2XP5A

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
157
structure length
145
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
total genus 42
structure length 145
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xp5A01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xp5A02
1HXVA 2MLZA 2MF9A 3O5PA 3EY6A 3WH0A 1ZK6A 3PRDA 2IF4A 3TDBA 2BA1A 1D7HA 3NI6A 1U79A 2DG4A 2DG9A 2RURA 3GPKA 2K8IA 2KI3A 2KR7A 2XP6A 4DRJA 5DIVA 3O5EA 1D6OA 4JYSA 4ODOA 1JMQA 1ROUA 4IQ2A 1J4RA 4DH0A 3KAHA 2DG3A 1FD9A 3O5MA 5HW7A 2PPOA 4FAPA 2L2SA 5HTGA 4N19A 3PA7A 3KACA 2JXWA 4ODLA 4DRKA 1FKBA 3H9RB 4U86A 3UI6A 4JFLA 1EQ3A 1K9RA 4JFMA 1J4HA 3RGCA 1J6YA 2LKNA 1QZ2A 1FKDA 4TNSA 2M08A 3UF8A 2JV4A 3JXVA 3TC5A 2E45A 1NMWA 3JYJA 3O5JA 1D7IA 2N87A 2FKEA 3M85A 3UQAA 1BL4A 1I5HW 4DZ2A 2YSGA 3RFWA 2EZ5W 3KAIA 2ZQTA 1KT1A 2MDIA 4IPXA 5HUAA 2ZR4A 4E5RA 2PV2A 5B8IC 1Q6HA 1J4IA 2M8JA 4MGVA 3KCEA 2VN1A 2DWVA 1WMVA 2YSFA 3LE4A 1JVWA 1Y0OA 3O5RA 3FAPA 3PRBA 2F21A 1BKFA 1JNTA 4DIPA 1NSGA 1NMVA 1R9HA 2MLYA 5D75A 3L4HA 1FKKA 2M3OW 3TCZA 1WR7A 2F2DA 2MNTA 2UZ5A 4DZ3A 3B7XA 1FKIA 2XP9A 3O5IA 4ODRA 4ODNA 2DMVA 5BXJA 1FJDA 2Q5AA 5DITA 1ZCNA 2XPBA 4QIBA 1B6CA 5DIUA 4R0XA 1D7JA 2ZQVA 2JZVA 5HWBA 2AWGA 2RUCA 4DRIA 3IK8A 2DK7A 4G2PA 4TX0A 5J6EA 1P5QA 1T11A 2MPHA 1EG4A 3IHZA 2XP7A 1Q6IA 4ODPA 1FKFA 1EG3A 3CGMA 3O5GA 2XP8A 2LJ4A 2RUDA 1QPLA 2PPNA 5I98A 4TW8A 2ITKA 3I6CA 3NRKA 4LAXA 4MSPA 4ODQA 1FKTA 1C9HA 4LAVA 2ZAJA 1K9QA 2L4JA 2XP3A 4TYOA 4DRMA 5HW8A 3MDYB 4J4OA 2FAPA 4DRNA 2LPVA 3O5DA 1W26A 2KGJA 3KABA 3KAGA 2XP5A 1ROTA 2VCDA 1PINA 1Q6UA 2ZQUA 2YSIA 3CNGA 5HWCA 4GGQA 4QT2A 4REXA 3KZ7A 1EYMA 4ODMA 2M1IA 4NNRA 1F8AB 2YSBA 4DROA 4FN2A 2KXQA 4DRPA 2XP4A 5AHTA 3KADA 1FKHA 1KT0A 1PBKA 3IKGA 4ITZA 3UI4A 3UQBA 2ZR5A 4ODKA 3KAFA 1TK7A 4DRHA 2ZQSA 2YSHA 1JNSA 1YATA 1FKLA 1M5YA 4JFIA 2M2AA 3CGNA 1FKJA 4LAYA 4QT3A 4W9QA 3UQIA 2RQSA 4TW6A 2RUQA 1FAPA 1N1AA 2D9FA 2F4EA 2DK1A 2KE0A 3O5FA 2PBCA 3O5QA 4W9OA 2LGOA 3VAWA 5HKGA 3O5OA 3LUOA 1FKRA 3NTPA 2KFWA 3O5KA 4IQCA 1FKSA 4GIVA 2KO7A 3UI5A 3O5LA 4JFKA 1Q1CA 1F40A 5CQ2A 2MLXA 2OFNA 2JMFA 3JYMA 3ODKA 2JX8A 4C02B 2M8IA 1QPFA 2RSEA 4JFJA 4J4NA 4DRQA 2ZR6A 1O6WA 4G50A 4BF8A 2RE3A 4O2TA 5GPGA 1YW5A 2LAJA 2PPPA 3IKDA 4LAWA 1L1PA 4U85A 2PV3A 2Y78A 2DJYA 2XPAA 1FKGA 4TW7A 5HT1A 3M7NA 1A7XA 4DT4A 5HW6A 1TCOC 4W9PA 3OOBA 4U84A 2PV1A
chains in the Genus database with same CATH superfamily
2MLZA 1W9VA 2MF9A 3EY6A 4LGXA 3BXWA 1LL6A 1D7HA 1U79A 3GPKA 2KR7A 2KI3A 4ODOA 1JMQA 1LG1A 4DH0A 1FFRA 1FD9A 1H0IA 2L2SA 2JXWA 3AS0A 4U86A 4P8WA 4JFLA 1EQ3A 1K9RA 1NWRA 2LKNA 1QZ2A 2M08A 3UF8A 2JV4A 3JXVA 2E45A 2DT1A 1D7IA 1I5HW 4DZ2A 2EZ5W 3KAIA 2ZQTA 3AROA 2MDIA 2ZR4A 1J4IA 2DWVA 1WMVA 2QRVA 3PRBA 4DIPA 1R9HA 3W4RA 3FY1A 5D75A 3L4HA 3B7XA 5E62A 3B9DA 4ODRA 4ODNA 5BXJA 2YBUA 5DITA 3WIJA 1E6RA 3CHDA 4TX0A 1P5QA 3IHZA 2XP7A 5I98A 4TW8A 4MSPA 4IT4A 1C9HA 4LAVA 4ZPVR 1ZL1A 2L4JA 2XP3A 4MAVA 4DRNA 2FAPA 3O5DA 2A3BA 4NSBA 2XP5A 4Q22A 3RM4A 2WM0A 1PINA 1UR9A 3CZ8A 