2XPBA

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
146
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 47
structure length 146
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xpbA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xpbA02
1ZK6A 3RGCA 3ODKA 1B6CA 4FN2A 1K9QA 1WR7A 3O5RA 1I5HW 3RFWA 2LKNA 2JXWA 3CGMA 1Q1CA 1J4IA 2FAPA 1TK7A 3UI6A 3IKDA 2PPPA 1FKJA 1M5YA 1JNSA 4W9QA 3FAPA 2M3OW 1WMVA 4LAWA 3O5QA 3VAWA 5DITA 3KAGA 4TX0A 5HUAA 2RUDA 1ROTA 4QT2A 2ITKA 5AHTA 3IK8A 2XPAA 1BL4A 4DRJA 4DRIA 4LAVA 3GPKA 2LJ4A 2AWGA 4C02B 3KACA 3PRBA 4JYSA 4R0XA 4JFKA 1FKHA 4ODNA 4DRKA 4DRQA 3JXVA 2XP3A 3OOBA 2PV2A 3UQAA 2RUCA 2VN1A 2XP7A 1PBKA 3O5DA 3O5JA 2ZR5A 1FKIA 1D7JA 4REXA 4JFIA 5DIVA 1EG3A 2MNTA 3KCEA 3IKGA 2L2SA 3EY6A 1F40A 4DZ2A 1Q6IA 3UQIA 3O5KA 1TCOC 4TW6A 4ODQA 2PBCA 2ZAJA 1T11A 5GPGA 4J4NA 5J6EA 5HTGA 4ODPA 2ZQVA 4DT4A 2EZ5W 2DG3A 2JZVA 1EYMA 3L4HA 2Y78A 2KI3A 4ODKA 3PRDA 1FJDA 3M85A 1BKFA 2DG9A 5BXJA 2YSGA 2D9FA 2YSBA 3KAHA 1KT0A 3KABA 3KZ7A 4MSPA 2DK7A 3H9RB 3TDBA 2MF9A 1FKLA 3O5OA 2YSFA 4U86A 2M8JA 2LGOA 4JFJA 4DRMA 3KAIA 1YATA 1FKRA 2BA1A 4NNRA 3MDYB 2MPHA 2F21A 1J4RA 1C9HA 2L4JA 2KR7A 2KFWA 1YW5A 4DRHA 4N19A 3O5IA 2JV4A 1QPFA 1Q6UA 3M7NA 4U84A 1D6OA 1FKBA 2DWVA 5D75A 1NMVA 2M1IA 4ITZA 4W9OA 1N1AA 2KXQA 2MDIA 4ODLA 4QT3A 1QZ2A 5HT1A 4TYOA 4U85A 1QPLA 2F4EA 2OFNA 2FKEA 2RURA 3CNGA 4FAPA 2PV3A 3O5LA 3TC5A 1J4HA 3KADA 4QIBA 3JYJA 1FKTA 5HWCA 2XP6A 2PPOA 4E5RA 3I6CA 3NI6A 1A7XA 3JYMA 4G2PA 2KE0A 2Q5AA 2MLXA 2XPBA 1PINA 2YSIA 3UI4A 4O2TA 1JVWA 1FKGA 2UZ5A 2XP5A 3UQBA 5HW8A 5HW7A 4DZ3A 4ODRA 5B8IC 1JNTA 2N87A 2JMFA 3B7XA 3O5MA 2DJYA 2XP9A 1ROUA 2KGJA 4DRPA 2M2AA 2F2DA 1R9HA 1JMQA 1EQ3A 2VCDA 3IHZA 4JFLA 2ZQSA 4IQ2A 3O5EA 1L1PA 4IQCA 4W9PA 1EG4A 4ODOA 4ODMA 4TW8A 2RSEA 4LAXA 1U79A 1D7HA 2MLYA 5HW6A 1O6WA 1FD9A 2JX8A 2ZR4A 5CQ2A 3CGNA 4BF8A 1D7IA 2PV1A 2PPNA 4MGVA 1J6YA 3O5GA 4DH0A 3WH0A 1Y0OA 5HKGA 3NTPA 1W26A 4GIVA 4LAYA 2RQSA 4G50A 3NRKA 2XP4A 1K9RA 3LUOA 1NSGA 3O5PA 1FKSA 3KAFA 4DROA 1ZCNA 1FAPA 2K8IA 1Q6HA 2LPVA 4GGQA 3O5FA 2IF4A 4IPXA 4JFMA 4J4OA 1FKKA 1NMWA 4TW7A 1KT1A 2DG4A 2XP8A 2LAJA 2ZQUA 3UI5A 2DK1A 1F8AB 2M8IA 4TNSA 1HXVA 2DMVA 2ZQTA 2RE3A 5I98A 2KO7A 1FKFA 2RUQA 2M08A 5HWBA 5DIUA 2ZR6A 3PA7A 2MLZA 4DRNA 4DIPA 2E45A 2YSHA 1FKDA 3LE4A 3TCZA 1P5QA 3UF8A
chains in the Genus database with same CATH superfamily
5E66A 1EDQA 1ZK6A 3ARUA 3RGCA 3ODKA 1B6CA 4FN2A 4P8WA 1K9QA 1O6IA 1WR7A 4DWSA 4WIWA 4NSBA 3O5RA 1I5HW 3FS8A 3RFWA 3AS1A 2LKNA 4A0UA 3CH9A 1UR8A 1K9TA 3WIJA 1ZBWA 2JXWA 3CGMA 1X6NA 1Q1CA 1J4IA 2FAPA 1TK7A 2WADA 3UI6A 3IKDA 2PPPA 1FKJA 4MPKA 1M5YA 1JNSA 4W9QA 3FAPA 2M3OW 1WMVA 4LAWA 3ARRA 3O5QA 1RP5A 3VAWA 5DITA 3KAGA 1CTNA 4WJXA 4TX0A 5HUAA 1E6ZA 2RUDA 1ROTA 2DT3A 3AS2A 2DT1A 1LQ0A 4QT2A 3ARPA 1FFQA 1WB0A 2ITKA 5AHTA 1H0IA 3IK8A 2XPAA 3ARTA 1BL4A 1E44A 4DRJA 1WAWA 4ZPWR 3GTYX 2QRVA 4DRIA 4LAVA 3GPKA 4PTMA 2LJ4A 4P8UA 2OLHA 2AWGA 4C02B 3KACA 3PRBA 4JYSA 4R0XA 4JFKA 1FKHA 4LGXA 4ODNA 4DRKA 4DRQA 