2XP5A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
total genus 42
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp5A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp5A02
3O5FA 2M8JA 2XP7A 3KAGA 1FKGA 1KT1A 2RSEA 2YSBA 1D7JA 1JNSA 1WMVA 3O5LA 4QT3A 3UI4A 1JNTA 1JMQA 1QZ2A 2ZAJA 3CNGA 3FAPA 3O5GA 4MGVA 2KXQA 2L4JA 2AWGA 2JMFA 3O5QA 4JYSA 4ODNA 3TC5A 2K8IA 4ODMA 1K9RA 3GPKA 2RUCA 4LAWA 2BA1A 1R9HA 2PPNA 4LAVA 4MSPA 3ODKA 2M1IA 2Y78A 2YSFA 2KGJA 3H9RB 1J4HA 4DH0A 3M7NA 4FAPA 4IPXA 3O5MA 2DJYA 3KCEA 1Y0OA 2FKEA 1EG3A 3O5RA 4W9OA 2JX8A 1EYMA 3JXVA 2VCDA 4ITZA 4GIVA 1PINA 3NTPA 1C9HA 1J4IA 5HWBA 4REXA 1FKSA 2RUDA 3O5PA 4ODKA 4DRQA 4JFJA 1TCOC 1F40A 2IF4A 3O5KA 5I98A 2ZR5A 4ODQA 5HWCA 3WH0A 1FAPA 1ROTA 5DIUA 3KAIA 3L4HA 4DROA 4JFIA 2XPBA 1KT0A 2PBCA 2OFNA 2YSHA 2PV2A 4IQCA 2LKNA 2MPHA 2MLXA 1PBKA 2PV1A 2RQSA 3PRBA 2KFWA 4U84A 2Q5AA 2XP6A 2ZQVA 5CQ2A 1W26A 1D7IA 2ZQTA 2KR7A 2M08A 3MDYB 4TX0A 3IK8A 4TYOA 4C02B 4DT4A 5HUAA 4U86A 3KZ7A 3NI6A 4W9QA 4ODOA 5HKGA 3PA7A 3CGMA 2DG3A 1ZK6A 5HW6A 5HW7A 1HXVA 4JFKA 4W9PA 2DWVA 2KI3A 1T11A 4DRNA 2YSIA 1M5YA 2M8IA 1FKJA 1QPFA 3UI6A 2PPPA 1NMWA 2FAPA 1K9QA 3I6CA 2D9FA 3O5DA 1D6OA 2UZ5A 2XP9A 3UI5A 2KE0A 3VAWA 4LAXA 4J4NA 1FKFA 2XP4A 2MNTA 2VN1A 2DG4A 4ODLA 2KO7A 4TNSA 3O5OA 1J6YA 1JVWA 3JYJA 4DRPA 5HTGA 2LGOA 2M2AA 2MDIA 3LUOA 3B7XA 2RUQA 2MF9A 2LJ4A 4DRIA 5HT1A 3M85A 2JV4A 2ZQUA 1F8AB 3PRDA 1N1AA 5B8IC 1FKHA 3KACA 2DK7A 2PV3A 2XP3A 1D7HA 1BKFA 3IKGA 1Q6HA 1NSGA 4ODPA 4TW8A 4DRHA 4ODRA 1FKKA 2E45A 2DMVA 4O2TA 1FKLA 4IQ2A 4DRJA 5HW8A 3TDBA 2RE3A 1J4RA 4JFLA 2LAJA 3RGCA 1B6CA 3O5JA 4BF8A 1EG4A 1FKIA 5BXJA 4GGQA 2ZR4A 3UF8A 1FJDA 1EQ3A 4DIPA 3KAHA 2RURA 3KABA 1I5HW 2JXWA 1FKDA 2MLYA 2N87A 3IHZA 4DRMA 1Q6IA 4QT2A 1FKTA 4TW6A 3LE4A 4LAYA 5AHTA 2LPVA 4R0XA 2ZR6A 2MLZA 2F2DA 4QIBA 1WR7A 1Q6UA 1U79A 1FKBA 4DZ2A 4FN2A 2M3OW 2PPOA 4NNRA 4J4OA 4JFMA 1QPLA 1ROUA 1A7XA 4G2PA 5DIVA 2L2SA 4DZ3A 1FD9A 3OOBA 3RFWA 3UQIA 1O6WA 2JZVA 5J6EA 1BL4A 1L1PA 2EZ5W 3CGNA 3IKDA 3UQBA 1FKRA 2XP5A 3NRKA 4E5RA 4TW7A 1Q1CA 2DG9A 2XP8A 5D75A 4DRKA 2ITKA 5GPGA 3EY6A 1ZCNA 1NMVA 3KADA 3KAFA 4G50A 1YW5A 3UQAA 2YSGA 3O5IA 2XPAA 3O5EA 1TK7A 4N19A 2ZQSA 3JYMA 4U85A 2F4EA 2F21A 5DITA 3TCZA 2DK1A 1P5QA 1YATA
chains in the Genus database with same CATH superfamily
2DSWA 1D7JA 3FAPA 3MCBA 1K9RA 3GPKA 4LAVA 3CHDA 1SYTA 4DH0A 4IPXA 3PQHA 3O5MA 2DJYA 3PRAA 4AY1A 2JX8A 1O6IA 4ITZA 4GIVA 3FS8A 1C9HA 3ARTA 1H0IA 4ODKA 1FKSA 2RUDA 3AS3A 3B9AA 1F40A 2ZR5A 2DT1A 4ODQA 3WH0A 5HWCA 1ROTA 1HKMA 4WIWA 3AS2A 2YSHA 3ARXA 4IQCA 4LGXA 5B8IC 3ARYA 2KFWA 1LL6A 2Q5AA 2XP6A 1HKKA 3UQAA 1D7IA 3MDYB 3IK8A 3ARWA 3KZ7A 4ODOA 4ZPVR 5HW7A 5HW6A 2DWVA 2KI3A 1T11A 4MNLA 2YSIA 2M8IA 1FKJA 4KR0B 3WKZA 3I6CA 1D6OA 1FFQA 1XRVA 4J4NA 2XP4A 5HBFA 3O5OA 1JVWA 3JYJA 2MDIA 2WK2A 3G6MA 4DRIA 1FKHA 1D7HA 1ZBKA 1HJXA 3AS1A 2DSVA 1J4RA 4JFLA 3RGCA 2LAJA 4GGQA 2Y8NB 4DIPA 1E44A 1UR9A 3KABA 1I5HW 2PI6A 4ZPTR 4QT2A 4R0XA 2MLZA 2F2DA 1WR7A 3GU0A 5GQBA 4DZ2A 