2XP5A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
157
structure length
145
Chain Sequence
b'LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 42
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp5A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp5A02
1KT1A 2RE3A 4U86A 1NMWA 1JNTA 1B6CA 1K9RA 3KAGA 2KE0A 1FJDA 3M7NA 1M5YA 3KAFA 5HUAA 2MLXA 4ODRA 3O5DA 4DIPA 1BKFA 1K9QA 2DG3A 1FKKA 4ODNA 2MDIA 2LJ4A 4MSPA 3UI4A 2MPHA 4DRHA 2PV2A 2XP5A 3UI6A 4J4OA 2KI3A 4ODLA 1Q6HA 3H9RB 3NRKA 4R0XA 5DITA 3TC5A 5D75A 4W9OA 1ROTA 4E5RA 1FKDA 4LAXA 2IF4A 2MF9A 5HWCA 1FKLA 2F4EA 4GGQA 4REXA 4JFLA 3O5QA 3NI6A 2XPAA 2RSEA 2Q5AA 2DWVA 3O5EA 2DG9A 2M2AA 3CGMA 4TX0A 2M8JA 2L4JA 4ITZA 1Q6UA 1F8AB 4BF8A 1TCOC 3RFWA 2JXWA 3O5FA 2RUDA 2XP8A 5HKGA 1HXVA 3O5GA 1A7XA 1FD9A 3LUOA 3FAPA 1F40A 3CGNA 1FKHA 2ZQVA 5HW6A 2LPVA 1N1AA 2OFNA 4IQ2A 4DRPA 3KAIA 2ZAJA 1EQ3A 4J4NA 2KO7A 1JVWA 2VN1A 3KABA 4DRJA 1Q6IA 3TDBA 3UQBA 3UF8A 4JYSA 3IHZA 5DIUA 4DRIA 4LAYA 1JMQA 2LAJA 5CQ2A 4TW6A 3M85A 2ZQTA 5HT1A 4W9PA 2BA1A 5I98A 1EYMA 1C9HA 2FAPA 2ZR5A 2KXQA 5DIVA 2DJYA 1D6OA 1W26A 3VAWA 4ODMA 1YATA 2L2SA 4JFMA 3UQAA 2M08A 2XPBA 2N87A 2KGJA 5HW8A 2DG4A 3O5MA 4ODQA 4TW7A 4U84A 4QIBA 1QZ2A 2Y78A 1TK7A 4G50A 1FKJA 2YSIA 1Y0OA 2XP6A 2RQSA 3PRDA 1J4IA 1D7IA 5J6EA 1D7HA 2RUCA 3KZ7A 4W9QA 1EG4A 3JYJA 1EG3A 3CNGA 2D9FA 1QPLA 2ITKA 3MDYB 4IPXA 3NTPA 1FKBA 4QT3A 2ZR4A 2YSBA 4MGVA 4N19A 4C02B 3IKGA 2JZVA 3EY6A 2XP4A 4DRQA 2DMVA 1QPFA 2ZR6A 2UZ5A 3O5RA 1L1PA 3JYMA 2KR7A 1O6WA 4TW8A 1J4RA 3OOBA 2AWGA 5BXJA 4DZ3A 3B7XA 2PPPA 2ZQSA 2ZQUA 4JFIA 2LGOA 5HTGA 2M8IA 4TYOA 2PPNA 4TNSA 1JNSA 3UQIA 2VCDA 2XP3A 3IKDA 1NSGA 4DRNA 4DZ2A 2LKNA 4JFJA 1U79A 3I6CA 4LAVA 1ROUA 4IQCA 1T11A 2XP7A 2PV3A 4FAPA 3UI5A 3ODKA 4ODPA 3KAHA 1PBKA 1J6YA 1Q1CA 3KCEA 2M1IA 2PBCA 2M3OW 1FKIA 4DH0A 2EZ5W 3O5PA 4DT4A 1KT0A 1WR7A 3RGCA 2YSGA 4U85A 1FKSA 4FN2A 1PINA 1P5QA 2KFWA 1R9HA 2JV4A 1FKGA 4GIVA 2PPOA 3L4HA 2JX8A 2MLYA 1YW5A 3KACA 3GPKA 2PV1A 4DRKA 2MLZA 2F2DA 2JMFA 4JFKA 3JXVA 4LAWA 2DK1A 5AHTA 3O5OA 2DK7A 3TCZA 1J4HA 3O5JA 5B8IC 1FAPA 3O5LA 4DROA 5HWBA 2RUQA 4O2TA 1NMVA 1FKFA 1FKRA 2E45A 1FKTA 3WH0A 1BL4A 5HW7A 1I5HW 4DRMA 3O5IA 2YSHA 2MNTA 2F21A 2K8IA 1ZK6A 3IK8A 4ODKA 2XP9A 1WMVA 4G2PA 4NNRA 1D7JA 4ODOA 3O5KA 3PRBA 4QT2A 1ZCNA 5GPGA 3KADA 2FKEA 2YSFA 3LE4A 3PA7A 2RURA
chains in the Genus database with same CATH superfamily
1TR8A 3WD2A 1KT1A 3CHEA 4DWSB 1LG2A 2RE3A 4U86A 1NMWA 1JNTA 1B6CA 1K9RA 2WM0A 3KAGA 2KE0A 3ARXA 5E64A 4Z2GA 3PRAA 3ARTA 4WKHA 1FJDA 3M7NA 1W9PA 1M5YA 4MNKA 3KAFA 5HUAA 1CTNA 2MLXA 4ODRA 3O5DA 1H0IA 4DIPA 1BKFA 1H0GA 5DO2A 1K9QA 1ZBCA 2DG3A 1FKKA 4KQZA 4ODNA 1HJWA 2MDIA 1NWTA 4HARA 4MPKA 2LJ4A 1E6RA 4MSPA 3UI4A 1KFWA 2MPHA 4DRHA 2PV2A 4XAKA 2XP5A 2IUZA 3UI6A 4J4OA 1W9UA 2KI3A 2WLZA 4ODLA 1Q6HA 3H9RB 4A0TA 3NRKA 2G41A 4R0XA 3WQVA 5DITA 1ZBWA 3TC5A 5D75A 1RP5A 1E44A 4W9OA 1ROTA 4E5RA 3ALGA 4S3KA 1FKDA 1LG1A 4LAXA 1ZB5A 2IF4A 2MF9A 5HWCA 1FKLA 2F4EA 4DWSA 4GGQA 4REXA 2DT2A 1FFQA 4JFLA 