3JXVA 2XP3A 3OOBA 1GRJA 2PV2A 3UQAA 2RUCA 4L72B 2VN1A 2XP7A 1PBKA 3O5DA 4IT6A 3O5JA 2ZR5A 4Z2LA 1FKIA 1TFVA 1EIBA 3CHDA 1D7JA 4MNMA 3LKXB 1JCHB 2B31A 4REXA 4JFIA 5DIVA 1EG3A 2MNTA 3KCEA 3BXWA 3IKGA 1KFWA 1E6RA 2WM0A 1SYTA 2L2SA 3EY6A 3RMEA 1F40A 4DZ2A 1Q6IA 1LL4A 3UQIA 3RM8A 3O5KA 1TCOC 4TW6A 4ODQA 2PBCA 2ZAJA 3GU0A 3MCBA 1T11A 2EULA 5GPGA 4J4NA 1XHGA 5J6EA 5HTGA 4ODPA 4W5UA 2ZQVA 5GPRA 4DT4A 2EZ5W 2DSZA 2DG3A 2JZVA 1EYMA 4Z2GA 2OWOA 1E6PA 2DT2A 3L4HA 1HKJA 2YBUA 2Y78A 3CHEA 3RM9A 2KI3A 4ODKA 3WKZA 3PRDA 1FJDA 1HKMA 1FFRA 3M85A 1BKFA 2DG9A 4WKAA 5BXJA 3AS0A 2YSGA 1E9LA 2D9FA 3ALFA 1JNDA 2YSBA 5JH8A 4MAVA 3KAHA 1KT0A 3ARYA 4Q22A 3KABA 3KZ7A 4MSPA 2DK7A 3H9RB 4WKHA 3TDBA 2MF9A 1FKLA 3AROA 3WD4A 3WD0A 3O5OA 4MNKA 5GQBA 3EIPA 2YSFA 4U86A 2M8JA 2LGOA 4JFJA 4DRMA 3KAIA 1YATA 4KR0B 1ZBCA 4WKFA 2BA1A 4NNRA 1FKRA 3MDYB 2MPHA 1HKIA 2G8ZA 2F21A 1J4RA 1C9HA 1X6LA 3ARZA 2L4JA 4WK9A 1TR8A 4A0TA 2KR7A 1NWTA 2KFWA 3CZ8A 1YW5A 3AQUA 4DRHA 1ZBKA 2A3EA 4L3NA 4N19A 3O5IA 2JV4A 2PN0A 1QPFA 1OGGA 1Q6UA 3M7NA 3G6MA 4U84A 1JNEA 1D6OA 1D2KA 1FKBA 2DWVA 5D75A 1ZL1A 1NMVA 1SR0A 1W1YA 2M1IA 1OGBA 2ETNA 3FSBA 4GLXA 4AY1A 1EHNA 4ITZA 2A3AA 4MNLA 4W9OA 1N1AA 2KXQA 2MDIA 4Z2KA 4ODLA 4QT3A 4QZVB 1QZ2A 3B9AA 2YAJB 5HT1A 3W4RA 4TYOA 1GPFA 4U85A 1QPLA 2WLZA 2F4EA 2OFNA 1VF8A 1W9VA 2FKEA 3BMBA 4R5EA 1ITXA 3CNGA 2RURA 4FAPA 2PV3A 3O5LA 4P8XA 3TC5A 1J4HA 2WAEA 1IX5A 3KADA 4QIBA 3JYJA 1FKTA 5HWCA 2XP6A 2PPOA 4E5RA 3I6CA 3NI6A 3WL1A 1A7XA 3JYMA 4G2PA 1W1TA 2KE0A 1W1PA 2Q5AA 2MLXA 2O92A 2XPBA 1PINA 1ZB5A 4NZCA 4MTVA 2YSIA 3UI4A 4O2TA 1JVWA 1FKGA 2UZ5A 2XP5A 3UQBA 5HW8A 5HW7A 2IUZA 3WD3A 4DZ3A 1NH6A 1RD6A 4ODRA 2PI6A 5B8IC 4UDMA 4HARA 1JNTA 4DWSC 2N87A 2AOSA 1GUVA 3CHFA 2JMFA 4HBEA 3B7XA 3QOKA 3O5MA 3FSCA 1UR9A 2DJYA 2XP9A 1ROUA 2KGJA 5E64A 4DRPA 2M2AA 2F2DA 2WK2A 3LKXA 5HBFA 1R9HA 1HJVA 1JMQA 4DWSD 1EQ3A 2VCDA 1LG2A 1HJWA 5E62A 4XAKA 3IHZA 2F23A 4JFLA 2ZQSA 4IQ2A 1XRVA 3O5EA 1W1VA 1LG1A 2Y8NB 2ESCA 1L1PA 3ARSA 4IQCA 4ML4A 4W9PA 1EG4A 4ODOA 2DT0A 4ODMA 4TW8A 2G41A 2RSEA 1E15A 4LAXA 1HKKA 1U79A 1D7HA 2A3BA 1NWUA 2MLYA 1NWRA 5HW6A 1O6WA 1FD9A 2JX8A 2ZR4A 3FXYA 5CQ2A 2B5UB 4Z2IA 3CGNA 2DSVA 4BF8A 4Z2JA 1D7IA 2PV1A 2PPNA 4MGVA 1GOIA 1J6YA 4P8VA 3MCBB 3ARWA 3ARVA 1LL6A 3B9EA 3O5GA 3WQWA 4DH0A 3WH0A 1Y0OA 1HJXA 5HKGA 3CHCA 3NTPA 1W26A 4GIVA 4LAYA 5E65A 2RQSA 4G50A 3NRKA 1WNOA 5DO2A 2XP4A 1K9RA 2DSUA 2YBTA 3MQHA 3LUOA 1NSGA 3O5PA 1FKSA 3KAFA 2DPEA 4DROA 3PQHA 1ZCNA 1FAPA 2K8IA 1ZU8A 1Q6HA 1FLCA 3AS3A 1W9UA 2LPVA 3PRAA 4GGQA 4DWSB 4MNJA 1ZBVA 3WD2A 3O5FA 3ARQA 3B8SA 3WL0A 2A3CA 4ZPVR 3B9DA 1OWQA 2IF4A 4IPXA 3FY1A 5DEZA 3ALGA 1NWSA 4JFMA 2P4VA 5U47A 4J4OA 1FKKA 1NMWA 4TW7A 5E5WA 2DSWA 1KT1A 2WLYA 2DG4A 2XP8A 2O9OA 3G6LA 2LAJA 4KQZA 5DF0A 1E6NA 1LL7A 2ZQUA 3UI5A 2DK1A 4ZS6A 1F8AB 2M8IA 4URIA 4TNSA 1HXVA 4ZPTR 2DMVA 2ZQTA 2RE3A 5I98A 2KO7A 1FKFA 2RUQA 3RM4A 3OA5A 3MQGA 2M08A 5HWBA 5DIUA 2ZR6A 3PA7A 2MLZA 1W9PA 3ARXA 4S3JA 4DRNA 4Q7NA 2FDMA 2QF8A 4HBOA 4DIPA 2E45A 2YSHA 1LJYA 4Z2HA 1FKDA 3LE4A 1H0GA 3PR9A 3TCZA 4IT4A 3WQVA 3WD1A 1P5QA 3UF8A 4S3KA
