUCA 4ZCSA 2RG7A 1L5WA 1L8XA 1Y4UA 4S2EA 4CCAA 4HV4A 1ZHOA 1V7CA 3VSEA 2AHOA 1RHJA 2BEVB 4JJ7A 4TRNA 3K6RA 1H2RS 1DS6A 3QUCA 1KZGB 1T3GA 3D3NA 3LUKA 1DWPA 3H5VA 3PXXA 5A02A 3EPKA 1ODFA 4WNIA 2LD4A 4MVJG 4LWZA 5ES3A 4CMAA 2GBIA 3DUFA 1OYOA 2EP7A 3S68A 4AI6A 2XD9A 1DRJA 1S6YA 1PWHA 1Y3FE 3B9BA 4ITRC 4KMMA 4WBSA 3ZHBA 3M4NA 3T4UA 4A23A 4BZQA 2Q45A 3KZVA 4RIHA 4C5BA 3NEYA 4DZTA 5AW6A 4E6PA 4YX9A 1DO8A 3E5NA 3N6RA 2XNCA 4O5OA 5B3AA 1FSGA 1SBCA 2O0LA 1PKXA 2ZRJA 3GJSA 3KVOA 4RORA 3QRWA 2F2TA 3AR9A 5T4FA 4Z53A 2PX0A 5CH3A 2JASA 3Q7IA 5KX5A 4NBLA 4CT5A 1VMIA 4JU8A 1T2DA 2YNMC 4BMOB 1IQRA 5A3SA 4RBNA 4CT0A 5HS4A 4CM7A 3TVYA 1JHQA 4E33A 1ZUIA 2XZLA 2BEUB 1C3LA 5IJ0B 4GMXA 5IM5A 1KEEB 3KQLA 1I4WA 3M1YA 3ROKA 1Z22A 4PFKA 1CUJA 1U9ZA 3JR7A 4JJ6A 4WV3A 4MRVA 4JVOA 4BE7B 3O8OB 4DCNA 4Q4CA 5KSWB 2AOTB 2SICE 1TVKA 1BMFA 3DTYA 5PNTA 2MMCA 3B5EA 2VWQA 3CH4B 1WDWB 3RNLA 2X9GA 2JHFA 3BHIA 2XWJI 5DLDA 1A27A 1E8DA 1L4YA 2BFOA 3I42A 4HGNA 4OPMA 4D8XA 5KTYA 4RCVA 2DULA 4DBVO 2AEJA 3EEQA 4A0GA 3S2UA 5EP3A 2PWYA 2XE6A 3CRRA 2B2CA 4HXYA 2H8KA 1UEIA 5ALZA 3UUWA 3V1LA 3T1HB 4K05A 3EVEA 5LDGA 2EC5A 1XNHA 4HEHA 2PLWA 2VYNA 3I5YA 1PUXA 4NPAA 3JQ6A 3VR6A 3QU5A 2QLFA 4TWRA 4M83A 1Z35A 2P91A 4DRZA 1KJQA 3EH1A 2Z8XA 3QVOA 1RKVA 3GJTA 1RRGA 4MQFB 2G07A 4OQ4A 2G70A 5JNWA 1L4FA 2FWBA 1XD2A 2YMMA 3AW9A 1P3JA 3Q3VA 4NG4A 2YVUA 2B2NA 1PKEA 4UBLA 2C3OA 3UMFA 1U02A 2B78A 2V98A 2J3HA 3ZS9A 3Q8XB 4OL9A 1MQ8B 4R1NA 1IBKB 1WPXA 3L82B 5B4TA 2DMRA 1JIXA 2ZKIA 1EUZA 4NE9A 4DWJA 4WADA 1OPXA 2EFHB 2XXAA 2IXFA 2HHCA 2DSTA 1SUAA 3D4NA 1H9BA 3HVJA 3Q3IA 4CFYA 2WMDA 3AM3A 3GUUA 1PS0A 4B4UA 2R9VA 4CR8A 2BHSA 4CODB 1Q95A 1IHPA 2OHIA 3H86A 2MU1A 3NAGA 4UUMA 3ZHVA 5I7RA 3NTXA 4QNNA 1Y7LA 2E82A 3CW8X 1GZUA 3N8DA 5EYPB 3V3TA 2FPSA 3L1VA 5HKAA 3G0OA 1A72A 1M2JA 2QD4A 3GP5A 1A96A 1JGTA 3MCZA 1G3IA 3NORA 2JI6A 5D2CA 4YAKA 1XNQB 5IPFA 1G8YA 4JMLA 1DHRA 1N5OX 5BYKA 2HF9A 2FUEA 5FI1B 2C7OA 1CERA 1X7XA 4P80A 3OCVA 4RNCA 2RHRA 5BNFA 2ZI3A 3I30X 2INGX 1T2VA 5FV7A 1DG1G 2DT8A 2V8OA 2Z9BA 4M1TA 4P8RA 3BJZA 3DE3X 3JQ9A 5A05A 3EX7C 1KXJA 2XI4A 1AX9A 3HI6A 3SR4A 4C2BA 4AJNA 1MABB 5KJ1A 4P4SB 