2XP5A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
157
structure length
145
Chain Sequence
b'LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
molecule tags Isomerase
source organism Homo sapiens
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
total genus 42
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp5A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp5A02
1JVWA 5I98A 2F2DA 1QZ2A 4MSPA 4DRPA 2RQSA 4NNRA 2LGOA 3M7NA 3O5EA 5HW6A 3O5RA 3IK8A 2M1IA 3NTPA 3TCZA 1D7IA 2MNTA 3UI5A 2ZQUA 3O5KA 3I6CA 4TYOA 2MLYA 2M8JA 3LE4A 5DITA 2M3OW 2XP6A 3JYMA 2D9FA 2L2SA 3UF8A 2YSHA 1ZCNA 1FKFA 1EG4A 4DIPA 4FAPA 1PBKA 4ODPA 1FKRA 5CQ2A 5BXJA 5HWBA 5HTGA 4ITZA 4N19A 4ODRA 4FN2A 5HWCA 1K9QA 3H9RB 3B7XA 5AHTA 5HUAA 1FKJA 1C9HA 2PBCA 2PV3A 4QT3A 3RFWA 1JMQA 5HW8A 1I5HW 1FD9A 2ZR5A 1K9RA 1D7HA 1QPFA 3CGMA 2RUQA 3NI6A 1NMVA 4IQCA 5D75A 5HT1A 2ITKA 4R0XA 2FAPA 4TW8A 3LUOA 1QPLA 2PPPA 2DMVA 2YSBA 2E45A 2XP5A 1YW5A 1A7XA 1ROTA 3FAPA 5HKGA 3KAFA 2ZQVA 3O5MA 4LAVA 5J6EA 3ODKA 1NMWA 4JFIA 4W9QA 4U84A 2Q5AA 3PRDA 4LAYA 1NSGA 3UI4A 4DRMA 1WMVA 1F8AB 4ODKA 1FKDA 2LJ4A 4TNSA 2DG9A 3JXVA 4C02B 1M5YA 4JFMA 1U79A 5B8IC 1PINA 2MLXA 2RUCA 4DRNA 1TCOC 4JFLA 3EY6A 3O5JA 4ODNA 4BF8A 1FAPA 5GPGA 3NRKA 2JXWA 3UI6A 3OOBA 3L4HA 2JMFA 2EZ5W 1Q6HA 3O5DA 1FKGA 2KR7A 4DT4A 3WH0A 3KCEA 3UQAA 2PV2A 2RSEA 1BKFA 4JFKA 1FKLA 2YSIA 3VAWA 4ODLA 3PRBA 2KGJA 4TW6A 2BA1A 1D6OA 4O2TA 2XP3A 2JZVA 4G2PA 4LAXA 4E5RA 2F4EA 3CNGA 4MGVA 3KZ7A 4W9PA 2RURA 3RGCA 5HW7A 3UQBA 2PPOA 1EQ3A 1FKTA 1FJDA 1YATA 2VN1A 2OFNA 3TDBA 2JV4A 3O5LA 4J4OA 2KE0A 4U85A 1D7JA 4DRQA 2XP4A 1BL4A 2F21A 1JNSA 2DG4A 3KADA 1F40A 1J4HA 2ZQSA 2Y78A 2MLZA 2M8IA 1EG3A 4LAWA 2ZR6A 3KAHA 3KACA 3O5QA 2MPHA 1Q6IA 1HXVA 1KT0A 2M2AA 3O5PA 1N1AA 5DIUA 1O6WA 3UQIA 3KABA 1TK7A 3JYJA 4DZ3A 1FKIA 1ROUA 4GIVA 4J4NA 4DH0A 2VCDA 2ZAJA 2YSFA 4REXA 2XP7A 3KAIA 3KAGA 1EYMA 1FKSA 2PV1A 3O5OA 4IPXA 2XPAA 2K8IA 2DG3A 2MDIA 3IHZA 1Q1CA 2LAJA 2DK1A 2KXQA 2XP9A 2FKEA 1FKHA 1ZK6A 4U86A 2KO7A 1FKBA 4ODOA 2YSGA 2RUDA 3CGNA 1J4RA 2L4JA 2MF9A 4W9OA 4QIBA 4ODMA 3O5GA 4JYSA 2ZQTA 3O5IA 1Q6UA 2N87A 4DZ2A 4GGQA 4DRIA 1Y0OA 3GPKA 4IQ2A 2DJYA 1L1PA 5DIVA 1FKKA 4ODQA 1WR7A 1T11A 4DRJA 2UZ5A 2XPBA 1KT1A 4JFJA 4QT2A 1W26A 4TX0A 1J6YA 2LPVA 2IF4A 2DWVA 2JX8A 2M08A 3IKDA 3MDYB 4DRKA 3O5FA 4DRHA 1J4IA 2KFWA 2DK7A 2AWGA 2KI3A 3TC5A 1JNTA 2LKNA 1B6CA 1P5QA 2XP8A 2PPNA 3IKGA 2RE3A 4TW7A 3M85A 3PA7A 4G50A 4DROA 1R9HA 2ZR4A
chains in the Genus database with same CATH superfamily
3WQWA 1QZ2A 5E66A 4NNRA 3O5EA 1XHGA 4WKAA 3NTPA 1D7IA 2MNTA 4Z2GA 1HKMA 5DITA 1JCHB 3JYMA 3LKXB 2DSVA 4WKFA 3GU0A 4DIPA 1FKRA 3WD1A 5CQ2A 4ZPWR 2QRVA 4N19A 2A3EA 2A3BA 1K9QA 4MTVA 3B7XA 4Z2IA 2PI6A 4Z2KA 1C9HA 4QT3A 5HW8A 1I5HW 1FD9A 2ZR5A 1QPFA 4IQCA 3CGMA 5D75A 1W9PA 4R0XA 1FFQA 3BXWA 2E45A 4KQZA 5HKGA 4DWSC 4LAVA 1NMWA 3B9AA 4L3NA 2O9OA 3WD4A 3UI4A 1SR0A 4DRMA 2LJ4A 1FLCA 3JXVA 3ARRA 3EIPA 1E6RA 1TCOC 4JFLA 3EY6A 4ODNA 3WQVA 1FAPA 3NRKA 1SYTA 3LKXA 3B9EA 2EZ5W 3O5DA 3UQAA 