chains in the Genus database with same CATH topology
5E66A 1EDQA 1ZK6A 3ARUA 3RGCA 3ODKA 1B6CA 4FN2A 4P8WA 1K9QA 1O6IA 1WR7A 4DWSA 4WIWA 4NSBA 3O5RA 1I5HW 3FS8A 3RFWA 3AS1A 2LKNA 4A0UA 3CH9A 1UR8A 1K9TA 3WIJA 1ZBWA 2JXWA 3CGMA 1X6NA 1Q1CA 1J4IA 2FAPA 1TK7A 2WADA 3UI6A 3IKDA 2PPPA 1FKJA 4MPKA 1M5YA 1JNSA 4W9QA 3FAPA 2M3OW 1WMVA 4LAWA 3ARRA 3O5QA 1RP5A 3VAWA 5DITA 3KAGA 1CTNA 4WJXA 4TX0A 5HUAA 1E6ZA 2RUDA 1ROTA 2DT3A 3AS2A 2DT1A 1LQ0A 4QT2A 3ARPA 1FFQA 1WB0A 2ITKA 5AHTA 1H0IA 3IK8A 2XPAA 3ARTA 1BL4A 4DRJA 1WAWA 4ZPWR 2QRVA 4DRIA 4LAVA 3GPKA 4PTMA 2LJ4A 4P8UA 2OLHA 2AWGA 4C02B 3KACA 3PRBA 4JYSA 4R0XA 4JFKA 1FKHA 4LGXA 4ODNA 4DRKA 4DRQA 3JXVA 2XP3A 3OOBA 2PV2A 3UQAA 2RUCA 4L72B 2VN1A 2XP7A 1PBKA 3O5DA 4IT6A 3O5JA 2ZR5A 4Z2LA 1FKIA 1TFVA 1EIBA 3CHDA 1D7JA 4MNMA 3LKXB 2B31A 4REXA 4JFIA 5DIVA 1EG3A 2MNTA 3KCEA 3BXWA 3IKGA 1KFWA 1E6RA 2WM0A 1SYTA 2L2SA 3EY6A 3RMEA 1F40A 4DZ2A 1Q6IA 1LL4A 3UQIA 3RM8A 3O5KA 1TCOC 4TW6A 4ODQA 2PBCA 2ZAJA 3MCBA 1T11A 5GPGA 4J4NA 1XHGA 5J6EA 5HTGA 4ODPA 4W5UA 2ZQVA 5GPRA 4DT4A 2EZ5W 2DSZA 2DG3A 2JZVA 1EYMA 4Z2GA 2OWOA 1E6PA 2DT2A 3L4HA 1HKJA 2YBUA 2Y78A 3CHEA 3RM9A 2KI3A 4ODKA 3WKZA 3PRDA 1FJDA 1HKMA 1FFRA 3M85A 1BKFA 2DG9A 4WKAA 5BXJA 3AS0A 2YSGA 1E9LA 2D9FA 3ALFA 1JNDA 2YSBA 5JH8A 4MAVA 3KAHA 1KT0A 3ARYA 4Q22A 3KABA 3KZ7A 4MSPA 2DK7A 3H9RB 4WKHA 3TDBA 2MF9A 1FKLA 3AROA 3WD4A 3WD0A 3O5OA 4MNKA 5GQBA 2YSFA 4U86A 2M8JA 2LGOA 4JFJA 4DRMA 3KAIA 1YATA 4KR0B 1ZBCA 4WKFA 2BA1A 4NNRA 1FKRA 3MDYB 2MPHA 1HKIA 2G8ZA 2F21A 1J4RA 1C9HA 1X6LA 3ARZA 2L4JA 4WK9A 1TR8A 4A0TA 2KR7A 1NWTA 2KFWA 3CZ8A 1YW5A 3AQUA 4DRHA 1ZBKA 2A3EA 4L3NA 4N19A 3O5IA 2JV4A 1QPFA 1OGGA 1Q6UA 3M7NA 3G6MA 4U84A 1JNEA 1D6OA 1D2KA 1FKBA 2DWVA 5D75A 1ZL1A 1NMVA 1SR0A 1W1YA 2M1IA 1OGBA 3FSBA 4GLXA 4AY1A 1EHNA 4ITZA 2A3AA 4MNLA 4W9OA 1N1AA 2KXQA 2MDIA 4Z2KA 4ODLA 4QT3A 4QZVB 1QZ2A 3B9AA 2YAJB 5HT1A 3W4RA 4TYOA 1GPFA 4U85A 1QPLA 2WLZA 2F4EA 2OFNA 1VF8A 1W9VA 2FKEA 4R5EA 1ITXA 3CNGA 2RURA 4FAPA 2PV3A 3O5LA 4P8XA 3TC5A 1J4HA 2WAEA 1IX5A 3KADA 4QIBA 3JYJA 1FKTA 5HWCA 2XP6A 2PPOA 4E5RA 3I6CA 3NI6A 3WL1A 1A7XA 3JYMA 4G2PA 1W1TA 2KE0A 1W1PA 2Q5AA 2MLXA 2O92A 2XPBA 1PINA 1ZB5A 4NZCA 4MTVA 2YSIA 3UI4A 4O2TA 1JVWA 1FKGA 2UZ5A 2XP5A 3UQBA 5HW8A 5HW7A 2IUZA 3WD3A 4DZ3A 1NH6A 1RD6A 4ODRA 2PI6A 5B8IC 4HARA 1JNTA 4DWSC 2N87A 2AOSA 1GUVA 3CHFA 2JMFA 4HBEA 3B7XA 3QOKA 3O5MA 3FSCA 1UR9A 2DJYA 2XP9A 1ROUA 2KGJA 5E64A 4DRPA 2M2AA 2F2DA 2WK2A 3LKXA 5HBFA 1R9HA 1HJVA 1JMQA 4DWSD 1EQ3A 2VCDA 1LG2A 1HJWA 5E62A 4XAKA 3IHZA 4JFLA 2ZQSA 4IQ2A 1XRVA 3O5EA 1W1VA 1LG1A 2Y8NB 2ESCA 1L1PA 3ARSA 4IQCA 4ML4A 4W9PA 1EG4A 4ODOA 2DT0A 4ODMA 4TW8A 2G41A 2RSEA 1E15A 4LAXA 1HKKA 1U79A 1D7HA 2A3BA 1NWUA 2MLYA 1NWRA 5HW6A 1O6WA 1FD9A 2JX8A 2ZR4A 3FXYA 5CQ2A 4Z2IA 3CGNA 2DSVA 4BF8A 4Z2JA 1D7IA 2PV1A 2PPNA 4MGVA 1GOIA 1J6YA 4P8VA 3MCBB 3ARWA 3ARVA 1LL6A 3B9EA 3O5GA 3WQWA 4DH0A 3WH0A 1Y0OA 1HJXA 5HKGA 3CHCA 3NTPA 1W26A 