4WQMA 2VDPB 1XCMA 1HT3A 4ENTA 5BXYA 4WZBE 4YYEA 2VPWA 1A4UA 2XKBA 3F3MA 3UVEA 4BB6A 2Q46A 2AJLI 1UDRA 2ZT6A 3PWSA 1PLKA 1UZNA 1TEXA 2OY0A 1YIOA 4NV1A 3R5FA 4RAOA 4RMJA 5CNIA 3VU8A 3NV9A 3T38A 1FMFA 5HIIA 2G36A 1CLEA 1J7KA 4F9TA 4YRAA 5IKEA 3K5PA 1O4WA 1G7SA 3AU8A 1KF0A 2F8TA 1G42A 1YCDA 4HAXA 2C3YA 2GXSA 4G37A 4IZ6A 1RYBA 1UK9A 5F9MA 3LX8A 5GQSA 3ZC3A 3DVRX 2FZLA 2WYOA 3V46A 4D4IA 2YXLA 2NO7A 4CJXA 3VC1A 4UZFA 2R1TB 2PMWB 2Y27A 3AM5A 1AO3A 3CX6A 4KU4A 4LXTA 4WE3A 2HWXA 5UKDA 1DAEA 1ZM3A 4MW2A 1HDEA 2RHBA 2D1FA 1MX5A 4QQ8A 4RHEA 2P9JA 1ENPA 4RPHA 2O0MA 1TAHA 2PPVA 3UAYA 3UOAB 2WD7A 2OGSA 3UXEA 3KQQA 3V2IA 4E7PA 3QX3A 1RAIA 2YMLA 1QMPA 4PLPA 2F3SA 2PKYX 5HQTA 1J1UA 3AUSA 5B2EA 2WV9A 3LKDA 1VE5A 4OP1A 4QT0A 3FRJA 3A8TA 2AR9A 2QYOA 5KSYA 2RARA 3NI2A 1NVGA 4DUGD 3A1DA 4EY6A 3ZD8A 3DZJA 3P9CA 4D9BA 1Y6FA 4ZO7A 2GRJA 1NGSA 4PAMA 3T0FA 4ZP1A 4QYSA 4HXEB 1HFWA 1TYDE 2H2GA 2ZJ2A 1UJ2A 3DYIA 3GELA 3COJA 1V7ZA 3OJFA 3I37X 1M6WA 5I9MA 4IOLA 9LDBA 1BCSB 5JYEA 5HRUA 5LZ8A 5A4AA 3D2AA 1VHDA 3WGYA 5C7YA 1CUWA 4KE6A 5IXJA 4ZJZA 3NT5A 1NN5A 2I7XA 4MUMA 3HYRA 3SFZA 3NRCA 3WOVA 4AO7A 2AXNA 1RPZA 5B1IA 3EZ2A 3HV0A 5AHWA 3KYJB 5K2MA 2MT9A 3RVOA 3T06B 1R0CA 3ZZTA 1PVVA 3LRXA 2XNSA 2LWIA 1Z13A 3E84A 4B8ZA 2AK3A 3EQ9A 4FHDA 4NLLA 2OAQ1 3LPMA 3AW8A 5J4VA 4IWYA 4Q18A 3CZMA 3Q72A 1E0KA 3NTQA 4EBFA 4ZMBA 1MIHA 3H19A 4ILEA 4MKFA 3MS2A 1XEXA 2WLSA 4GMHA 2RK3A 4X71A 5DNDA 4KQKA 3W5UA 4KDRA 4K6KA 2HA3A 3ZXYA 5FTNA 1EFPA 4IH4A 5E6SA 2ERCA 1LCIA 3M34A 4KJXA 1OC4A 5C3UA 1UPUA 5K4HA 1FMJA 1IHDA 3I2KA 4I1UA 5BNWA 2AXQA 4H08A 1TTHA 1L3CA 3NHBA 2HYDA 1CUIA 4XA8A 2O0JA 3VZBA 1I3KA 2IGTA 2RKBA 4YCAA 4IJQA 3TB6A 3N0RA 1BXRA 3FD8A 4CMHA 4ZVQA 1VBNA 2GCNA 1P75A 3RWMB 1PD1A 3GJ0A 4LG1A 3JQDA 4NJOA 4Z7OB 4DV2B 4CLEA 3CWCA 4DNXA 3IULA 1IZ0A 4WASA 5FFFA 4LZWA 2VYVA 5H7XA 4ZYZA 3INGA 3IQZA 4MV7A 3GXBA 4RD0A 2PGXA 4N54A 1T6ZA 2GD6A 3DFIA 4W5JA 2ACWA 2W6MA 2LCIA 3OJEA 2YVQA 4AY3A 1JSLA 3TIVA 1R0LA 3PKZA 3OECA 4LF5B 4UNIA 1Z0UA 1ZRSA 1QYCA 4HVTA 4DV7B 3VPAA 4HQ0A 2D2XA 3OZWA 1BTOA 1EEHA 1WD5A 2IDKA 2IXAA 4J4TA 3VNSA 1RBZA 3CVJA 4M2LA 4WT7A 4RXTA 3HCPA 1XZQA 3GOHA 