3PRAA 4DROA 4FN2A 3CHFA 2XP4A 4GLXA 1E6ZA 1PBKA 2PN0A 2DSZA 3KAFA 1TK7A 1CTNA 2YSHA 2WADA 1EDQA 1TFVA 4S3KA 2RUQA 2D9FA 1N1AA 2DK1A 3O5QA 1SYTA 3LUOA 4P8XA 4DWSD 3B8SA 4IQCA 4Z2JA 1FKSA 2IUZA 4P8UA 1ZBKA 1F40A 4AY1A 4IT6A 3JYMA 1NWTA 3MCBA 3GU0A 4ZS6A 4BF8A 2G41A 1YW5A 2PPPA 4LAWA 5HT1A 4HBEA 1ITXA 3CHEA 4W9PA 3RMEA 2JMFA 4JFJA 3WD3A 3FXYA 2BA1A 2DG9A 2O92A 3O5EA 1XHGA 4IQ2A 1J4RA 3KAHA 2P4VA 4Z2HA 2PPOA 1TR8A 4DWSC 4FAPA 4N19A 4XAKA 4DRKA 2Y8NB 3H9RB 3UI6A 4JFMA 3OA5A 4MNKA 1NMWA 2FKEA 3M85A 1BL4A 3ARQA 4Z2GA 2YSGA 1GOIA 3MQHA 1KT1A 4DRQA 4MGVA 3KCEA 2VN1A 1JVWA 2F21A 3ARPA 1OGGA 1W9PA 4WKHA 1GRJA 4Q7NA 4KQZA 2XP9A 2ETNA 4L3NA 2XPBA 2WLZA 4R0XA 1D7JA 2AWGA 3GTYX 1FLCA 5JH8A 2MPHA 1W9UA 1JCHB 4ODPA 3CGMA 4P8VA 2RUDA 4ZPWR 1QPLA 1LL7A 5E64A 3I6CA 3NRKA 1FKTA 3RM9A 2LPVA 1W26A 2KGJA 3KABA 3KAGA 1ROTA 2O9OA 2VCDA 1Q6UA 2YSIA 1EYMA 2DT2A 4ZPTR 4R5EA 3WQVA 1EHNA 4QT3A 4W9QA 3UQIA 2M2AA 3CGNA 3WD0A 1LL4A 2F4EA 2PBCA 3VAWA 2LGOA 3O5OA 4WJXA 1UR8A 2KFWA 4PTMA 4GIVA 2JX8A 1HJXA 1O6WA 2RE3A 3WD4A 5GPGA 1HKIA 3IKDA 3PQHA 2DJYA 1RP5A 1VF8A 2OLHA 4UDMA 2DSVA 3M7NA 5HW6A 3G6LA 2WLYA 4U84A 1HXVA 3O5PA 2A3AA 3WH0A 3PRDA 3TDBA 3NI6A 3O5FA 1HJVA 2K8IA 2XP6A 5DIVA 3MQGA 2DG3A 1NH6A 3O5MA 3LKXA 3ALGA 3PA7A 3KACA 1ZB5A 3ARRA 4ODLA 1NWSA 2YAJB 3RGCA 3ALFA 1J4HA 4TNSA 1K9TA 3ARZA 3O5JA 4WIWA 3ARYA 3RFWA 1OGBA 1WNOA 3BMBA 4IPXA 5HUAA 4E5RA 1E44A 2WAEA 1ZBVA 1HJWA 3LE4A 1Y0OA 1BKFA 1NMVA 2FDMA 5DEZA 3B9AA 1JNEA 2OWOA 1FKKA 3TCZA 1WR7A 2F2DA 2MNTA 4DZ3A 2EULA 1FJDA 2Q5AA 1ZCNA 5DIUA 5DO2A 1B6CA 2JZVA 2ZQVA 5HWBA 4DRIA 3FSBA 3MCBB 5J6EA 4Z2IA 1FKFA 3ARUA 3G6MA 3LKXB 2XP8A 2LJ4A 1IX5A 2ITKA 3QOKA 1HKKA 5GPRA 5DF0A 4DRMA 3MDYB 3WKZA 3PR9A 2ZQUA 1ZU8A 4QT2A 3KZ7A 4MPKA 2YSBA 4A0TA 2KXQA 4ML4A 1XRVA 2B5UB 2DT3A 1W1YA 4S3JA 3IKGA 4ITZA 3UI4A 4ODKA 4WKFA 3ARXA 4L72B 1JNSA 1HKJA 1YATA 1FKLA 4JFIA 4HARA 4LAYA 2RQSA 2DSWA 5HKGA 5E5WA 3AS2A 5U47A 4WK9A 1FKRA 3ARSA 3O5KA 4MNMA 3AQUA 1E6NA 1X6LA 2KO7A 4HBOA 3UI5A 4JFKA 1Q1CA 2MLXA 1SR0A 2M8IA 1QPFA 3ARTA 2ZR6A 4G50A 4O2TA 5E66A 1L1PA 1GUVA 1HKMA 2Y78A 2XPAA 4TW7A 5HBFA 5GQBA 1RD6A 2QF8A 4A0UA 1TCOC 4URIA 3CH9A 2DT0A 1ZK6A 2IF4A 2RURA 2DG4A 2B31A 4DRJA 4MTVA 1D6OA 4JYSA 4Z2LA 1ROUA 3ARVA 5HW7A 4Z2KA 2F23A 3FS8A 1FFQA 5HTGA 2YBTA 3AS1A 2A3EA 1E6PA 1FKBA 3ARWA 5E65A 1ZBWA 1J6YA 1FKDA 3B9EA 4QZVB 3TC5A 3JYJA 2ESCA 2N87A 3UQAA 2DPEA 2PV2A 1LQ0A 1Q6HA 5B8IC 2M8JA 3UQBA 2YSFA 3O5RA 2A3CA 3FAPA 1JNTA 1D2KA 1NSGA 1X6NA 4DWSB 2MLYA 1W1PA 2M3OW 2UZ5A 4W5UA 1FKIA 1W1VA 3O5IA 2DMVA 1ZBCA 4QIBA 2RUCA 3IK8A 2DK7A 1LG2A 4G2PA 2PI6A 1T11A 1EG4A 1H0GA 3CHCA 1Q6IA 3EIPA 1EG3A 3FSCA 3O5GA 2DSUA 1WB0A 2PPNA 4LAXA 4NZCA 4ODQA 2ZAJA 1K9QA 4WKAA 5HW8A 4TYOA 1W1TA 4J4OA 1NWUA 1GPFA 3WD1A 5HWCA 3WL1A 1WAWA 3CNGA 1EIBA 4GGQA 4REXA 1E15A 4ODMA 2M1IA 2WK2A 1F8AB 4MNJA 4NNRA 3WQWA 4DRPA 5AHTA 3KADA 1FKHA 1KT0A 2ZR5A 1E9LA 1LJYA 4DRHA 2ZQSA 4DWSA 3RM8A 3AS3A 3WD2A 4KR0B 1M5YA 3WL0A 1FKJA 4TW6A 2AOSA 1FAPA 4W9OA 2KE0A 1JNDA 1O6IA 3NTPA 3O5LA 5CQ2A 2OFNA 3ODKA 4C02B 2RSEA 4J4NA 1KFWA 2LAJA 4MNLA 2PV3A 4U85A 2G8ZA 1FKGA 1OWQA 1A7XA 4DT4A 3OOBA 2PV1A