3O5QA 3NI6A 2XPAA 3FS8A 2RSEA 2A3BA 2Q5AA 1HKIA 4WK9A 2DWVA 1GOIA 3O5EA 1X6NA 2DG9A 2M2AA 3WD4A 3CGMA 4TX0A 3ARPA 3FSCA 2M8JA 4QZVB 4ZS6A 2L4JA 1FLCA 3RM8A 4ITZA 1Q6UA 4WJXA 1E6ZA 1F8AB 1SR0A 4BF8A 1TCOC 3RFWA 2O9OA 2JXWA 4DWSC 2G8ZA 3O5FA 2RUDA 2XP8A 5HKGA 1HXVA 3O5GA 1ZU8A 3CHDA 4WKAA 1A7XA 1FD9A 5HBFA 2A3AA 3LUOA 3FAPA 1F40A 3CGNA 3CHFA 1FKHA 4IT6A 3MQGA 2F23A 2WAEA 2ZQVA 5HW6A 4R5EA 5U47A 2O92A 3MCBB 2LPVA 1N1AA 3FSBA 4MAVA 2WK2A 2OFNA 4IQ2A 1OGBA 3WL1A 4DRPA 3KAIA 2ZAJA 1EQ3A 4J4NA 2KO7A 1JVWA 2VN1A 1NWRA 3BMBA 4MNMA 3KABA 1LJYA 4DRJA 1OWQA 1Q6IA 4PTMA 1WAWA 3QOKA 1E6NA 4AY1A 3TDBA 3CZ8A 3WKZA 3UQBA 3BXWA 1HKMA 1HJXA 3UF8A 4JYSA 1E15A 3IHZA 1E9LA 1HKKA 4P8VA 4P8XA 1LL6A 5DIUA 4DRIA 1FFRA 3ARQA 2OWOA 4LAYA 1JMQA 3WL0A 1RD6A 3LKXB 2LAJA 5CQ2A 4TW6A 3M85A 2ZQTA 5HT1A 4W9PA 4MTVA 4UDMA 2BA1A 5I98A 1EYMA 3AS0A 1C9HA 2FAPA 2ZR5A 1LQ0A 2WLYA 4KR0B 1O6IA 3B9DA 1W1YA 2KXQA 3MCBA 5E65A 5DIVA 3FY1A 1EHNA 3ARVA 2DJYA 1D6OA 3CHCA 1W26A 3VAWA 3RMEA 4ODMA 1YATA 2L2SA 3OA5A 2ESCA 4JFMA 2A3CA 3FXYA 3UQAA 3AS2A 2M08A 2XPBA 2N87A 1GUVA 1TFVA 2KGJA 5HW8A 4GLXA 2DG4A 2Y8NB 3AQUA 5JH8A 2PN0A 1JNDA 3RM4A 3O5MA 1LL4A 1EIBA 3B9EA 3AROA 4Q7NA 4ZPWR 4ODQA 4TW7A 2A3EA 4U84A 3B8SA 2EULA 4P8WA 4QIBA 1QZ2A 1TK7A 2Y78A 1FKJA 4G50A 3ARUA 3W4RA 2YSIA 1Y0OA 2XP6A 1GPFA 2QF8A 1ZBKA 2RQSA 2YBUA 5DEZA 3PRDA 3LKXA 1J4IA 1D7IA 5GPRA 2DSUA 5J6EA 3AS1A 1D7HA 2RUCA 3KZ7A 4W9QA 4P8UA 3WD1A 4A0UA 1EG4A 3JYJA 4ZPTR 1EG3A 3CNGA 2D9FA 1QPLA 2ITKA 3MDYB 4IPXA 3NTPA 1FKBA 4QT3A 5GQBA 2ZR4A 3ARWA 2YSBA 4MGVA 4N19A 4C02B 1XRVA 3IKGA 2JZVA 3EY6A 2XP4A 4Z2JA 1JNEA 1ZL1A 3GTYX 4DRQA 2DMVA 1QPFA 2ZR6A 1ITXA 2UZ5A 4URIA 3O5RA 3G6MA 2OLHA 3AS3A 3ARZA 2B5UB 1L1PA 3JYMA 4ML4A 2KR7A 3EIPA 1O6WA 3PQHA 5E5WA 1J4RA 3OOBA 4TW8A 4WIWA 2AWGA 5BXJA 1D2KA 4DZ3A 3B7XA 1X6LA 2PPPA 2ZQSA 2ZQUA 4HBOA 4JFIA 3ARYA 1NWUA 2LGOA 2DSZA 5HTGA 2M8IA 3B9AA 4TYOA 3WD0A 2YBTA 1ZBVA 2PPNA 4TNSA 2B31A 1JNSA 3UQIA 2VCDA 2XP3A 3IKDA 1NSGA 1HJVA 2DT0A 4DRNA 2PI6A 4DZ2A 2LKNA 1W1PA 3PR9A 4JFJA 1K9TA 1U79A 1W1VA 2YAJB 1UR8A 1WNOA 3I6CA 4Z2KA 4W5UA 4LAVA 1ROUA 4IQCA 1T11A 2XP7A 4Q22A 2PV3A 3G6LA 4FAPA 3UI5A 3ODKA 1GRJA 1IX5A 4ODPA 3KAHA 1PBKA 1J6YA 4S3JA 1Q1CA 1HKJA 2DSWA 3KCEA 2M1IA 4Z2IA 2PBCA 2M3OW 1FKIA 4DH0A 2EZ5W 3O5PA 3GU0A 4DT4A 1KT0A 1XHGA 1VF8A 1WR7A 5E66A 3ARSA 3RGCA 2YSGA 2P4VA 4U85A 4L72B 3RM9A 1FKSA 4MNLA 4FN2A 1PINA 1P5QA 2KFWA 4HBEA 5DF0A 1R9HA 2JV4A 4NSBA 1FKGA 4GIVA 2PPOA 3L4HA 2AOSA 2JX8A 2DT3A 1E6PA 2MLYA 1YW5A 3KACA 3GPKA 2PV1A 1W9VA 4DRKA 2MLZA 2DT1A 2F2DA 2JMFA 4JFKA 3JXVA 4LAWA 2DK1A 5AHTA 3O5OA 4DWSD 4Z2HA 4Z2LA 2DK7A 3TCZA 1J4HA 4ZPVR 3O5JA 2QRVA 2WADA 5B8IC 3WQWA 1FAPA 3O5LA 4DROA 1SYTA 5HWBA 2RUQA 4O2TA 1LL7A 1NMVA 1FKFA 1EDQA 1FKRA 4IT4A 1W1TA 2E45A 1FKTA 3CH9A 3WH0A 1BL4A 5HW7A 2DPEA 4MNJA 1I5HW 3ALFA 4DRMA 3O5IA 2YSHA 3WD3A 2MNTA 2F21A 4WKFA 2K8IA 4LGXA 1UR9A 2ETNA 1ZK6A 3IK8A 1OGGA 4ODKA 1JCHB 2XP9A 2DSVA 1NWSA 5E62A 1WMVA 4G2PA 4NNRA 3MQHA 3ARRA 1D7JA 4ODOA 3O5KA 3PRBA 1WB0A 4QT2A 1NH6A 1ZCNA 5GPGA 3KADA 2FDMA 2FKEA 2YSFA 3LE4A 3WIJA 3PA7A 4NZCA 4L3NA 2RURA