4PTMA 3BMBA 2F23A 3PRBA 4O2TA 2DSUA 2WADA 2F4EA 3RGCA 1FJDA 1YATA 3O5LA 5U47A 2KE0A 1TR8A 4MAVA 4DRQA 2XP4A 1JNSA 3KADA 3AS1A 4S3JA 2ZQSA 3W4RA 2DT3A 3KACA 3O5QA 2DSZA 2M2AA 1N1AA 1H0GA 5DIUA 3UQIA 3KABA 3JYJA 1FKIA 1NH6A 1LG2A 3ARTA 2A3AA 4REXA 2XPAA 1Q1CA 1K9TA 1FKBA 2RUDA 1J4RA 3PR9A 4HBOA 1HKIA 4NSBA 2EULA 2N87A 1HJWA 4DRIA 3ARSA 1ZB5A 5E5WA 1L1PA 4ODQA 4Z2JA 2XPBA 2A3CA 4QT2A 1J6YA 2LPVA 2JX8A 2M08A 2AOSA 3O5FA 1J4IA 1B6CA 2XP8A 3IKGA 4WJXA 5E65A 5HT1A 4A0TA 2B5UB 1JVWA 1GUVA 3O5RA 3IK8A 5JH8A 3MQHA 1NWRA 3WD2A 4TYOA 2IUZA 4Z2LA 2M8JA 2M3OW 2XP6A 4DWSB 2D9FA 1W1TA 2L2SA 3UF8A 1FKFA 3FSBA 1EG4A 2P4VA 4W5UA 4FAPA 4Z2HA 1RP5A 3MCBB 3RM9A 5DEZA 1FKJA 2PV3A 3AS3A 3RFWA 3NI6A 1K9RA 2RUQA 2ITKA 1QPLA 1VF8A 3FAPA 3MQGA 1HJXA 1HJVA 5E62A 4LAYA 1F8AB 1X6LA 1M5YA 1PINA 4DRNA 4BF8A 4KR0B 4DWSA 1H0IA 4HBEA 4MPKA 3WKZA 1FKGA 4DT4A 2PV2A 1BKFA 3VAWA 1FKLA 3MCBA 4ODLA 4TW6A 2KGJA 1RD6A 1LL7A 3CNGA 1W9VA 3KZ7A 4MGVA 4WKHA 5HW7A 1EQ3A 1ZBVA 2B31A 2PPOA 4R5EA 3TDBA 2JV4A 3WL1A 2YAJB 1TFVA 2F21A 4ZPTR 1J4HA 4AY1A 1EG3A 4LAWA 2ZR6A 2MPHA 1Q6IA 1HXVA 1KT0A 3O5PA 1TK7A 4GIVA 1ROUA 1WB0A 4J4NA 4DH0A 3KAIA 3UQBA 2MDIA 3FSCA 1ZU8A 3B8SA 2XP9A 2FKEA 4HARA 4U86A 2KO7A 4ODOA 4W9OA 2MF9A 3AS2A 1WAWA 3O5IA 1Q6UA 4DZ2A 4ML4A 3OA5A 4IQ2A 2DJYA 3ARXA 5DIVA 1FKKA 1T11A 4GLXA 2UZ5A 1JNEA 1OWQA 4JFJA 4TX0A 1W26A 2IF4A 4S3KA 4DRHA 1NWUA 3RM8A 2PPNA 5DO2A 4G50A 5DF0A 2ZR4A 1E15A 4DRPA 3M7NA 1ZL1A 5HW6A 3UI5A 3TCZA 3WIJA 3WD0A 2ZQUA 3O5KA 3I6CA 1W1PA 1E9LA 3LE4A 3CHCA 1PBKA 1KFWA 4P8VA 5HWBA 3CHDA 3PQHA 4IT4A 3ARPA 3H9RB 3CHEA 4WK9A 3WD3A 1D7HA 4IT6A 4A0UA 1NMVA 5BXJA 4TW8A 1E44A 1LJYA 2PPPA 2DMVA 5E64A 4P8UA 3KAFA 2ZQVA 1LQ0A 4P8WA 5J6EA 1IX5A 3ODKA 3FXYA 4W9QA 4U84A 3PRDA 2DPEA 3AQUA 2WK2A 4JFMA 3CH9A 1EHNA 2RUCA 4MNJA 4MNLA 3UI6A 2JXWA 3QOKA 3OOBA 2JMFA 2G8ZA 3KCEA 2RSEA 3FS8A 4LGXA 3RMEA 2BA1A 2ESCA 4G2PA 4E5RA 2RURA 1ZBKA 1FKTA 4J4OA 4U85A 1OGBA 1D7JA 2OWOA 4ZPVR 1BL4A 2DG4A 2YBTA 1UR9A 2Y78A 2MLZA 3KAHA 1O6WA 4DZ3A 1JNDA 2VCDA 2YSFA 2XP7A 3O5OA 2PV1A 4IPXA 2G41A 1X6NA 2KXQA 1FKHA 1W1YA 4Q22A 2L4JA 4QIBA 3G6LA 3ARVA 5GPRA 1W1VA 1WNOA 3GPKA 2YBUA 3FY1A 4DRJA 3PRAA 1KT1A 1O6IA 2DWVA 3IKDA 3AROA 4DRKA 2KFWA 1NWSA 4NZCA 2DK7A 3AS0A 2LKNA 1LL4A 1P5QA 3WL0A 3CHFA 4TW7A 1LG1A 3M85A 3PA7A 3ALFA 4DROA 5I98A 2F2DA 4MSPA 2RQSA 2LGOA 2WLZA 2M1IA 2ETNA 2MLYA 1E6NA 2YSHA 4UDMA 1ZCNA 4ODPA 1ITXA 5HTGA 4ITZA 1E6ZA 4ODRA 4FN2A 5AHTA 5HUAA 2PBCA 1JMQA 1LL6A 2FAPA 1GPFA 3LUOA 4JYSA 1ROTA 2YSBA 2XP5A 1YW5A 1A7XA 2PN0A 3O5MA 2WAEA 2O92A 1EIBA 4JFIA 2WM0A 2Q5AA 1NSGA 1GRJA 1WMVA 4TNSA 4ODKA 1FKDA 2DG9A 2DT2A 4C02B 4URIA 3ARYA 5HBFA 1U79A 1E6PA 2DT1A 2MLXA 2WLYA 4WIWA 5B8IC 3O5JA 5GPGA 4L72B 3ARQA 3L4HA 1Q6HA 2KR7A 4ZS6A 3WH0A 3RM4A 4JFKA 1D6OA 1UR8A 2XP3A 2JZVA 4LAXA 5HWCA 3ARUA 4W9PA 2OLHA 2VN1A 1FFRA 2Y8NB 2OFNA 5GQBA 4Q7NA 3GTYX 1OGGA 1F40A 2M8IA 3B9DA 3ARZA 1D2KA 2QF8A 4MNKA 1HKJA 3G6MA 4P8XA 2ZAJA 4XAKA 1CTNA 1EYMA 3ARWA 3KAGA 1FKSA 2DT0A 2FDMA 2K8IA 2DG3A 3IHZA 2LAJA 2DK1A 1XRVA 1ZK6A 2YSGA 1GOIA 1EDQA 3CGNA 4MNMA 4ODMA 3O5GA 2ZQTA 4QZVB 4GGQA 1Y0OA 1ZBWA 3ALGA 1WR7A 4DWSD 1NWTA 3CZ8A 2DSWA 3MDYB 1ZBCA 1W9UA 1HKKA 2AWGA 2KI3A 3TC5A 1JNTA 2RE3A 1R9HA 2YSIA