1NQ5A 2Y4NA 4R9UC 1RKBA 1ZBQA 1RQXA 4L9WA 3P9XA 4TUYA 3B1YA 4UTVA 1QU2A 4RZ2A 5DYIA 3HABA 1V47A 3LJKA 3TFQA 4YR9A 2EWVA 3NC4A 3QA3E 4ZPXA 3ZEAA 2MYNA 5CW1A 4F6RA 4IFBA 2I2AA 1PL0A 2QD1A 5JS8A 1KFCB 1S3SA 3T7KA 2W6NA 1GT91 5TX7A 1I3CA 4CI0B 4KP7A 2AOWA 1Y1PA 2QX4A 1II0A 4TRRA 3KC2A 3T0IA 2J9RA 3GDHA 1LLCA 3ZI0A 2OBBA 1VRCA 3R0XA 3GQBA 5FCDA 3KALA 4KMSA 1HMPA 5CP8A 5BURA 1T5DX 1L4GA 3IUPA 2IWRA 3AJEA 3BZUA 3W0LB 4DFDA 1Z29A 4EEZA 4M7OA 4IDHA 3WVNA 2GHTA 3OHMA 2XUIA 1OZ0A 4V1CA 1MC5A 2CGEA 3I09A 1QLHA 1YFZA 3EARA 3P0IA 4YRMA 3U6KA 4N3AA 3R4CA 1X1CA 4K9QA 2I22A 2HU7A 3GJ4A 3OZDA 5A0FA 3ZVRA 1JG4A 3Q7SA 4N40A 1XPRA 4HNTA 1DL5A 3GFQA 2ZAIA 4TTTS 5ITWA 2B4TO 3KKMA 5DYYA 2PMBA 3IRVA 4K28A 4MQ6A 4NQZA 2HLDD 4G0PA 4G5FA 4WXYB 5CFMA 1I2ZA 2YVKA 2G9RA 1I6KA 3GA0A 1BMTA 1Q20A 1GNLA 5EJ6A 5M5BA 1E1YA 1RW4A 3UHJA 3OQ1A 2C7PA 3GZTB 4CLOB 2E6KA 2QOEA 2R6GA 2QRQA 4L1KA 4YH1A 4QOSA 3A1UA 1NZDA 4XSGA 1JHXA 3NANA 5AM4A 1BYIA 1UPTA 2LZ0A 5SZKB 4TRJA 2AKAB 2WRZA 3CF2A 4KVZA 4KZKA 4O0LA 4QWWA 1UMDB 3KLBA 3NHUA 1UBCA 2QT9A 2BFBA 4I81A 1X7ZA 2RGUA 4QOEA 1F2TB 4M89A 1TW2A 4C7VA 3V32A 3PRJA 4DCCA 4WVFA 2WF9A 5IN4A 2CW5A 1MX9A 3OIYA 2RHGB 4K0KB 1LDBA 1FPMA 3G0GA 2O7RA 4O02B 3KEGA 1TIBA 4Z9BA 4U00A 2PRJA 3CH7A 1UBMS 3ZK9A 2CFRA 3IE2A 1FDIA 4E31A 1EVIA 1B76A 3G0DA 3GD5A 5B6PA 2I6UA 2LGJA 4C0BA 1QE3A 4Q9DA 4B43A 1TU4A 2IEIA 3SY8A 2D6FA 3WMXA 2OZEA 3EVTA 5SY6A 3ZDXB 2C61A 3L3BA 2EW1A 3AIOA 4ZMRA 2IIQA 3ZD7A 3OSZA 1WF3A 2GAFA 3WNDA 3GP8A 1AC5A 1QP7A 3J7AC 1THTA 2XE7A 1QQ7A 4CCYA 3T9FA 1LFAA 1G4HA 5DK6A 5DNUA 3PC8C 4FINA 1KRWA 1NI4B 1A9OA 4PSUA 3MGAA 4CMIB 1G66A 1HOTA 3GIDA 3UJNA 5DM70 5IM4A 2NUBA 1QORA 4JENA 4AN0A 1NXWA 1G21B 3W8FA 2BDEA 2P2NA 4HFNA 5K3SA 2BHTA 2PJDA 4J2TA 4EMSA 3SAJA 1N6HA 2H5EA 4GOXA 3NYIA 4OM8A 5EINA 2P2CA 4OOEA 1DKOA 1Z33A 5CAEA 4KYTA 1YE5A 1SBHA 3E8XA 3IUMA 4UEWA 4X7RA 4Y6PA 3ZHQA 5K6AC 3K71B 1YUMA 4PX9A 4JJZA 4IDGA 3BFPA 4EZIA 3DDNA 3QKSB 4CETA 3FPHA 5KNCH 3CLUC 1A9SA 1T91A 3E7XA 1T35A 4G4IA 4ZVTA 3EGVA 2O6LA 1QQTA 1F2DA 1IXSB 2JHAA 2MSCB 3IEIA 4R8MA 2IZ6A 3K9HA 5KNLA 3B70A 4YJ2F 1I4EB 4I55A 3B9PA 2QBYB 3E9ZA 4UPVA 4JJ4A 