chains in the Genus database with same CATH topology
2MLZA 1W9VA 2MF9A 3EY6A 4LGXA 3BXWA 1LL6A 1D7HA 1U79A 3GPKA 2KR7A 2KI3A 4ODOA 1JMQA 1LG1A 4DH0A 1FFRA 1FD9A 1H0IA 2L2SA 2JXWA 3AS0A 4U86A 4P8WA 4JFLA 1EQ3A 1K9RA 1NWRA 2LKNA 1QZ2A 2M08A 3UF8A 2JV4A 3JXVA 2E45A 2DT1A 1D7IA 1I5HW 4DZ2A 2EZ5W 3KAIA 2ZQTA 3AROA 2MDIA 2ZR4A 1J4IA 2DWVA 1WMVA 2QRVA 3PRBA 4DIPA 1R9HA 3W4RA 3FY1A 5D75A 3L4HA 3B7XA 5E62A 3B9DA 4ODRA 4ODNA 5BXJA 2YBUA 5DITA 3WIJA 1E6RA 3CHDA 4TX0A 1P5QA 3IHZA 2XP7A 5I98A 4TW8A 4MSPA 4IT4A 1C9HA 4LAVA 4ZPVR 1ZL1A 2L4JA 2XP3A 4MAVA 4DRNA 2FAPA 3O5DA 2A3BA 4NSBA 2XP5A 4Q22A 3RM4A 2WM0A 1PINA 1UR9A 3CZ8A 3PRAA 4DROA 4FN2A 3CHFA 2XP4A 4GLXA 1E6ZA 1PBKA 2DSZA 3KAFA 1TK7A 1CTNA 2YSHA 2WADA 1EDQA 1TFVA 4S3KA 2RUQA 2D9FA 1N1AA 2DK1A 3O5QA 1SYTA 3LUOA 4P8XA 4DWSD 3B8SA 4IQCA 4Z2JA 1FKSA 2IUZA 4P8UA 1ZBKA 1F40A 4AY1A 4IT6A 3JYMA 1NWTA 3MCBA 4ZS6A 4BF8A 2G41A 1YW5A 2PPPA 4LAWA 5HT1A 4HBEA 1ITXA 3CHEA 4W9PA 3RMEA 2JMFA 4JFJA 3WD3A 3FXYA 2BA1A 2DG9A 2O92A 3O5EA 1XHGA 4IQ2A 1J4RA 3KAHA 4Z2HA 2PPOA 1TR8A 4DWSC 4FAPA 4N19A 4XAKA 4DRKA 2Y8NB 3H9RB 3UI6A 4JFMA 3OA5A 4MNKA 1NMWA 2FKEA 3M85A 1BL4A 3ARQA 4Z2GA 2YSGA 1GOIA 3MQHA 1KT1A 4DRQA 4MGVA 3KCEA 2VN1A 1JVWA 2F21A 3ARPA 1OGGA 1W9PA 4WKHA 4Q7NA 4KQZA 2XP9A 4L3NA 2XPBA 2WLZA 4R0XA 1D7JA 2AWGA 1FLCA 5JH8A 2MPHA 1W9UA 4ODPA 3CGMA 4P8VA 2RUDA 4ZPWR 1QPLA 1LL7A 5E64A 3I6CA 3NRKA 1FKTA 3RM9A 2LPVA 1W26A 2KGJA 3KABA 3KAGA 1ROTA 2O9OA 2VCDA 1Q6UA 2YSIA 1EYMA 2DT2A 4ZPTR 4R5EA 3WQVA 1EHNA 4QT3A 4W9QA 3UQIA 2M2AA 3CGNA 3WD0A 1LL4A 2F4EA 2PBCA 3VAWA 2LGOA 3O5OA 4WJXA 1UR8A 2KFWA 4PTMA 4GIVA 2JX8A 1HJXA 1O6WA 2RE3A 3WD4A 5GPGA 1HKIA 3IKDA 3PQHA 2DJYA 1RP5A 1VF8A 2OLHA 2DSVA 3M7NA 5HW6A 3G6LA 2WLYA 4U84A 1HXVA 3O5PA 2A3AA 3WH0A 3PRDA 3TDBA 3NI6A 3O5FA 1HJVA 2K8IA 2XP6A 5DIVA 3MQGA 2DG3A 1NH6A 3O5MA 3LKXA 3ALGA 3PA7A 3KACA 1ZB5A 3ARRA 4ODLA 1NWSA 2YAJB 3RGCA 3ALFA 1J4HA 4TNSA 1K9TA 3ARZA 3O5JA 4WIWA 3ARYA 3RFWA 1OGBA 1WNOA 4IPXA 5HUAA 4E5RA 2WAEA 1ZBVA 1HJWA 3LE4A 1Y0OA 1BKFA 1NMVA 2FDMA 5DEZA 3B9AA 1JNEA 2OWOA 1FKKA 3TCZA 1WR7A 2F2DA 2MNTA 4DZ3A 1FJDA 2Q5AA 1ZCNA 5DIUA 5DO2A 1B6CA 2JZVA 2ZQVA 5HWBA 4DRIA 3FSBA 3MCBB 5J6EA 4Z2IA 1FKFA 3ARUA 3G6MA 3LKXB 2XP8A 2LJ4A 1IX5A 2ITKA 3QOKA 1HKKA 5GPRA 5DF0A 4DRMA 3MDYB 3WKZA 3PR9A 2ZQUA 1ZU8A 4QT2A 3KZ7A 4MPKA 2YSBA 4A0TA 2KXQA 4ML4A 1XRVA 2DT3A 1W1YA 4S3JA 3IKGA 4ITZA 3UI4A 4ODKA 4WKFA 3ARXA 4L72B 1JNSA 1HKJA 1YATA 1FKLA 4JFIA 4HARA 4LAYA 2RQSA 2DSWA 5HKGA 5E5WA 3AS2A 5U47A 4WK9A 1FKRA 3ARSA 3O5KA 4MNMA 3AQUA 1E6NA 1X6LA 2KO7A 4HBOA 3UI5A 4JFKA 1Q1CA 2MLXA 1SR0A 2M8IA 1QPFA 3ARTA 2ZR6A 4G50A 4O2TA 5E66A 1L1PA 1GUVA 1HKMA 2Y78A 2XPAA 4TW7A 5HBFA 5GQBA 1RD6A 2QF8A 4A0UA 1TCOC 4URIA 3CH9A 2DT0A 1ZK6A 2IF4A 2RURA 2DG4A 2B31A 4DRJA 4MTVA 1D6OA 4JYSA 4Z2LA 1ROUA 3ARVA 5HW7A 4Z2KA 3FS8A 1FFQA 5HTGA 2YBTA 3AS1A 2A3EA 1E6PA 1FKBA 3ARWA 5E65A 1ZBWA 1J6YA 1FKDA 3B9EA 4QZVB 