chains in the Genus database with same CATH topology
1TR8A 3WD2A 1KT1A 3CHEA 4DWSB 1LG2A 2RE3A 4U86A 1NMWA 1JNTA 1B6CA 1K9RA 2WM0A 3KAGA 2KE0A 3ARXA 5E64A 4Z2GA 3PRAA 3ARTA 4WKHA 1FJDA 3M7NA 1W9PA 1M5YA 4MNKA 3KAFA 5HUAA 1CTNA 2MLXA 4ODRA 3O5DA 1H0IA 4DIPA 1BKFA 1H0GA 5DO2A 1K9QA 1ZBCA 2DG3A 1FKKA 4KQZA 4ODNA 1HJWA 2MDIA 1NWTA 4HARA 4MPKA 2LJ4A 1E6RA 4MSPA 3UI4A 1KFWA 2MPHA 4DRHA 2PV2A 4XAKA 2XP5A 2IUZA 3UI6A 4J4OA 1W9UA 2KI3A 2WLZA 4ODLA 1Q6HA 3H9RB 4A0TA 3NRKA 2G41A 4R0XA 3WQVA 5DITA 1ZBWA 3TC5A 5D75A 1RP5A 4W9OA 1ROTA 4E5RA 3ALGA 4S3KA 1FKDA 1LG1A 4LAXA 1ZB5A 2IF4A 2MF9A 5HWCA 1FKLA 2F4EA 4DWSA 4GGQA 4REXA 2DT2A 1FFQA 4JFLA 3O5QA 3NI6A 2XPAA 3FS8A 2RSEA 2A3BA 2Q5AA 1HKIA 4WK9A 2DWVA 1GOIA 3O5EA 1X6NA 2DG9A 2M2AA 3WD4A 3CGMA 4TX0A 3ARPA 3FSCA 2M8JA 4QZVB 4ZS6A 2L4JA 1FLCA 3RM8A 4ITZA 1Q6UA 4WJXA 1E6ZA 1F8AB 1SR0A 4BF8A 1TCOC 3RFWA 2O9OA 2JXWA 4DWSC 2G8ZA 3O5FA 2RUDA 2XP8A 5HKGA 1HXVA 3O5GA 1ZU8A 3CHDA 4WKAA 1A7XA 1FD9A 5HBFA 2A3AA 3LUOA 3FAPA 1F40A 3CGNA 3CHFA 1FKHA 4IT6A 3MQGA 2WAEA 2ZQVA 5HW6A 4R5EA 5U47A 2O92A 3MCBB 2LPVA 1N1AA 3FSBA 4MAVA 2WK2A 2OFNA 4IQ2A 1OGBA 3WL1A 4DRPA 3KAIA 2ZAJA 1EQ3A 4J4NA 2KO7A 1JVWA 2VN1A 1NWRA 4MNMA 3KABA 1LJYA 4DRJA 1OWQA 1Q6IA 4PTMA 1WAWA 3QOKA 1E6NA 4AY1A 3TDBA 3CZ8A 3WKZA 3UQBA 3BXWA 1HKMA 1HJXA 3UF8A 4JYSA 1E15A 3IHZA 1E9LA 1HKKA 4P8VA 4P8XA 1LL6A 5DIUA 4DRIA 1FFRA 3ARQA 2OWOA 4LAYA 1JMQA 3WL0A 1RD6A 3LKXB 2LAJA 5CQ2A 4TW6A 3M85A 2ZQTA 5HT1A 4W9PA 4MTVA 2BA1A 5I98A 1EYMA 3AS0A 1C9HA 2FAPA 2ZR5A 1LQ0A 2WLYA 4KR0B 1O6IA 3B9DA 1W1YA 2KXQA 3MCBA 5E65A 5DIVA 3FY1A 1EHNA 3ARVA 2DJYA 1D6OA 3CHCA 1W26A 3VAWA 3RMEA 4ODMA 1YATA 2L2SA 3OA5A 2ESCA 4JFMA 2A3CA 3FXYA 3UQAA 3AS2A 2M08A 2XPBA 2N87A 1GUVA 1TFVA 2KGJA 5HW8A 4GLXA 2DG4A 2Y8NB 3AQUA 5JH8A 1JNDA 3RM4A 3O5MA 1LL4A 1EIBA 3B9EA 3AROA 4Q7NA 4ZPWR 4ODQA 4TW7A 2A3EA 4U84A 3B8SA 4P8WA 4QIBA 1QZ2A 1TK7A 2Y78A 1FKJA 4G50A 3ARUA 3W4RA 2YSIA 1Y0OA 2XP6A 1GPFA 2QF8A 1ZBKA 2RQSA 2YBUA 5DEZA 3PRDA 3LKXA 1J4IA 1D7IA 5GPRA 2DSUA 5J6EA 3AS1A 1D7HA 2RUCA 3KZ7A 4W9QA 4P8UA 3WD1A 4A0UA 1EG4A 3JYJA 4ZPTR 1EG3A 3CNGA 2D9FA 1QPLA 2ITKA 3MDYB 4IPXA 3NTPA 1FKBA 4QT3A 5GQBA 2ZR4A 3ARWA 2YSBA 4MGVA 4N19A 4C02B 1XRVA 3IKGA 2JZVA 3EY6A 2XP4A 4Z2JA 1JNEA 1ZL1A 4DRQA 2DMVA 1QPFA 2ZR6A 1ITXA 2UZ5A 4URIA 3O5RA 3G6MA 2OLHA 3AS3A 3ARZA 1L1PA 3JYMA 4ML4A 2KR7A 1O6WA 3PQHA 5E5WA 1J4RA 3OOBA 4TW8A 4WIWA 2AWGA 5BXJA 1D2KA 4DZ3A 3B7XA 1X6LA 2PPPA 2ZQSA 2ZQUA 4HBOA 4JFIA 3ARYA 1NWUA 2LGOA 2DSZA 5HTGA 2M8IA 3B9AA 4TYOA 3WD0A 2YBTA 1ZBVA 2PPNA 4TNSA 2B31A 1JNSA 3UQIA 2VCDA 2XP3A 3IKDA 1NSGA 1HJVA 2DT0A 4DRNA 2PI6A 4DZ2A 2LKNA 1W1PA 3PR9A 4JFJA 1K9TA 1U79A 1W1VA 2YAJB 1UR8A 1WNOA 3I6CA 4Z2KA 4W5UA 4LAVA 1ROUA 4IQCA 1T11A 2XP7A 4Q22A 2PV3A 3G6LA 4FAPA 3UI5A 3ODKA 1IX5A 4ODPA 3KAHA 1PBKA 1J6YA 4S3JA 1Q1CA 1HKJA 2DSWA 3KCEA 2M1IA 4Z2IA 2PBCA 2M3OW 1FKIA 4DH0A 2EZ5W 3O5PA 4DT4A 1KT0A 1XHGA 1VF8A 1WR7A 5E66A 