3FSBA 2M3OW 4DWSC 3WD1A 3QOKA 3ARSA 2DSUA 3UQIA 1O6WA 4HBOA 4MTVA 5J6EA 4QZVB 4TW7A 4GLXA 5U47A 1Q1CA 4HARA 2A3BA 3EY6A 1NMVA 3KADA 4G50A 1TR8A 3OA5A 3WQVA 5DITA 2DK1A 1P5QA 1YATA 3O5FA 2M8JA 2OWOA 3KAGA 1W1VA 1WMVA 2WLYA 3UI4A 1JMQA 1NWSA 3CNGA 3O5GA 4MGVA 3AQUA 4JYSA 4KQZA 3TC5A 1ZBWA 1GUVA 4IT6A 4LAWA 4MNKA 3ODKA 2YSFA 1E6ZA 1J4HA 4FAPA 3KCEA 2FKEA 4W9OA 4WJXA 3JXVA 3ARZA 2B31A 1TFVA 1FLCA 1PINA 3NTPA 1JCHB 1EHNA 2OLHA 4Z2HA 3O5PA 5I98A 3O5KA 1LG2A 3WD4A 1NH6A 1W9UA 1E15A 2XPBA 2PV2A 2PBCA 5E5WA 1KFWA 2MPHA 5DO2A 2PV1A 4L72B 1LG1A 1W26A 4TX0A 4C02B 4U86A 3NI6A 4IT4A 3B8SA 4NSBA 1W9PA 1ZK6A 4W9PA 2A3CA 4DRNA 1XHGA 3UI6A 2PPPA 1GPFA 2UZ5A 3UI5A 3BXWA 1EDQA 4DWSD 1E6RA 2VN1A 4TNSA 2KO7A 3WL1A 2LGOA 4A0UA 1D2KA 2MF9A 5HT1A 2JV4A 2ZQUA 1E6PA 5E66A 2O92A 2PV3A 4Z2KA 1BKFA 3IKGA 4ODPA 1FKKA 2E45A 2FDMA 3BMBA 1FKLA 5HW8A 3TDBA 1B6CA 4ZPWR 2DSZA 4Q22A 2G41A 3RMEA 1EQ3A 2RURA 4P8UA 2MLYA 2G8ZA 2N87A 3LE4A 4LAYA 5AHTA 3ARVA 3CH9A 4QIBA 4Z2IA 4Q7NA 1NWRA 4FN2A 1HKJA 4JFMA 1A7XA 1W1TA 1FD9A 3OOBA 1ZU8A 1CTNA 2JZVA 1BL4A 1LQ0A 3UQBA 3CHFA 2DG9A 1H0GA 4DRKA 1YW5A 2XPAA 1VF8A 4MNMA 4N19A 4A0TA 2ZQSA 1ZB5A 4U85A 3TCZA 2WADA 3RM4A 2RSEA 2DPEA 1JNTA 3MQHA 1QZ2A 2ZAJA 2KXQA 2AWGA 3O5QA 2RUCA 1R9HA 2PPNA 1HKIA 3WQWA 2M1IA 2DT2A 2AOSA 1FFRA 1HJVA 2KGJA 3M7NA 4DWSA 3O5RA 1EG3A 4NZCA 1EYMA 4P8VA 3FSCA 4REXA 4DRQA 1RP5A 1TCOC 2ESCA 3G6LA 4WK9A 5DIUA 3L4HA 3WIJA 4JFIA 2OFNA 1E6NA 2LKNA 2MLXA 4DROA 1PBKA 3PRBA 4S3JA 2KR7A 2M08A 4TYOA 2F23A 4PTMA 2ZQTA 1IX5A 5DEZA 2WAEA 4W9QA 5HKGA 1ZL1A 3PA7A 2DG3A 3LKXB 2YAJB 3MCBB 1QPFA 3FXYA 4XAKA 1K9QA 3CZ8A 2D9FA 3O5DA 1X6LA 2KE0A 1SR0A 3VAWA 4LAXA 1FKFA 2DG4A 1J6YA 5HTGA 2M2AA 3LUOA 2RUQA 3CHEA 2LJ4A 3PRDA 1F8AB 3CHCA 1NSGA 4DRHA 4ODRA 4O2TA 2DMVA 4BF8A 2RE3A 1W1PA 3O5JA 1EG4A 5BXJA 2ZR4A 3UF8A 3KAHA 1NWUA 4MPKA 1JNEA 2JXWA 1FKDA 1NWTA 4DRMA 3RM9A 1FKTA 4WKFA 2LPVA 3RM8A 2B5UB 1Q6UA 1U79A 4ML4A 1FKBA 2PPOA 3AROA 2O9OA 2QRVA 2IUZA 2L2SA 1GOIA 3GTYX 4MNJA 3B9EA 4W5UA 1OWQA 1L1PA 2EZ5W 3CGNA 3IKDA 3B9DA 4ZS6A 2XP5A 2YBTA 4E5RA 3NRKA 1OGBA 1RD6A 2ITKA 5GPGA 1ZCNA 3KAFA 2EULA 3O5IA 3O5EA 3ALGA 3FY1A 2F4EA 1WNOA 3WD0A 1JNSA 2XP7A 1FKGA 1KT1A 3WD3A 2YSBA 3O5LA 4QT3A 4WKHA 1HJWA 1K9TA 4ODNA 2L4JA 5E65A 2JMFA 4ODMA 4Z2GA 1WB0A 2K8IA 4Z2LA 4R5EA 1GRJA 2BA1A 4MSPA 1JNDA 1EIBA 1ZBVA 2A3AA 2Y78A 4MAVA 3H9RB 1X6NA 4URIA 1Y0OA 2VCDA 1ZBCA 1J4IA 5HWBA 4JFJA 2IF4A 2WLZA 1FAPA 3KAIA 2PN0A 1KT0A 4DWSB 3ARUA 2RQSA 3WL0A 4U84A 2ZQVA 5CQ2A 4DT4A 5HUAA 3CGMA 3ARPA 1HXVA 4JFKA 2ETNA 1LL4A 1M5YA 2WM0A 4HBEA 1NMWA 2FAPA 4WKAA 2XP9A 4Z2JA 2MNTA 4ODLA 4DRPA 3B7XA 4L3NA 2QF8A 3PR9A 3M85A 1N1AA 2A3EA 3KACA 2DK7A 1LJYA 2XP3A 3ARRA 4P8XA 1Q6HA 4UDMA 4TW8A 4DRJA 4IQ2A 2DT0A 4P8WA 5E64A 5JH8A 1FKIA 2DT3A 3LKXA 1FJDA 3ALFA 3AS0A 4S3KA 5DF0A 3IHZA 1Q6IA 4TW6A 3MQGA 2ZR6A 1WAWA 2YBUA 1OGGA 4NNRA 3ARQA 1W1YA 4J4OA 1QPLA 1ROUA 4G2PA 5DIVA 4DZ3A 3RFWA 1LL7A 1W9VA 3EIPA 1FKRA 1E9LA 2XP8A 5D75A 3WD2A 1UR8A 1ITXA 5GPRA 2YSGA 1TK7A 5E62A 3JYMA 2F21A 2P4VA 3W4RA