chains in the Genus database with same CATH topology
3WQWA 1QZ2A 5E66A 4NNRA 3O5EA 1XHGA 4WKAA 3NTPA 1D7IA 2MNTA 4Z2GA 1HKMA 5DITA 3JYMA 3LKXB 2DSVA 4WKFA 4DIPA 1FKRA 3WD1A 5CQ2A 4ZPWR 2QRVA 4N19A 2A3EA 2A3BA 1K9QA 4MTVA 3B7XA 4Z2IA 2PI6A 4Z2KA 1C9HA 4QT3A 5HW8A 1I5HW 1FD9A 2ZR5A 1QPFA 4IQCA 3CGMA 5D75A 1W9PA 4R0XA 1FFQA 3BXWA 2E45A 4KQZA 5HKGA 4DWSC 4LAVA 1NMWA 3B9AA 4L3NA 2O9OA 3WD4A 3UI4A 1SR0A 4DRMA 2LJ4A 1FLCA 3JXVA 3ARRA 1E6RA 1TCOC 4JFLA 3EY6A 4ODNA 3WQVA 1FAPA 3NRKA 1SYTA 3LKXA 3B9EA 2EZ5W 3O5DA 3UQAA 4PTMA 3PRBA 4O2TA 2DSUA 2WADA 2F4EA 3RGCA 1FJDA 1YATA 3O5LA 5U47A 2KE0A 1TR8A 4MAVA 4DRQA 2XP4A 1JNSA 3KADA 3AS1A 4S3JA 2ZQSA 3W4RA 2DT3A 3KACA 3O5QA 2DSZA 2M2AA 1N1AA 1H0GA 5DIUA 3UQIA 3KABA 3JYJA 1FKIA 1NH6A 1LG2A 3ARTA 2A3AA 4REXA 2XPAA 1Q1CA 1K9TA 1FKBA 2RUDA 1J4RA 3PR9A 4HBOA 1HKIA 4NSBA 2N87A 1HJWA 4DRIA 3ARSA 1ZB5A 5E5WA 1L1PA 4ODQA 4Z2JA 2XPBA 2A3CA 4QT2A 1J6YA 2LPVA 2JX8A 2M08A 2AOSA 3O5FA 1J4IA 1B6CA 2XP8A 3IKGA 4WJXA 5E65A 5HT1A 4A0TA 1JVWA 1GUVA 3O5RA 3IK8A 5JH8A 3MQHA 1NWRA 3WD2A 4TYOA 2IUZA 4Z2LA 2M8JA 2M3OW 2XP6A 4DWSB 2D9FA 1W1TA 2L2SA 3UF8A 1FKFA 3FSBA 1EG4A 4W5UA 4FAPA 4Z2HA 1RP5A 3MCBB 3RM9A 5DEZA 1FKJA 2PV3A 3AS3A 3RFWA 3NI6A 1K9RA 2RUQA 2ITKA 1QPLA 1VF8A 3FAPA 3MQGA 1HJXA 1HJVA 5E62A 4LAYA 1F8AB 1X6LA 1M5YA 1PINA 4DRNA 4BF8A 4KR0B 4DWSA 1H0IA 4HBEA 4MPKA 3WKZA 1FKGA 4DT4A 2PV2A 1BKFA 3VAWA 1FKLA 3MCBA 4ODLA 4TW6A 2KGJA 1RD6A 1LL7A 3CNGA 1W9VA 3KZ7A 4MGVA 4WKHA 5HW7A 1EQ3A 1ZBVA 2B31A 2PPOA 4R5EA 3TDBA 2JV4A 3WL1A 2YAJB 1TFVA 2F21A 4ZPTR 1J4HA 4AY1A 1EG3A 4LAWA 2ZR6A 2MPHA 1Q6IA 1HXVA 1KT0A 3O5PA 1TK7A 4GIVA 1ROUA 1WB0A 4J4NA 4DH0A 3KAIA 3UQBA 2MDIA 3FSCA 1ZU8A 3B8SA 2XP9A 2FKEA 4HARA 4U86A 2KO7A 4ODOA 4W9OA 2MF9A 3AS2A 1WAWA 3O5IA 1Q6UA 4DZ2A 4ML4A 3OA5A 4IQ2A 2DJYA 3ARXA 5DIVA 1FKKA 1T11A 4GLXA 2UZ5A 1JNEA 1OWQA 4JFJA 4TX0A 1W26A 2IF4A 4S3KA 4DRHA 1NWUA 3RM8A 2PPNA 5DO2A 4G50A 5DF0A 2ZR4A 1E15A 4DRPA 3M7NA 1ZL1A 5HW6A 3UI5A 3TCZA 3WIJA 3WD0A 2ZQUA 3O5KA 3I6CA 1W1PA 1E9LA 3LE4A 3CHCA 1PBKA 1KFWA 4P8VA 5HWBA 3CHDA 3PQHA 4IT4A 3ARPA 3H9RB 3CHEA 4WK9A 3WD3A 1D7HA 4IT6A 4A0UA 1NMVA 5BXJA 4TW8A 1LJYA 2PPPA 2DMVA 5E64A 4P8UA 3KAFA 2ZQVA 1LQ0A 4P8WA 5J6EA 1IX5A 3ODKA 3FXYA 4W9QA 4U84A 3PRDA 2DPEA 3AQUA 2WK2A 4JFMA 3CH9A 1EHNA 2RUCA 4MNJA 4MNLA 3UI6A 2JXWA 3QOKA 3OOBA 2JMFA 2G8ZA 3KCEA 2RSEA 3FS8A 4LGXA 3RMEA 2BA1A 2ESCA 4G2PA 4E5RA 2RURA 1ZBKA 1FKTA 4J4OA 4U85A 1OGBA 1D7JA 2OWOA 4ZPVR 1BL4A 2DG4A 2YBTA 1UR9A 2Y78A 2MLZA 3KAHA 1O6WA 4DZ3A 1JNDA 2VCDA 2YSFA 2XP7A 3O5OA 2PV1A 4IPXA 2G41A 1X6NA 2KXQA 1FKHA 1W1YA 4Q22A 2L4JA 4QIBA 3G6LA 3ARVA 5GPRA 1W1VA 1WNOA 3GPKA 2YBUA 3FY1A 4DRJA 3PRAA 1KT1A 1O6IA 2DWVA 3IKDA 3AROA 4DRKA 2KFWA 1NWSA 4NZCA 2DK7A 3AS0A 2LKNA 1LL4A 1P5QA 3WL0A 3CHFA 4TW7A 1LG1A 3M85A 3PA7A 3ALFA 4DROA 5I98A 2F2DA 4MSPA 2RQSA 2LGOA 2WLZA 