3ARSA 3RGCA 2YSGA 4U85A 4L72B 3RM9A 1FKSA 4MNLA 4FN2A 1PINA 1P5QA 2KFWA 4HBEA 5DF0A 1R9HA 2JV4A 4NSBA 1FKGA 4GIVA 2PPOA 3L4HA 2AOSA 2JX8A 2DT3A 1E6PA 2MLYA 1YW5A 3KACA 3GPKA 2PV1A 1W9VA 4DRKA 2MLZA 2DT1A 2F2DA 2JMFA 4JFKA 3JXVA 4LAWA 2DK1A 5AHTA 3O5OA 4DWSD 4Z2HA 4Z2LA 2DK7A 3TCZA 1J4HA 4ZPVR 3O5JA 2QRVA 2WADA 5B8IC 3WQWA 1FAPA 3O5LA 4DROA 1SYTA 5HWBA 2RUQA 4O2TA 1LL7A 1NMVA 1FKFA 1EDQA 1FKRA 4IT4A 1W1TA 2E45A 1FKTA 3CH9A 3WH0A 1BL4A 5HW7A 2DPEA 4MNJA 1I5HW 3ALFA 4DRMA 3O5IA 2YSHA 3WD3A 2MNTA 2F21A 4WKFA 2K8IA 4LGXA 1UR9A 1ZK6A 3IK8A 1OGGA 4ODKA 2XP9A 2DSVA 1NWSA 5E62A 1WMVA 4G2PA 4NNRA 3MQHA 3ARRA 1D7JA 4ODOA 3O5KA 3PRBA 1WB0A 4QT2A 1NH6A 1ZCNA 5GPGA 3KADA 2FDMA 2FKEA 2YSFA 3LE4A 3WIJA 3PA7A 4NZCA 4L3NA 2RURA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KT1 A;  2RE3 A;  4U86 A;  1NMW A;  1JNT A;  1B6C A;  1K9R A;  3KAG A;  2KE0 A;  1FJD A;  3M7N A;  1M5Y A;  3KAF A;  5HUA A;  2MLX A;  4ODR A;  3O5D A;  4DIP A;  1BKF A;  1K9Q A;  2DG3 A;  1FKK A;  4ODN A;  2MDI A;  2LJ4 A;  4MSP A;  3UI4 A;  2MPH A;  4DRH A;  2PV2 A;  2XP5 A;  3UI6 A;  4J4O A;  2KI3 A;  4ODL A;  1Q6H A;  3H9R B;  3NRK A;  4R0X A;  5DIT A;  3TC5 A;  5D75 A;  4W9O A;  1ROT A;  4E5R A;  1FKD A;  4LAX A;  2IF4 A;  2MF9 A;  5HWC A;  1FKL A;  2F4E A;  4GGQ A;  4REX A;  4JFL A;  3O5Q A;  3NI6 A;  2XPA A;  2RSE A;  2Q5A A;  2DWV A;  3O5E A;  2DG9 A;  2M2A A;  3CGM A;  4TX0 A;  2M8J A;  2L4J A;  4ITZ A;  1Q6U A;  1F8A B;  4BF8 A;  1TCO C;  3RFW A;  2JXW A;  3O5F A;  2RUD A;  2XP8 A;  5HKG A;  1HXV A;  3O5G A;  1A7X A;  1FD9 A;  3LUO A;  3FAP A;  1F40 A;  3CGN A;  1FKH A;  2ZQV A;  5HW6 A;  2LPV A;  1N1A A;  2OFN A;  4IQ2 A;  4DRP A;  3KAI A;  2ZAJ A;  1EQ3 A;  4J4N A;  2KO7 A;  1JVW A;  2VN1 A;  3KAB A;  4DRJ A;  1Q6I A;  3TDB A;  3UQB A;  3UF8 A;  4JYS A;  3IHZ A;  5DIU A;  4DRI A;  4LAY A;  1JMQ A;  2LAJ A;  5CQ2 A;  4TW6 A;  3M85 A;  2ZQT A;  5HT1 A;  4W9P A;  2BA1 A;  5I98 A;  1EYM A;  1C9H A;  2FAP A;  2ZR5 A;  2KXQ A;  5DIV A;  2DJY A;  1D6O A;  1W26 A;  3VAW A;  4ODM A;  1YAT A;  2L2S A;  4JFM A;  3UQA A;  2M08 A;  2XPB A;  2N87 A;  2KGJ A;  5HW8 A;  2DG4 A;  3O5M A;  4ODQ A;  4TW7 A;  4U84 A;  4QIB A;  1QZ2 A;  2Y78 A;  1TK7 A;  4G50 A;  1FKJ A;  2YSI A;  1Y0O A;  2XP6 A;  2RQS A;  3PRD A;  1J4I A;  1D7I A;  5J6E A;  1D7H A;  2RUC A;  3KZ7 A;  4W9Q A;  1EG4 A;  3JYJ A;  1EG3 A;  3CNG A;  2D9F A;  1QPL A;  2ITK A;  3MDY B;  4IPX A;  3NTP A;  1FKB A;  4QT3 A;  2ZR4 A;  2YSB A;  4MGV A;  4N19 A;  4C02 B;  3IKG A;  2JZV A;  3EY6 A;  2XP4 A;  4DRQ A;  2DMV A;  1QPF A;  2ZR6 A;  2UZ5 A;  3O5R A;  1L1P A;  3JYM A;  2KR7 A;  1O6W A;  4TW8 A;  1J4R A;  3OOB A;  2AWG A;  5BXJ A;  4DZ3 A;  3B7X A;  2PPP A;  2ZQS A;  2ZQU A;  4JFI A;  2LGO A;  5HTG A;  2M8I A;  4TYO A;  2PPN A;  4TNS A;  1JNS A;  3UQI A;  2VCD A;  2XP3 A;  3IKD A;  1NSG A;  4DRN A;  4DZ2 A;  2LKN A;  4JFJ A;  1U79 A;  3I6C A;  4LAV A;  1ROU A;  4IQC A;  1T11 A;  2XP7 A;  2PV3 A;  4FAP A;  3UI5 A;  