4GIVA 4LAYA 5E65A 2RQSA 4G50A 3NRKA 1WNOA 5DO2A 2XP4A 1K9RA 2DSUA 2YBTA 3MQHA 3LUOA 1NSGA 3O5PA 1FKSA 3KAFA 2DPEA 4DROA 3PQHA 1ZCNA 1FAPA 2K8IA 1ZU8A 1Q6HA 1FLCA 3AS3A 1W9UA 2LPVA 3PRAA 4GGQA 4DWSB 4MNJA 1ZBVA 3WD2A 3O5FA 3ARQA 3B8SA 3WL0A 2A3CA 4ZPVR 3B9DA 1OWQA 2IF4A 4IPXA 3FY1A 5DEZA 3ALGA 1NWSA 4JFMA 5U47A 4J4OA 1FKKA 1NMWA 4TW7A 5E5WA 2DSWA 1KT1A 2WLYA 2DG4A 2XP8A 2O9OA 3G6LA 2LAJA 4KQZA 5DF0A 1E6NA 1LL7A 2ZQUA 3UI5A 2DK1A 4ZS6A 1F8AB 2M8IA 4URIA 4TNSA 1HXVA 4ZPTR 2DMVA 2ZQTA 2RE3A 5I98A 2KO7A 1FKFA 2RUQA 3RM4A 3OA5A 3MQGA 2M08A 5HWBA 5DIUA 2ZR6A 3PA7A 2MLZA 1W9PA 3ARXA 4S3JA 4DRNA 4Q7NA 2FDMA 2QF8A 4HBOA 4DIPA 2E45A 2YSHA 1LJYA 4Z2HA 1FKDA 3LE4A 1H0GA 3PR9A 3TCZA 4IT4A 3WQVA 3WD1A 1P5QA 3UF8A 4S3KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZK6 A;  3RGC A;  3ODK A;  1B6C A;  4FN2 A;  1K9Q A;  1WR7 A;  3O5R A;  1I5H W;  3RFW A;  2LKN A;  2JXW A;  3CGM A;  1Q1C A;  1J4I A;  2FAP A;  1TK7 A;  3UI6 A;  3IKD A;  2PPP A;  1FKJ A;  1M5Y A;  1JNS A;  4W9Q A;  3FAP A;  2M3O W;  1WMV A;  4LAW A;  3O5Q A;  3VAW A;  5DIT A;  3KAG A;  4TX0 A;  5HUA A;  2RUD A;  1ROT A;  4QT2 A;  2ITK A;  5AHT A;  3IK8 A;  2XPA A;  1BL4 A;  4DRJ A;  4DRI A;  4LAV A;  3GPK A;  2LJ4 A;  2AWG A;  4C02 B;  3KAC A;  3PRB A;  4JYS A;  4R0X A;  4JFK A;  1FKH A;  4ODN A;  4DRK A;  4DRQ A;  3JXV A;  2XP3 A;  3OOB A;  2PV2 A;  3UQA A;  2RUC A;  2VN1 A;  2XP7 A;  1PBK A;  3O5D A;  3O5J A;  2ZR5 A;  1FKI A;  1D7J A;  4REX A;  4JFI A;  5DIV A;  1EG3 A;  2MNT A;  3KCE A;  3IKG A;  2L2S A;  3EY6 A;  1F40 A;  4DZ2 A;  1Q6I A;  3UQI A;  3O5K A;  1TCO C;  4TW6 A;  4ODQ A;  2PBC A;  2ZAJ A;  1T11 A;  5GPG A;  4J4N A;  5J6E A;  5HTG A;  4ODP A;  2ZQV A;  4DT4 A;  2EZ5 W;  2DG3 A;  2JZV A;  1EYM A;  3L4H A;  2Y78 A;  2KI3 A;  4ODK A;  3PRD A;  1FJD A;  3M85 A;  1BKF A;  2DG9 A;  5BXJ A;  2YSG A;  2D9F A;  2YSB A;  3KAH A;  1KT0 A;  3KAB A;  3KZ7 A;  4MSP A;  2DK7 A;  3H9R B;  3TDB A;  2MF9 A;  1FKL A;  3O5O A;  2YSF A;  4U86 A;  2M8J A;  2LGO A;  4JFJ A;  4DRM A;  3KAI A;  1YAT A;  1FKR A;  2BA1 A;  4NNR A;  3MDY B;  2MPH A;  2F21 A;  1J4R A;  1C9H A;  2L4J A;  2KR7 A;  2KFW A;  1YW5 A;  4DRH A;  4N19 A;  3O5I A;  2JV4 A;  1QPF A;  1Q6U A;  3M7N A;  4U84 A;  1D6O A;  1FKB A;  2DWV A;  5D75 A;  1NMV A;  2M1I A;  4ITZ A;  4W9O A;  1N1A A;  2KXQ A;  2MDI A;  4ODL A;  4QT3 A;  1QZ2 A;  5HT1 A;  4TYO A;  4U85 A;  1QPL A;  2F4E A;  2OFN A;  2FKE A;  2RUR A;  3CNG A;  4FAP A;  2PV3 A;  3O5L A;  3TC5 A;  1J4H A;  3KAD A;  4QIB A;  3JYJ A;  1FKT A;  5HWC A;  2XP6 A;  2PPO A;  4E5R A;  3I6C A;  3NI6 A;  1A7X A;  3JYM A;  4G2P A;  2KE0 A;  2Q5A A;  2MLX A;  2XPB A;  1PIN A;  2YSI A;  3UI4 A;  4O2T A;  1JVW A;  1FKG A;  2UZ5 A;  2XP5 A;  3UQB A;  5HW8 A;  5HW7 A;  4DZ3 A;  4ODR A;  5B8I C;  1JNT A;  2N87 A;  2JMF A;  3B7X A;  3O5M A;  2DJY A;  2XP9 A;  1ROU A;  2KGJ A;  4DRP A;  2M2A A;  2F2D A;  1R9H A;  1JMQ A;  1EQ3 A;  2VCD A;  3IHZ A;  4JFL A;  2ZQS A;  4IQ2 A;  3O5E A;  