3RS5A 3DBLA 1NJ5A 3I1YA 1BDIA 1BXGB 1JHDA 1BEUB 1TC2A 1U2DC 3ZCXA 2X2EA 2Y1LA 2R5WA 4DVJA 4AJEA 1M7GA 1UWLA 4J9VA 1DDIA 1A8QA 2Q0XA 3P2OA 3HU2A 1L5YA 3LIIA 3DF7A 3DKKA 1I4LD 1BXKA 1PGOA 1YVDA 4EGFA 2W42A 7MHTA 1UC4B 4AX4A 4HNGA 2YWGA 5KKNB 3U7RA 2NGRA 4MPDA 4EPTA 3CF6R 4KGVA 1LU9A 1RKQA 3D6MA 2FE4A 2LCFA 4D5GA 3EYAA 3U48A 2NYUA 1ZM4A 3I32A 5IXYA 2GCOB 1LPPA 3OFJA 3PQ7A 3LP5A 1E2BA 1CUEA 1RR6A 2BFDA 3E1GA 4YRGA 1QHNA 2A7QA 4GKKB 1NBMA 2ECFA 2C92A 5JNLA 3L7AA 2A0UA 2GFIA 1EJ6A 1R9MA 2AJBA 1AN0A 2OVBA 3NPMA 3QPCA 2H3EA 4HDQB 4UC0A 4AXBA 5JALA 2EU8A 1G9SA 5DMHA 1GR0A 1K8QA 3FNQA 2CHGA 2UVPB 1XLUA 3UNXA 1RYZA 4MWGA 3OWXA 2CCKA 3H1PA 4C4TA 3A4YA 2ID8A 1ZIXA 4BWYA 1UCFA 1UANA 3I3OA 3DH0A 3VDMA 4EYQA 4M0EA 3VI3B 1ZI6A 4MK4A 4BVLA 4L78A 2DPGA 4HCJA 1V9CA 3JRWA 4D4GA 2VEDA 1NY5A 2CHVA 1DV2A 1KO1A 3BH0A 4J1TA 5FV4A 2A3RA 2WOJA 4Q3EA 3WRYA 5DSXA 4DV5B 1G0OA 4MW6A 1JR3E 1DE0A 2XYPA 4G2TA 4GR9A 2QAGC 4M8NE 4TKVB 3WQSB 3C4QA 1HEYA 3OEED 2JAUA 1DXQA 2EBFX 4YI3A 3MAJA 1VCMA 3LOQA 1M2VB 3KSAC 2AIRA 3PQ6A 1JQAA 3DPIA 2FE1A 4WNAA 1IHUA 2JIBA 1KWGA 3D3WB 3RIHA 5TS3A 3GVPA 4KNYA 3WIOA 2BE7A 3L9XA 4HLDA 2JD0A 1DTWA 4HWKA 2Y77A 1RJ9B 3CUKA 4TQUS 2VDMB 4WK6A 3WLAA 4BBZA 3RAFC 5DYWA 3TRFA 4G0WA 1BFDA 2UUOA 5FFMA 1T1SA 4KVGA 4LGVA 1JTVA 2NTNA 1KSFX 2OHJA 2WJGA 4I6GA 3SN6A 4BNZA 5K8CA 4ZOQI 1H6BA 3OFSA 1RXWA 2NZ2A 2VJLA 1T2AA 4J16C 3DTVB 2C5GA 1F51E 3VA7A 4N49A 5ITVA 3VBEA 1L5HA 2NZJA 3K9GA 4L16A 4X8LA 3HLKA 4WXMA 1A9YA 3ZW9A 2P67A 2FW6A 2VKQA 3TG8A 1R4AA 4C4YA 2MHCA 5HFJA 5TRTA 1U98A 2QLJA 5KVAA 1E58A 2J5QA 3WLEA 3L6EA 2VS1A 3IPXA 4LOJA 2DQKA 1D2GA 4PZYA 2GZDA 3ANTA 4ON9A 1I8TA 2YZKA 3HCOA 1KP3A 1X1SA 1WW2A 2O2HA 4J03A 4U2FA 3TRHA 4S1NA 3WFZA 3NOXA 5C51B 1EVZA 4WDQA 1L0BA 4L5AA 5AW9A 1JT9A 4Q9IA 4L85A 1J2TA 4ZXPA 1W93A 1UZUA 3BJMA 3DYBA 1YGYA 4D74A 4B6FA 1IRXA 2PS9A 4ZCMA 2OBYA 3C7AA 3O8DA 5HE9A 3BCSA 3RS3A 3TRKA 1OILA 4N18A 4Y2QA 4ZEWA 5TPZA 1RZ3A 2ZI7A 1ADBA 3T7JA 2JFHA 3UEOA 3C3KA 3Q5DA 4LHWA 3LCRA 1R5BA 3ON5A 3WDLA 4ZAFA 4GPEA 4NENA 1NYQA 3HV2A 4J94A 2WT8A 5EIBD 5HK8A 1A5BB 3U44B 1WJGA 1Z0JA 3WMWA 1VPEA 1RXIA 2QDXA 3RBXA 1WCV1 5BMVB 1GFIA 