3ODK A;  4ODP A;  3KAH A;  1PBK A;  1J6Y A;  1Q1C A;  3KCE A;  2M1I A;  2PBC A;  2M3O W;  1FKI A;  4DH0 A;  2EZ5 W;  3O5P A;  4DT4 A;  1KT0 A;  1WR7 A;  3RGC A;  2YSG A;  4U85 A;  1FKS A;  4FN2 A;  1PIN A;  1P5Q A;  2KFW A;  1R9H A;  2JV4 A;  1FKG A;  4GIV A;  2PPO A;  3L4H A;  2JX8 A;  2MLY A;  1YW5 A;  3KAC A;  3GPK A;  2PV1 A;  4DRK A;  2MLZ A;  2F2D A;  2JMF A;  4JFK A;  3JXV A;  4LAW A;  2DK1 A;  5AHT A;  3O5O A;  2DK7 A;  3TCZ A;  1J4H A;  3O5J A;  5B8I C;  1FAP A;  3O5L A;  4DRO A;  5HWB A;  2RUQ A;  4O2T A;  1NMV A;  1FKF A;  1FKR A;  2E45 A;  1FKT A;  3WH0 A;  1BL4 A;  5HW7 A;  1I5H W;  4DRM A;  3O5I A;  2YSH A;  2MNT A;  2F21 A;  2K8I A;  1ZK6 A;  3IK8 A;  4ODK A;  2XP9 A;  1WMV A;  4G2P A;  4NNR A;  1D7J A;  4ODO A;  3O5K A;  3PRB A;  4QT2 A;  1ZCN A;  5GPG A;  3KAD A;  2FKE A;  2YSF A;  3LE4 A;  3PA7 A;  2RUR A; 
#chains in the Genus database with same CATH topology
 1TR8 A;  3WD2 A;  1KT1 A;  3CHE A;  4DWS B;  1LG2 A;  2RE3 A;  4U86 A;  1NMW A;  1JNT A;  1B6C A;  1K9R A;  2WM0 A;  3KAG A;  2KE0 A;  3ARX A;  5E64 A;  4Z2G A;  3PRA A;  3ART A;  4WKH A;  1FJD A;  3M7N A;  1W9P A;  1M5Y A;  4MNK A;  3KAF A;  5HUA A;  1CTN A;  2MLX A;  4ODR A;  3O5D A;  1H0I A;  4DIP A;  1BKF A;  1H0G A;  5DO2 A;  1K9Q A;  1ZBC A;  2DG3 A;  1FKK A;  4KQZ A;  4ODN A;  1HJW A;  2MDI A;  1NWT A;  4HAR A;  4MPK A;  2LJ4 A;  1E6R A;  4MSP A;  3UI4 A;  1KFW A;  2MPH A;  4DRH A;  2PV2 A;  4XAK A;  2XP5 A;  2IUZ A;  3UI6 A;  4J4O A;  1W9U A;  2KI3 A;  2WLZ A;  4ODL A;  1Q6H A;  3H9R B;  4A0T A;  3NRK A;  2G41 A;  4R0X A;  3WQV A;  5DIT A;  1ZBW A;  3TC5 A;  5D75 A;  1RP5 A;  1E44 A;  4W9O A;  1ROT A;  4E5R A;  3ALG A;  4S3K A;  1FKD A;  1LG1 A;  4LAX A;  1ZB5 A;  2IF4 A;  2MF9 A;  5HWC A;  1FKL A;  2F4E A;  4DWS A;  4GGQ A;  4REX A;  2DT2 A;  1FFQ A;  4JFL A;  3O5Q A;  3NI6 A;  2XPA A;  3FS8 A;  2RSE A;  2A3B A;  2Q5A A;  1HKI A;  4WK9 A;  2DWV A;  1GOI A;  3O5E A;  1X6N A;  2DG9 A;  2M2A A;  3WD4 A;  3CGM A;  4TX0 A;  3ARP A;  3FSC A;  2M8J A;  4QZV B;  4ZS6 A;  2L4J A;  1FLC A;  3RM8 A;  4ITZ A;  1Q6U A;  4WJX A;  1E6Z A;  1F8A B;  1SR0 A;  4BF8 A;  1TCO C;  3RFW A;  2O9O A;  2JXW A;  4DWS C;  2G8Z A;  3O5F A;  2RUD A;  2XP8 A;  5HKG A;  1HXV A;  3O5G A;  1ZU8 A;  3CHD A;  4WKA A;  1A7X A;  1FD9 A;  5HBF A;  2A3A A;  3LUO A;  3FAP A;  1F40 A;  3CGN A;  3CHF A;  1FKH A;  4IT6 A;  3MQG A;  2F23 A;  2WAE A;  2ZQV A;  5HW6 A;  4R5E A;  5U47 A;  2O92 A;  3MCB B;  2LPV A;  1N1A A;  3FSB A;  4MAV A;  2WK2 A;  2OFN A;  4IQ2 A;  1OGB A;  3WL1 A;  4DRP A;  3KAI A;  2ZAJ A;  1EQ3 A;  4J4N A;  2KO7 A;  1JVW A;  2VN1 A;  1NWR A;  3BMB A;  4MNM A;  3KAB A;  1LJY A;  4DRJ A;  1OWQ A;  1Q6I A;  4PTM A;  1WAW A;  3QOK A;  1E6N A;  4AY1 A;  3TDB A;  3CZ8 A;  3WKZ A;  3UQB A;  3BXW A;  1HKM A;  1HJX A;  3UF8 A;  4JYS A;  1E15 A;  3IHZ A;  1E9L A;  1HKK A;  4P8V A;  4P8X A;  1LL6 A;  5DIU A;  4DRI A;  1FFR A;  3ARQ A;  2OWO A;  4LAY A;  1JMQ A;  3WL0 A;  1RD6 