3TC5A 3JYJA 2ESCA 2N87A 3UQAA 2DPEA 2PV2A 1LQ0A 1Q6HA 5B8IC 2M8JA 3UQBA 2YSFA 3O5RA 2A3CA 3FAPA 1JNTA 1D2KA 1NSGA 1X6NA 4DWSB 2MLYA 1W1PA 2M3OW 2UZ5A 4W5UA 1FKIA 1W1VA 3O5IA 2DMVA 1ZBCA 4QIBA 2RUCA 3IK8A 2DK7A 1LG2A 4G2PA 2PI6A 1T11A 1EG4A 1H0GA 3CHCA 1Q6IA 1EG3A 3FSCA 3O5GA 2DSUA 1WB0A 2PPNA 4LAXA 4NZCA 4ODQA 2ZAJA 1K9QA 4WKAA 5HW8A 4TYOA 1W1TA 4J4OA 1NWUA 1GPFA 3WD1A 5HWCA 3WL1A 1WAWA 3CNGA 1EIBA 4GGQA 4REXA 1E15A 4ODMA 2M1IA 2WK2A 1F8AB 4MNJA 4NNRA 3WQWA 4DRPA 5AHTA 3KADA 1FKHA 1KT0A 2ZR5A 1E9LA 1LJYA 4DRHA 2ZQSA 4DWSA 3RM8A 3AS3A 3WD2A 4KR0B 1M5YA 3WL0A 1FKJA 4TW6A 2AOSA 1FAPA 4W9OA 2KE0A 1JNDA 1O6IA 3NTPA 3O5LA 5CQ2A 2OFNA 3ODKA 4C02B 2RSEA 4J4NA 1KFWA 2LAJA 4MNLA 2PV3A 4U85A 2G8ZA 1FKGA 1OWQA 1A7XA 4DT4A 3OOBA 2PV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HXV A;  2MLZ A;  2MF9 A;  3O5P A;  3EY6 A;  3WH0 A;  1ZK6 A;  3PRD A;  2IF4 A;  3TDB A;  2BA1 A;  1D7H A;  3NI6 A;  1U79 A;  2DG4 A;  2DG9 A;  2RUR A;  3GPK A;  2K8I A;  2KI3 A;  2KR7 A;  2XP6 A;  4DRJ A;  5DIV A;  3O5E A;  1D6O A;  4JYS A;  4ODO A;  1JMQ A;  1ROU A;  4IQ2 A;  1J4R A;  4DH0 A;  3KAH A;  2DG3 A;  1FD9 A;  3O5M A;  5HW7 A;  2PPO A;  4FAP A;  2L2S A;  5HTG A;  4N19 A;  3PA7 A;  3KAC A;  2JXW A;  4ODL A;  4DRK A;  1FKB A;  3H9R B;  4U86 A;  3UI6 A;  4JFL A;  1EQ3 A;  1K9R A;  4JFM A;  1J4H A;  3RGC A;  1J6Y A;  2LKN A;  1QZ2 A;  1FKD A;  4TNS A;  2M08 A;  3UF8 A;  2JV4 A;  3JXV A;  3TC5 A;  2E45 A;  1NMW A;  3JYJ A;  3O5J A;  1D7I A;  2N87 A;  2FKE A;  3M85 A;  3UQA A;  1BL4 A;  1I5H W;  4DZ2 A;  2YSG A;  3RFW A;  2EZ5 W;  3KAI A;  2ZQT A;  1KT1 A;  2MDI A;  4IPX A;  5HUA A;  2ZR4 A;  4E5R A;  2PV2 A;  5B8I C;  1Q6H A;  1J4I A;  2M8J A;  4MGV A;  3KCE A;  2VN1 A;  2DWV A;  1WMV A;  2YSF A;  3LE4 A;  1JVW A;  1Y0O A;  3O5R A;  3FAP A;  3PRB A;  2F21 A;  1BKF A;  1JNT A;  4DIP A;  1NSG A;  1NMV A;  1R9H A;  2MLY A;  5D75 A;  3L4H A;  1FKK A;  2M3O W;  3TCZ A;  1WR7 A;  2F2D A;  2MNT A;  2UZ5 A;  4DZ3 A;  3B7X A;  1FKI A;  2XP9 A;  3O5I A;  4ODR A;  4ODN A;  2DMV A;  5BXJ A;  1FJD A;  2Q5A A;  5DIT A;  1ZCN A;  2XPB A;  4QIB A;  1B6C A;  5DIU A;  4R0X A;  1D7J A;  2ZQV A;  2JZV A;  5HWB A;  2AWG A;  2RUC A;  4DRI A;  3IK8 A;  2DK7 A;  4G2P A;  4TX0 A;  5J6E A;  1P5Q A;  1T11 A;  2MPH A;  1EG4 A;  3IHZ A;  2XP7 A;  1Q6I A;  4ODP A;  1FKF A;  1EG3 A;  3CGM A;  3O5G A;  2XP8 A;  2LJ4 A;  2RUD A;  1QPL A;  2PPN A;  5I98 A;  4TW8 A;  2ITK A;  3I6C A;  3NRK A;  4LAX A;  4MSP A;  4ODQ A;  1FKT A;  1C9H A;  4LAV A;  2ZAJ A;  1K9Q A;  2L4J A;  2XP3 A;  4TYO A;  4DRM A;  5HW8 A;  3MDY B;  4J4O A;  2FAP A;  4DRN A;  2LPV A;  3O5D A;  1W26 A;  2KGJ A;  3KAB A;  3KAG A;  2XP5 A;  1ROT A;  2VCD A;  1PIN A;  1Q6U A;  2ZQU A;  2YSI A;  3CNG A;  5HWC A;  4GGQ A;  4QT2 A;  4REX A;  3KZ7 A;  1EYM A;  4ODM A;  2M1I A;  4NNR A;  1F8A B;  2YSB A;  4DRO A;  4FN2 A;  2KXQ A;  4DRP A;  2XP4 A;  5AHT A;  3KAD A;  1FKH A;  1KT0 A;  1PBK A;  3IKG A;  4ITZ A;  3UI4 A;  3UQB A;  