1L1P A;  4IQC A;  4W9P A;  1EG4 A;  4ODO A;  4ODM A;  4TW8 A;  2RSE A;  4LAX A;  1U79 A;  1D7H A;  2MLY A;  5HW6 A;  1O6W A;  1FD9 A;  2JX8 A;  2ZR4 A;  5CQ2 A;  3CGN A;  4BF8 A;  1D7I A;  2PV1 A;  2PPN A;  4MGV A;  1J6Y A;  3O5G A;  4DH0 A;  3WH0 A;  1Y0O A;  5HKG A;  3NTP A;  1W26 A;  4GIV A;  4LAY A;  2RQS A;  4G50 A;  3NRK A;  2XP4 A;  1K9R A;  3LUO A;  1NSG A;  3O5P A;  1FKS A;  3KAF A;  4DRO A;  1ZCN A;  1FAP A;  2K8I A;  1Q6H A;  2LPV A;  4GGQ A;  3O5F A;  2IF4 A;  4IPX A;  4JFM A;  4J4O A;  1FKK A;  1NMW A;  4TW7 A;  1KT1 A;  2DG4 A;  2XP8 A;  2LAJ A;  2ZQU A;  3UI5 A;  2DK1 A;  1F8A B;  2M8I A;  4TNS A;  1HXV A;  2DMV A;  2ZQT A;  2RE3 A;  5I98 A;  2KO7 A;  1FKF A;  2RUQ A;  2M08 A;  5HWB A;  5DIU A;  2ZR6 A;  3PA7 A;  2MLZ A;  4DRN A;  4DIP A;  2E45 A;  2YSH A;  1FKD A;  3LE4 A;  3TCZ A;  1P5Q A;  3UF8 A; 
#chains in the Genus database with same CATH topology
 5E66 A;  1EDQ A;  1ZK6 A;  3ARU A;  3RGC A;  3ODK A;  1B6C A;  4FN2 A;  4P8W A;  1K9Q A;  1O6I A;  1WR7 A;  4DWS A;  4WIW A;  4NSB A;  3O5R A;  1I5H W;  3FS8 A;  3RFW A;  3AS1 A;  2LKN A;  4A0U A;  3CH9 A;  1UR8 A;  1K9T A;  3WIJ A;  1ZBW A;  2JXW A;  3CGM A;  1X6N A;  1Q1C A;  1J4I A;  2FAP A;  1TK7 A;  2WAD A;  3UI6 A;  3IKD A;  2PPP A;  1FKJ A;  4MPK A;  1M5Y A;  1JNS A;  4W9Q A;  3FAP A;  2M3O W;  1WMV A;  4LAW A;  3ARR A;  3O5Q A;  1RP5 A;  3VAW A;  5DIT A;  3KAG A;  1CTN A;  4WJX A;  4TX0 A;  5HUA A;  1E6Z A;  2RUD A;  1ROT A;  2DT3 A;  3AS2 A;  2DT1 A;  1LQ0 A;  4QT2 A;  3ARP A;  1FFQ A;  1WB0 A;  2ITK A;  5AHT A;  1H0I A;  3IK8 A;  2XPA A;  3ART A;  1BL4 A;  1E44 A;  4DRJ A;  1WAW A;  4ZPW R;  3GTY X;  2QRV A;  4DRI A;  4LAV A;  3GPK A;  4PTM A;  2LJ4 A;  4P8U A;  2OLH A;  2AWG A;  4C02 B;  3KAC A;  3PRB A;  4JYS A;  4R0X A;  4JFK A;  1FKH A;  4LGX A;  4ODN A;  4DRK A;  4DRQ A;  3JXV A;  2XP3 A;  3OOB A;  1GRJ A;  2PV2 A;  3UQA A;  2RUC A;  4L72 B;  2VN1 A;  2XP7 A;  1PBK A;  3O5D A;  4IT6 A;  3O5J A;  2ZR5 A;  4Z2L A;  1FKI A;  1TFV A;  1EIB A;  3CHD A;  1D7J A;  4MNM A;  3LKX B;  1JCH B;  2B31 A;  4REX A;  4JFI A;  5DIV A;  1EG3 A;  2MNT A;  3KCE A;  3BXW A;  3IKG A;  1KFW A;  1E6R A;  2WM0 A;  1SYT A;  2L2S A;  3EY6 A;  3RME A;  1F40 A;  4DZ2 A;  1Q6I A;  1LL4 A;  3UQI A;  3RM8 A;  3O5K A;  1TCO C;  4TW6 A;  4ODQ A;  2PBC A;  2ZAJ A;  3GU0 A;  3MCB A;  1T11 A;  2EUL A;  5GPG A;  4J4N A;  1XHG A;  5J6E A;  5HTG A;  4ODP A;  4W5U A;  2ZQV A;  5GPR A;  4DT4 A;  2EZ5 W;  2DSZ A;  2DG3 A;  2JZV A;  1EYM A;  4Z2G A;  2OWO A;  1E6P A;  2DT2 A;  3L4H A;  1HKJ A;  2YBU A;  2Y78 A;  3CHE A;  3RM9 A;  2KI3 A;  4ODK A;  3WKZ A;  3PRD A;  1FJD A;  1HKM A;  1FFR A;  3M85 A;  1BKF A;  2DG9 A;  4WKA A;  5BXJ A;  3AS0 A;  2YSG A;  1E9L A;  2D9F A;  3ALF A;  1JND A;  2YSB A;  5JH8 A;  4MAV A;  3KAH A;  1KT0 A;  3ARY A;  4Q22 A;  3KAB A;  3KZ7 A;  4MSP A;  2DK7 A;  3H9R B;  4WKH A;  3TDB A;  2MF9 A;  1FKL A;  3ARO A;  3WD4 A;  3WD0 A;  3O5O A;  4MNK A;  5GQB A;  