A;  3LKX B;  2LAJ A;  5CQ2 A;  4TW6 A;  3M85 A;  2ZQT A;  5HT1 A;  4W9P A;  4MTV A;  4UDM A;  2BA1 A;  5I98 A;  1EYM A;  3AS0 A;  1C9H A;  2FAP A;  2ZR5 A;  1LQ0 A;  2WLY A;  4KR0 B;  1O6I A;  3B9D A;  1W1Y A;  2KXQ A;  3MCB A;  5E65 A;  5DIV A;  3FY1 A;  1EHN A;  3ARV A;  2DJY A;  1D6O A;  3CHC A;  1W26 A;  3VAW A;  3RME A;  4ODM A;  1YAT A;  2L2S A;  3OA5 A;  2ESC A;  4JFM A;  2A3C A;  3FXY A;  3UQA A;  3AS2 A;  2M08 A;  2XPB A;  2N87 A;  1GUV A;  1TFV A;  2KGJ A;  5HW8 A;  4GLX A;  2DG4 A;  2Y8N B;  3AQU A;  5JH8 A;  2PN0 A;  1JND A;  3RM4 A;  3O5M A;  1LL4 A;  1EIB A;  3B9E A;  3ARO A;  4Q7N A;  4ZPW R;  4ODQ A;  4TW7 A;  2A3E A;  4U84 A;  3B8S A;  2EUL A;  4P8W A;  4QIB A;  1QZ2 A;  1TK7 A;  2Y78 A;  1FKJ A;  4G50 A;  3ARU A;  3W4R A;  2YSI A;  1Y0O A;  2XP6 A;  1GPF A;  2QF8 A;  1ZBK A;  2RQS A;  2YBU A;  5DEZ A;  3PRD A;  3LKX A;  1J4I A;  1D7I A;  5GPR A;  2DSU A;  5J6E A;  3AS1 A;  1D7H A;  2RUC A;  3KZ7 A;  4W9Q A;  4P8U A;  3WD1 A;  4A0U A;  1EG4 A;  3JYJ A;  4ZPT R;  1EG3 A;  3CNG A;  2D9F A;  1QPL A;  2ITK A;  3MDY B;  4IPX A;  3NTP A;  1FKB A;  4QT3 A;  5GQB A;  2ZR4 A;  3ARW A;  2YSB A;  4MGV A;  4N19 A;  4C02 B;  1XRV A;  3IKG A;  2JZV A;  3EY6 A;  2XP4 A;  4Z2J A;  1JNE A;  1ZL1 A;  3GTY X;  4DRQ A;  2DMV A;  1QPF A;  2ZR6 A;  1ITX A;  2UZ5 A;  4URI A;  3O5R A;  3G6M A;  2OLH A;  3AS3 A;  3ARZ A;  2B5U B;  1L1P A;  3JYM A;  4ML4 A;  2KR7 A;  3EIP A;  1O6W A;  3PQH A;  5E5W A;  1J4R A;  3OOB A;  4TW8 A;  4WIW A;  2AWG A;  5BXJ A;  1D2K A;  4DZ3 A;  3B7X A;  1X6L A;  2PPP A;  2ZQS A;  2ZQU A;  4HBO A;  4JFI A;  3ARY A;  1NWU A;  2LGO A;  2DSZ A;  5HTG A;  2M8I A;  3B9A A;  4TYO A;  3WD0 A;  2YBT A;  1ZBV A;  2PPN A;  4TNS A;  2B31 A;  1JNS A;  3UQI A;  2VCD A;  2XP3 A;  3IKD A;  1NSG A;  1HJV A;  2DT0 A;  4DRN A;  2PI6 A;  4DZ2 A;  2LKN A;  1W1P A;  3PR9 A;  4JFJ A;  1K9T A;  1U79 A;  1W1V A;  2YAJ B;  1UR8 A;  1WNO A;  3I6C A;  4Z2K A;  4W5U A;  4LAV A;  1ROU A;  4IQC A;  1T11 A;  2XP7 A;  4Q22 A;  2PV3 A;  3G6L A;  4FAP A;  3UI5 A;  3ODK A;  1GRJ A;  1IX5 A;  4ODP A;  3KAH A;  1PBK A;  1J6Y A;  4S3J A;  1Q1C A;  1HKJ A;  2DSW A;  3KCE A;  2M1I A;  4Z2I A;  2PBC A;  2M3O W;  1FKI A;  4DH0 A;  2EZ5 W;  3O5P A;  3GU0 A;  4DT4 A;  1KT0 A;  1XHG A;  1VF8 A;  1WR7 A;  5E66 A;  3ARS A;  3RGC A;  2YSG A;  2P4V A;  4U85 A;  4L72 B;  3RM9 A;  1FKS A;  4MNL A;  4FN2 A;  1PIN A;  1P5Q A;  2KFW A;  4HBE A;  5DF0 A;  1R9H A;  2JV4 A;  4NSB A;  1FKG A;  4GIV A;  2PPO A;  3L4H A;  2AOS A;  2JX8 A;  2DT3 A;  1E6P A;  2MLY A;  1YW5 A;  3KAC A;  3GPK A;  2PV1 A;  1W9V A;  4DRK A;  2MLZ A;  2DT1 A;  2F2D A;  2JMF A;  4JFK A;  3JXV A;  4LAW A;  2DK1 A;  5AHT A;  3O5O A;  4DWS D;  4Z2H A;  4Z2L A;  2DK7 A;  3TCZ A;  1J4H A;  4ZPV R;  3O5J A;  2QRV A;  2WAD A;  5B8I C;  3WQW A;  1FAP A;  3O5L A;  4DRO A;  1SYT A;  5HWB A;  2RUQ A;  4O2T A;  1LL7 A;  1NMV A;  1FKF A;  1EDQ A;  1FKR A;  4IT4 A;  1W1T A;  2E45 A;  1FKT A;  3CH9 A;  3WH0 