chains in the Genus database with same CATH topology
2DSWA 1D7JA 3FAPA 3MCBA 1K9RA 3GPKA 4LAVA 3CHDA 1SYTA 4DH0A 4IPXA 3PQHA 3O5MA 2DJYA 3PRAA 4AY1A 2JX8A 1O6IA 4ITZA 4GIVA 3FS8A 1C9HA 3ARTA 1H0IA 4ODKA 1FKSA 2RUDA 3AS3A 3B9AA 1F40A 2ZR5A 2DT1A 4ODQA 3WH0A 5HWCA 1ROTA 1HKMA 4WIWA 3AS2A 2YSHA 3ARXA 4IQCA 4LGXA 5B8IC 3ARYA 2KFWA 1LL6A 2Q5AA 2XP6A 1HKKA 3UQAA 1D7IA 3MDYB 3IK8A 3ARWA 3KZ7A 4ODOA 4ZPVR 5HW7A 5HW6A 2DWVA 2KI3A 1T11A 4MNLA 2YSIA 2M8IA 1FKJA 4KR0B 3WKZA 3I6CA 1D6OA 1FFQA 1XRVA 4J4NA 2XP4A 5HBFA 3O5OA 1JVWA 3JYJA 2MDIA 2WK2A 3G6MA 4DRIA 1FKHA 1D7HA 1ZBKA 1HJXA 3AS1A 2DSVA 1J4RA 4JFLA 3RGCA 2LAJA 4GGQA 2Y8NB 4DIPA 1UR9A 3KABA 1I5HW 2PI6A 4ZPTR 4QT2A 4R0XA 2MLZA 2F2DA 1WR7A 5GQBA 4DZ2A 3FSBA 2M3OW 4DWSC 3WD1A 3QOKA 3ARSA 2DSUA 3UQIA 1O6WA 4HBOA 4MTVA 5J6EA 4QZVB 4TW7A 4GLXA 5U47A 1Q1CA 4HARA 2A3BA 3EY6A 1NMVA 3KADA 4G50A 1TR8A 3OA5A 3WQVA 5DITA 2DK1A 1P5QA 1YATA 3O5FA 2M8JA 2OWOA 3KAGA 1W1VA 1WMVA 2WLYA 3UI4A 1JMQA 1NWSA 3CNGA 3O5GA 4MGVA 3AQUA 4JYSA 4KQZA 3TC5A 1ZBWA 1GUVA 4IT6A 4LAWA 4MNKA 3ODKA 2YSFA 1E6ZA 1J4HA 4FAPA 3KCEA 2FKEA 4W9OA 4WJXA 3JXVA 3ARZA 2B31A 1TFVA 1FLCA 1PINA 3NTPA 1EHNA 2OLHA 4Z2HA 3O5PA 5I98A 3O5KA 1LG2A 3WD4A 1NH6A 1W9UA 1E15A 2XPBA 2PV2A 2PBCA 5E5WA 1KFWA 2MPHA 5DO2A 2PV1A 4L72B 1LG1A 1W26A 4TX0A 4C02B 4U86A 3NI6A 4IT4A 3B8SA 4NSBA 1W9PA 1ZK6A 4W9PA 2A3CA 4DRNA 1XHGA 3UI6A 2PPPA 1GPFA 2UZ5A 3UI5A 3BXWA 1EDQA 4DWSD 1E6RA 2VN1A 4TNSA 2KO7A 3WL1A 2LGOA 4A0UA 1D2KA 2MF9A 5HT1A 2JV4A 2ZQUA 1E6PA 5E66A 2O92A 2PV3A 4Z2KA 1BKFA 3IKGA 4ODPA 1FKKA 2E45A 2FDMA 5HW8A 1FKLA 3TDBA 1B6CA 4ZPWR 2DSZA 4Q22A 2G41A 3RMEA 1EQ3A 2RURA 4P8UA 2MLYA 2G8ZA 2N87A 3LE4A 4LAYA 5AHTA 3ARVA 3CH9A 4QIBA 4Z2IA 4Q7NA 1NWRA 4FN2A 1HKJA 4JFMA 1A7XA 1W1TA 1FD9A 3OOBA 1ZU8A 1CTNA 2JZVA 1BL4A 1LQ0A 3UQBA 3CHFA 2DG9A 1H0GA 4DRKA 1YW5A 2XPAA 1VF8A 4MNMA 4N19A 4A0TA 2ZQSA 1ZB5A 4U85A 3TCZA 2WADA 3RM4A 2RSEA 2DPEA 1JNTA 3MQHA 1QZ2A 2ZAJA 2KXQA 2AWGA 3O5QA 2RUCA 1R9HA 2PPNA 1HKIA 3WQWA 2M1IA 2DT2A 2AOSA 1FFRA 1HJVA 2KGJA 3M7NA 4DWSA 3O5RA 1EG3A 4NZCA 1EYMA 4P8VA 3FSCA 4REXA 4DRQA 1RP5A 1TCOC 2ESCA 3G6LA 4WK9A 5DIUA 3L4HA 3WIJA 4JFIA 2OFNA 1E6NA 2LKNA 2MLXA 4DROA 1PBKA 3PRBA 4S3JA 2KR7A 2M08A 4TYOA 4PTMA 2ZQTA 1IX5A 5DEZA 2WAEA 4W9QA 5HKGA 1ZL1A 3PA7A 2DG3A 3LKXB 2YAJB 3MCBB 1QPFA 3FXYA 4XAKA 1K9QA 3CZ8A 2D9FA 3O5DA 1X6LA 2KE0A 1SR0A 3VAWA 4LAXA 1FKFA 2DG4A 1J6YA 5HTGA 2M2AA 3LUOA 2RUQA 3CHEA 2LJ4A 3PRDA 1F8AB 3CHCA 1NSGA 4DRHA 4ODRA 4O2TA 2DMVA 4BF8A 2RE3A 1W1PA 3O5JA 1EG4A 5BXJA 2ZR4A 3UF8A 3KAHA 1NWUA 4MPKA 1JNEA 2JXWA 1FKDA 1NWTA 4DRMA 3RM9A 1FKTA 4WKFA 2LPVA 3RM8A 1Q6UA 1U79A 4ML4A 1FKBA 2PPOA 3AROA 2O9OA 2QRVA 2IUZA 2L2SA 1GOIA 4MNJA 3B9EA 4W5UA 1OWQA 1L1PA 2EZ5W 3CGNA 3IKDA 3B9DA 4ZS6A 2XP5A 2YBTA 4E5RA 3NRKA 1OGBA 1RD6A 2ITKA 5GPGA 1ZCNA 3KAFA 3O5IA 3O5EA 3ALGA 3FY1A 2F4EA 1WNOA 3WD0A 1JNSA 2XP7A 1FKGA 1KT1A 3WD3A 2YSBA 3O5LA 4QT3A 4WKHA 1HJWA 1K9TA 4ODNA 2L4JA 5E65A 2JMFA 4ODMA 4Z2GA 1WB0A 2K8IA 4Z2LA 