2XPBA

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
146
Chain Sequence
b'LPPGWEKAMSRSSGRVYYFNHITNASQWERPSGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 47
structure length 146
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xpbA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xpbA02
1ROTA 2RUDA 3I6CA 4U84A 2XPBA 1FKRA 4ODMA 1Q6UA 3UQIA 3B7XA 4U86A 1I5HW 1R9HA 3KZ7A 4IPXA 3KACA 3O5JA 2IF4A 1Q1CA 5B8IC 2ZR6A 4FAPA 2JXWA 2JZVA 3NRKA 5HUAA 5DIUA 3UF8A 2LPVA 4BF8A 1M5YA 2YSBA 1D7HA 2OFNA 4DT4A 4GGQA 3KADA 2ZQUA 1K9QA 3O5KA 1FD9A 1QPFA 4DH0A 2DMVA 2D9FA 2ZQTA 4W9PA 1FKTA 2FKEA 2LKNA 2F21A 4IQCA 1FKBA 3O5IA 2YSFA 3O5GA 5HKGA 4ITZA 3FAPA 3O5QA 5AHTA 4QIBA 5HTGA 3M85A 2ITKA 4J4NA 1BL4A 1BKFA 2DJYA 2PV2A 2KR7A 3MDYB 2BA1A 2XP7A 4NNRA 3CGNA 1FKHA 2JMFA 5CQ2A 3O5MA 2XP5A 3O5LA 2PPNA 1EYMA 3L4HA 4IQ2A 4TW7A 2YSIA 1C9HA 2DG3A 2RE3A 2DWVA 5J6EA 1EG3A 2JV4A 4DZ3A 1JVWA 2MPHA 1A7XA 1ZK6A 2PBCA 5HWBA 2PPOA 1T11A 2MNTA 2KXQA 2M3OW 3UI6A 4O2TA 1JNTA 3NI6A 4G2PA 4DRJA 2M8JA 5BXJA 1FKDA 3JYJA 2PV3A 4DRHA 1QZ2A 4ODRA 1EQ3A 2XP6A 2LGOA 5DITA 4TX0A 1W26A 2XP4A 1KT1A 4W9OA 3RFWA 2N87A 2KFWA 2DG9A 1KT0A 2FAPA 2F2DA 5DIVA 1QPLA 4JFMA 2JX8A 2ZQVA 3LE4A 1Y0OA 3EY6A 1D7IA 1J6YA 2Q5AA 3IKDA 4JFKA 2KO7A 3LUOA 1PINA 1FKSA 4MGVA 2XPAA 2ZAJA 5HW8A 4U85A 4LAVA 4REXA 1WMVA 3UQBA 1YATA 4TYOA 4W9QA 1JMQA 4DRNA 4DRPA 4DRIA 3O5FA 1B6CA 1NMVA 2M2AA 3UI5A 2ZR5A 4DZ2A 4ODQA 1Q6IA 1FJDA 2M1IA 2M08A 1ROUA 5D75A 3O5EA 3NTPA 1YW5A 3M7NA 2VCDA 5GPGA 1K9RA 4C02B 2DG4A 2L4JA 1PBKA 4G50A 2MDIA 4LAYA 2MLXA 4DRMA 4JFLA 3O5PA 3UI4A 5I98A 2L2SA 4QT3A 4E5RA 3KAFA 2K8IA 1TCOC 2YSGA 2MF9A 4DRKA 3PRBA 1J4HA 1FKGA 2RSEA 4JFJA 1NSGA 1NMWA 3KAHA 3KABA 4LAXA 4DRQA 4FN2A 2RUQA 3IKGA 1D7JA 1O6WA 3GPKA 2DK7A 4N19A 4TNSA 4LAWA 3KAIA 1HXVA 3CNGA 1WR7A 3OOBA 2RUCA 