2M1IA 2MLYA 1E6NA 2YSHA 1ZCNA 4ODPA 1ITXA 5HTGA 4ITZA 1E6ZA 4ODRA 4FN2A 5AHTA 5HUAA 2PBCA 1JMQA 1LL6A 2FAPA 1GPFA 3LUOA 4JYSA 1ROTA 2YSBA 2XP5A 1YW5A 1A7XA 3O5MA 2WAEA 2O92A 1EIBA 4JFIA 2WM0A 2Q5AA 1NSGA 1WMVA 4TNSA 4ODKA 1FKDA 2DG9A 2DT2A 4C02B 4URIA 3ARYA 5HBFA 1U79A 1E6PA 2DT1A 2MLXA 2WLYA 4WIWA 5B8IC 3O5JA 5GPGA 4L72B 3ARQA 3L4HA 1Q6HA 2KR7A 4ZS6A 3WH0A 3RM4A 4JFKA 1D6OA 1UR8A 2XP3A 2JZVA 4LAXA 5HWCA 3ARUA 4W9PA 2OLHA 2VN1A 1FFRA 2Y8NB 2OFNA 5GQBA 4Q7NA 1OGGA 1F40A 2M8IA 3B9DA 3ARZA 1D2KA 2QF8A 4MNKA 1HKJA 3G6MA 4P8XA 2ZAJA 4XAKA 1CTNA 1EYMA 3ARWA 3KAGA 1FKSA 2DT0A 2FDMA 2K8IA 2DG3A 3IHZA 2LAJA 2DK1A 1XRVA 1ZK6A 2YSGA 1GOIA 1EDQA 3CGNA 4MNMA 4ODMA 3O5GA 2ZQTA 4QZVB 4GGQA 1Y0OA 1ZBWA 3ALGA 1WR7A 4DWSD 1NWTA 3CZ8A 2DSWA 3MDYB 1ZBCA 1W9UA 1HKKA 2AWGA 2KI3A 3TC5A 1JNTA 2RE3A 1R9HA 2YSIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JVW A;  5I98 A;  2F2D A;  1QZ2 A;  4MSP A;  4DRP A;  2RQS A;  4NNR A;  2LGO A;  3M7N A;  3O5E A;  5HW6 A;  3O5R A;  3IK8 A;  2M1I A;  3NTP A;  3TCZ A;  1D7I A;  2MNT A;  3UI5 A;  2ZQU A;  3O5K A;  3I6C A;  4TYO A;  2MLY A;  2M8J A;  3LE4 A;  5DIT A;  2M3O W;  2XP6 A;  3JYM A;  2D9F A;  2L2S A;  3UF8 A;  2YSH A;  1ZCN A;  1FKF A;  1EG4 A;  4DIP A;  4FAP A;  1PBK A;  4ODP A;  1FKR A;  5CQ2 A;  5BXJ A;  5HWB A;  5HTG A;  4ITZ A;  4N19 A;  4ODR A;  4FN2 A;  5HWC A;  1K9Q A;  3H9R B;  3B7X A;  5AHT A;  5HUA A;  1FKJ A;  1C9H A;  2PBC A;  2PV3 A;  4QT3 A;  3RFW A;  1JMQ A;  5HW8 A;  1I5H W;  1FD9 A;  2ZR5 A;  1K9R A;  1D7H A;  1QPF A;  3CGM A;  2RUQ A;  3NI6 A;  1NMV A;  4IQC A;  5D75 A;  5HT1 A;  2ITK A;  4R0X A;  2FAP A;  4TW8 A;  3LUO A;  1QPL A;  2PPP A;  2DMV A;  2YSB A;  2E45 A;  2XP5 A;  1YW5 A;  1A7X A;  1ROT A;  3FAP A;  5HKG A;  3KAF A;  2ZQV A;  3O5M A;  4LAV A;  5J6E A;  3ODK A;  1NMW A;  4JFI A;  4W9Q A;  4U84 A;  2Q5A A;  3PRD A;  4LAY A;  1NSG A;  3UI4 A;  4DRM A;  1WMV A;  1F8A B;  4ODK A;  1FKD A;  2LJ4 A;  4TNS A;  2DG9 A;  3JXV A;  4C02 B;  1M5Y A;  4JFM A;  1U79 A;  5B8I C;  1PIN A;  2MLX A;  2RUC A;  4DRN A;  1TCO C;  4JFL A;  3EY6 A;  3O5J A;  4ODN A;  4BF8 A;  1FAP A;  5GPG A;  3NRK A;  2JXW A;  3UI6 A;  3OOB A;  3L4H A;  2JMF A;  2EZ5 W;  1Q6H A;  3O5D A;  1FKG A;  2KR7 A;  4DT4 A;  3WH0 A;  3KCE A;  3UQA A;  2PV2 A;  2RSE A;  1BKF A;  4JFK A;  1FKL A;  2YSI A;  3VAW A;  4ODL A;  3PRB A;  2KGJ A;  4TW6 A;  2BA1 A;  1D6O A;  4O2T A;  2XP3 A;  2JZV A;  4G2P A;  4LAX A;  4E5R A;  2F4E A;  3CNG A;  4MGV A;  3KZ7 A;  4W9P A;  2RUR A;  3RGC A;  5HW7 A;  3UQB A;  2PPO A;  1EQ3 A;  1FKT A;  1FJD A;  1YAT A;  2VN1 A;  2OFN A;  3TDB A;  2JV4 A;  3O5L A;  4J4O A;  2KE0 A;  4U85 A;  1D7J A;  4DRQ A;  2XP4 A;  1BL4 A;  2F21 A;  1JNS A;  2DG4 A;  3KAD A;  1F40 A;  1J4H A;  2ZQS A;  2Y78 A;  2MLZ A;  2M8I A;  1EG3 A;  4LAW A;  2ZR6 A;  3KAH A;  3KAC A;  3O5Q A;  2MPH A;  1Q6I A;  1HXV A;  1KT0 A;  2M2A A;  3O5P A;  1N1A A;  5DIU A;  1O6W A;  3UQI A;  3KAB A;  1TK7 A;  3JYJ A;  4DZ3 A;  1FKI A;  1ROU A;  4GIV