4R5EA 2BA1A 4MSPA 1JNDA 1EIBA 1ZBVA 2A3AA 2Y78A 4MAVA 3H9RB 1X6NA 4URIA 1Y0OA 2VCDA 1ZBCA 1J4IA 5HWBA 4JFJA 2IF4A 2WLZA 1FAPA 3KAIA 1KT0A 4DWSB 3ARUA 2RQSA 3WL0A 4U84A 2ZQVA 5CQ2A 4DT4A 5HUAA 3CGMA 3ARPA 1HXVA 4JFKA 1LL4A 1M5YA 2WM0A 4HBEA 1NMWA 2FAPA 4WKAA 2XP9A 4Z2JA 2MNTA 4ODLA 4DRPA 3B7XA 4L3NA 2QF8A 3PR9A 3M85A 1N1AA 2A3EA 3KACA 2DK7A 1LJYA 2XP3A 3ARRA 4P8XA 1Q6HA 4TW8A 4DRJA 4IQ2A 2DT0A 4P8WA 5E64A 5JH8A 1FKIA 2DT3A 3LKXA 1FJDA 3ALFA 3AS0A 4S3KA 5DF0A 3IHZA 1Q6IA 4TW6A 3MQGA 2ZR6A 1WAWA 2YBUA 1OGGA 4NNRA 3ARQA 1W1YA 4J4OA 1QPLA 1ROUA 4G2PA 5DIVA 4DZ3A 3RFWA 1LL7A 1W9VA 1FKRA 1E9LA 2XP8A 5D75A 3WD2A 1UR8A 1ITXA 5GPRA 2YSGA 1TK7A 5E62A 3JYMA 2F21A 3W4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O5F A;  2M8J A;  2XP7 A;  3KAG A;  1FKG A;  1KT1 A;  2RSE A;  2YSB A;  1D7J A;  1JNS A;  1WMV A;  3O5L A;  4QT3 A;  3UI4 A;  1JNT A;  1JMQ A;  1QZ2 A;  2ZAJ A;  3CNG A;  3FAP A;  3O5G A;  4MGV A;  2KXQ A;  2L4J A;  2AWG A;  2JMF A;  3O5Q A;  4JYS A;  4ODN A;  3TC5 A;  2K8I A;  4ODM A;  1K9R A;  3GPK A;  2RUC A;  4LAW A;  2BA1 A;  1R9H A;  2PPN A;  4LAV A;  4MSP A;  3ODK A;  2M1I A;  2Y78 A;  2YSF A;  2KGJ A;  3H9R B;  1J4H A;  4DH0 A;  3M7N A;  4FAP A;  4IPX A;  3O5M A;  2DJY A;  3KCE A;  1Y0O A;  2FKE A;  1EG3 A;  3O5R A;  4W9O A;  2JX8 A;  1EYM A;  3JXV A;  2VCD A;  4ITZ A;  4GIV A;  1PIN A;  3NTP A;  1C9H A;  1J4I A;  5HWB A;  4REX A;  1FKS A;  2RUD A;  3O5P A;  4ODK A;  4DRQ A;  4JFJ A;  1TCO C;  1F40 A;  2IF4 A;  3O5K A;  5I98 A;  2ZR5 A;  4ODQ A;  5HWC A;  3WH0 A;  1FAP A;  1ROT A;  5DIU A;  3KAI A;  3L4H A;  4DRO A;  4JFI A;  2XPB A;  1KT0 A;  2PBC A;  2OFN A;  2YSH A;  2PV2 A;  4IQC A;  2LKN A;  2MPH A;  2MLX A;  1PBK A;  2PV1 A;  2RQS A;  3PRB A;  2KFW A;  4U84 A;  2Q5A A;  2XP6 A;  2ZQV A;  5CQ2 A;  1W26 A;  1D7I A;  2ZQT A;  2KR7 A;  2M08 A;  3MDY B;  4TX0 A;  3IK8 A;  4TYO A;  4C02 B;  4DT4 A;  5HUA A;  4U86 A;  3KZ7 A;  3NI6 A;  4W9Q A;  4ODO A;  5HKG A;  3PA7 A;  3CGM A;  2DG3 A;  1ZK6 A;  5HW6 A;  5HW7 A;  1HXV A;  4JFK A;  4W9P A;  2DWV A;  2KI3 A;  1T11 A;  4DRN A;  2YSI A;  1M5Y A;  2M8I A;  1FKJ A;  1QPF A;  3UI6 A;  2PPP A;  1NMW A;  2FAP A;  1K9Q A;  3I6C A;  2D9F A;  3O5D A;  1D6O A;  2UZ5 A;  2XP9 A;  3UI5 A;  2KE0 A;  3VAW A;  4LAX A;  4J4N A;  1FKF A;  2XP4 A;  2MNT A;  2VN1 A;  2DG4 A;  4ODL A;  2KO7 A;  4TNS A;  3O5O A;  1J6Y A;  1JVW A;  3JYJ A;  4DRP A;  5HTG A;  2LGO A;  2M2A A;  2MDI A;  3LUO A;  3B7X A;  2RUQ A;  2MF9 A;  2LJ4 A;  4DRI A;  5HT1 A;  3M85 A;  2JV4 A;  2ZQU A;  1F8A B;  3PRD A;  1N1A A;  5B8I C;  1FKH A;  3KAC A;  2DK7 A;  2PV3 A;  2XP3 A;  1D7H A;  1BKF A;  3IKG A;  1Q6H A;  1NSG A;  4ODP A;  4TW8 A;  4DRH A;  4ODR A;  1FKK A;  2E45 A;  2DMV A;  4O2T A;  1FKL A;  4IQ2 A;  4DRJ A;  5HW8 A;  3TDB A;  2RE3 A;  1J4R A;  4JFL A;  2LAJ A;  3RGC A;  1B6C A;  3O5J A;  4BF8 A;  1EG4 A;  1FKI A;  5BXJ A;  4GGQ A;  2ZR4 A;  3UF8 A;  1FJD A;  1EQ3 A;  4DIP A;  3KAH A;  2RUR