2ZR4A 3TCZA 3KAGA 2RQSA 2EZ5W 3H9RB 2F4EA 3ODKA 3WH0A 2XP9A 4JYSA 1FAPA 4ODLA 4DROA 4R0XA 3JYMA 1TK7A 3IHZA 3PRDA 4QT2A 1J4IA 2YSHA 2KI3A 2LJ4A 2MLYA 1EG4A 1FKLA 3RGCA 3PA7A 3VAWA 2M8IA 3TC5A 1N1AA 1ZCNA 4DIPA 2UZ5A 1F40A 5HW7A 1FKKA 3JXVA 1FKJA 2VN1A 2PV1A 4TW6A 2KE0A 2XP8A 1FKFA 2E45A 1J4RA 1P5QA 4GIVA 1FKIA 3IK8A 1D6OA 4ODKA 2RURA 1U79A 5HWCA 5HW6A 1JNSA 2MLZA 4TW8A 5HT1A 2DK1A 2LAJA 3O5DA 2KGJA 3TDBA 3O5OA 4JFIA 1F8AB 4ODOA 3KCEA 2XP3A 1Q6HA 2Y78A 2AWGA 3CGMA 3UQAA 3O5RA 4ODPA 2ZQSA 4ODNA 2PPPA 4MSPA 1L1PA 4J4OA
chains in the Genus database with same CATH superfamily
3MQGA 3EIPA 1ROTA 2RUDA 3I6CA 2OLHA 4U84A 2XPBA 1FKRA 3FS8A 1Q6UA 4ODMA 3RM9A 2YBUA 3UQIA 2WADA 3ARRA 3B7XA 4U86A 1I5HW 1R9HA 3KZ7A 4IPXA 3G6LA 3B9EA 3KACA 3O5JA 2IF4A 1Q1CA 3PRAA 3FSBA 3RM8A 5B8IC 2ZR6A 1X6NA 1W1PA 1E15A 4FAPA 1W9VA 2JXWA 2JZVA 3NRKA 1E6PA 5HUAA 5DIUA 3ARYA 3UF8A 3W4RA 2LPVA 4BF8A 1OGBA 1M5YA 2YSBA 1LG2A 3MCBB 3BXWA 4DWSB 1HKJA 1D7HA 2P4VA 3WL0A 5DF0A 2OFNA 3GU0A 4GGQA 4DT4A 3B9AA 3KADA 4Z2LA 2ZQUA 2YBTA 3CZ8A 5HBFA 1K9QA 3O5KA 1FD9A 1QPFA 3WD0A 1E6NA 4DH0A 4MTVA 2WAEA 2DMVA 2D9FA 4NSBA 2ZQTA 4Q7NA 4W9PA 1FKTA 2FKEA 4IT6A 1E6RA 5DO2A 2LKNA 2O9OA 4L72B 2F21A 4HBOA 4WK9A 4IQCA 3LKXA 1FKBA 3O5IA 4P8VA 2YSFA 3WIJA 3O5GA 1WB0A 4KQZA 5HKGA 4ITZA 3FAPA 3WQWA 4HBEA 3O5QA 5AHTA 4QIBA 5HTGA 2WM0A 4L3NA 3AS1A 3M85A 2ITKA 4J4NA 2QF8A 1BL4A 1JNDA 1BKFA 5DEZA 2DJYA 2PV2A 2KR7A 2DSUA 4ZS6A 2A3BA 3MDYB 2BA1A 2XP7A 3ARPA 3G6MA 4NNRA 3CGNA 1NWRA 2DT0A 4ZPWR 1FKHA 2JMFA 5CQ2A 3O5MA 2XP5A 2QRVA 1LG1A 1CTNA 3O5LA 2PPNA 1EYMA 3L4HA 4IQ2A 4TW7A 4MNJA 3RM4A 2YSIA 4MNKA 1HJVA 1C9HA 2DG3A 2RE3A 2DWVA 5J6EA 1EG3A 2JV4A 3PQHA 3CHFA 4MPKA 4DZ3A 1W1TA 4HARA 3ARTA 1JVWA 2MPHA 1KFWA 1A7XA 4LGXA 1ZK6A 2PBCA 5HWBA 2PPOA 1T11A 2MNTA 2KXQA 2WLZA 1LJYA 2M3OW 4UDMA 3UI6A 4O2TA 