2ZR5 A;  4ODK A;  3KAF A;  1TK7 A;  4DRH A;  2ZQS A;  2YSH A;  1JNS A;  1YAT A;  1FKL A;  1M5Y A;  4JFI A;  2M2A A;  3CGN A;  1FKJ A;  4LAY A;  4QT3 A;  4W9Q A;  3UQI A;  2RQS A;  4TW6 A;  2RUQ A;  1FAP A;  1N1A A;  2D9F A;  2F4E A;  2DK1 A;  2KE0 A;  3O5F A;  2PBC A;  3O5Q A;  4W9O A;  2LGO A;  3VAW A;  5HKG A;  3O5O A;  3LUO A;  1FKR A;  3NTP A;  2KFW A;  3O5K A;  4IQC A;  1FKS A;  4GIV A;  2KO7 A;  3UI5 A;  3O5L A;  4JFK A;  1Q1C A;  1F40 A;  5CQ2 A;  2MLX A;  2OFN A;  2JMF A;  3JYM A;  3ODK A;  2JX8 A;  4C02 B;  2M8I A;  1QPF A;  2RSE A;  4JFJ A;  4J4N A;  4DRQ A;  2ZR6 A;  1O6W A;  4G50 A;  4BF8 A;  2RE3 A;  4O2T A;  5GPG A;  1YW5 A;  2LAJ A;  2PPP A;  3IKD A;  4LAW A;  1L1P A;  4U85 A;  2PV3 A;  2Y78 A;  2DJY A;  2XPA A;  1FKG A;  4TW7 A;  5HT1 A;  3M7N A;  1A7X A;  4DT4 A;  5HW6 A;  1TCO C;  4W9P A;  3OOB A;  4U84 A;  2PV1 A; 
#chains in the Genus database with same CATH topology
 2MLZ A;  1W9V A;  2MF9 A;  3EY6 A;  4LGX A;  3BXW A;  1LL6 A;  1D7H A;  1U79 A;  3GPK A;  2KR7 A;  2KI3 A;  4ODO A;  1JMQ A;  1LG1 A;  4DH0 A;  1FFR A;  1FD9 A;  1H0I A;  2L2S A;  2JXW A;  3AS0 A;  4U86 A;  4P8W A;  4JFL A;  1EQ3 A;  1K9R A;  1NWR A;  2LKN A;  1QZ2 A;  2M08 A;  3UF8 A;  2JV4 A;  3JXV A;  2E45 A;  2DT1 A;  1D7I A;  1I5H W;  4DZ2 A;  2EZ5 W;  3KAI A;  2ZQT A;  3ARO A;  2MDI A;  2ZR4 A;  1J4I A;  2DWV A;  1WMV A;  2QRV A;  3PRB A;  4DIP A;  1R9H A;  3W4R A;  3FY1 A;  5D75 A;  3L4H A;  3B7X A;  5E62 A;  3B9D A;  4ODR A;  4ODN A;  5BXJ A;  2YBU A;  5DIT A;  3WIJ A;  1E6R A;  3CHD A;  4TX0 A;  1P5Q A;  3IHZ A;  2XP7 A;  5I98 A;  4TW8 A;  4MSP A;  4IT4 A;  1C9H A;  4LAV A;  4ZPV R;  1ZL1 A;  2L4J A;  2XP3 A;  4MAV A;  4DRN A;  2FAP A;  3O5D A;  2A3B A;  4NSB A;  2XP5 A;  4Q22 A;  3RM4 A;  2WM0 A;  1PIN A;  1UR9 A;  3CZ8 A;  3PRA A;  4DRO A;  4FN2 A;  3CHF A;  2XP4 A;  4GLX A;  1E6Z A;  1PBK A;  2PN0 A;  2DSZ A;  3KAF A;  1TK7 A;  1CTN A;  2YSH A;  2WAD A;  1EDQ A;  1TFV A;  4S3K A;  2RUQ A;  2D9F A;  1N1A A;  2DK1 A;  3O5Q A;  1SYT A;  3LUO A;  4P8X A;  4DWS D;  3B8S A;  4IQC A;  4Z2J A;  1FKS A;  2IUZ A;  4P8U A;  1ZBK A;  1F40 A;  4AY1 A;  4IT6 A;  3JYM A;  1NWT A;  3MCB A;  3GU0 A;  4ZS6 A;  4BF8 A;  2G41 A;  1YW5 A;  2PPP A;  4LAW A;  5HT1 A;  4HBE A;  1ITX A;  3CHE A;  4W9P A;  3RME A;  2JMF A;  4JFJ A;  3WD3 A;  3FXY A;  2BA1 A;  2DG9 A;  2O92 A;  3O5E A;  1XHG A;  4IQ2 A;  1J4R A;  3KAH A;  2P4V A;  4Z2H A;  2PPO A;  1TR8 A;  4DWS C;  4FAP A;  4N19 A;  4XAK A;  4DRK A;  2Y8N B;  3H9R B;  3UI6 A;  4JFM A;  3OA5 A;  4MNK A;  1NMW A;  2FKE A;  3M85 A;  1BL4 A;  3ARQ A;  4Z2G A;  2YSG A;  1GOI A;  3MQH A;  1KT1 A;  4DRQ A;  4MGV A;  3KCE A;  2VN1 A;  1JVW A;  2F21 A;  3ARP A;  1OGG A;  1W9P A;  4WKH A;  1GRJ A;  4Q7N A;  4KQZ A;  2XP9 A;  2ETN A;  4L3N A;  2XPB A;  2WLZ A;  4R0X A;  1D7J A;  2AWG A;  3GTY X;  1FLC A;  5JH8 A;  2MPH A;  1W9U A;  1JCH B;  4ODP A;  3CGM A;  4P8V A;  2RUD A;  4ZPW R;  1QPL A;  1LL7 A;  5E64 A;  3I6C