2XP5A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 42
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp5A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp5A02
3O5JA 1BL4A 4DZ2A 4MGVA 1Y0OA 2LAJA 3IK8A 2LJ4A 4LAXA 2FAPA 1FKLA 1QZ2A 1FAPA 2ZR4A 2F2DA 4ODMA 3ODKA 1NSGA 4IQCA 3KZ7A 4JFJA 4FAPA 4JFLA 1EQ3A 3KACA 1F8AB 3FAPA 1F40A 3OOBA 3O5LA 4DRHA 4JYSA 1W26A 1Q6HA 4U84A 4FN2A 4DZ3A 1ROTA 2D9FA 3O5KA 4DT4A 2LPVA 1J6YA 3KAIA 2RE3A 1NMVA 2PV1A 1QPFA 1O6WA 1ZCNA 5DIVA 3KABA 3B7XA 3PRBA 3TDBA 1L1PA 2XPAA 1A7XA 2YSFA 2ZR5A 3RFWA 1K9RA 1TK7A 4O2TA 3IHZA 2PPPA 3TCZA 5HW8A 3UI6A 4JFIA 3UQIA 2XP3A 4QIBA 4DIPA 2DK1A 4JFKA 2YSIA 1BKFA 3KAGA 1ROUA 2KXQA 4TYOA 5HW7A 4LAVA 4DRMA 2JXWA 2PPOA 3NTPA 3JYMA 2F21A 3LE4A 4BF8A 3CGNA 3H9RB 2RQSA 2JMFA 4NNRA 5HKGA 4LAWA 2K8IA 3IKDA 2VCDA 2IF4A 1D7IA 3O5MA 4W9PA 2DK7A 2PPNA 1C9HA 2XP6A 4TX0A 5DITA 4DROA 3UF8A 2L2SA 4ODLA 3PA7A 5HWBA 2Y78A 2XP9A 4W9OA 3LUOA 2RUQA 4LAYA 2JV4A 2L4JA 4ODPA 1FKDA 1FKTA 4ODNA 2MLYA 2XP7A 2YSHA 2MF9A 1Q1CA 4TNSA 2ZQTA 2N87A 2PV3A 2ZQSA 4C02B 1J4RA 4IPXA 1J4HA 4ODKA 1D7JA 5AHTA 2RUCA 3UQAA 2RSEA 1R9HA 2M8JA 2ZAJA 3EY6A 4U86A 5HW6A 1M5YA 2XPBA 1TCOC 3O5QA 3KCEA 4E5RA 3JXVA 1FKJA 4ODQA 1JMQA 4N19A 2LGOA 2KE0A 3KAHA 3KADA 4QT3A 2DWVA 4DRQA 2MPHA 1K9QA 3GPKA 1ZK6A 5BXJA 1HXVA 3MDYB 3M85A 4REXA 3O5PA 1Q6UA 1JNTA 2EZ5W 1EG4A 3CNGA 1NMWA 5HUAA 1PBKA 2KI3A 1KT1A 1KT0A 3VAWA 2ZR6A 4ODOA 5CQ2A 2XP4A 1EG3A 3UI4A 1I5HW 2DG4A 1J4IA 4U85A 5D75A 4G50A 2RUDA 2E45A 5I98A 1YW5A 2DMVA 2DJYA 2DG3A 2FKEA 2JZVA 1FJDA 1FD9A 4MSPA 1FKFA 5J6EA 2ZQUA 1JNSA 3RGCA 4QT2A 1D6OA 5B8IC 3O5FA 2UZ5A 1Q6IA 2VN1A 2M8IA 3O5OA 1YATA 3WH0A 4J4NA 2MNTA 3UI5A 1T11A 1FKKA 4GIVA 2PV2A 2KFWA 1QPLA 5HTGA 4DRPA 4DRJA 4GGQA 2YSBA 4ITZA 1FKIA 2OFNA 3O5RA 2LKNA 3L4HA 4G2PA 2ZQVA 2MDIA 1P5QA 1D7HA 1FKRA 3I6CA 3IKGA 3M7NA 4JFMA 5DIUA 2BA1A 2Q5AA 3PRDA 2ITKA 2MLZA 1WR7A 5GPGA 2JX8A 4TW7A 2M08A 1FKBA 4IQ2A 4DRNA 2M3OW 3O5EA 3NI6A 5HT1A 4J4OA 1B6CA 4DRIA 2KO7A 3O5DA 3CGMA 1EYMA 2KR7A 4TW6A 4DRKA 3KAFA 3TC5A 2M1IA 2RURA 4ODRA 4DH0A 3O5GA 1PINA 2F4EA 3O5IA 2M2AA 1FKSA 2XP5A 3JYJA 1FKHA 4W9QA 3UQBA 1U79A 1N1AA 1JVWA 3NRKA 2XP8A 2DG9A 2PBCA 5HWCA 2KGJA 1FKGA 4TW8A 2YSGA 2AWGA 1WMVA 4R0XA 2MLXA
chains in the Genus database with same CATH superfamily
3LKXB 4MPKA 3FS8A 3O5JA 4Z2GA 1W9PA 1BL4A 5E65A 5DO2A 4DZ2A 4L72B 1EIBA 4PTMA 4MGVA 1Y0OA 1ZBCA 2WLZA 2LAJA 3IK8A 2LJ4A 4LAXA 2FAPA 1E15A 1W9UA 1FKLA 3RM4A 3ARYA 1FLCA 1QZ2A 1X6LA 4W5UA 1FAPA 4R5EA 2ZR4A 2F2DA 3ARSA 3CHDA 4ODMA 2ESCA 3ODKA 1NSGA 3ARWA 4IQCA 3KZ7A 4JFJA 1E6ZA 4FAPA 4JFLA 1EQ3A 3KACA 1F8AB 3FAPA 3AS3A 4L3NA 1F40A 3OOBA 3WD4A 4S3KA 1OWQA 3B9DA 5U47A 3O5LA 1IX5A 4DRHA 4JYSA 4ML4A 1UR8A 1W26A 2P4VA 1Q6HA 2QF8A 4U84A 1GUVA 4FN2A 2G41A 2FDMA 4DZ3A 2O9OA 1ROTA 2D9FA 3O5KA 4DT4A 2AOSA 2WLYA 1HJXA 2LPVA 1TFVA 4Z2LA 1J6YA 3KAIA 4XAKA 2RE3A 4IT6A 1NMVA 2PV1A 1QPFA 1O6WA 3RM8A 4HBEA 1ZCNA 5DIVA 2B5UB 4A0TA 1SYTA 3KABA 3B7XA 3PRBA 1H0GA 3ARRA 3TDBA 1L1PA 2XPAA 