A;  4J4N A;  4DH0 A;  2VCD A;  2ZAJ A;  2YSF A;  4REX A;  2XP7 A;  3KAI A;  3KAG A;  1EYM A;  1FKS A;  2PV1 A;  3O5O A;  4IPX A;  2XPA A;  2K8I A;  2DG3 A;  2MDI A;  3IHZ A;  1Q1C A;  2LAJ A;  2DK1 A;  2KXQ A;  2XP9 A;  2FKE A;  1FKH A;  1ZK6 A;  4U86 A;  2KO7 A;  1FKB A;  4ODO A;  2YSG A;  2RUD A;  3CGN A;  1J4R A;  2L4J A;  2MF9 A;  4W9O A;  4QIB A;  4ODM A;  3O5G A;  4JYS A;  2ZQT A;  3O5I A;  1Q6U A;  2N87 A;  4DZ2 A;  4GGQ A;  4DRI A;  1Y0O A;  3GPK A;  4IQ2 A;  2DJY A;  1L1P A;  5DIV A;  1FKK A;  4ODQ A;  1WR7 A;  1T11 A;  4DRJ A;  2UZ5 A;  2XPB A;  1KT1 A;  4JFJ A;  4QT2 A;  1W26 A;  4TX0 A;  1J6Y A;  2LPV A;  2IF4 A;  2DWV A;  2JX8 A;  2M08 A;  3IKD A;  3MDY B;  4DRK A;  3O5F A;  4DRH A;  1J4I A;  2KFW A;  2DK7 A;  2AWG A;  2KI3 A;  3TC5 A;  1JNT A;  2LKN A;  1B6C A;  1P5Q A;  2XP8 A;  2PPN A;  3IKG A;  2RE3 A;  4TW7 A;  3M85 A;  3PA7 A;  4G50 A;  4DRO A;  1R9H A;  2ZR4 A; 
#chains in the Genus database with same CATH topology
 3WQW A;  1QZ2 A;  5E66 A;  4NNR A;  3O5E A;  1XHG A;  4WKA A;  3NTP A;  1D7I A;  2MNT A;  4Z2G A;  1HKM A;  5DIT A;  1JCH B;  3JYM A;  3LKX B;  2DSV A;  4WKF A;  3GU0 A;  4DIP A;  1FKR A;  3WD1 A;  5CQ2 A;  4ZPW R;  2QRV A;  4N19 A;  2A3E A;  2A3B A;  1K9Q A;  4MTV A;  3B7X A;  4Z2I A;  2PI6 A;  4Z2K A;  1C9H A;  4QT3 A;  5HW8 A;  1I5H W;  1FD9 A;  2ZR5 A;  1QPF A;  4IQC A;  3CGM A;  5D75 A;  1W9P A;  4R0X A;  1FFQ A;  3BXW A;  2E45 A;  4KQZ A;  5HKG A;  4DWS C;  4LAV A;  1NMW A;  3B9A A;  4L3N A;  2O9O A;  3WD4 A;  3UI4 A;  1SR0 A;  4DRM A;  2LJ4 A;  1FLC A;  3JXV A;  3ARR A;  3EIP A;  1E6R A;  1TCO C;  4JFL A;  3EY6 A;  4ODN A;  3WQV A;  1FAP A;  3NRK A;  1SYT A;  3LKX A;  3B9E A;  2EZ5 W;  3O5D A;  3UQA A;  4PTM A;  3BMB A;  2F23 A;  3PRB A;  4O2T A;  2DSU A;  2WAD A;  2F4E A;  3RGC A;  1FJD A;  1YAT A;  3O5L A;  5U47 A;  2KE0 A;  1TR8 A;  4MAV A;  4DRQ A;  2XP4 A;  1JNS A;  3KAD A;  3AS1 A;  4S3J A;  2ZQS A;  3W4R A;  2DT3 A;  3KAC A;  3O5Q A;  2DSZ A;  2M2A A;  1N1A A;  1H0G A;  5DIU A;  3UQI A;  3KAB A;  3JYJ A;  1FKI A;  1NH6 A;  1LG2 A;  3ART A;  2A3A A;  4REX A;  2XPA A;  1Q1C A;  1K9T A;  1FKB A;  2RUD A;  1J4R A;  3PR9 A;  4HBO A;  1HKI A;  4NSB A;  2EUL A;  2N87 A;  1HJW A;  4DRI A;  3ARS A;  1ZB5 A;  5E5W A;  1L1P A;  4ODQ A;  4Z2J A;  2XPB A;  2A3C A;  4QT2 A;  1J6Y A;  2LPV A;  2JX8 A;  2M08 A;  2AOS A;  3O5F A;  1J4I A;  1B6C A;  2XP8 A;  3IKG A;  4WJX A;  5E65 A;  5HT1 A;  4A0T A;  2B5U B;  1JVW A;  1GUV A;  3O5R A;  3IK8 A;  5JH8 A;  3MQH A;  1NWR A;  3WD2 A;  4TYO A;  2IUZ A;  4Z2L A;  2M8J A;  2M3O W;  2XP6 A;  4DWS B;  2D9F A;  1W1T A;  2L2S A;  3UF8 A;  1FKF A;  3FSB A;  1EG4 A;  2P4V A;  4W5U A;  4FAP A;  4Z2H A;  1RP5 A;  3MCB B;  3RM9 A;  5DEZ A;  1FKJ A;  2PV3 A;  3AS3 A;  3RFW A;  3NI6 A;  1K9R A;  2RUQ A;  2ITK A;  1QPL A;  1VF8 A;  3FAP A;  3MQG A;  1HJX A;  1HJV A;  5E62 A;  4LAY A;  1F8A B;  1X6L A;  1M5Y A;  1PIN A;  4DRN A;  4BF8 A;  4KR0 B;  4DWS A;  1H0I A;  4HBE A;  4MPK