3EIP A;  2YSF A;  4U86 A;  2M8J A;  2LGO A;  4JFJ A;  4DRM A;  3KAI A;  1YAT A;  4KR0 B;  1ZBC A;  4WKF A;  2BA1 A;  4NNR A;  1FKR A;  3MDY B;  2MPH A;  1HKI A;  2G8Z A;  2F21 A;  1J4R A;  1C9H A;  1X6L A;  3ARZ A;  2L4J A;  4WK9 A;  1TR8 A;  4A0T A;  2KR7 A;  1NWT A;  2KFW A;  3CZ8 A;  1YW5 A;  3AQU A;  4DRH A;  1ZBK A;  2A3E A;  4L3N A;  4N19 A;  3O5I A;  2JV4 A;  2PN0 A;  1QPF A;  1OGG A;  1Q6U A;  3M7N A;  3G6M A;  4U84 A;  1JNE A;  1D6O A;  1D2K A;  1FKB A;  2DWV A;  5D75 A;  1ZL1 A;  1NMV A;  1SR0 A;  1W1Y A;  2M1I A;  1OGB A;  2ETN A;  3FSB A;  4GLX A;  4AY1 A;  1EHN A;  4ITZ A;  2A3A A;  4MNL A;  4W9O A;  1N1A A;  2KXQ A;  2MDI A;  4Z2K A;  4ODL A;  4QT3 A;  4QZV B;  1QZ2 A;  3B9A A;  2YAJ B;  5HT1 A;  3W4R A;  4TYO A;  1GPF A;  4U85 A;  1QPL A;  2WLZ A;  2F4E A;  2OFN A;  1VF8 A;  1W9V A;  2FKE A;  3BMB A;  4R5E A;  1ITX A;  3CNG A;  2RUR A;  4FAP A;  2PV3 A;  3O5L A;  4P8X A;  3TC5 A;  1J4H A;  2WAE A;  1IX5 A;  3KAD A;  4QIB A;  3JYJ A;  1FKT A;  5HWC A;  2XP6 A;  2PPO A;  4E5R A;  3I6C A;  3NI6 A;  3WL1 A;  1A7X A;  3JYM A;  4G2P A;  1W1T A;  2KE0 A;  1W1P A;  2Q5A A;  2MLX A;  2O92 A;  2XPB A;  1PIN A;  1ZB5 A;  4NZC A;  4MTV A;  2YSI A;  3UI4 A;  4O2T A;  1JVW A;  1FKG A;  2UZ5 A;  2XP5 A;  3UQB A;  5HW8 A;  5HW7 A;  2IUZ A;  3WD3 A;  4DZ3 A;  1NH6 A;  1RD6 A;  4ODR A;  2PI6 A;  5B8I C;  4UDM A;  4HAR A;  1JNT A;  4DWS C;  2N87 A;  2AOS A;  1GUV A;  3CHF A;  2JMF A;  4HBE A;  3B7X A;  3QOK A;  3O5M A;  3FSC A;  1UR9 A;  2DJY A;  2XP9 A;  1ROU A;  2KGJ A;  5E64 A;  4DRP A;  2M2A A;  2F2D A;  2WK2 A;  3LKX A;  5HBF A;  1R9H A;  1HJV A;  1JMQ A;  4DWS D;  1EQ3 A;  2VCD A;  1LG2 A;  1HJW A;  5E62 A;  4XAK A;  3IHZ A;  2F23 A;  4JFL A;  2ZQS A;  4IQ2 A;  1XRV A;  3O5E A;  1W1V A;  1LG1 A;  2Y8N B;  2ESC A;  1L1P A;  3ARS A;  4IQC A;  4ML4 A;  4W9P A;  1EG4 A;  4ODO A;  2DT0 A;  4ODM A;  4TW8 A;  2G41 A;  2RSE A;  1E15 A;  4LAX A;  1HKK A;  1U79 A;  1D7H A;  2A3B A;  1NWU A;  2MLY A;  1NWR A;  5HW6 A;  1O6W A;  1FD9 A;  2JX8 A;  2ZR4 A;  3FXY A;  5CQ2 A;  2B5U B;  4Z2I A;  3CGN A;  2DSV A;  4BF8 A;  4Z2J A;  1D7I A;  2PV1 A;  2PPN A;  4MGV A;  1GOI A;  1J6Y A;  4P8V A;  3MCB B;  3ARW A;  3ARV A;  1LL6 A;  3B9E A;  3O5G A;  3WQW A;  4DH0 A;  3WH0 A;  1Y0O A;  1HJX A;  5HKG A;  3CHC A;  3NTP A;  1W26 A;  4GIV A;  4LAY A;  5E65 A;  2RQS A;  4G50 A;  3NRK A;  1WNO A;  5DO2 A;  2XP4 A;  1K9R A;  2DSU A;  2YBT A;  3MQH A;  3LUO A;  1NSG A;  3O5P A;  1FKS A;  3KAF A;  2DPE A;  4DRO A;  3PQH A;  1ZCN A;  1FAP A;  2K8I A;  1ZU8 A;  1Q6H A;  1FLC A;  3AS3 A;  1W9U A;  2LPV A;  3PRA A;  4GGQ A;  4DWS B;  4MNJ A;  1ZBV A;  3WD2 A;  3O5F A;  3ARQ A;  3B8S A;  3WL0 A;  2A3C A;  4ZPV R;  3B9D A;  1OWQ A;  2IF4 A;  4IPX A;  3FY1 A;  5DEZ A;  3ALG A;  1NWS A;  4JFM A;  2P4V A;  5U47 A;  4J4O A;  1FKK A;  1NMW A;  4TW7 A;  5E5W A;  2DSW A;  1KT1 A;  2WLY A;  2DG4 A;  2XP8 A;  2O9O A;  3G6L A;  2LAJ A;  4KQZ A;  5DF0 A;  1E6N A;  1LL7 