3PHLA 1I94B 2IU4A 2HBRA 1DAPA 2VJPA 4A6PA 3KQKA 3PSAA 5H9WA 2OGUA 2LIPA 3DNMA 3VZQA 3T3PB 1JHRA 3U3ZA 4G24A 2CLDX 5E9JA 1X1AA 1T0IA 5BV2P 4O59O 4FVTA 2H51A 3O92A 4X54A 5HIMA 1TW3A 1U3UA 3MG9A 3F7MA 1E94E 4FBGA 4OUDB 1I4TD 2JGLA 2VUIB 1P0CA 1SNYA 2RHJA 4MR9B 5IAAA 2BEWA 1M0TA 3EVFA 2VDWB 4EJFA 2XZOA 1Y6GA 3MNFA 4W63A 5CVTA 4PO8A 1T8RA 1BAPA 2GDZA 2QRHA 5CRIA 3ZWKA 4LJ6A 5G3YA 3BRSA 2JLQA 3EIOA 5GGYA 5HEKA 3SC3A 5IHXA 5K8UA 5HTOA 1RWVA 1FTNA 4K8OA 1OLSB 2PNJA 4V0SA 1F8YA 2IZ1A 3GDOA 3IKLA 1WV0A 2H5LA 3N2EA 5F1OA 1SXJA 3X1JA 1YQEA 2JLSA 4F56A 1Z0AA 4CQMA 3OE1A 4ID3A 4NSNA 4PZPA 1ORVA 1G8MA 3S7TA 2QU7A 4COKA 1I7NA 3U3MA 3CG0A 5E1DA 3PCRB 4KNVA 1W30A 3RTAA 5DWQA 3GMDA 4EFMA 1ZZEA 2FCRA 2YV1A 5F4BA 1E1MA 1JE0A 4CM8B 2I4TA 3UAXA 2AX4A 2XR1A 4MHOA 2YBDA 3HO1A 3TCNA 3QU9A 4B40A 3WHKA 2CF6A 1IHYA 3GZNA 4OJYA 4BQSA 2PQ6A 1I7DA 1NW9B 5K1ZA 2XHEA 1RC8A 1NRIA 2VJNA 1ZOSA 2AMFA 2QXYA 2AF4C 2NSYA 3A28A 3ZXXA 2HMSA 1Z2DA 3LDFA 5I5EA 3FI9A 5FADA 2N47A 4HLUC 1QIGA 5MN4A 3WBJA 2XJ4A 2FN8A 5EPEA 3WC4A 2ZBVA 3MUEA 2UVDA 2XGOA 3GF4A 1M0EA 2Q5JA 4IGKA 2PYDA 4D92A 1XQVA 4ER3A 1N8SA 4GMKA 3Q7QA 4PXAA 4L4SA 2B92A 4Q5IA 1IEXA 3DOUA 1HV8A 2OXTA 1U1CA 2H06A 2HWUA 2KBEA 4PQFA 3DKVA 2C1XA 5JS2A 1AKMA 4PZ9A 1QIFA 1CUAA 1WOMA 2PFSA 2WAYA 3AB7A 4F4UA 1MJHA 3O0DA 4YJ3F 4RVCA 5BRJA 1DBWA 1WSDA 3G9XA 3ZHTA 3QVGA 3PXCX 1U8XX 1IY0A 1MH1A 2VAPA 1L6RA 4J49A 4NBRA 1N4DA 4XQCA 1EFDN 1U7TA 1ZOOA 2EFJA 4BUJA 1XL0A 3QZUA 4AKEA 3QYJA 5KYWB 2G76A 2J4FA 2W8ZA 1USKA 3DZHA 1TCVA 1ZIPA 2GZRA 2XMGA 4J90A 4JLKA 1GN9A 3OZEA 1MW8X 3QEKA 4I9NA 2QZJA 2QIPA 2WJZB 6ADHA 1N5IA 1J0EA 1NAHA 1TKCA 3FM9A 1G0NA 4KIFA 4TLAA 4TLEA 1MR3F 2VHYA 3TVTA 1SXJC 1IMJA 1X70A 4L22A 1P0IA 2YHIA 2VQEB 4CGZA 1CJTC 3TQOA 1KOJA 2VA9A 4XSVA 2I54A 5TPWA 4ERNA 4XVRA 4P7GA 4EVRA 3RVRA 3IA2A 4U7TB 3W1EA 2DTDA 1LQUA 3HKEA 4BGDA 3M81A 4DSOA 4R9NA 5HKKD 1D2CA 2LDBA 2V45A 4NU6A 4CRWB 2FHPA 1EFPB 5E6SB 1QB7A 3CR8A 3MYYA 5A7FA 5DHTA 4QGSA 3BWVA 2WKQA 1NWCA 3Q6IA 4E5YA 5EKSA 1PLLA 5EXPA 2DYKA 3PA6A 2OA0A 1DIOB 1PJ4A 1IAQA 2GNAA 1OXXK 1QNLA 2SKDA 3JQ9C 1N33B 1KA9H 3C3DA 2BSXA 1XB2A 4FGLA 3HXQA 1G291 4OCZA 