A;  3WKZ A;  1FKG A;  4DT4 A;  2PV2 A;  1BKF A;  3VAW A;  1FKL A;  3MCB A;  4ODL A;  4TW6 A;  2KGJ A;  1RD6 A;  1LL7 A;  3CNG A;  1W9V A;  3KZ7 A;  4MGV A;  4WKH A;  5HW7 A;  1EQ3 A;  1ZBV A;  2B31 A;  2PPO A;  4R5E A;  3TDB A;  2JV4 A;  3WL1 A;  2YAJ B;  1TFV A;  2F21 A;  4ZPT R;  1J4H A;  4AY1 A;  1EG3 A;  4LAW A;  2ZR6 A;  2MPH A;  1Q6I A;  1HXV A;  1KT0 A;  3O5P A;  1TK7 A;  4GIV A;  1ROU A;  1WB0 A;  4J4N A;  4DH0 A;  3KAI A;  3UQB A;  2MDI A;  3FSC A;  1ZU8 A;  3B8S A;  2XP9 A;  2FKE A;  4HAR A;  4U86 A;  2KO7 A;  4ODO A;  4W9O A;  2MF9 A;  3AS2 A;  1WAW A;  3O5I A;  1Q6U A;  4DZ2 A;  4ML4 A;  3OA5 A;  4IQ2 A;  2DJY A;  3ARX A;  5DIV A;  1FKK A;  1T11 A;  4GLX A;  2UZ5 A;  1JNE A;  1OWQ A;  4JFJ A;  4TX0 A;  1W26 A;  2IF4 A;  4S3K A;  4DRH A;  1NWU A;  3RM8 A;  2PPN A;  5DO2 A;  4G50 A;  5DF0 A;  2ZR4 A;  1E15 A;  4DRP A;  3M7N A;  1ZL1 A;  5HW6 A;  3UI5 A;  3TCZ A;  3WIJ A;  3WD0 A;  2ZQU A;  3O5K A;  3I6C A;  1W1P A;  1E9L A;  3LE4 A;  3CHC A;  1PBK A;  1KFW A;  4P8V A;  5HWB A;  3CHD A;  3PQH A;  4IT4 A;  3ARP A;  3H9R B;  3CHE A;  4WK9 A;  3WD3 A;  1D7H A;  4IT6 A;  4A0U A;  1NMV A;  5BXJ A;  4TW8 A;  1E44 A;  1LJY A;  2PPP A;  2DMV A;  5E64 A;  4P8U A;  3KAF A;  2ZQV A;  1LQ0 A;  4P8W A;  5J6E A;  1IX5 A;  3ODK A;  3FXY A;  4W9Q A;  4U84 A;  3PRD A;  2DPE A;  3AQU A;  2WK2 A;  4JFM A;  3CH9 A;  1EHN A;  2RUC A;  4MNJ A;  4MNL A;  3UI6 A;  2JXW A;  3QOK A;  3OOB A;  2JMF A;  2G8Z A;  3KCE A;  2RSE A;  3FS8 A;  4LGX A;  3RME A;  2BA1 A;  2ESC A;  4G2P A;  4E5R A;  2RUR A;  1ZBK A;  1FKT A;  4J4O A;  4U85 A;  1OGB A;  1D7J A;  2OWO A;  4ZPV R;  1BL4 A;  2DG4 A;  2YBT A;  1UR9 A;  2Y78 A;  2MLZ A;  3KAH A;  1O6W A;  4DZ3 A;  1JND A;  2VCD A;  2YSF A;  2XP7 A;  3O5O A;  2PV1 A;  4IPX A;  2G41 A;  1X6N A;  2KXQ A;  1FKH A;  1W1Y A;  4Q22 A;  2L4J A;  4QIB A;  3G6L A;  3ARV A;  5GPR A;  1W1V A;  1WNO A;  3GPK A;  2YBU A;  3FY1 A;  4DRJ A;  3PRA A;  1KT1 A;  1O6I A;  2DWV A;  3IKD A;  3ARO A;  4DRK A;  2KFW A;  1NWS A;  4NZC A;  2DK7 A;  3AS0 A;  2LKN A;  1LL4 A;  1P5Q A;  3WL0 A;  3CHF A;  4TW7 A;  1LG1 A;  3M85 A;  3PA7 A;  3ALF A;  4DRO A;  5I98 A;  2F2D A;  4MSP A;  2RQS A;  2LGO A;  2WLZ A;  2M1I A;  2ETN A;  2MLY A;  1E6N A;  2YSH A;  4UDM A;  1ZCN A;  4ODP A;  1ITX A;  5HTG A;  4ITZ A;  1E6Z A;  4ODR A;  4FN2 A;  5AHT A;  5HUA A;  2PBC A;  1JMQ A;  1LL6 A;  2FAP A;  1GPF A;  3LUO A;  4JYS A;  1ROT A;  2YSB A;  2XP5 A;  1YW5 A;  1A7X A;  2PN0 A;  3O5M A;  2WAE A;  2O92 A;  1EIB A;  4JFI A;  2WM0 A;  2Q5A A;  1NSG A;  1GRJ A;  1WMV A;  4TNS A;  4ODK A;  1FKD A;  2DG9 A;  2DT2 A;  4C02 B;  4URI A;  3ARY A;  5HBF A;  1U79 A;  1E6P A;  2DT1 A;  2MLX A;  2WLY A;  4WIW A;  5B8I C;  3O5J A;  5GPG A;  4L72 B;  3ARQ A;  3L4H A;  1Q6H A;  2KR7 A;  4ZS6 A;  3WH0 A;  3RM4 A;  4JFK A;  1D6O A;  1UR8 A;  2XP3 A;  2JZV A;  4LAX A;  5HWC A;  3ARU A;  4W9P A;  2OLH A;  2VN1 A;  1FFR A;  2Y8N B;  2OFN A;  5GQB A;  4Q7N A;  3GTY X;  1OGG A;  1F40 A;  