A;  3NRK A;  1FKT A;  3RM9 A;  2LPV A;  1W26 A;  2KGJ A;  3KAB A;  3KAG A;  1ROT A;  2O9O A;  2VCD A;  1Q6U A;  2YSI A;  1EYM A;  2DT2 A;  4ZPT R;  4R5E A;  3WQV A;  1EHN A;  4QT3 A;  4W9Q A;  3UQI A;  2M2A A;  3CGN A;  3WD0 A;  1LL4 A;  2F4E A;  2PBC A;  3VAW A;  2LGO A;  3O5O A;  4WJX A;  1UR8 A;  2KFW A;  4PTM A;  4GIV A;  2JX8 A;  1HJX A;  1O6W A;  2RE3 A;  3WD4 A;  5GPG A;  1HKI A;  3IKD A;  3PQH A;  2DJY A;  1RP5 A;  1VF8 A;  2OLH A;  4UDM A;  2DSV A;  3M7N A;  5HW6 A;  3G6L A;  2WLY A;  4U84 A;  1HXV A;  3O5P A;  2A3A A;  3WH0 A;  3PRD A;  3TDB A;  3NI6 A;  3O5F A;  1HJV A;  2K8I A;  2XP6 A;  5DIV A;  3MQG A;  2DG3 A;  1NH6 A;  3O5M A;  3LKX A;  3ALG A;  3PA7 A;  3KAC A;  1ZB5 A;  3ARR A;  4ODL A;  1NWS A;  2YAJ B;  3RGC A;  3ALF A;  1J4H A;  4TNS A;  1K9T A;  3ARZ A;  3O5J A;  4WIW A;  3ARY A;  3RFW A;  1OGB A;  1WNO A;  3BMB A;  4IPX A;  5HUA A;  4E5R A;  1E44 A;  2WAE A;  1ZBV A;  1HJW A;  3LE4 A;  1Y0O A;  1BKF A;  1NMV A;  2FDM A;  5DEZ A;  3B9A A;  1JNE A;  2OWO A;  1FKK A;  3TCZ A;  1WR7 A;  2F2D A;  2MNT A;  4DZ3 A;  2EUL A;  1FJD A;  2Q5A A;  1ZCN A;  5DIU A;  5DO2 A;  1B6C A;  2JZV A;  2ZQV A;  5HWB A;  4DRI A;  3FSB A;  3MCB B;  5J6E A;  4Z2I A;  1FKF A;  3ARU A;  3G6M A;  3LKX B;  2XP8 A;  2LJ4 A;  1IX5 A;  2ITK A;  3QOK A;  1HKK A;  5GPR A;  5DF0 A;  4DRM A;  3MDY B;  3WKZ A;  3PR9 A;  2ZQU A;  1ZU8 A;  4QT2 A;  3KZ7 A;  4MPK A;  2YSB A;  4A0T A;  2KXQ A;  4ML4 A;  1XRV A;  2B5U B;  2DT3 A;  1W1Y A;  4S3J A;  3IKG A;  4ITZ A;  3UI4 A;  4ODK A;  4WKF A;  3ARX A;  4L72 B;  1JNS A;  1HKJ A;  1YAT A;  1FKL A;  4JFI A;  4HAR A;  4LAY A;  2RQS A;  2DSW A;  5HKG A;  5E5W A;  3AS2 A;  5U47 A;  4WK9 A;  1FKR A;  3ARS A;  3O5K A;  4MNM A;  3AQU A;  1E6N A;  1X6L A;  2KO7 A;  4HBO A;  3UI5 A;  4JFK A;  1Q1C A;  2MLX A;  1SR0 A;  2M8I A;  1QPF A;  3ART A;  2ZR6 A;  4G50 A;  4O2T A;  5E66 A;  1L1P A;  1GUV A;  1HKM A;  2Y78 A;  2XPA A;  4TW7 A;  5HBF A;  5GQB A;  1RD6 A;  2QF8 A;  4A0U A;  1TCO C;  4URI A;  3CH9 A;  2DT0 A;  1ZK6 A;  2IF4 A;  2RUR A;  2DG4 A;  2B31 A;  4DRJ A;  4MTV A;  1D6O A;  4JYS A;  4Z2L A;  1ROU A;  3ARV A;  5HW7 A;  4Z2K A;  2F23 A;  3FS8 A;  1FFQ A;  5HTG A;  2YBT A;  3AS1 A;  2A3E A;  1E6P A;  1FKB A;  3ARW A;  5E65 A;  1ZBW A;  1J6Y A;  1FKD A;  3B9E A;  4QZV B;  3TC5 A;  3JYJ A;  2ESC A;  2N87 A;  3UQA A;  2DPE A;  2PV2 A;  1LQ0 A;  1Q6H A;  5B8I C;  2M8J A;  3UQB A;  2YSF A;  3O5R A;  2A3C A;  3FAP A;  1JNT A;  1D2K A;  1NSG A;  1X6N A;  4DWS B;  2MLY A;  1W1P A;  2M3O W;  2UZ5 A;  4W5U A;  1FKI A;  1W1V A;  3O5I A;  2DMV A;  1ZBC A;  4QIB A;  2RUC A;  3IK8 A;  2DK7 A;  1LG2 A;  4G2P A;  2PI6 A;  1T11 A;  1EG4 A;  1H0G A;  3CHC A;  1Q6I A;  3EIP A;  1EG3 A;  3FSC A;  3O5G A;  2DSU A;  1WB0 A;  2PPN A;  4LAX A;  4NZC A;  4ODQ A;  2ZAJ A;  1K9Q A;  4WKA A;  5HW8 A;  4TYO A;  1W1T A;  4J4O A;  1NWU A;  1GPF A;  3WD1 A;  5HWC A;  3WL1 A;  1WAW A;  3CNG A;  1EIB A;  4GGQ A;  4REX A;  1E15 A;  4ODM