A;  3KAB A;  1I5H W;  2JXW A;  1FKD A;  2MLY A;  2N87 A;  3IHZ A;  4DRM A;  1Q6I A;  4QT2 A;  1FKT A;  4TW6 A;  3LE4 A;  4LAY A;  5AHT A;  2LPV A;  4R0X A;  2ZR6 A;  2MLZ A;  2F2D A;  4QIB A;  1WR7 A;  1Q6U A;  1U79 A;  1FKB A;  4DZ2 A;  4FN2 A;  2M3O W;  2PPO A;  4NNR A;  4J4O A;  4JFM A;  1QPL A;  1ROU A;  1A7X A;  4G2P A;  5DIV A;  2L2S A;  4DZ3 A;  1FD9 A;  3OOB A;  3RFW A;  3UQI A;  1O6W A;  2JZV A;  5J6E A;  1BL4 A;  1L1P A;  2EZ5 W;  3CGN A;  3IKD A;  3UQB A;  1FKR A;  2XP5 A;  3NRK A;  4E5R A;  4TW7 A;  1Q1C A;  2DG9 A;  2XP8 A;  5D75 A;  4DRK A;  2ITK A;  5GPG A;  3EY6 A;  1ZCN A;  1NMV A;  3KAD A;  3KAF A;  4G50 A;  1YW5 A;  3UQA A;  2YSG A;  3O5I A;  2XPA A;  3O5E A;  1TK7 A;  4N19 A;  2ZQS A;  3JYM A;  4U85 A;  2F4E A;  2F21 A;  5DIT A;  3TCZ A;  2DK1 A;  1P5Q A;  1YAT A; 
#chains in the Genus database with same CATH topology
 2DSW A;  1D7J A;  3FAP A;  3MCB A;  1K9R A;  3GPK A;  4LAV A;  3CHD A;  1SYT A;  4DH0 A;  4IPX A;  3PQH A;  3O5M A;  2DJY A;  3PRA A;  4AY1 A;  2JX8 A;  1O6I A;  4ITZ A;  4GIV A;  3FS8 A;  1C9H A;  3ART A;  1H0I A;  4ODK A;  1FKS A;  2RUD A;  3AS3 A;  3B9A A;  1F40 A;  2ZR5 A;  2DT1 A;  4ODQ A;  3WH0 A;  5HWC A;  1ROT A;  1HKM A;  4WIW A;  3AS2 A;  2YSH A;  3ARX A;  4IQC A;  4LGX A;  5B8I C;  3ARY A;  2KFW A;  1LL6 A;  2Q5A A;  2XP6 A;  1HKK A;  3UQA A;  1D7I A;  3MDY B;  3IK8 A;  3ARW A;  3KZ7 A;  4ODO A;  4ZPV R;  5HW7 A;  5HW6 A;  2DWV A;  2KI3 A;  1T11 A;  4MNL A;  2YSI A;  2M8I A;  1FKJ A;  4KR0 B;  3WKZ A;  3I6C A;  1D6O A;  1FFQ A;  1XRV A;  4J4N A;  2XP4 A;  5HBF A;  3O5O A;  1JVW A;  3JYJ A;  2MDI A;  2WK2 A;  3G6M A;  4DRI A;  1FKH A;  1D7H A;  1ZBK A;  1HJX A;  3AS1 A;  2DSV A;  1J4R A;  4JFL A;  3RGC A;  2LAJ A;  4GGQ A;  2Y8N B;  4DIP A;  1E44 A;  1UR9 A;  3KAB A;  1I5H W;  2PI6 A;  4ZPT R;  4QT2 A;  4R0X A;  2MLZ A;  2F2D A;  1WR7 A;  3GU0 A;  5GQB A;  4DZ2 A;  3FSB A;  2M3O W;  4DWS C;  3WD1 A;  3QOK A;  3ARS A;  2DSU A;  3UQI A;  1O6W A;  4HBO A;  4MTV A;  5J6E A;  4QZV B;  4TW7 A;  4GLX A;  5U47 A;  1Q1C A;  4HAR A;  2A3B A;  3EY6 A;  1NMV A;  3KAD A;  4G50 A;  1TR8 A;  3OA5 A;  3WQV A;  5DIT A;  2DK1 A;  1P5Q A;  1YAT A;  3O5F A;  2M8J A;  2OWO A;  3KAG A;  1W1V A;  1WMV A;  2WLY A;  3UI4 A;  1JMQ A;  1NWS A;  3CNG A;  3O5G A;  4MGV A;  3AQU A;  4JYS A;  4KQZ A;  3TC5 A;  1ZBW A;  1GUV A;  4IT6 A;  4LAW A;  4MNK A;  3ODK A;  2YSF A;  1E6Z A;  1J4H A;  4FAP A;  3KCE A;  2FKE A;  4W9O A;  4WJX A;  3JXV A;  3ARZ A;  2B31 A;  1TFV A;  1FLC A;  1PIN A;  3NTP A;  1JCH B;  1EHN A;  2OLH A;  4Z2H A;  3O5P A;  5I98 A;  3O5K A;  1LG2 A;  3WD4 A;  1NH6 A;  1W9U A;  1E15 A;  2XPB A;  2PV2 A;  2PBC A;  5E5W A;  1KFW A;  2MPH A;  5DO2 A;  2PV1 A;  4L72 B;  1LG1 A;  1W26 A;  4TX0 A;  4C02 B;  4U86 A;  3NI6 A;  4IT4 A;  3B8S A;  4NSB A;  1W9P A;  1ZK6 A;  4W9P A;  2A3C A;  4DRN A;  1XHG A;  3UI6 A;  2PPP A;  1GPF A;  2UZ5 A;  3UI5 A;  3BXW A;  1EDQ A;  4DWS D;  1E6R A;  2VN1 A;  