2M8I A;  3B9D A;  3ARZ A;  1D2K A;  2QF8 A;  4MNK A;  1HKJ A;  3G6M A;  4P8X A;  2ZAJ A;  4XAK A;  1CTN A;  1EYM A;  3ARW A;  3KAG A;  1FKS A;  2DT0 A;  2FDM A;  2K8I A;  2DG3 A;  3IHZ A;  2LAJ A;  2DK1 A;  1XRV A;  1ZK6 A;  2YSG A;  1GOI A;  1EDQ A;  3CGN A;  4MNM A;  4ODM A;  3O5G A;  2ZQT A;  4QZV B;  4GGQ A;  1Y0O A;  1ZBW A;  3ALG A;  1WR7 A;  4DWS D;  1NWT A;  3CZ8 A;  2DSW A;  3MDY B;  1ZBC A;  1W9U A;  1HKK A;  2AWG A;  2KI3 A;  3TC5 A;  1JNT A;  2RE3 A;  1R9H A;  2YSI A; 
#chains in the Genus database with same CATH homology
 3WQW A;  1QZ2 A;  5E66 A;  4NNR A;  3O5E A;  1XHG A;  4WKA A;  3NTP A;  1D7I A;  2MNT A;  4Z2G A;  1HKM A;  5DIT A;  3JYM A;  3LKX B;  2DSV A;  4WKF A;  4DIP A;  1FKR A;  3WD1 A;  5CQ2 A;  4ZPW R;  2QRV A;  4N19 A;  2A3E A;  2A3B A;  1K9Q A;  4MTV A;  3B7X A;  4Z2I A;  2PI6 A;  4Z2K A;  1C9H A;  4QT3 A;  5HW8 A;  1I5H W;  1FD9 A;  2ZR5 A;  1QPF A;  4IQC A;  3CGM A;  5D75 A;  1W9P A;  4R0X A;  1FFQ A;  3BXW A;  2E45 A;  4KQZ A;  5HKG A;  4DWS C;  4LAV A;  1NMW A;  3B9A A;  4L3N A;  2O9O A;  3WD4 A;  3UI4 A;  1SR0 A;  4DRM A;  2LJ4 A;  1FLC A;  3JXV A;  3ARR A;  1E6R A;  1TCO C;  4JFL A;  3EY6 A;  4ODN A;  3WQV A;  1FAP A;  3NRK A;  1SYT A;  3LKX A;  3B9E A;  2EZ5 W;  3O5D A;  3UQA A;  4PTM A;  3PRB A;  4O2T A;  2DSU A;  2WAD A;  2F4E A;  3RGC A;  1FJD A;  1YAT A;  3O5L A;  5U47 A;  2KE0 A;  1TR8 A;  4MAV A;  4DRQ A;  2XP4 A;  1JNS A;  3KAD A;  3AS1 A;  4S3J A;  2ZQS A;  3W4R A;  2DT3 A;  3KAC A;  3O5Q A;  2DSZ A;  2M2A A;  1N1A A;  1H0G A;  5DIU A;  3UQI A;  3KAB A;  3JYJ A;  1FKI A;  1NH6 A;  1LG2 A;  3ART A;  2A3A A;  4REX A;  2XPA A;  1Q1C A;  1K9T A;  1FKB A;  2RUD A;  1J4R A;  3PR9 A;  4HBO A;  1HKI A;  4NSB A;  2N87 A;  1HJW A;  4DRI A;  3ARS A;  1ZB5 A;  5E5W A;  1L1P A;  4ODQ A;  4Z2J A;  2XPB A;  2A3C A;  4QT2 A;  1J6Y A;  2LPV A;  2JX8 A;  2M08 A;  2AOS A;  3O5F A;  1J4I A;  1B6C A;  2XP8 A;  3IKG A;  4WJX A;  5E65 A;  5HT1 A;  4A0T A;  1JVW A;  1GUV A;  3O5R A;  3IK8 A;  5JH8 A;  3MQH A;  1NWR A;  3WD2 A;  4TYO A;  2IUZ A;  4Z2L A;  2M8J A;  2M3O W;  2XP6 A;  4DWS B;  2D9F A;  1W1T A;  2L2S A;  3UF8 A;  1FKF A;  3FSB A;  1EG4 A;  4W5U A;  4FAP A;  4Z2H A;  1RP5 A;  3MCB B;  3RM9 A;  5DEZ A;  1FKJ A;  2PV3 A;  3AS3 A;  3RFW A;  3NI6 A;  1K9R A;  2RUQ A;  2ITK A;  1QPL A;  1VF8 A;  3FAP A;  3MQG A;  1HJX A;  1HJV A;  5E62 A;  4LAY A;  1F8A B;  1X6L A;  1M5Y A;  1PIN A;  4DRN A;  4BF8 A;  4KR0 B;  4DWS A;  1H0I A;  4HBE A;  4MPK A;  3WKZ A;  1FKG A;  4DT4 A;  2PV2 A;  1BKF A;  3VAW A;  1FKL A;  3MCB A;  4ODL A;  4TW6 A;  2KGJ A;  1RD6 A;  1LL7 A;  3CNG A;  1W9V A;  3KZ7 A;  4MGV A;  4WKH A;  5HW7 A;  1EQ3 A;  1ZBV A;  2B31 A;  2PPO A;  4R5E A;  3TDB A;  2JV4 A;  3WL1 A;  2YAJ B;  1TFV A;  2F21 A;  4ZPT R;  1J4H A;  4AY1 A;  1EG3 A;  4LAW A;  2ZR6 A;  2MPH A;  1Q6I A;  1HXV A;  1KT0 A;  3O5P A;  1TK7 A;  4GIV A;  1ROU A;  1WB0 A;  4J4N A;  4DH0 A;  3KAI A;  3UQB A;  2MDI A;  3FSC A;  1ZU8 A;  3B8S A;  2XP9 