3HFGA 3T9AA 4QX6A 5JH7B 3ZD9A 5C4GB 2IXEA 1OXKB 3A1CA 4P34A 3VHXA 3BYZA 3ZDRA 2WWFA 3K0FB 4MB6A 3JQEA 1BHSA 4EB8A 4JBNA 3KT3A 3OIGA 3OTQA 1JZTA 1UT6A 3GVCA 4RLQA 2QVLA 4M7RA 1Y8CA 4GXNA 5DW0A 4WKOA 2HPHA 4FIDA 2ZJ7A 2AQ8A 4AZWA 1YBAA 1MMFB 3SE0A 2WF5A 3DCJA 4FXPA 4RJ2A 2VN8A 4QTTB 4PGGA 4QGFA 1QIIA 1N2IA 5C32A 3DV0A 5LMUB 4YPOA 3LHKA 3FBTA 1JX6A 2IUEA 4BUZA 1MVOA 5BMVF 2RE8A 2XT6A 4A73A 4AJKA 2C5EA 1K7FB 2PAAA 1TVCA 2PR7A 3AXSA 3EIWA 5DB4A 4G5QA 3RVQA 1GPYA 2NZ8A 4M8KA 3BICA 1NIJA 3CF0A 1U4OA 1E9RA 3KZXA 3ME5A 3S8MA 4JY7A 3ZWWA 4DQ0A 4JUFA 2GZAA 3ZS8A 4Z6KA 5K0JA 4UBNA 1P7VA 4MRAA 1DWQA 2VHJA 1IM2A 2Y0DA 4OQYA 4B3CA 3JW8A 4F0JA 4XWWA 2ZYTX 4CKXA 3UXYA 2W6CX 4JJFA 1V7PC 4E08A 2VT7A 4PLFA 2D1RA 2YJ6A 4EHLA 2PMCA 3CLRD 1IC6A 4YIKA 2CYCA 3E9DA 5ICGA 3A9TA 4DUPA 3QVJA 4MIEA 2BYTA 1U63A 2VHEA 4LQDA 4FCTA 1JA1A 2JDID 4HMQA 1ZAYA 1JXQA 2XSZA 4LZPA 4S0XA 4BBAA 4BKUA 5K5EA 4LMPA 3TJRA 3FUTA 1OFTA 3GJXC 2EBWA 4HH4A 4MMXB 4AKHA 3L7OA 1TF7A 5IKXA 2RDMA 4LBYA 1Z74A 5EJEA 1I36A 4US0R 3TR5A 2X77A 5KWEA 4RK7A 1LS1A 5A4JA 3AWIA 2XAAA 1V9SA 2HGZA 3K0AB 4EYSA 3B5IA 2OD7A 5F3RA 3LH5A 1UQUA 4CG3A 4E3ZA 3ZH2A 1PEAA 1XMSA 1DV1A 3TXYA 1TO6A 1V3QE 3FTCA 1S3IA 4KE8A 5THQA 5SICE 1JSXA 1W1WA 4I6JA 4KDEA 3AI3A 2J5RA 4Y0AA 1ZHHA 1P74A 1YWGO 2GBLA 3OBBA 5I9LA 4XZ3A 1PUJA 1Y6RA 1E1NA 2RH9B 2JB9A 3X1KA 3GLIA 4GD3Q 2HSEA 1H2XA 5DM1A 3DWIA 3EFHA 3TN7A 4WEQA 1ENOA 1LDGA 5I4BA 4RZIA 3LCCA 3OEHD 4GF5A 2A5YB 4XD2A 5AKIA 3RUFA 1O6GA 3TO5A 2V55B 3R20A 4UTOA 5C35A 5T8KC 5CA1F 3ZIDA 2W22A 2NVWA 1FSPA 1CY0A 1L5NA 4LF8B 4EHIA 2VLIA 1OXUA 1XAJA 1K89A 1V48A 2GYYA 2VIIA 3H2GA 4I4TB 3MAAC 4HAOA 1PJLA 1ECGA 3DHNA 4MVJH 1LY1A 2I65A 3ZZUA 1Q50A 5AVTA 5ESWA 2C9OA 2QM7A 2XKKA 2XQKA 1QYRA 2IY9A 2ONYA 3E2MA 2Z2ZA 4MUNA 4Q93A 1YJ8A 5KTKA 2X2PA 1SVKA 4GX5A 1AGRA 1ESNA 1GPH1 3GJYA 4PYLA 4RACA 1OWLA 3FZYA 1GY8A 1VLZA 1VMEA 2BTQB 1MRZA 3ZI4A 5JHHB 1VP3A 4JZKA 3VOTA 4HQLA 4WESB 4Z54A 1C0EA 4WERA 4FEEA 2IH2A 3CCFA 1YDHA 2EZ9A 3A27A 4EWLA 4TV9B 1ZMBA 2QEQA 4IGEA 1RWNA 2YV2A 5TQ0A 1XCPA 3L43A 3OT4A 4Z3DA 4A0SA 1SU4A 2GAJA 3BIWA 3BTOA 5AI8A 2IY7A 3MMXA 1QVWA 1W94A 2ZYSA 3UAWA 