1A7XA 2YSFA 2ZR5A 4P8VA 1LG1A 3RFWA 1K9RA 1TK7A 4O2TA 3IHZA 2PPPA 3WD1A 3MCBA 1NH6A 3WKZA 3TCZA 2DT2A 5HW8A 3UI6A 4JFIA 3UQIA 2XP3A 3MCBB 4QIBA 4DIPA 2DK1A 4UDMA 1HKIA 4DWSD 4JFKA 2YSIA 1BKFA 1ITXA 3KAGA 5DEZA 1ROUA 2KXQA 3G6LA 4TYOA 5HW7A 4LAVA 1ZB5A 4WKAA 4WK9A 1ZL1A 4DRMA 3MQGA 2JXWA 3QOKA 2PPOA 4S3JA 3NTPA 3CHFA 3B8SA 3JYMA 2F21A 4MTVA 3RMEA 3LE4A 1WAWA 4BF8A 1JNEA 5E5WA 3CGNA 3H9RB 4KR0B 2RQSA 2JMFA 4ZS6A 4NNRA 5HKGA 4LAWA 2K8IA 3IKDA 2VCDA 2IF4A 1D7IA 3O5MA 4W9PA 2DK7A 2PPNA 3BXWA 1C9HA 2XP6A 4TX0A 1W1PA 1HKJA 5DITA 1GOIA 4IT4A 3OA5A 4DROA 1NWUA 5E66A 1ZBWA 3UF8A 2L2SA 3ALFA 4ODLA 3WL1A 3PA7A 4ZPVR 5HWBA 1X6NA 2Y78A 2XP9A 4W9OA 2IUZA 3LUOA 2RUQA 1XHGA 4LAYA 1ZBKA 2JV4A 2L4JA 1FKDA 1FKTA 4ODPA 2A3BA 1E6RA 4ODNA 5DF0A 2MLYA 2XP7A 3WD3A 2YSHA 2MF9A 1Q1CA 4TNSA 2ZQTA 1OGBA 3GU0A 2N87A 2PV3A 4GLXA 2ZQSA 4C02B 2OWOA 1J4RA 4IPXA 1EHNA 4AY1A 1J4HA 4DWSC 2DT1A 2Y8NB 1NWTA 4QZVB 4ODKA 1D7JA 5AHTA 4Z2HA 2RUCA 3UQAA 2RSEA 1CTNA 4MNMA 1R9HA 2M8JA 4WIWA 2A3CA 1W9VA 2ZAJA 3EY6A 4DWSA 4U86A 1RD6A 5HW6A 1ZBVA 1K9TA 1M5YA 1NWSA 2XPBA 1TCOC 3O5QA 3KCEA 4E5RA 3JXVA 1FKJA 4ODQA 1JMQA 5GQBA 3WD2A 4N19A 2LGOA 4KQZA 2KE0A 3KAHA 3KADA 4QT3A 2DWVA 2YBTA 4DRQA 2MPHA 3ARZA 4HARA 3ARQA 1K9QA 3GTYX 3GPKA 3ARTA 1ZK6A 1JNDA 3FY1A 5BXJA 1LG2A 2PI6A 4P8XA 3ALGA 1JCHB 3AS2A 3AROA 2PN0A 3AS1A 1HXVA 2A3AA 3ARUA 3MDYB 1E6NA 3M85A 3RM9A 4REXA 1LL6A 3O5PA 3FSCA 1JNTA 1Q6UA 1HKKA 2EZ5W 1VF8A 1EG4A 1FFRA 3CNGA 1NMWA 5HUAA 1PBKA 2KI3A 1KT1A 1KT0A 4Z2JA 2ETNA 1WNOA 3VAWA 2ZR6A 4ODOA 1E9LA 2G8ZA 5CQ2A 2WAEA 2XP4A 5JH8A 4Q22A 1EG3A 1I5HW 3UI4A 2DG4A 5HBFA 1H0IA 2EULA 1HJWA 1J4IA 4U85A 4ZPTR 5D75A 3BMBA 4G50A 2RUDA 2E45A 3PRAA 1NWRA 5I98A 3FSBA 1E44A 1YW5A 2DMVA 2DJYA 3CHEA 2DG3A 2FKEA 4MNKA 2JZVA 3B9AA 3AS0A 4WJXA 1FJDA 1FD9A 4MSPA 4MAVA 3WIJA 1FKFA 5J6EA 3MQHA 2ZQUA 1JNSA 1W1TA 1W1YA 3RGCA 4QT2A 1D6OA 5B8IC 3O5FA 2UZ5A 1Q6IA 2DSZA 2VN1A 4WKFA 2M8IA 4P8UA 4P8WA 4URIA 1KFWA 3O5OA 1YATA 3WH0A 4J4NA 3B9EA 2MNTA 3UI5A 1W1VA 1T11A 4HBOA 1FKKA 4MNLA 4GIVA 5GPRA 2DSUA 2PV2A 2KFWA 1QPLA 2DPEA 5HTGA 3CH9A 2WM0A 4DRPA 4DRJA 4GGQA 2YSBA 4ITZA 3PR9A 1FKIA 2OFNA 3O5RA 2LKNA 3L4HA 4G2PA 2ZQVA 2MDIA 4A0UA 1LL7A 2WK2A 1UR9A 1P5QA 1LL4A 2WADA 1D7HA 3G6MA 1FKRA 1OGGA 3I6CA 3IKGA 3M7NA 4JFMA 3CZ8A 4DWSB 1HKMA 5DIUA 2BA1A 2Q5AA 2F23A 3PRDA 2ITKA 4Q7NA 2MLZA 1WR7A 3W4RA 4NSBA 5GPGA 2JX8A 2OLHA 2M08A 4TW7A 1FKBA 4IQ2A 4LGXA 5E62A 2YAJB 2DT3A 4DRNA 1LJYA 2DT0A 2YBUA 2M3OW 3O5EA 3NI6A 4NZCA 5HT1A 4J4OA 1B6CA 4DRIA 2B31A 2DSWA 2O92A 2KO7A 3O5DA 1O6IA 2DSVA 3CGMA 1RP5A 3WD0A 1EYMA 3AQUA 3WQVA 2KR7A 5E64A 4TW6A 4DRKA 3KAFA 3TC5A 2M1IA 3ARVA 4WKHA 2RURA 3WQWA 4ODRA 4DH0A 1XRVA 1ZU8A 3O5GA 3ARXA 1PINA 1EDQA 3PQHA 2F4EA 3ARPA 3CHCA 3O5IA 1WB0A 1LQ0A 2A3EA 1GPFA 3EIPA 2M2AA 1FFQA 4Z2KA 2QRVA 1GRJA 1FKSA 2XP5A 3JYJA 1FKHA 4MNJA 4W9QA 3UQBA 1SR0A 1U79A 3WL0A 1N1AA 1HJVA 1JVWA 3NRKA 4ZPWR 4Z2IA 3FXYA 3LKXA 2XP8A 2DG9A 1TR8A 2PBCA 5HWCA 2KGJA 1FKGA 4TW8A 1D2KA 2YSGA 2AWGA 1E6PA 1WMVA 4R0XA 2MLXA