4TNS A;  2KO7 A;  3WL1 A;  2LGO A;  4A0U A;  1D2K A;  2MF9 A;  5HT1 A;  2JV4 A;  2ZQU A;  1E6P A;  5E66 A;  2O92 A;  2PV3 A;  4Z2K A;  1BKF A;  3IKG A;  4ODP A;  1FKK A;  2E45 A;  2FDM A;  3BMB A;  1FKL A;  5HW8 A;  3TDB A;  1B6C A;  4ZPW R;  2DSZ A;  4Q22 A;  2G41 A;  3RME A;  1EQ3 A;  2RUR A;  4P8U A;  2MLY A;  2G8Z A;  2N87 A;  3LE4 A;  4LAY A;  5AHT A;  3ARV A;  3CH9 A;  4QIB A;  4Z2I A;  4Q7N A;  1NWR A;  4FN2 A;  1HKJ A;  4JFM A;  1A7X A;  1W1T A;  1FD9 A;  3OOB A;  1ZU8 A;  1CTN A;  2JZV A;  1BL4 A;  1LQ0 A;  3UQB A;  3CHF A;  2DG9 A;  1H0G A;  4DRK A;  1YW5 A;  2XPA A;  1VF8 A;  4MNM A;  4N19 A;  4A0T A;  2ZQS A;  1ZB5 A;  4U85 A;  3TCZ A;  2WAD A;  3RM4 A;  2RSE A;  2DPE A;  1JNT A;  3MQH A;  1QZ2 A;  2ZAJ A;  2KXQ A;  2AWG A;  3O5Q A;  2RUC A;  1R9H A;  2PPN A;  1HKI A;  3WQW A;  2M1I A;  2DT2 A;  2AOS A;  1FFR A;  1HJV A;  2KGJ A;  3M7N A;  4DWS A;  3O5R A;  1EG3 A;  4NZC A;  1EYM A;  4P8V A;  3FSC A;  4REX A;  4DRQ A;  1RP5 A;  1TCO C;  2ESC A;  3G6L A;  4WK9 A;  5DIU A;  3L4H A;  3WIJ A;  4JFI A;  2OFN A;  1E6N A;  2LKN A;  2MLX A;  4DRO A;  1PBK A;  3PRB A;  4S3J A;  2KR7 A;  2M08 A;  4TYO A;  2F23 A;  4PTM A;  2ZQT A;  1IX5 A;  5DEZ A;  2WAE A;  4W9Q A;  5HKG A;  1ZL1 A;  3PA7 A;  2DG3 A;  3LKX B;  2YAJ B;  3MCB B;  1QPF A;  3FXY A;  4XAK A;  1K9Q A;  3CZ8 A;  2D9F A;  3O5D A;  1X6L A;  2KE0 A;  1SR0 A;  3VAW A;  4LAX A;  1FKF A;  2DG4 A;  1J6Y A;  5HTG A;  2M2A A;  3LUO A;  2RUQ A;  3CHE A;  2LJ4 A;  3PRD A;  1F8A B;  3CHC A;  1NSG A;  4DRH A;  4ODR A;  4O2T A;  2DMV A;  4BF8 A;  2RE3 A;  1W1P A;  3O5J A;  1EG4 A;  5BXJ A;  2ZR4 A;  3UF8 A;  3KAH A;  1NWU A;  4MPK A;  1JNE A;  2JXW A;  1FKD A;  1NWT A;  4DRM A;  3RM9 A;  1FKT A;  4WKF A;  2LPV A;  3RM8 A;  2B5U B;  1Q6U A;  1U79 A;  4ML4 A;  1FKB A;  2PPO A;  3ARO A;  2O9O A;  2QRV A;  2IUZ A;  2L2S A;  1GOI A;  3GTY X;  4MNJ A;  3B9E A;  4W5U A;  1OWQ A;  1L1P A;  2EZ5 W;  3CGN A;  3IKD A;  3B9D A;  4ZS6 A;  2XP5 A;  2YBT A;  4E5R A;  3NRK A;  1OGB A;  1RD6 A;  2ITK A;  5GPG A;  1ZCN A;  3KAF A;  2EUL A;  3O5I A;  3O5E A;  3ALG A;  3FY1 A;  2F4E A;  1WNO A;  3WD0 A;  1JNS A;  2XP7 A;  1FKG A;  1KT1 A;  3WD3 A;  2YSB A;  3O5L A;  4QT3 A;  4WKH A;  1HJW A;  1K9T A;  4ODN A;  2L4J A;  5E65 A;  2JMF A;  4ODM A;  4Z2G A;  1WB0 A;  2K8I A;  4Z2L A;  4R5E A;  1GRJ A;  2BA1 A;  4MSP A;  1JND A;  1EIB A;  1ZBV A;  2A3A A;  2Y78 A;  4MAV A;  3H9R B;  1X6N A;  4URI A;  1Y0O A;  2VCD A;  1ZBC A;  1J4I A;  5HWB A;  4JFJ A;  2IF4 A;  2WLZ A;  1FAP A;  3KAI A;  2PN0 A;  1KT0 A;  4DWS B;  3ARU A;  2RQS A;  3WL0 A;  4U84 A;  2ZQV A;  5CQ2 A;  4DT4 A;  5HUA A;  3CGM A;  3ARP A;  1HXV A;  4JFK A;  2ETN A;  1LL4 A;  1M5Y A;  2WM0 A;  4HBE A;  1NMW A;  2FAP A;  4WKA A;  2XP9 A;  4Z2J A;  2MNT A;  4ODL A;  4DRP A;  3B7X A;  4L3N A;  2QF8 A;  3PR9 A;  3M85 A;  1N1A A;  2A3E A;  3KAC A;  2DK7 A;  1LJY A;  2XP3 A;  3ARR A;  4P8X A;  1Q6H A;  4UDM A;  4TW8 A;  4DRJ A;  4IQ2 