A;  1BL4 A;  5HW7 A;  2DPE A;  4MNJ A;  1I5H W;  3ALF A;  4DRM A;  3O5I A;  2YSH A;  3WD3 A;  2MNT A;  2F21 A;  4WKF A;  2K8I A;  4LGX A;  1UR9 A;  2ETN A;  1ZK6 A;  3IK8 A;  1OGG A;  4ODK A;  1JCH B;  2XP9 A;  2DSV A;  1NWS A;  5E62 A;  1WMV A;  4G2P A;  4NNR A;  3MQH A;  3ARR A;  1D7J A;  4ODO A;  3O5K A;  3PRB A;  1WB0 A;  4QT2 A;  1NH6 A;  1ZCN A;  5GPG A;  3KAD A;  2FDM A;  2FKE A;  2YSF A;  3LE4 A;  3WIJ A;  3PA7 A;  4NZC A;  4L3N A;  2RUR A; 
#chains in the Genus database with same CATH homology
 1TR8 A;  3WD2 A;  1KT1 A;  3CHE A;  4DWS B;  1LG2 A;  2RE3 A;  4U86 A;  1NMW A;  1JNT A;  1B6C A;  1K9R A;  2WM0 A;  3KAG A;  2KE0 A;  3ARX A;  5E64 A;  4Z2G A;  3PRA A;  3ART A;  4WKH A;  1FJD A;  3M7N A;  1W9P A;  1M5Y A;  4MNK A;  3KAF A;  5HUA A;  1CTN A;  2MLX A;  4ODR A;  3O5D A;  1H0I A;  4DIP A;  1BKF A;  1H0G A;  5DO2 A;  1K9Q A;  1ZBC A;  2DG3 A;  1FKK A;  4KQZ A;  4ODN A;  1HJW A;  2MDI A;  1NWT A;  4HAR A;  4MPK A;  2LJ4 A;  1E6R A;  4MSP A;  3UI4 A;  1KFW A;  2MPH A;  4DRH A;  2PV2 A;  4XAK A;  2XP5 A;  2IUZ A;  3UI6 A;  4J4O A;  1W9U A;  2KI3 A;  2WLZ A;  4ODL A;  1Q6H A;  3H9R B;  4A0T A;  3NRK A;  2G41 A;  4R0X A;  3WQV A;  5DIT A;  1ZBW A;  3TC5 A;  5D75 A;  1RP5 A;  4W9O A;  1ROT A;  4E5R A;  3ALG A;  4S3K A;  1FKD A;  1LG1 A;  4LAX A;  1ZB5 A;  2IF4 A;  2MF9 A;  5HWC A;  1FKL A;  2F4E A;  4DWS A;  4GGQ A;  4REX A;  2DT2 A;  1FFQ A;  4JFL A;  3O5Q A;  3NI6 A;  2XPA A;  3FS8 A;  2RSE A;  2A3B A;  2Q5A A;  1HKI A;  4WK9 A;  2DWV A;  1GOI A;  3O5E A;  1X6N A;  2DG9 A;  2M2A A;  3WD4 A;  3CGM A;  4TX0 A;  3ARP A;  3FSC A;  2M8J A;  4QZV B;  4ZS6 A;  2L4J A;  1FLC A;  3RM8 A;  4ITZ A;  1Q6U A;  4WJX A;  1E6Z A;  1F8A B;  1SR0 A;  4BF8 A;  1TCO C;  3RFW A;  2O9O A;  2JXW A;  4DWS C;  2G8Z A;  3O5F A;  2RUD A;  2XP8 A;  5HKG A;  1HXV A;  3O5G A;  1ZU8 A;  3CHD A;  4WKA A;  1A7X A;  1FD9 A;  5HBF A;  2A3A A;  3LUO A;  3FAP A;  1F40 A;  3CGN A;  3CHF A;  1FKH A;  4IT6 A;  3MQG A;  2WAE A;  2ZQV A;  5HW6 A;  4R5E A;  5U47 A;  2O92 A;  3MCB B;  2LPV A;  1N1A A;  3FSB A;  4MAV A;  2WK2 A;  2OFN A;  4IQ2 A;  1OGB A;  3WL1 A;  4DRP A;  3KAI A;  2ZAJ A;  1EQ3 A;  4J4N A;  2KO7 A;  1JVW A;  2VN1 A;  1NWR A;  4MNM A;  3KAB A;  1LJY A;  4DRJ A;  1OWQ A;  1Q6I A;  4PTM A;  1WAW A;  3QOK A;  1E6N A;  4AY1 A;  3TDB A;  3CZ8 A;  3WKZ A;  3UQB A;  3BXW A;  1HKM A;  1HJX A;  3UF8 A;  4JYS A;  1E15 A;  3IHZ A;  1E9L A;  1HKK A;  4P8V A;  4P8X A;  1LL6 A;  5DIU A;  4DRI A;  1FFR A;  3ARQ A;  2OWO A;  4LAY A;  1JMQ A;  3WL0 A;  1RD6 A;  3LKX B;  2LAJ A;  5CQ2 A;  4TW6 A;  3M85 A;  2ZQT A;  5HT1 A;  4W9P A;  4MTV A;  2BA1 A;  5I98 A;  1EYM A;  3AS0 A;  1C9H A;  2FAP A;  2ZR5 A;  1LQ0 A;  2WLY A;  4KR0 B;  1O6I A;  3B9D A;  1W1Y A;  2KXQ A;  3MCB A;  5E65 A;  5DIV A;  3FY1 A;  1EHN A;  3ARV A;  2DJY A;  1D6O A;  3CHC A;  1W26 A;  3VAW A;  3RME A;  4ODM A;  1YAT A;  2L2S A;  3OA5 A;  2ESC A;  4JFM A;  2A3C A;  3FXY A;  3UQA A;  3AS2 A;  