chains in the Genus database with same CATH topology
3LKXB 4MPKA 3FS8A 3O5JA 4Z2GA 1W9PA 1BL4A 5E65A 5DO2A 4DZ2A 4L72B 1EIBA 4PTMA 4MGVA 1Y0OA 1ZBCA 2WLZA 2LAJA 3IK8A 2LJ4A 4LAXA 2FAPA 1E15A 1W9UA 1FKLA 3RM4A 3ARYA 1FLCA 1QZ2A 1X6LA 4W5UA 1FAPA 4R5EA 2ZR4A 2F2DA 3ARSA 3CHDA 4ODMA 2ESCA 3ODKA 1NSGA 3ARWA 4IQCA 3KZ7A 4JFJA 1E6ZA 4FAPA 4JFLA 1EQ3A 3KACA 1F8AB 3FAPA 3AS3A 4L3NA 1F40A 3OOBA 3WD4A 4S3KA 1OWQA 3B9DA 5U47A 3O5LA 1IX5A 4DRHA 4JYSA 4ML4A 1UR8A 1W26A 1Q6HA 2QF8A 4U84A 1GUVA 4FN2A 2G41A 2FDMA 4DZ3A 2O9OA 1ROTA 2D9FA 3O5KA 4DT4A 2AOSA 2WLYA 1HJXA 2LPVA 1TFVA 4Z2LA 1J6YA 3KAIA 4XAKA 2RE3A 4IT6A 1NMVA 2PV1A 1QPFA 1O6WA 3RM8A 4HBEA 1ZCNA 5DIVA 4A0TA 1SYTA 3KABA 3B7XA 3PRBA 1H0GA 3ARRA 3TDBA 1L1PA 2XPAA 1A7XA 2YSFA 2ZR5A 4P8VA 1LG1A 3RFWA 1K9RA 1TK7A 4O2TA 3IHZA 2PPPA 3WD1A 3MCBA 1NH6A 3WKZA 3TCZA 2DT2A 5HW8A 3UI6A 4JFIA 3UQIA 2XP3A 3MCBB 4QIBA 4DIPA 2DK1A 1HKIA 4DWSD 4JFKA 2YSIA 1BKFA 1ITXA 3KAGA 5DEZA 1ROUA 2KXQA 3G6LA 4TYOA 5HW7A 4LAVA 1ZB5A 4WKAA 4WK9A 1ZL1A 4DRMA 3MQGA 2JXWA 3QOKA 2PPOA 4S3JA 3NTPA 3CHFA 3B8SA 3JYMA 2F21A 4MTVA 3RMEA 3LE4A 1WAWA 4BF8A 1JNEA 5E5WA 3CGNA 3H9RB 4KR0B 2RQSA 2JMFA 4ZS6A 4NNRA 5HKGA 4LAWA 2K8IA 3IKDA 2VCDA 2IF4A 1D7IA 3O5MA 4W9PA 2DK7A 2PPNA 3BXWA 1C9HA 2XP6A 4TX0A 1W1PA 1HKJA 5DITA 1GOIA 4IT4A 3OA5A 4DROA 1NWUA 5E66A 1ZBWA 3UF8A 2L2SA 3ALFA 4ODLA 3WL1A 3PA7A 4ZPVR 5HWBA 1X6NA 2Y78A 2XP9A 4W9OA 2IUZA 3LUOA 2RUQA 1XHGA 4LAYA 1ZBKA 2JV4A 2L4JA 1FKDA 1FKTA 4ODPA 2A3BA 1E6RA 4ODNA 5DF0A 2MLYA 2XP7A 3WD3A 2YSHA 2MF9A 1Q1CA 4TNSA 2ZQTA 1OGBA 2N87A 2PV3A 4GLXA 2ZQSA 4C02B 2OWOA 1J4RA 4IPXA 1EHNA 4AY1A 1J4HA 4DWSC 2DT1A 2Y8NB 1NWTA 4QZVB 4ODKA 1D7JA 5AHTA 4Z2HA 2RUCA 3UQAA 2RSEA 1CTNA 4MNMA 1R9HA 2M8JA 4WIWA 2A3CA 1W9VA 2ZAJA 3EY6A 4DWSA 4U86A 1RD6A 5HW6A 1ZBVA 1K9TA 1M5YA 1NWSA 2XPBA 1TCOC 3O5QA 3KCEA 4E5RA 3JXVA 1FKJA 4ODQA 1JMQA 5GQBA 3WD2A 4N19A 2LGOA 4KQZA 2KE0A 3KAHA 3KADA 4QT3A 2DWVA 2YBTA 4DRQA 2MPHA 3ARZA 4HARA 3ARQA 1K9QA 3GPKA 3ARTA 1ZK6A 1JNDA 3FY1A 5BXJA 1LG2A 2PI6A 4P8XA 3ALGA 3AS2A 3AROA 3AS1A 1HXVA 2A3AA 3ARUA 3MDYB 1E6NA 3M85A 3RM9A 4REXA 1LL6A 3O5PA 3FSCA 1JNTA 1Q6UA 1HKKA 2EZ5W 1VF8A 1EG4A 1FFRA 3CNGA 1NMWA 5HUAA 1PBKA 2KI3A 1KT1A 1KT0A 4Z2JA 1WNOA 3VAWA 2ZR6A 4ODOA 1E9LA 2G8ZA 5CQ2A 2WAEA 2XP4A 5JH8A 4Q22A 1EG3A 1I5HW 3UI4A 2DG4A 5HBFA 1H0IA 1HJWA 1J4IA 4U85A 4ZPTR 5D75A 4G50A 2RUDA 2E45A 3PRAA 1NWRA 5I98A 3FSBA 1YW5A 2DMVA 2DJYA 3CHEA 2DG3A 2FKEA 4MNKA 2JZVA 3B9AA 3AS0A 4WJXA 1FJDA 1FD9A 4MSPA 4MAVA 3WIJA 1FKFA 5J6EA 3MQHA 2ZQUA 1JNSA 1W1TA 1W1YA 3RGCA 4QT2A 1D6OA 5B8IC 3O5FA 2UZ5A 1Q6IA 2DSZA 2VN1A 4WKFA 2M8IA 4P8UA 4P8WA 4URIA 1KFWA 3O5OA 1YATA 3WH0A 4J4NA 3B9EA 2MNTA 3UI5A 1W1VA 1T11A 4HBOA 1FKKA 4MNLA 4GIVA 5GPRA 2DSUA 2PV2A 2KFWA 1QPLA 2DPEA 5HTGA 3CH9A 2WM0A 4DRPA 4DRJA 4GGQA 2YSBA 4ITZA 3PR9A 1FKIA 2OFNA 3O5RA 2LKNA 3L4HA 4G2PA 2ZQVA 2MDIA 4A0UA 1LL7A 2WK2A 1UR9A 1P5QA 1LL4A 2WADA 1D7HA 3G6MA 1FKRA 1OGGA 3I6CA 3IKGA 3M7NA 4JFMA 3CZ8A 4DWSB 1HKMA 5DIUA 