A;  2DT0 A;  4P8W A;  5E64 A;  5JH8 A;  1FKI A;  2DT3 A;  3LKX A;  1FJD A;  3ALF A;  3AS0 A;  4S3K A;  5DF0 A;  3IHZ A;  1Q6I A;  4TW6 A;  3MQG A;  2ZR6 A;  1WAW A;  2YBU A;  1OGG A;  4NNR A;  3ARQ A;  1W1Y A;  4J4O A;  1QPL A;  1ROU A;  4G2P A;  5DIV A;  4DZ3 A;  3RFW A;  1LL7 A;  1W9V A;  3EIP A;  1FKR A;  1E9L A;  2XP8 A;  5D75 A;  3WD2 A;  1UR8 A;  1ITX A;  5GPR A;  2YSG A;  1TK7 A;  5E62 A;  3JYM A;  2F21 A;  2P4V A;  3W4R A; 
#chains in the Genus database with same CATH homology
 2DSW A;  1D7J A;  3FAP A;  3MCB A;  1K9R A;  3GPK A;  4LAV A;  3CHD A;  1SYT A;  4DH0 A;  4IPX A;  3PQH A;  3O5M A;  2DJY A;  3PRA A;  4AY1 A;  2JX8 A;  1O6I A;  4ITZ A;  4GIV A;  3FS8 A;  1C9H A;  3ART A;  1H0I A;  4ODK A;  1FKS A;  2RUD A;  3AS3 A;  3B9A A;  1F40 A;  2ZR5 A;  2DT1 A;  4ODQ A;  3WH0 A;  5HWC A;  1ROT A;  1HKM A;  4WIW A;  3AS2 A;  2YSH A;  3ARX A;  4IQC A;  4LGX A;  5B8I C;  3ARY A;  2KFW A;  1LL6 A;  2Q5A A;  2XP6 A;  1HKK A;  3UQA A;  1D7I A;  3MDY B;  3IK8 A;  3ARW A;  3KZ7 A;  4ODO A;  4ZPV R;  5HW7 A;  5HW6 A;  2DWV A;  2KI3 A;  1T11 A;  4MNL A;  2YSI A;  2M8I A;  1FKJ A;  4KR0 B;  3WKZ A;  3I6C A;  1D6O A;  1FFQ A;  1XRV A;  4J4N A;  2XP4 A;  5HBF A;  3O5O A;  1JVW A;  3JYJ A;  2MDI A;  2WK2 A;  3G6M A;  4DRI A;  1FKH A;  1D7H A;  1ZBK A;  1HJX A;  3AS1 A;  2DSV A;  1J4R A;  4JFL A;  3RGC A;  2LAJ A;  4GGQ A;  2Y8N B;  4DIP A;  1UR9 A;  3KAB A;  1I5H W;  2PI6 A;  4ZPT R;  4QT2 A;  4R0X A;  2MLZ A;  2F2D A;  1WR7 A;  5GQB A;  4DZ2 A;  3FSB A;  2M3O W;  4DWS C;  3WD1 A;  3QOK A;  3ARS A;  2DSU A;  3UQI A;  1O6W A;  4HBO A;  4MTV A;  5J6E A;  4QZV B;  4TW7 A;  4GLX A;  5U47 A;  1Q1C A;  4HAR A;  2A3B A;  3EY6 A;  1NMV A;  3KAD A;  4G50 A;  1TR8 A;  3OA5 A;  3WQV A;  5DIT A;  2DK1 A;  1P5Q A;  1YAT A;  3O5F A;  2M8J A;  2OWO A;  3KAG A;  1W1V A;  1WMV A;  2WLY A;  3UI4 A;  1JMQ A;  1NWS A;  3CNG A;  3O5G A;  4MGV A;  3AQU A;  4JYS A;  4KQZ A;  3TC5 A;  1ZBW A;  1GUV A;  4IT6 A;  4LAW A;  4MNK A;  3ODK A;  2YSF A;  1E6Z A;  1J4H A;  4FAP A;  3KCE A;  2FKE A;  4W9O A;  4WJX A;  3JXV A;  3ARZ A;  2B31 A;  1TFV A;  1FLC A;  1PIN A;  3NTP A;  1EHN A;  2OLH A;  4Z2H A;  3O5P A;  5I98 A;  3O5K A;  1LG2 A;  3WD4 A;  1NH6 A;  1W9U A;  1E15 A;  2XPB A;  2PV2 A;  2PBC A;  5E5W A;  1KFW A;  2MPH A;  5DO2 A;  2PV1 A;  4L72 B;  1LG1 A;  1W26 A;  4TX0 A;  4C02 B;  4U86 A;  3NI6 A;  4IT4 A;  3B8S A;  4NSB A;  1W9P A;  1ZK6 A;  4W9P A;  2A3C A;  4DRN A;  1XHG A;  3UI6 A;  2PPP A;  1GPF A;  2UZ5 A;  3UI5 A;  3BXW A;  1EDQ A;  4DWS D;  1E6R A;  2VN1 A;  4TNS A;  2KO7 A;  3WL1 A;  2LGO A;  4A0U A;  1D2K A;  2MF9 A;  5HT1 A;  2JV4 A;  2ZQU A;  1E6P A;  5E66 A;  2O92 A;  2PV3 A;  4Z2K A;  1BKF A;  3IKG A;  4ODP A;  1FKK A;  2E45 A;  2FDM A;  5HW8 A;  1FKL A;  3TDB A;  1B6C A;  4ZPW R;  2DSZ A;  4Q22 A;  2G41 A;  3RME A;  1EQ3 A;  2RUR A;  4P8U A;  2MLY A;  2G8Z A;  2N87 A;  3LE4 A;  4LAY A;  5AHT A;  3ARV A;  3CH9 A;  4QIB A;  4Z2I A;  