1TEHA 2KLBA 4OHWA 2IIPA 2PT9A 2SKEA 3Q9NA 4KO1S 1G3UA 4YV7A 1SUDA 5BOSA 1KS2A 5KSOA 1KVUA 1H6AA 1RRPA 2JCYA 2QR5A 1H4QA 3HY6A 2GD0A 2XADA 1R6AA 2Q5CA 4ARSA 4QVIA 5T6BA 3NCTA 3EXG2 4EVIA 2ONKA 1O94A 1DEHA 2DP4E 2WWHA 3VDRA 3P0HA 5DNAA 5F4ZA 2YZGA 2X22A 3QEOA 1KVRA 2D00A 3GBVA 5E9WA 1VYUA 4LZAA 1SULA 5AVWA 5DGHA 1HZZA 2YJ5A 1TUBA 3RGWS 4IHJA 4ZO6A 4BECA 1MOZA 1Q1BA 2V6GA 3DE1X 4HQRA 4ZZ0A 1TTTA 2FFBA 3DMRA 3AL3A 1GQRA 3ZDEA 3PF9A 3HB5X 4XOIA 3S1LA 1X94A 2E3JA 3ILSA 1FFSA 4U2EA 2CWWA 5FTJA 1QHHB 5AOBA 2X0EA 3FNFA 5CB4F 1YK0A 1GPUA 4E5SA 2Q8PA 3NASA 4BNDB 2OO5C 2ZRQA 1I0LA 1D8AA 1OGYA 4G5GA 5TGTA 5SYAA 4D45A 4A7PA 4A8PA 3NMUF 1IONA 5J2TA 5DHPA 5EY5B 4G5OA 3K5HA 2FGKA 4H3HB 2X9NA 4P33A 4IX1A 5TQ2A 3AG5A 3BPSA 2YQ4A 2OYRA 3BJEA 1RYDA 1U65A 1KEZA 4LRTB 2JI7A 2LPMA 2OTCA 2PQ0A 5CIYA 3U3OA 1QLWA 4ZDJA 1N2SA 2W2PA 1X2EA 3KAQA 5BV0A 1B14A 4LZZA 3UMJA 1GTZA 3L5KA 4L4RA 1HXHA 4HLCA 5NULA 3RWBA 4BO4A 2IBTA 1QKIA 4MX8A 1T9BA 4Y6SA 4YAFA 4U7HA 3UB2A 5BMVA 2QF7A 2G63A 3QVWA 2AN1A 3IAEA 3LBFA 1Y4ZA 4EELA 2VQ3A 4WD3A 5JCZA 4L5CA 5KQPA 1JPUA 1LKZA 2AH5A 2IYTA 3IOCA 4EDFA 4X1OA 3CUSA 2OCYC 1U0NA 4RVUA 5HP4A 3KJFA 1BWSA 4IVRA 5JYBA 1S01A 2ZUFA 4EGSA 3IEKA 1EHIA 5LUAA 2HJGA 1OXSC 3W4JA 1BMQA 4AJ9A 4LDAA 5EMMA 2A35A 3IQHX 4I3FA 4RA6A 4KACA 4XPIA 3UKJA 1O1YA 5BYBA 3DWEX 2JAHA 2ZYIA 4HDKA 4QJ4A 2FMTA 5EUBA 2Q3HA 1PW7A 3FPKA 4KN8A 5HK9A 4UM9D 5LU8A 5HCIA 1KI4A 3PEFA 4EJSA 2YOFA 2HRCA 1E4EA 4L7QA 5JSQA 1NFQA 3I6MA 4ERXA 5KZMB 5JD5A 2CY0A 2Q1YA 1XBTA 1RP7A 5IC4A 3MHTA 3D3QA 4DPKA 2F4VB 3W9YA 4QNMA 3G2OA 2VDQB 1YA8A 4X45A 4OU4A 1Q5PA 3TLZA 2YXNA 4RFVA 5FULA 4Z2YA 3RVSA 4AP6A 3TFOA 1BEZA 1VPVA 2GPJA 1DCMA 2B30A 4OB6A 1FBTA 1H2WA 3F6CA 1KSHA 5IRCD 2FB9A 2FK8A 1COWA 1Z5NA 1WU7A 4BB5A 2BGIA 2P5YA 4B4WA 4TZ0A 2AQIA 2JJ8A 1ZS9A 5FWNA 2C4VA 4WN9B 5J3JA 4C76A 2EERA 1Q1NA 1W581 4MGKR 4Y30A 4AXXA 4JX9A 1ZA2A 2H07A 3NH9A 1UDAA 1PE0A 5EUCA 1TF2A 3TTXA 4F2GA 3A6LA 4TVSA 1EK5A 1KJWA 2BY4A 2WTAA 3H1TA 4WXHA 1E1QD 3PUJA 2TMYA 2QV7A 4RNDB 3ZUPA 4BNNA 1TM4E 5IM4F 1SKYB 1WHSB 2ZVJA 1NE2A 2EJWA 3EFOB 2JJ1A 5DULA 3R8FA 5IJXA 2DOKA 5EI5A 4C0WA 5KUTA 2O8CB 5DXFA 1A7UA 