2BA1A 2Q5AA 3PRDA 2ITKA 4Q7NA 2MLZA 1WR7A 3W4RA 4NSBA 5GPGA 2JX8A 2OLHA 2M08A 4TW7A 1FKBA 4IQ2A 4LGXA 5E62A 2YAJB 2DT3A 4DRNA 1LJYA 2DT0A 2YBUA 2M3OW 3O5EA 3NI6A 4NZCA 5HT1A 4J4OA 1B6CA 4DRIA 2B31A 2DSWA 2O92A 2KO7A 3O5DA 1O6IA 2DSVA 3CGMA 1RP5A 3WD0A 1EYMA 3AQUA 3WQVA 2KR7A 5E64A 4TW6A 4DRKA 3KAFA 3TC5A 2M1IA 3ARVA 4WKHA 2RURA 3WQWA 4ODRA 4DH0A 1XRVA 1ZU8A 3O5GA 3ARXA 1PINA 1EDQA 3PQHA 2F4EA 3ARPA 3CHCA 3O5IA 1WB0A 1LQ0A 2A3EA 1GPFA 2M2AA 1FFQA 4Z2KA 2QRVA 1FKSA 2XP5A 3JYJA 1FKHA 4MNJA 4W9QA 3UQBA 1SR0A 1U79A 3WL0A 1N1AA 1HJVA 1JVWA 3NRKA 4ZPWR 4Z2IA 3FXYA 3LKXA 2XP8A 2DG9A 1TR8A 2PBCA 5HWCA 2KGJA 1FKGA 4TW8A 1D2KA 2YSGA 2AWGA 1E6PA 1WMVA 4R0XA 2MLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5J A;  1BL4 A;  4DZ2 A;  4MGV A;  1Y0O A;  2LAJ A;  3IK8 A;  2LJ4 A;  4LAX A;  2FAP A;  1FKL A;  1QZ2 A;  1FAP A;  2ZR4 A;  2F2D A;  4ODM A;  3ODK A;  1NSG A;  4IQC A;  3KZ7 A;  4JFJ A;  4FAP A;  4JFL A;  1EQ3 A;  3KAC A;  1F8A B;  3FAP A;  1F40 A;  3OOB A;  3O5L A;  4DRH A;  4JYS A;  1W26 A;  1Q6H A;  4U84 A;  4FN2 A;  4DZ3 A;  1ROT A;  2D9F A;  3O5K A;  4DT4 A;  2LPV A;  1J6Y A;  3KAI A;  2RE3 A;  1NMV A;  2PV1 A;  1QPF A;  1O6W A;  1ZCN A;  5DIV A;  3KAB A;  3B7X A;  3PRB A;  3TDB A;  1L1P A;  2XPA A;  1A7X A;  2YSF A;  2ZR5 A;  3RFW A;  1K9R A;  1TK7 A;  4O2T A;  3IHZ A;  2PPP A;  3TCZ A;  5HW8 A;  3UI6 A;  4JFI A;  3UQI A;  2XP3 A;  4QIB A;  4DIP A;  2DK1 A;  4JFK A;  2YSI A;  1BKF A;  3KAG A;  1ROU A;  2KXQ A;  4TYO A;  5HW7 A;  4LAV A;  4DRM A;  2JXW A;  2PPO A;  3NTP A;  3JYM A;  2F21 A;  3LE4 A;  4BF8 A;  3CGN A;  3H9R B;  2RQS A;  2JMF A;  4NNR A;  5HKG A;  4LAW A;  2K8I A;  3IKD A;  2VCD A;  2IF4 A;  1D7I A;  3O5M A;  4W9P A;  2DK7 A;  2PPN A;  1C9H A;  2XP6 A;  4TX0 A;  5DIT A;  4DRO A;  3UF8 A;  2L2S A;  4ODL A;  3PA7 A;  5HWB A;  2Y78 A;  2XP9 A;  4W9O A;  3LUO A;  2RUQ A;  4LAY A;  2JV4 A;  2L4J A;  4ODP A;  1FKD A;  1FKT A;  4ODN A;  2MLY A;  2XP7 A;  2YSH A;  2MF9 A;  1Q1C A;  4TNS A;  2ZQT A;  2N87 A;  2PV3 A;  2ZQS A;  4C02 B;  1J4R A;  4IPX A;  1J4H A;  4ODK A;  1D7J A;  5AHT A;  2RUC A;  3UQA A;  2RSE A;  1R9H A;  2M8J A;  2ZAJ A;  3EY6 A;  4U86 A;  5HW6 A;  1M5Y A;  2XPB A;  1TCO C;  3O5Q A;  3KCE A;  4E5R A;  3JXV A;  1FKJ A;  4ODQ A;  1JMQ A;  4N19 A;  2LGO A;  2KE0 A;  3KAH A;  3KAD A;  4QT3 A;  2DWV A;  4DRQ A;  2MPH A;  1K9Q A;  3GPK A;  1ZK6 A;  5BXJ A;  1HXV A;  3MDY B;  3M85 A;  4REX A;  3O5P A;  1Q6U A;  1JNT A;  2EZ5 W;  1EG4 A;  3CNG A;  1NMW A;  5HUA A;  1PBK A;  2KI3 A;  1KT1 A;  1KT0 A;  3VAW A;  2ZR6 A;  4ODO A;  5CQ2 A;  2XP4 A;  1EG3 A;  3UI4 A;  1I5H W;  2DG4 A;  1J4I A;  4U85 A;  5D75 A;  4G50 A;  2RUD A;  2E45 A;  5I98 A;  1YW5 A;  2DMV A;  2DJY A;  2DG3 A;  2FKE A;  2JZV A;  1FJD A;  1FD9 A;  4MSP A;  1FKF A;  5J6E A;  2ZQU A;  1JNS A;  3RGC A;  4QT2 A;  1D6O A;  5B8I C;  3O5F A;  2UZ5 A;  1Q6I A;  2VN1 A;  2M8I A;  3O5O A;  1YAT A;  3WH0 A;  4J4N A;  2MNT A;  3UI5 A;  1T11 