A;  2M1I A;  2WK2 A;  1F8A B;  4MNJ A;  4NNR A;  3WQW A;  4DRP A;  5AHT A;  3KAD A;  1FKH A;  1KT0 A;  2ZR5 A;  1E9L A;  1LJY A;  4DRH A;  2ZQS A;  4DWS A;  3RM8 A;  3AS3 A;  3WD2 A;  4KR0 B;  1M5Y A;  3WL0 A;  1FKJ A;  4TW6 A;  2AOS A;  1FAP A;  4W9O A;  2KE0 A;  1JND A;  1O6I A;  3NTP A;  3O5L A;  5CQ2 A;  2OFN A;  3ODK A;  4C02 B;  2RSE A;  4J4N A;  1KFW A;  2LAJ A;  4MNL A;  2PV3 A;  4U85 A;  2G8Z A;  1FKG A;  1OWQ A;  1A7X A;  4DT4 A;  3OOB A;  2PV1 A; 
#chains in the Genus database with same CATH homology
 2MLZ A;  1W9V A;  2MF9 A;  3EY6 A;  4LGX A;  3BXW A;  1LL6 A;  1D7H A;  1U79 A;  3GPK A;  2KR7 A;  2KI3 A;  4ODO A;  1JMQ A;  1LG1 A;  4DH0 A;  1FFR A;  1FD9 A;  1H0I A;  2L2S A;  2JXW A;  3AS0 A;  4U86 A;  4P8W A;  4JFL A;  1EQ3 A;  1K9R A;  1NWR A;  2LKN A;  1QZ2 A;  2M08 A;  3UF8 A;  2JV4 A;  3JXV A;  2E45 A;  2DT1 A;  1D7I A;  1I5H W;  4DZ2 A;  2EZ5 W;  3KAI A;  2ZQT A;  3ARO A;  2MDI A;  2ZR4 A;  1J4I A;  2DWV A;  1WMV A;  2QRV A;  3PRB A;  4DIP A;  1R9H A;  3W4R A;  3FY1 A;  5D75 A;  3L4H A;  3B7X A;  5E62 A;  3B9D A;  4ODR A;  4ODN A;  5BXJ A;  2YBU A;  5DIT A;  3WIJ A;  1E6R A;  3CHD A;  4TX0 A;  1P5Q A;  3IHZ A;  2XP7 A;  5I98 A;  4TW8 A;  4MSP A;  4IT4 A;  1C9H A;  4LAV A;  4ZPV R;  1ZL1 A;  2L4J A;  2XP3 A;  4MAV A;  4DRN A;  2FAP A;  3O5D A;  2A3B A;  4NSB A;  2XP5 A;  4Q22 A;  3RM4 A;  2WM0 A;  1PIN A;  1UR9 A;  3CZ8 A;  3PRA A;  4DRO A;  4FN2 A;  3CHF A;  2XP4 A;  4GLX A;  1E6Z A;  1PBK A;  2DSZ A;  3KAF A;  1TK7 A;  1CTN A;  2YSH A;  2WAD A;  1EDQ A;  1TFV A;  4S3K A;  2RUQ A;  2D9F A;  1N1A A;  2DK1 A;  3O5Q A;  1SYT A;  3LUO A;  4P8X A;  4DWS D;  3B8S A;  4IQC A;  4Z2J A;  1FKS A;  2IUZ A;  4P8U A;  1ZBK A;  1F40 A;  4AY1 A;  4IT6 A;  3JYM A;  1NWT A;  3MCB A;  4ZS6 A;  4BF8 A;  2G41 A;  1YW5 A;  2PPP A;  4LAW A;  5HT1 A;  4HBE A;  1ITX A;  3CHE A;  4W9P A;  3RME A;  2JMF A;  4JFJ A;  3WD3 A;  3FXY A;  2BA1 A;  2DG9 A;  2O92 A;  3O5E A;  1XHG A;  4IQ2 A;  1J4R A;  3KAH A;  4Z2H A;  2PPO A;  1TR8 A;  4DWS C;  4FAP A;  4N19 A;  4XAK A;  4DRK A;  2Y8N B;  3H9R B;  3UI6 A;  4JFM A;  3OA5 A;  4MNK A;  1NMW A;  2FKE A;  3M85 A;  1BL4 A;  3ARQ A;  4Z2G A;  2YSG A;  1GOI A;  3MQH A;  1KT1 A;  4DRQ A;  4MGV A;  3KCE A;  2VN1 A;  1JVW A;  2F21 A;  3ARP A;  1OGG A;  1W9P A;  4WKH A;  4Q7N A;  4KQZ A;  2XP9 A;  4L3N A;  2XPB A;  2WLZ A;  4R0X A;  1D7J A;  2AWG A;  1FLC A;  5JH8 A;  2MPH A;  1W9U A;  4ODP A;  3CGM A;  4P8V A;  2RUD A;  4ZPW R;  1QPL A;  1LL7 A;  5E64 A;  3I6C A;  3NRK A;  1FKT A;  3RM9 A;  2LPV A;  1W26 A;  2KGJ A;  3KAB A;  3KAG A;  1ROT A;  2O9O A;  2VCD A;  1Q6U A;  2YSI A;  1EYM A;  2DT2 A;  4ZPT R;  4R5E A;  3WQV A;  1EHN A;  4QT3 A;  4W9Q A;  3UQI A;  2M2A A;  3CGN A;  3WD0 A;  1LL4 A;  2F4E A;  2PBC A;  3VAW A;  2LGO A;  3O5O A;  4WJX A;  1UR8 A;  2KFW A;  4PTM A;  4GIV A;  2JX8 A;  1HJX A;  1O6W A;  2RE3 A;  3WD4 A;  5GPG A;  1HKI A;  3IKD A;  3PQH A;  2DJY A;  1RP5 A;  1VF8 A;  2OLH A;  2DSV