2M08 A;  2XPB A;  2N87 A;  1GUV A;  1TFV A;  2KGJ A;  5HW8 A;  4GLX A;  2DG4 A;  2Y8N B;  3AQU A;  5JH8 A;  1JND A;  3RM4 A;  3O5M A;  1LL4 A;  1EIB A;  3B9E A;  3ARO A;  4Q7N A;  4ZPW R;  4ODQ A;  4TW7 A;  2A3E A;  4U84 A;  3B8S A;  4P8W A;  4QIB A;  1QZ2 A;  1TK7 A;  2Y78 A;  1FKJ A;  4G50 A;  3ARU A;  3W4R A;  2YSI A;  1Y0O A;  2XP6 A;  1GPF A;  2QF8 A;  1ZBK A;  2RQS A;  2YBU A;  5DEZ A;  3PRD A;  3LKX A;  1J4I A;  1D7I A;  5GPR A;  2DSU A;  5J6E A;  3AS1 A;  1D7H A;  2RUC A;  3KZ7 A;  4W9Q A;  4P8U A;  3WD1 A;  4A0U A;  1EG4 A;  3JYJ A;  4ZPT R;  1EG3 A;  3CNG A;  2D9F A;  1QPL A;  2ITK A;  3MDY B;  4IPX A;  3NTP A;  1FKB A;  4QT3 A;  5GQB A;  2ZR4 A;  3ARW A;  2YSB A;  4MGV A;  4N19 A;  4C02 B;  1XRV A;  3IKG A;  2JZV A;  3EY6 A;  2XP4 A;  4Z2J A;  1JNE A;  1ZL1 A;  4DRQ A;  2DMV A;  1QPF A;  2ZR6 A;  1ITX A;  2UZ5 A;  4URI A;  3O5R A;  3G6M A;  2OLH A;  3AS3 A;  3ARZ A;  1L1P A;  3JYM A;  4ML4 A;  2KR7 A;  1O6W A;  3PQH A;  5E5W A;  1J4R A;  3OOB A;  4TW8 A;  4WIW A;  2AWG A;  5BXJ A;  1D2K A;  4DZ3 A;  3B7X A;  1X6L A;  2PPP A;  2ZQS A;  2ZQU A;  4HBO A;  4JFI A;  3ARY A;  1NWU A;  2LGO A;  2DSZ A;  5HTG A;  2M8I A;  3B9A A;  4TYO A;  3WD0 A;  2YBT A;  1ZBV A;  2PPN A;  4TNS A;  2B31 A;  1JNS A;  3UQI A;  2VCD A;  2XP3 A;  3IKD A;  1NSG A;  1HJV A;  2DT0 A;  4DRN A;  2PI6 A;  4DZ2 A;  2LKN A;  1W1P A;  3PR9 A;  4JFJ A;  1K9T A;  1U79 A;  1W1V A;  2YAJ B;  1UR8 A;  1WNO A;  3I6C A;  4Z2K A;  4W5U A;  4LAV A;  1ROU A;  4IQC A;  1T11 A;  2XP7 A;  4Q22 A;  2PV3 A;  3G6L A;  4FAP A;  3UI5 A;  3ODK A;  1IX5 A;  4ODP A;  3KAH A;  1PBK A;  1J6Y A;  4S3J A;  1Q1C A;  1HKJ A;  2DSW A;  3KCE A;  2M1I A;  4Z2I A;  2PBC A;  2M3O W;  1FKI A;  4DH0 A;  2EZ5 W;  3O5P A;  4DT4 A;  1KT0 A;  1XHG A;  1VF8 A;  1WR7 A;  5E66 A;  3ARS A;  3RGC A;  2YSG A;  4U85 A;  4L72 B;  3RM9 A;  1FKS A;  4MNL A;  4FN2 A;  1PIN A;  1P5Q A;  2KFW A;  4HBE A;  5DF0 A;  1R9H A;  2JV4 A;  4NSB A;  1FKG A;  4GIV A;  2PPO A;  3L4H A;  2AOS A;  2JX8 A;  2DT3 A;  1E6P A;  2MLY A;  1YW5 A;  3KAC A;  3GPK A;  2PV1 A;  1W9V A;  4DRK A;  2MLZ A;  2DT1 A;  2F2D A;  2JMF A;  4JFK A;  3JXV A;  4LAW A;  2DK1 A;  5AHT A;  3O5O A;  4DWS D;  4Z2H A;  4Z2L A;  2DK7 A;  3TCZ A;  1J4H A;  4ZPV R;  3O5J A;  2QRV A;  2WAD A;  5B8I C;  3WQW A;  1FAP A;  3O5L A;  4DRO A;  1SYT A;  5HWB A;  2RUQ A;  4O2T A;  1LL7 A;  1NMV A;  1FKF A;  1EDQ A;  1FKR A;  4IT4 A;  1W1T A;  2E45 A;  1FKT A;  3CH9 A;  3WH0 A;  1BL4 A;  5HW7 A;  2DPE A;  4MNJ A;  1I5H W;  3ALF A;  4DRM A;  3O5I A;  2YSH A;  3WD3 A;  2MNT A;  2F21 A;  4WKF A;  2K8I A;  4LGX A;  1UR9 A;  1ZK6 A;  3IK8 A;  1OGG A;  4ODK A;  2XP9 A;  2DSV A;  1NWS A;  5E62 A;  1WMV A;  4G2P A;  4NNR A;  3MQH A;  3ARR A;  1D7J A;  4ODO A;  3O5K A;  3PRB A;  1WB0 A;  4QT2 A;  1NH6 A;  1ZCN A;  5GPG A;  3KAD A;  2FDM A;  2FKE A;  2YSF A;  3LE4 A;  3WIJ A;  3PA7 A;  4NZC A;  4L3N A;  2RUR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...