A;  1FKK A;  4GIV A;  2PV2 A;  2KFW A;  1QPL A;  5HTG A;  4DRP A;  4DRJ A;  4GGQ A;  2YSB A;  4ITZ A;  1FKI A;  2OFN A;  3O5R A;  2LKN A;  3L4H A;  4G2P A;  2ZQV A;  2MDI A;  1P5Q A;  1D7H A;  1FKR A;  3I6C A;  3IKG A;  3M7N A;  4JFM A;  5DIU A;  2BA1 A;  2Q5A A;  3PRD A;  2ITK A;  2MLZ A;  1WR7 A;  5GPG A;  2JX8 A;  4TW7 A;  2M08 A;  1FKB A;  4IQ2 A;  4DRN A;  2M3O W;  3O5E A;  3NI6 A;  5HT1 A;  4J4O A;  1B6C A;  4DRI A;  2KO7 A;  3O5D A;  3CGM A;  1EYM A;  2KR7 A;  4TW6 A;  4DRK A;  3KAF A;  3TC5 A;  2M1I A;  2RUR A;  4ODR A;  4DH0 A;  3O5G A;  1PIN A;  2F4E A;  3O5I A;  2M2A A;  1FKS A;  2XP5 A;  3JYJ A;  1FKH A;  4W9Q A;  3UQB A;  1U79 A;  1N1A A;  1JVW A;  3NRK A;  2XP8 A;  2DG9 A;  2PBC A;  5HWC A;  2KGJ A;  1FKG A;  4TW8 A;  2YSG A;  2AWG A;  1WMV A;  4R0X A;  2MLX A; 
#chains in the Genus database with same CATH topology
 3LKX B;  4MPK A;  3FS8 A;  3O5J A;  4Z2G A;  1W9P A;  1BL4 A;  5E65 A;  5DO2 A;  4DZ2 A;  4L72 B;  1EIB A;  4PTM A;  4MGV A;  1Y0O A;  1ZBC A;  2WLZ A;  2LAJ A;  3IK8 A;  2LJ4 A;  4LAX A;  2FAP A;  1E15 A;  1W9U A;  1FKL A;  3RM4 A;  3ARY A;  1FLC A;  1QZ2 A;  1X6L A;  4W5U A;  1FAP A;  4R5E A;  2ZR4 A;  2F2D A;  3ARS A;  3CHD A;  4ODM A;  2ESC A;  3ODK A;  1NSG A;  3ARW A;  4IQC A;  3KZ7 A;  4JFJ A;  1E6Z A;  4FAP A;  4JFL A;  1EQ3 A;  3KAC A;  1F8A B;  3FAP A;  3AS3 A;  4L3N A;  1F40 A;  3OOB A;  3WD4 A;  4S3K A;  1OWQ A;  3B9D A;  5U47 A;  3O5L A;  1IX5 A;  4DRH A;  4JYS A;  4ML4 A;  1UR8 A;  1W26 A;  2P4V A;  1Q6H A;  2QF8 A;  4U84 A;  1GUV A;  4FN2 A;  2G41 A;  2FDM A;  4DZ3 A;  2O9O A;  1ROT A;  2D9F A;  3O5K A;  4DT4 A;  2AOS A;  2WLY A;  1HJX A;  2LPV A;  1TFV A;  4Z2L A;  1J6Y A;  3KAI A;  4XAK A;  2RE3 A;  4IT6 A;  1NMV A;  2PV1 A;  1QPF A;  1O6W A;  3RM8 A;  4HBE A;  1ZCN A;  5DIV A;  2B5U B;  4A0T A;  1SYT A;  3KAB A;  3B7X A;  3PRB A;  1H0G A;  3ARR A;  3TDB A;  1L1P A;  2XPA A;  1A7X A;  2YSF A;  2ZR5 A;  4P8V A;  1LG1 A;  3RFW A;  1K9R A;  1TK7 A;  4O2T A;  3IHZ A;  2PPP A;  3WD1 A;  3MCB A;  1NH6 A;  3WKZ A;  3TCZ A;  2DT2 A;  5HW8 A;  3UI6 A;  4JFI A;  3UQI A;  2XP3 A;  3MCB B;  4QIB A;  4DIP A;  2DK1 A;  4UDM A;  1HKI A;  4DWS D;  4JFK A;  2YSI A;  1BKF A;  1ITX A;  3KAG A;  5DEZ A;  1ROU A;  2KXQ A;  3G6L A;  4TYO A;  5HW7 A;  4LAV A;  1ZB5 A;  4WKA A;  4WK9 A;  1ZL1 A;  4DRM A;  3MQG A;  2JXW A;  3QOK A;  2PPO A;  4S3J A;  3NTP A;  3CHF A;  3B8S A;  3JYM A;  2F21 A;  4MTV A;  3RME A;  3LE4 A;  1WAW A;  4BF8 A;  1JNE A;  5E5W A;  3CGN A;  3H9R B;  4KR0 B;  2RQS A;  2JMF A;  4ZS6 A;  4NNR A;  5HKG A;  4LAW A;  2K8I A;  3IKD A;  2VCD A;  2IF4 A;  1D7I A;  3O5M A;  4W9P A;  2DK7 A;  2PPN A;  3BXW A;  1C9H A;  2XP6 A;  4TX0 A;  1W1P A;  1HKJ A;  5DIT A;  1GOI A;  4IT4 A;  3OA5 A;  4DRO A;  1NWU A;  5E66 A;  1ZBW A;  3UF8 A;  2L2S A;  3ALF A;  4ODL A;  3WL1 A;  3PA7 A;  4ZPV R;  5HWB A;  1X6N A;  2Y78 A;  2XP9 A;  4W9O A;  2IUZ A;  3LUO A;  2RUQ A;  1XHG A;  4LAY A;  1ZBK