A;  3M7N A;  5HW6 A;  3G6L A;  2WLY A;  4U84 A;  1HXV A;  3O5P A;  2A3A A;  3WH0 A;  3PRD A;  3TDB A;  3NI6 A;  3O5F A;  1HJV A;  2K8I A;  2XP6 A;  5DIV A;  3MQG A;  2DG3 A;  1NH6 A;  3O5M A;  3LKX A;  3ALG A;  3PA7 A;  3KAC A;  1ZB5 A;  3ARR A;  4ODL A;  1NWS A;  2YAJ B;  3RGC A;  3ALF A;  1J4H A;  4TNS A;  1K9T A;  3ARZ A;  3O5J A;  4WIW A;  3ARY A;  3RFW A;  1OGB A;  1WNO A;  4IPX A;  5HUA A;  4E5R A;  2WAE A;  1ZBV A;  1HJW A;  3LE4 A;  1Y0O A;  1BKF A;  1NMV A;  2FDM A;  5DEZ A;  3B9A A;  1JNE A;  2OWO A;  1FKK A;  3TCZ A;  1WR7 A;  2F2D A;  2MNT A;  4DZ3 A;  1FJD A;  2Q5A A;  1ZCN A;  5DIU A;  5DO2 A;  1B6C A;  2JZV A;  2ZQV A;  5HWB A;  4DRI A;  3FSB A;  3MCB B;  5J6E A;  4Z2I A;  1FKF A;  3ARU A;  3G6M A;  3LKX B;  2XP8 A;  2LJ4 A;  1IX5 A;  2ITK A;  3QOK A;  1HKK A;  5GPR A;  5DF0 A;  4DRM A;  3MDY B;  3WKZ A;  3PR9 A;  2ZQU A;  1ZU8 A;  4QT2 A;  3KZ7 A;  4MPK A;  2YSB A;  4A0T A;  2KXQ A;  4ML4 A;  1XRV A;  2DT3 A;  1W1Y A;  4S3J A;  3IKG A;  4ITZ A;  3UI4 A;  4ODK A;  4WKF A;  3ARX A;  4L72 B;  1JNS A;  1HKJ A;  1YAT A;  1FKL A;  4JFI A;  4HAR A;  4LAY A;  2RQS A;  2DSW A;  5HKG A;  5E5W A;  3AS2 A;  5U47 A;  4WK9 A;  1FKR A;  3ARS A;  3O5K A;  4MNM A;  3AQU A;  1E6N A;  1X6L A;  2KO7 A;  4HBO A;  3UI5 A;  4JFK A;  1Q1C A;  2MLX A;  1SR0 A;  2M8I A;  1QPF A;  3ART A;  2ZR6 A;  4G50 A;  4O2T A;  5E66 A;  1L1P A;  1GUV A;  1HKM A;  2Y78 A;  2XPA A;  4TW7 A;  5HBF A;  5GQB A;  1RD6 A;  2QF8 A;  4A0U A;  1TCO C;  4URI A;  3CH9 A;  2DT0 A;  1ZK6 A;  2IF4 A;  2RUR A;  2DG4 A;  2B31 A;  4DRJ A;  4MTV A;  1D6O A;  4JYS A;  4Z2L A;  1ROU A;  3ARV A;  5HW7 A;  4Z2K A;  3FS8 A;  1FFQ A;  5HTG A;  2YBT A;  3AS1 A;  2A3E A;  1E6P A;  1FKB A;  3ARW A;  5E65 A;  1ZBW A;  1J6Y A;  1FKD A;  3B9E A;  4QZV B;  3TC5 A;  3JYJ A;  2ESC A;  2N87 A;  3UQA A;  2DPE A;  2PV2 A;  1LQ0 A;  1Q6H A;  5B8I C;  2M8J A;  3UQB A;  2YSF A;  3O5R A;  2A3C A;  3FAP A;  1JNT A;  1D2K A;  1NSG A;  1X6N A;  4DWS B;  2MLY A;  1W1P A;  2M3O W;  2UZ5 A;  4W5U A;  1FKI A;  1W1V A;  3O5I A;  2DMV A;  1ZBC A;  4QIB A;  2RUC A;  3IK8 A;  2DK7 A;  1LG2 A;  4G2P A;  2PI6 A;  1T11 A;  1EG4 A;  1H0G A;  3CHC A;  1Q6I A;  1EG3 A;  3FSC A;  3O5G A;  2DSU A;  1WB0 A;  2PPN A;  4LAX A;  4NZC A;  4ODQ A;  2ZAJ A;  1K9Q A;  4WKA A;  5HW8 A;  4TYO A;  1W1T A;  4J4O A;  1NWU A;  1GPF A;  3WD1 A;  5HWC A;  3WL1 A;  1WAW A;  3CNG A;  1EIB A;  4GGQ A;  4REX A;  1E15 A;  4ODM A;  2M1I A;  2WK2 A;  1F8A B;  4MNJ A;  4NNR A;  3WQW A;  4DRP A;  5AHT A;  3KAD A;  1FKH A;  1KT0 A;  2ZR5 A;  1E9L A;  1LJY A;  4DRH A;  2ZQS A;  4DWS A;  3RM8 A;  3AS3 A;  3WD2 A;  4KR0 B;  1M5Y A;  3WL0 A;  1FKJ A;  4TW6 A;  2AOS A;  1FAP A;  4W9O A;  2KE0 A;  1JND A;  1O6I A;  3NTP A;  3O5L A;  5CQ2 A;  2OFN A;  3ODK A;  4C02 B;  2RSE A;  4J4N A;  1KFW A;  2LAJ A;  4MNL A;  2PV3 A;  4U85 A;  2G8Z A;  1FKG A;  1OWQ A;  1A7X A;  4DT4 A;  3OOB A;  2PV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...