3QI7A 5E7JA 5FHRA 2ZIUB 3LPDA 5TQ0B 5CEEA 1NFFA 3C85A 4PX5A 1ST3A 3QF4B 4JT8A 5AFSA 4LF6B 4JT2A 4B6SA 2XB8A 1HRKA 1SM4A 3Q3JB 3C3CA 1U7UA 3HU1A 3BD8A 1E6MA 2CL7X 3CT6A 2AVDA 3STVA 4GPTA 4R9RA 4YRQA 3GMTA 4YUYA 3UJ9A 3EISA 1DOHA 2JFYA 2VTKA 3T4XA 1NKSA 2FEWB 2C9ZA 3LWDA 3EOAI 4UPEA 2IYZA 4Q1VA 4U6NA 4CV1A 1FSSA 1HTBA 1QHIA 2WZBA 4GFDA 2HTEA 1VDZA 4B7AA 1PAUA 3JPYA 1H3EA 4Z4EA 1TJYA 2HQOA 3OU7A 1I7QB 4DDHA 1QPBA 3K0HA 5L95A 1XI2A 2QX9A 3HRIA 3VAYA 3U4CA 5FOQA 2Y71A 3AEZA 3IURA 3PUYA 2BFDB 4ZREA 2EKBA 2W6OA 3N7TA 5A9TA 3CVXA 1WQ1R 4IYRA 2ST1A 2ZIEA 1RVV1 1DQRA 3HKBB 1T4CA 1GQ2A 3R9KA 4BRWA 1KYVA 4UEQA 3LPAA 1XTQA 1DZ3A 2HHJA 5DNVA 3VR3D 3ZV3A 4OHZA 1ZXBA 2Q6LA 3QLUC 4H1TA 1VA4A 2EF0A 3CMMA 4L50A 4OJQA 1Y4AE 4XQEA 1E6WA 4DA6A 4E94A 5LMCA 1JA9A 4M55A 4PTLA 3T3NA 1R6UA 5DW3A 2OFXA 3RC1A 821PA 2ID9A 4U7DA 2L18A 4HJXA 3SHTA 1Z4MA 1ZNQO 5KVQA 3T3EA 3BREA 5FLKA 4OXIA 2HT1A 3V80A 2M6RA 4RYDA 2RG1A 4GXRA 4N5LA 3PHIA 2H4HA 3DC2A 3LHDA 4QUHA 3GL9A 2H1CA 5CK5A 3RJ9A 3SICE 3VH3A 1EWQA 1U6IA 1O9BA 4HJRA 4JUCA 4U4AA 1R5JA 4OIMA 3SZ3A 1KE2A 3HSSA 2GMWA 3F47A 3J81k 3L0DA 1GCIA 1MO3A 5FOVA 5EXSA 2QVBA 1UC9A 5BW4A 3NLLA 3JWEA 2FF7A 5CB4A 1BS9A 3DDUA 1IH8A 1JHAA 1VRVA 3DYVA 2PGDA 4G09A 4A9AA 1U9IA 4TL6A 3H4TA 3NVMB 1SIOA 1IM8A 4QLOA 4Q34A 4BX2A 3QLTA 3GH3A 5AWFC 2PKWA 4AL4A 1GV0A 2JPDA 4GM1A 3IEPA 1L5KA 4XVUA 2ZVDA 4LZJA 3ZHOA 2UUCB 4D8UA 5LZ9A 4HYQA 4MPPA 3QKTA 3QBJA 4ZZ3A 5KTPA 1T29A 3BA1A 4B47A 2CUNA 2CJXA 3FMGA 2GJKA 3IP9A 3R0IA 3S1AB 1E8MA 5A5FA 3RADC 1AB6A 4FCCA 3CR7A 3LECA 2HLPA 3KZKA 3NALA 5REQA 3CSDA 3A9SA 3OJCA 3ZX5A 5IBCA 3A6FA 4QG7A 3JX9A 4GC9A 2R7KA 5E1BA 3BUSA 3EY9A 1B3BA 4PC6A 4LK2A 1SO8A 3ODPA 4LEIA 1WDTA 3RDPA 5K6TA 5FI0B 5CT9A 1BE0A 5FPYA 5KAPA 4IWXA 5EL0A 1VJCA 3SIPA 1C3OA 2Q5LA 4X3PA 4D9GA 3V34A 2E9SA 5HOQA 5IDQA 4GSYA 3DOHA 4HWOA 2P9FA 3BB1A 1V5IA 3WYNA 1QK4A 3D4BA 4JYPA 2X15A 4U0JA 3VMMA 3A37A 2JLUA 3WGMA 2VCEA 4EDHA 2H4ZA 2ZVPX 1J42A 2PL9A 4HQKA 3R41A 3DXXA 5LJLA 1SCJA 4IJMA 3MIZA 2VBGA 3CRZA 1UOOA 3F5DA 3KQMA 1ZJZA 4JVNA 3TTVA 2BGUA 1S4QA 2NW6A 4RCZA 4JDPA 3RAGA 4DJFC 4MEAA 3QW4B 4NNJA 3IMCA 4RY0A 4M9ZA 5HOEA