A;  2JV4 A;  2L4J A;  1FKD A;  1FKT A;  4ODP A;  2A3B A;  1E6R A;  4ODN A;  5DF0 A;  2MLY A;  2XP7 A;  3WD3 A;  2YSH A;  2MF9 A;  1Q1C A;  4TNS A;  2ZQT A;  1OGB A;  3GU0 A;  2N87 A;  2PV3 A;  4GLX A;  2ZQS A;  4C02 B;  2OWO A;  1J4R A;  4IPX A;  1EHN A;  4AY1 A;  1J4H A;  4DWS C;  2DT1 A;  2Y8N B;  1NWT A;  4QZV B;  4ODK A;  1D7J A;  5AHT A;  4Z2H A;  2RUC A;  3UQA A;  2RSE A;  1CTN A;  4MNM A;  1R9H A;  2M8J A;  4WIW A;  2A3C A;  1W9V A;  2ZAJ A;  3EY6 A;  4DWS A;  4U86 A;  1RD6 A;  5HW6 A;  1ZBV A;  1K9T A;  1M5Y A;  1NWS A;  2XPB A;  1TCO C;  3O5Q A;  3KCE A;  4E5R A;  3JXV A;  1FKJ A;  4ODQ A;  1JMQ A;  5GQB A;  3WD2 A;  4N19 A;  2LGO A;  4KQZ A;  2KE0 A;  3KAH A;  3KAD A;  4QT3 A;  2DWV A;  2YBT A;  4DRQ A;  2MPH A;  3ARZ A;  4HAR A;  3ARQ A;  1K9Q A;  3GTY X;  3GPK A;  3ART A;  1ZK6 A;  1JND A;  3FY1 A;  5BXJ A;  1LG2 A;  2PI6 A;  4P8X A;  3ALG A;  1JCH B;  3AS2 A;  3ARO A;  2PN0 A;  3AS1 A;  1HXV A;  2A3A A;  3ARU A;  3MDY B;  1E6N A;  3M85 A;  3RM9 A;  4REX A;  1LL6 A;  3O5P A;  3FSC A;  1JNT A;  1Q6U A;  1HKK A;  2EZ5 W;  1VF8 A;  1EG4 A;  1FFR A;  3CNG A;  1NMW A;  5HUA A;  1PBK A;  2KI3 A;  1KT1 A;  1KT0 A;  4Z2J A;  2ETN A;  1WNO A;  3VAW A;  2ZR6 A;  4ODO A;  1E9L A;  2G8Z A;  5CQ2 A;  2WAE A;  2XP4 A;  5JH8 A;  4Q22 A;  1EG3 A;  1I5H W;  3UI4 A;  2DG4 A;  5HBF A;  1H0I A;  2EUL A;  1HJW A;  1J4I A;  4U85 A;  4ZPT R;  5D75 A;  3BMB A;  4G50 A;  2RUD A;  2E45 A;  3PRA A;  1NWR A;  5I98 A;  3FSB A;  1E44 A;  1YW5 A;  2DMV A;  2DJY A;  3CHE A;  2DG3 A;  2FKE A;  4MNK A;  2JZV A;  3B9A A;  3AS0 A;  4WJX A;  1FJD A;  1FD9 A;  4MSP A;  4MAV A;  3WIJ A;  1FKF A;  5J6E A;  3MQH A;  2ZQU A;  1JNS A;  1W1T A;  1W1Y A;  3RGC A;  4QT2 A;  1D6O A;  5B8I C;  3O5F A;  2UZ5 A;  1Q6I A;  2DSZ A;  2VN1 A;  4WKF A;  2M8I A;  4P8U A;  4P8W A;  4URI A;  1KFW A;  3O5O A;  1YAT A;  3WH0 A;  4J4N A;  3B9E A;  2MNT A;  3UI5 A;  1W1V A;  1T11 A;  4HBO A;  1FKK A;  4MNL A;  4GIV A;  5GPR A;  2DSU A;  2PV2 A;  2KFW A;  1QPL A;  2DPE A;  5HTG A;  3CH9 A;  2WM0 A;  4DRP A;  4DRJ A;  4GGQ A;  2YSB A;  4ITZ A;  3PR9 A;  1FKI A;  2OFN A;  3O5R A;  2LKN A;  3L4H A;  4G2P A;  2ZQV A;  2MDI A;  4A0U A;  1LL7 A;  2WK2 A;  1UR9 A;  1P5Q A;  1LL4 A;  2WAD A;  1D7H A;  3G6M A;  1FKR A;  1OGG A;  3I6C A;  3IKG A;  3M7N A;  4JFM A;  3CZ8 A;  4DWS B;  1HKM A;  5DIU A;  2BA1 A;  2Q5A A;  2F23 A;  3PRD A;  2ITK A;  4Q7N A;  2MLZ A;  1WR7 A;  3W4R A;  4NSB A;  5GPG A;  2JX8 A;  2OLH A;  2M08 A;  4TW7 A;  1FKB A;  4IQ2 A;  4LGX A;  5E62 A;  2YAJ B;  2DT3 A;  4DRN A;  1LJY A;  2DT0 A;  2YBU A;  2M3O W;  3O5E A;  3NI6 A;  4NZC A;  5HT1 A;  4J4O A;  1B6C A;  4DRI A;  2B31 A;  2DSW A;  2O92 A;  2KO7 A;  3O5D A;  1O6I A;  2DSV A;  3CGM A;  1RP5 A;  3WD0 A;  1EYM A;  3AQU A;  3WQV A;  2KR7 A;  5E64 A;  4TW6 A;  4DRK A;  3KAF A;  3TC5 A;  2M1I A;  3ARV A;  4WKH A;  2RUR A;  3WQW A;  4ODR A;  4DH0 A;  1XRV A;  1ZU8 A;  3O5G A;  3ARX A;  1PIN A;  1EDQ A;  