A;  2FKE A;  4HAR A;  4U86 A;  2KO7 A;  4ODO A;  4W9O A;  2MF9 A;  3AS2 A;  1WAW A;  3O5I A;  1Q6U A;  4DZ2 A;  4ML4 A;  3OA5 A;  4IQ2 A;  2DJY A;  3ARX A;  5DIV A;  1FKK A;  1T11 A;  4GLX A;  2UZ5 A;  1JNE A;  1OWQ A;  4JFJ A;  4TX0 A;  1W26 A;  2IF4 A;  4S3K A;  4DRH A;  1NWU A;  3RM8 A;  2PPN A;  5DO2 A;  4G50 A;  5DF0 A;  2ZR4 A;  1E15 A;  4DRP A;  3M7N A;  1ZL1 A;  5HW6 A;  3UI5 A;  3TCZ A;  3WIJ A;  3WD0 A;  2ZQU A;  3O5K A;  3I6C A;  1W1P A;  1E9L A;  3LE4 A;  3CHC A;  1PBK A;  1KFW A;  4P8V A;  5HWB A;  3CHD A;  3PQH A;  4IT4 A;  3ARP A;  3H9R B;  3CHE A;  4WK9 A;  3WD3 A;  1D7H A;  4IT6 A;  4A0U A;  1NMV A;  5BXJ A;  4TW8 A;  1LJY A;  2PPP A;  2DMV A;  5E64 A;  4P8U A;  3KAF A;  2ZQV A;  1LQ0 A;  4P8W A;  5J6E A;  1IX5 A;  3ODK A;  3FXY A;  4W9Q A;  4U84 A;  3PRD A;  2DPE A;  3AQU A;  2WK2 A;  4JFM A;  3CH9 A;  1EHN A;  2RUC A;  4MNJ A;  4MNL A;  3UI6 A;  2JXW A;  3QOK A;  3OOB A;  2JMF A;  2G8Z A;  3KCE A;  2RSE A;  3FS8 A;  4LGX A;  3RME A;  2BA1 A;  2ESC A;  4G2P A;  4E5R A;  2RUR A;  1ZBK A;  1FKT A;  4J4O A;  4U85 A;  1OGB A;  1D7J A;  2OWO A;  4ZPV R;  1BL4 A;  2DG4 A;  2YBT A;  1UR9 A;  2Y78 A;  2MLZ A;  3KAH A;  1O6W A;  4DZ3 A;  1JND A;  2VCD A;  2YSF A;  2XP7 A;  3O5O A;  2PV1 A;  4IPX A;  2G41 A;  1X6N A;  2KXQ A;  1FKH A;  1W1Y A;  4Q22 A;  2L4J A;  4QIB A;  3G6L A;  3ARV A;  5GPR A;  1W1V A;  1WNO A;  3GPK A;  2YBU A;  3FY1 A;  4DRJ A;  3PRA A;  1KT1 A;  1O6I A;  2DWV A;  3IKD A;  3ARO A;  4DRK A;  2KFW A;  1NWS A;  4NZC A;  2DK7 A;  3AS0 A;  2LKN A;  1LL4 A;  1P5Q A;  3WL0 A;  3CHF A;  4TW7 A;  1LG1 A;  3M85 A;  3PA7 A;  3ALF A;  4DRO A;  5I98 A;  2F2D A;  4MSP A;  2RQS A;  2LGO A;  2WLZ A;  2M1I A;  2MLY A;  1E6N A;  2YSH A;  1ZCN A;  4ODP A;  1ITX A;  5HTG A;  4ITZ A;  1E6Z A;  4ODR A;  4FN2 A;  5AHT A;  5HUA A;  2PBC A;  1JMQ A;  1LL6 A;  2FAP A;  1GPF A;  3LUO A;  4JYS A;  1ROT A;  2YSB A;  2XP5 A;  1YW5 A;  1A7X A;  3O5M A;  2WAE A;  2O92 A;  1EIB A;  4JFI A;  2WM0 A;  2Q5A A;  1NSG A;  1WMV A;  4TNS A;  4ODK A;  1FKD A;  2DG9 A;  2DT2 A;  4C02 B;  4URI A;  3ARY A;  5HBF A;  1U79 A;  1E6P A;  2DT1 A;  2MLX A;  2WLY A;  4WIW A;  5B8I C;  3O5J A;  5GPG A;  4L72 B;  3ARQ A;  3L4H A;  1Q6H A;  2KR7 A;  4ZS6 A;  3WH0 A;  3RM4 A;  4JFK A;  1D6O A;  1UR8 A;  2XP3 A;  2JZV A;  4LAX A;  5HWC A;  3ARU A;  4W9P A;  2OLH A;  2VN1 A;  1FFR A;  2Y8N B;  2OFN A;  5GQB A;  4Q7N A;  1OGG A;  1F40 A;  2M8I A;  3B9D A;  3ARZ A;  1D2K A;  2QF8 A;  4MNK A;  1HKJ A;  3G6M A;  4P8X A;  2ZAJ A;  4XAK A;  1CTN A;  1EYM A;  3ARW A;  3KAG A;  1FKS A;  2DT0 A;  2FDM A;  2K8I A;  2DG3 A;  3IHZ A;  2LAJ A;  2DK1 A;  1XRV A;  1ZK6 A;  2YSG A;  1GOI A;  1EDQ A;  3CGN A;  4MNM A;  4ODM A;  3O5G A;  2ZQT A;  4QZV B;  4GGQ A;  1Y0O A;  1ZBW A;  3ALG A;  1WR7 A;  4DWS D;  1NWT A;  3CZ8 A;  2DSW A;  3MDY B;  1ZBC A;  1W9U A;  1HKK A;  2AWG A;  2KI3 A;  3TC5 A;  1JNT A;  2RE3 A;  1R9H A;  2YSI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...