A;  2ZQU A;  3UI5 A;  2DK1 A;  4ZS6 A;  1F8A B;  2M8I A;  4URI A;  4TNS A;  1HXV A;  4ZPT R;  2DMV A;  2ZQT A;  2RE3 A;  5I98 A;  2KO7 A;  1FKF A;  2RUQ A;  3RM4 A;  3OA5 A;  3MQG A;  2M08 A;  5HWB A;  5DIU A;  2ZR6 A;  3PA7 A;  2MLZ A;  1W9P A;  3ARX A;  4S3J A;  4DRN A;  4Q7N A;  2FDM A;  2QF8 A;  4HBO A;  4DIP A;  2E45 A;  2YSH A;  1LJY A;  4Z2H A;  1FKD A;  3LE4 A;  1H0G A;  3PR9 A;  3TCZ A;  4IT4 A;  3WQV A;  3WD1 A;  1P5Q A;  3UF8 A;  4S3K A; 
#chains in the Genus database with same CATH homology
 5E66 A;  1EDQ A;  1ZK6 A;  3ARU A;  3RGC A;  3ODK A;  1B6C A;  4FN2 A;  4P8W A;  1K9Q A;  1O6I A;  1WR7 A;  4DWS A;  4WIW A;  4NSB A;  3O5R A;  1I5H W;  3FS8 A;  3RFW A;  3AS1 A;  2LKN A;  4A0U A;  3CH9 A;  1UR8 A;  1K9T A;  3WIJ A;  1ZBW A;  2JXW A;  3CGM A;  1X6N A;  1Q1C A;  1J4I A;  2FAP A;  1TK7 A;  2WAD A;  3UI6 A;  3IKD A;  2PPP A;  1FKJ A;  4MPK A;  1M5Y A;  1JNS A;  4W9Q A;  3FAP A;  2M3O W;  1WMV A;  4LAW A;  3ARR A;  3O5Q A;  1RP5 A;  3VAW A;  5DIT A;  3KAG A;  1CTN A;  4WJX A;  4TX0 A;  5HUA A;  1E6Z A;  2RUD A;  1ROT A;  2DT3 A;  3AS2 A;  2DT1 A;  1LQ0 A;  4QT2 A;  3ARP A;  1FFQ A;  1WB0 A;  2ITK A;  5AHT A;  1H0I A;  3IK8 A;  2XPA A;  3ART A;  1BL4 A;  4DRJ A;  1WAW A;  4ZPW R;  2QRV A;  4DRI A;  4LAV A;  3GPK A;  4PTM A;  2LJ4 A;  4P8U A;  2OLH A;  2AWG A;  4C02 B;  3KAC A;  3PRB A;  4JYS A;  4R0X A;  4JFK A;  1FKH A;  4LGX A;  4ODN A;  4DRK A;  4DRQ A;  3JXV A;  2XP3 A;  3OOB A;  2PV2 A;  3UQA A;  2RUC A;  4L72 B;  2VN1 A;  2XP7 A;  1PBK A;  3O5D A;  4IT6 A;  3O5J A;  2ZR5 A;  4Z2L A;  1FKI A;  1TFV A;  1EIB A;  3CHD A;  1D7J A;  4MNM A;  3LKX B;  2B31 A;  4REX A;  4JFI A;  5DIV A;  1EG3 A;  2MNT A;  3KCE A;  3BXW A;  3IKG A;  1KFW A;  1E6R A;  2WM0 A;  1SYT A;  2L2S A;  3EY6 A;  3RME A;  1F40 A;  4DZ2 A;  1Q6I A;  1LL4 A;  3UQI A;  3RM8 A;  3O5K A;  1TCO C;  4TW6 A;  4ODQ A;  2PBC A;  2ZAJ A;  3MCB A;  1T11 A;  5GPG A;  4J4N A;  1XHG A;  5J6E A;  5HTG A;  4ODP A;  4W5U A;  2ZQV A;  5GPR A;  4DT4 A;  2EZ5 W;  2DSZ A;  2DG3 A;  2JZV A;  1EYM A;  4Z2G A;  2OWO A;  1E6P A;  2DT2 A;  3L4H A;  1HKJ A;  2YBU A;  2Y78 A;  3CHE A;  3RM9 A;  2KI3 A;  4ODK A;  3WKZ A;  3PRD A;  1FJD A;  1HKM A;  1FFR A;  3M85 A;  1BKF A;  2DG9 A;  4WKA A;  5BXJ A;  3AS0 A;  2YSG A;  1E9L A;  2D9F A;  3ALF A;  1JND A;  2YSB A;  5JH8 A;  4MAV A;  3KAH A;  1KT0 A;  3ARY A;  4Q22 A;  3KAB A;  3KZ7 A;  4MSP A;  2DK7 A;  3H9R B;  4WKH A;  3TDB A;  2MF9 A;  1FKL A;  3ARO A;  3WD4 A;  3WD0 A;  3O5O A;  4MNK A;  5GQB A;  2YSF A;  4U86 A;  2M8J A;  2LGO A;  4JFJ A;  4DRM A;  3KAI A;  1YAT A;  4KR0 B;  1ZBC A;  4WKF A;  2BA1 A;  4NNR A;  1FKR A;  3MDY B;  2MPH A;  1HKI A;  2G8Z A;  2F21 A;  1J4R A;  1C9H A;  1X6L A;  3ARZ A;  2L4J A;  4WK9 A;  1TR8 A;  4A0T A;  2KR7 A;  1NWT A;  2KFW A;  3CZ8 A;  1YW5 A;  3AQU A;  4DRH A;  1ZBK A;  2A3E A;  4L3N A;  4N19 A;  3O5I A;  2JV4 A;  1QPF A;  1OGG A;  1Q6U A;  3M7N A;  3G6M A;  4U84 A;  1JNE A;  1D6O A;  