3PQH A;  2F4E A;  3ARP A;  3CHC A;  3O5I A;  1WB0 A;  1LQ0 A;  2A3E A;  1GPF A;  3EIP A;  2M2A A;  1FFQ A;  4Z2K A;  2QRV A;  1GRJ A;  1FKS A;  2XP5 A;  3JYJ A;  1FKH A;  4MNJ A;  4W9Q A;  3UQB A;  1SR0 A;  1U79 A;  3WL0 A;  1N1A A;  1HJV A;  1JVW A;  3NRK A;  4ZPW R;  4Z2I A;  3FXY A;  3LKX A;  2XP8 A;  2DG9 A;  1TR8 A;  2PBC A;  5HWC A;  2KGJ A;  1FKG A;  4TW8 A;  1D2K A;  2YSG A;  2AWG A;  1E6P A;  1WMV A;  4R0X A;  2MLX A; 
#chains in the Genus database with same CATH homology
 3LKX B;  4MPK A;  3FS8 A;  3O5J A;  4Z2G A;  1W9P A;  1BL4 A;  5E65 A;  5DO2 A;  4DZ2 A;  4L72 B;  1EIB A;  4PTM A;  4MGV A;  1Y0O A;  1ZBC A;  2WLZ A;  2LAJ A;  3IK8 A;  2LJ4 A;  4LAX A;  2FAP A;  1E15 A;  1W9U A;  1FKL A;  3RM4 A;  3ARY A;  1FLC A;  1QZ2 A;  1X6L A;  4W5U A;  1FAP A;  4R5E A;  2ZR4 A;  2F2D A;  3ARS A;  3CHD A;  4ODM A;  2ESC A;  3ODK A;  1NSG A;  3ARW A;  4IQC A;  3KZ7 A;  4JFJ A;  1E6Z A;  4FAP A;  4JFL A;  1EQ3 A;  3KAC A;  1F8A B;  3FAP A;  3AS3 A;  4L3N A;  1F40 A;  3OOB A;  3WD4 A;  4S3K A;  1OWQ A;  3B9D A;  5U47 A;  3O5L A;  1IX5 A;  4DRH A;  4JYS A;  4ML4 A;  1UR8 A;  1W26 A;  1Q6H A;  2QF8 A;  4U84 A;  1GUV A;  4FN2 A;  2G41 A;  2FDM A;  4DZ3 A;  2O9O A;  1ROT A;  2D9F A;  3O5K A;  4DT4 A;  2AOS A;  2WLY A;  1HJX A;  2LPV A;  1TFV A;  4Z2L A;  1J6Y A;  3KAI A;  4XAK A;  2RE3 A;  4IT6 A;  1NMV A;  2PV1 A;  1QPF A;  1O6W A;  3RM8 A;  4HBE A;  1ZCN A;  5DIV A;  4A0T A;  1SYT A;  3KAB A;  3B7X A;  3PRB A;  1H0G A;  3ARR A;  3TDB A;  1L1P A;  2XPA A;  1A7X A;  2YSF A;  2ZR5 A;  4P8V A;  1LG1 A;  3RFW A;  1K9R A;  1TK7 A;  4O2T A;  3IHZ A;  2PPP A;  3WD1 A;  3MCB A;  1NH6 A;  3WKZ A;  3TCZ A;  2DT2 A;  5HW8 A;  3UI6 A;  4JFI A;  3UQI A;  2XP3 A;  3MCB B;  4QIB A;  4DIP A;  2DK1 A;  1HKI A;  4DWS D;  4JFK A;  2YSI A;  1BKF A;  1ITX A;  3KAG A;  5DEZ A;  1ROU A;  2KXQ A;  3G6L A;  4TYO A;  5HW7 A;  4LAV A;  1ZB5 A;  4WKA A;  4WK9 A;  1ZL1 A;  4DRM A;  3MQG A;  2JXW A;  3QOK A;  2PPO A;  4S3J A;  3NTP A;  3CHF A;  3B8S A;  3JYM A;  2F21 A;  4MTV A;  3RME A;  3LE4 A;  1WAW A;  4BF8 A;  1JNE A;  5E5W A;  3CGN A;  3H9R B;  4KR0 B;  2RQS A;  2JMF A;  4ZS6 A;  4NNR A;  5HKG A;  4LAW A;  2K8I A;  3IKD A;  2VCD A;  2IF4 A;  1D7I A;  3O5M A;  4W9P A;  2DK7 A;  2PPN A;  3BXW A;  1C9H A;  2XP6 A;  4TX0 A;  1W1P A;  1HKJ A;  5DIT A;  1GOI A;  4IT4 A;  3OA5 A;  4DRO A;  1NWU A;  5E66 A;  1ZBW A;  3UF8 A;  2L2S A;  3ALF A;  4ODL A;  3WL1 A;  3PA7 A;  4ZPV R;  5HWB A;  1X6N A;  2Y78 A;  2XP9 A;  4W9O A;  2IUZ A;  3LUO A;  2RUQ A;  1XHG A;  4LAY A;  1ZBK A;  2JV4 A;  2L4J A;  1FKD A;  1FKT A;  4ODP A;  2A3B A;  1E6R A;  4ODN A;  5DF0 A;  2MLY A;  2XP7 A;  3WD3 A;  2YSH A;  2MF9 A;  1Q1C A;  4TNS A;  2ZQT A;  1OGB A;  2N87 A;  2PV3 A;  4GLX A;  2ZQS A;  4C02 B;  2OWO A;  1J4R A;  4IPX A;  1EHN A;  4AY1 A;  1J4H A;  4DWS C;  2DT1 A;  2Y8N B;  1NWT A;  4QZV B;  4ODK A;  1D7J A;  5AHT A;  4Z2H A;  2RUC A;  3UQA A;  2RSE A;  1CTN A;  