4Q7N A;  1NWR A;  4FN2 A;  1HKJ A;  4JFM A;  1A7X A;  1W1T A;  1FD9 A;  3OOB A;  1ZU8 A;  1CTN A;  2JZV A;  1BL4 A;  1LQ0 A;  3UQB A;  3CHF A;  2DG9 A;  1H0G A;  4DRK A;  1YW5 A;  2XPA A;  1VF8 A;  4MNM A;  4N19 A;  4A0T A;  2ZQS A;  1ZB5 A;  4U85 A;  3TCZ A;  2WAD A;  3RM4 A;  2RSE A;  2DPE A;  1JNT A;  3MQH A;  1QZ2 A;  2ZAJ A;  2KXQ A;  2AWG A;  3O5Q A;  2RUC A;  1R9H A;  2PPN A;  1HKI A;  3WQW A;  2M1I A;  2DT2 A;  2AOS A;  1FFR A;  1HJV A;  2KGJ A;  3M7N A;  4DWS A;  3O5R A;  1EG3 A;  4NZC A;  1EYM A;  4P8V A;  3FSC A;  4REX A;  4DRQ A;  1RP5 A;  1TCO C;  2ESC A;  3G6L A;  4WK9 A;  5DIU A;  3L4H A;  3WIJ A;  4JFI A;  2OFN A;  1E6N A;  2LKN A;  2MLX A;  4DRO A;  1PBK A;  3PRB A;  4S3J A;  2KR7 A;  2M08 A;  4TYO A;  4PTM A;  2ZQT A;  1IX5 A;  5DEZ A;  2WAE A;  4W9Q A;  5HKG A;  1ZL1 A;  3PA7 A;  2DG3 A;  3LKX B;  2YAJ B;  3MCB B;  1QPF A;  3FXY A;  4XAK A;  1K9Q A;  3CZ8 A;  2D9F A;  3O5D A;  1X6L A;  2KE0 A;  1SR0 A;  3VAW A;  4LAX A;  1FKF A;  2DG4 A;  1J6Y A;  5HTG A;  2M2A A;  3LUO A;  2RUQ A;  3CHE A;  2LJ4 A;  3PRD A;  1F8A B;  3CHC A;  1NSG A;  4DRH A;  4ODR A;  4O2T A;  2DMV A;  4BF8 A;  2RE3 A;  1W1P A;  3O5J A;  1EG4 A;  5BXJ A;  2ZR4 A;  3UF8 A;  3KAH A;  1NWU A;  4MPK A;  1JNE A;  2JXW A;  1FKD A;  1NWT A;  4DRM A;  3RM9 A;  1FKT A;  4WKF A;  2LPV A;  3RM8 A;  1Q6U A;  1U79 A;  4ML4 A;  1FKB A;  2PPO A;  3ARO A;  2O9O A;  2QRV A;  2IUZ A;  2L2S A;  1GOI A;  4MNJ A;  3B9E A;  4W5U A;  1OWQ A;  1L1P A;  2EZ5 W;  3CGN A;  3IKD A;  3B9D A;  4ZS6 A;  2XP5 A;  2YBT A;  4E5R A;  3NRK A;  1OGB A;  1RD6 A;  2ITK A;  5GPG A;  1ZCN A;  3KAF A;  3O5I A;  3O5E A;  3ALG A;  3FY1 A;  2F4E A;  1WNO A;  3WD0 A;  1JNS A;  2XP7 A;  1FKG A;  1KT1 A;  3WD3 A;  2YSB A;  3O5L A;  4QT3 A;  4WKH A;  1HJW A;  1K9T A;  4ODN A;  2L4J A;  5E65 A;  2JMF A;  4ODM A;  4Z2G A;  1WB0 A;  2K8I A;  4Z2L A;  4R5E A;  2BA1 A;  4MSP A;  1JND A;  1EIB A;  1ZBV A;  2A3A A;  2Y78 A;  4MAV A;  3H9R B;  1X6N A;  4URI A;  1Y0O A;  2VCD A;  1ZBC A;  1J4I A;  5HWB A;  4JFJ A;  2IF4 A;  2WLZ A;  1FAP A;  3KAI A;  1KT0 A;  4DWS B;  3ARU A;  2RQS A;  3WL0 A;  4U84 A;  2ZQV A;  5CQ2 A;  4DT4 A;  5HUA A;  3CGM A;  3ARP A;  1HXV A;  4JFK A;  1LL4 A;  1M5Y A;  2WM0 A;  4HBE A;  1NMW A;  2FAP A;  4WKA A;  2XP9 A;  4Z2J A;  2MNT A;  4ODL A;  4DRP A;  3B7X A;  4L3N A;  2QF8 A;  3PR9 A;  3M85 A;  1N1A A;  2A3E A;  3KAC A;  2DK7 A;  1LJY A;  2XP3 A;  3ARR A;  4P8X A;  1Q6H A;  4TW8 A;  4DRJ A;  4IQ2 A;  2DT0 A;  4P8W A;  5E64 A;  5JH8 A;  1FKI A;  2DT3 A;  3LKX A;  1FJD A;  3ALF A;  3AS0 A;  4S3K A;  5DF0 A;  3IHZ A;  1Q6I A;  4TW6 A;  3MQG A;  2ZR6 A;  1WAW A;  2YBU A;  1OGG A;  4NNR A;  3ARQ A;  1W1Y A;  4J4O A;  1QPL A;  1ROU A;  4G2P A;  5DIV A;  4DZ3 A;  3RFW A;  1LL7 A;  1W9V A;  1FKR A;  1E9L A;  2XP8 A;  5D75 A;  3WD2 A;  1UR8 A;  1ITX A;  5GPR A;  2YSG A;  1TK7 A;  5E62 A;  3JYM A;  2F21 A;  3W4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...