1D2K A;  1FKB A;  2DWV A;  5D75 A;  1ZL1 A;  1NMV A;  1SR0 A;  1W1Y A;  2M1I A;  1OGB A;  3FSB A;  4GLX A;  4AY1 A;  1EHN A;  4ITZ A;  2A3A A;  4MNL A;  4W9O A;  1N1A A;  2KXQ A;  2MDI A;  4Z2K A;  4ODL A;  4QT3 A;  4QZV B;  1QZ2 A;  3B9A A;  2YAJ B;  5HT1 A;  3W4R A;  4TYO A;  1GPF A;  4U85 A;  1QPL A;  2WLZ A;  2F4E A;  2OFN A;  1VF8 A;  1W9V A;  2FKE A;  4R5E A;  1ITX A;  3CNG A;  2RUR A;  4FAP A;  2PV3 A;  3O5L A;  4P8X A;  3TC5 A;  1J4H A;  2WAE A;  1IX5 A;  3KAD A;  4QIB A;  3JYJ A;  1FKT A;  5HWC A;  2XP6 A;  2PPO A;  4E5R A;  3I6C A;  3NI6 A;  3WL1 A;  1A7X A;  3JYM A;  4G2P A;  1W1T A;  2KE0 A;  1W1P A;  2Q5A A;  2MLX A;  2O92 A;  2XPB A;  1PIN A;  1ZB5 A;  4NZC A;  4MTV A;  2YSI A;  3UI4 A;  4O2T A;  1JVW A;  1FKG A;  2UZ5 A;  2XP5 A;  3UQB A;  5HW8 A;  5HW7 A;  2IUZ A;  3WD3 A;  4DZ3 A;  1NH6 A;  1RD6 A;  4ODR A;  2PI6 A;  5B8I C;  4HAR A;  1JNT A;  4DWS C;  2N87 A;  2AOS A;  1GUV A;  3CHF A;  2JMF A;  4HBE A;  3B7X A;  3QOK A;  3O5M A;  3FSC A;  1UR9 A;  2DJY A;  2XP9 A;  1ROU A;  2KGJ A;  5E64 A;  4DRP A;  2M2A A;  2F2D A;  2WK2 A;  3LKX A;  5HBF A;  1R9H A;  1HJV A;  1JMQ A;  4DWS D;  1EQ3 A;  2VCD A;  1LG2 A;  1HJW A;  5E62 A;  4XAK A;  3IHZ A;  4JFL A;  2ZQS A;  4IQ2 A;  1XRV A;  3O5E A;  1W1V A;  1LG1 A;  2Y8N B;  2ESC A;  1L1P A;  3ARS A;  4IQC A;  4ML4 A;  4W9P A;  1EG4 A;  4ODO A;  2DT0 A;  4ODM A;  4TW8 A;  2G41 A;  2RSE A;  1E15 A;  4LAX A;  1HKK A;  1U79 A;  1D7H A;  2A3B A;  1NWU A;  2MLY A;  1NWR A;  5HW6 A;  1O6W A;  1FD9 A;  2JX8 A;  2ZR4 A;  3FXY A;  5CQ2 A;  4Z2I A;  3CGN A;  2DSV A;  4BF8 A;  4Z2J A;  1D7I A;  2PV1 A;  2PPN A;  4MGV A;  1GOI A;  1J6Y A;  4P8V A;  3MCB B;  3ARW A;  3ARV A;  1LL6 A;  3B9E A;  3O5G A;  3WQW A;  4DH0 A;  3WH0 A;  1Y0O A;  1HJX A;  5HKG A;  3CHC A;  3NTP A;  1W26 A;  4GIV A;  4LAY A;  5E65 A;  2RQS A;  4G50 A;  3NRK A;  1WNO A;  5DO2 A;  2XP4 A;  1K9R A;  2DSU A;  2YBT A;  3MQH A;  3LUO A;  1NSG A;  3O5P A;  1FKS A;  3KAF A;  2DPE A;  4DRO A;  3PQH A;  1ZCN A;  1FAP A;  2K8I A;  1ZU8 A;  1Q6H A;  1FLC A;  3AS3 A;  1W9U A;  2LPV A;  3PRA A;  4GGQ A;  4DWS B;  4MNJ A;  1ZBV A;  3WD2 A;  3O5F A;  3ARQ A;  3B8S A;  3WL0 A;  2A3C A;  4ZPV R;  3B9D A;  1OWQ A;  2IF4 A;  4IPX A;  3FY1 A;  5DEZ A;  3ALG A;  1NWS A;  4JFM A;  5U47 A;  4J4O A;  1FKK A;  1NMW A;  4TW7 A;  5E5W A;  2DSW A;  1KT1 A;  2WLY A;  2DG4 A;  2XP8 A;  2O9O A;  3G6L A;  2LAJ A;  4KQZ A;  5DF0 A;  1E6N A;  1LL7 A;  2ZQU A;  3UI5 A;  2DK1 A;  4ZS6 A;  1F8A B;  2M8I A;  4URI A;  4TNS A;  1HXV A;  4ZPT R;  2DMV A;  2ZQT A;  2RE3 A;  5I98 A;  2KO7 A;  1FKF A;  2RUQ A;  3RM4 A;  3OA5 A;  3MQG A;  2M08 A;  5HWB A;  5DIU A;  2ZR6 A;  3PA7 A;  2MLZ A;  1W9P A;  3ARX A;  4S3J A;  4DRN A;  4Q7N A;  2FDM A;  2QF8 A;  4HBO A;  4DIP A;  2E45 A;  2YSH A;  1LJY A;  4Z2H A;  1FKD A;  3LE4 A;  1H0G A;  3PR9 A;  3TCZ A;  4IT4 A;  3WQV A;  3WD1 A;  1P5Q A;  3UF8 A;  4S3K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...