4MNM A;  1R9H A;  2M8J A;  4WIW A;  2A3C A;  1W9V A;  2ZAJ A;  3EY6 A;  4DWS A;  4U86 A;  1RD6 A;  5HW6 A;  1ZBV A;  1K9T A;  1M5Y A;  1NWS A;  2XPB A;  1TCO C;  3O5Q A;  3KCE A;  4E5R A;  3JXV A;  1FKJ A;  4ODQ A;  1JMQ A;  5GQB A;  3WD2 A;  4N19 A;  2LGO A;  4KQZ A;  2KE0 A;  3KAH A;  3KAD A;  4QT3 A;  2DWV A;  2YBT A;  4DRQ A;  2MPH A;  3ARZ A;  4HAR A;  3ARQ A;  1K9Q A;  3GPK A;  3ART A;  1ZK6 A;  1JND A;  3FY1 A;  5BXJ A;  1LG2 A;  2PI6 A;  4P8X A;  3ALG A;  3AS2 A;  3ARO A;  3AS1 A;  1HXV A;  2A3A A;  3ARU A;  3MDY B;  1E6N A;  3M85 A;  3RM9 A;  4REX A;  1LL6 A;  3O5P A;  3FSC A;  1JNT A;  1Q6U A;  1HKK A;  2EZ5 W;  1VF8 A;  1EG4 A;  1FFR A;  3CNG A;  1NMW A;  5HUA A;  1PBK A;  2KI3 A;  1KT1 A;  1KT0 A;  4Z2J A;  1WNO A;  3VAW A;  2ZR6 A;  4ODO A;  1E9L A;  2G8Z A;  5CQ2 A;  2WAE A;  2XP4 A;  5JH8 A;  4Q22 A;  1EG3 A;  1I5H W;  3UI4 A;  2DG4 A;  5HBF A;  1H0I A;  1HJW A;  1J4I A;  4U85 A;  4ZPT R;  5D75 A;  4G50 A;  2RUD A;  2E45 A;  3PRA A;  1NWR A;  5I98 A;  3FSB A;  1YW5 A;  2DMV A;  2DJY A;  3CHE A;  2DG3 A;  2FKE A;  4MNK A;  2JZV A;  3B9A A;  3AS0 A;  4WJX A;  1FJD A;  1FD9 A;  4MSP A;  4MAV A;  3WIJ A;  1FKF A;  5J6E A;  3MQH A;  2ZQU A;  1JNS A;  1W1T A;  1W1Y A;  3RGC A;  4QT2 A;  1D6O A;  5B8I C;  3O5F A;  2UZ5 A;  1Q6I A;  2DSZ A;  2VN1 A;  4WKF A;  2M8I A;  4P8U A;  4P8W A;  4URI A;  1KFW A;  3O5O A;  1YAT A;  3WH0 A;  4J4N A;  3B9E A;  2MNT A;  3UI5 A;  1W1V A;  1T11 A;  4HBO A;  1FKK A;  4MNL A;  4GIV A;  5GPR A;  2DSU A;  2PV2 A;  2KFW A;  1QPL A;  2DPE A;  5HTG A;  3CH9 A;  2WM0 A;  4DRP A;  4DRJ A;  4GGQ A;  2YSB A;  4ITZ A;  3PR9 A;  1FKI A;  2OFN A;  3O5R A;  2LKN A;  3L4H A;  4G2P A;  2ZQV A;  2MDI A;  4A0U A;  1LL7 A;  2WK2 A;  1UR9 A;  1P5Q A;  1LL4 A;  2WAD A;  1D7H A;  3G6M A;  1FKR A;  1OGG A;  3I6C A;  3IKG A;  3M7N A;  4JFM A;  3CZ8 A;  4DWS B;  1HKM A;  5DIU A;  2BA1 A;  2Q5A A;  3PRD A;  2ITK A;  4Q7N A;  2MLZ A;  1WR7 A;  3W4R A;  4NSB A;  5GPG A;  2JX8 A;  2OLH A;  2M08 A;  4TW7 A;  1FKB A;  4IQ2 A;  4LGX A;  5E62 A;  2YAJ B;  2DT3 A;  4DRN A;  1LJY A;  2DT0 A;  2YBU A;  2M3O W;  3O5E A;  3NI6 A;  4NZC A;  5HT1 A;  4J4O A;  1B6C A;  4DRI A;  2B31 A;  2DSW A;  2O92 A;  2KO7 A;  3O5D A;  1O6I A;  2DSV A;  3CGM A;  1RP5 A;  3WD0 A;  1EYM A;  3AQU A;  3WQV A;  2KR7 A;  5E64 A;  4TW6 A;  4DRK A;  3KAF A;  3TC5 A;  2M1I A;  3ARV A;  4WKH A;  2RUR A;  3WQW A;  4ODR A;  4DH0 A;  1XRV A;  1ZU8 A;  3O5G A;  3ARX A;  1PIN A;  1EDQ A;  3PQH A;  2F4E A;  3ARP A;  3CHC A;  3O5I A;  1WB0 A;  1LQ0 A;  2A3E A;  1GPF A;  2M2A A;  1FFQ A;  4Z2K A;  2QRV A;  1FKS A;  2XP5 A;  3JYJ A;  1FKH A;  4MNJ A;  4W9Q A;  3UQB A;  1SR0 A;  1U79 A;  3WL0 A;  1N1A A;  1HJV A;  1JVW A;  3NRK A;  4ZPW R;  4Z2I A;  3FXY A;  3LKX A;  2XP8 A;  2DG9 A;  1TR8 A;  2PBC A;  5HWC A;  2KGJ A;  1FKG A;  4TW8 A;  1D2K A;  2YSG A;  2AWG A;  1E6P A;  1WMV A;  4R0X A;  2MLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...