3WKZA 1JNTA 3CHCA 4W5UA 1UR8A 3NI6A 4G2PA 4DRJA 4ZPVR 2M8JA 1ITXA 5BXJA 1FKDA 3JYJA 1O6IA 2PV3A 3LKXB 1RP5A 1XRVA 1GRJA 4DRHA 2G8ZA 3WD2A 1NH6A 1QZ2A 3AS0A 4ODRA 1EQ3A 2XP6A 1NWSA 2LGOA 5DITA 4TX0A 1W26A 2XP4A 4S3KA 4P8WA 1KT1A 4W9OA 3RFWA 3ARSA 2N87A 1ZBCA 2B5UB 2KFWA 4S3JA 2DG9A 1KT0A 2FAPA 5GPRA 2F2DA 1EDQA 3PR9A 3CHEA 1W1YA 5DIVA 4URIA 1QPLA 4JFMA 2JX8A 2ZQVA 3LE4A 3B9DA 1Y0OA 3EY6A 1D7IA 1J6YA 2Q5AA 3IKDA 4P8XA 4JFKA 2OWOA 3AS2A 2KO7A 3LUOA 1PINA 1FKSA 1HJXA 4MGVA 2XPAA 3WD3A 2ZAJA 5HW8A 3RMEA 4U85A 1OGGA 4LAVA 1SYTA 2A3AA 4REXA 1WMVA 3UQBA 1LL7A 1YATA 1UR9A 4TYOA 5E66A 1W9UA 4W9QA 1GPFA 1JMQA 4DRNA 4DRPA 1E44A 3WL1A 4DRIA 3O5FA 1B6CA 1NMVA 4Z2JA 1NWTA 3QOKA 1E9LA 2M2AA 4WJXA 3UI5A 2ZR5A 4AY1A 4WKFA 4DZ2A 4ODQA 1Q6IA 1FJDA 1HKKA 2M1IA 4Z2HA 2M08A 1ROUA 2ETNA 5D75A 3O5EA 3NTPA 1YW5A 2A3EA 5E62A 3M7NA 3GTYX 1TFVA 2VCDA 5GPGA 3ARWA 1K9RA 4C02B 2DG4A 2L4JA 1PBKA 4DWSD 4G50A 2MDIA 4LAYA 1WNOA 2MLXA 5JH8A 2F23A 4DRMA 1EIBA 3O5PA 4JFLA 3UI4A 5I98A 1VF8A 2L2SA 4QT3A 4E5RA 3KAFA 2K8IA 1TCOC 2YSGA 2EULA 3WQVA 2IUZA 1IX5A 1FLCA 2MF9A 4DRKA 4GLXA 1ZBVA 2O92A 3PRBA 1J4HA 1FKGA 2RSEA 4JFJA 4QZVB 4Q22A 1OWQA 1NSGA 1NMWA 1E6ZA 4MAVA 2B31A 3KAHA 3WD1A 4ML4A 3KABA 2Y8NB 1JCHB 4WIWA 4LAXA 2PI6A 3AROA 4DRQA 4FN2A 2RUQA 3IKGA 1D7JA 1HKMA 1O6WA 3GPKA 2DK7A 4N19A 2AOSA 4TNSA 1D2KA 4LAWA 3KAIA 1HXVA 3CNGA 3AS3A 1WR7A 4IT4A 3OOBA 2RUCA 2ZR4A 3TCZA 3KAGA 2RQSA 5GQBA 3WD4A 2EZ5W 3H9RB 2F4EA 3ODKA 2FDMA 3FY1A 3WH0A 1FFQA 2DSVA 3AQUA 4MNMA 4ZPTR 2XP9A 4JYSA 2DSWA 1FAPA 4ODLA 4DROA 4R0XA 3JYMA 1TK7A 3IHZA 1HJWA 3PRDA 3ARZA 4QT2A 3BMBA 1J4IA 2YSHA 2KI3A 2LJ4A 2MLYA 1W1VA 4NZCA 1EG4A 1FKLA 3RGCA 3PA7A 3B8SA 3VAWA 1TR8A 5E65A 4WKHA 2M8IA 1HKIA 4P8UA 3ARXA 3TC5A 1N1AA 4PTMA 1JNEA 1RD6A 2ESCA 1ZBWA 1X6LA 1ZCNA 4MNLA 4DIPA 4Z2IA 2DPEA 2UZ5A 1F40A 5HW7A 1FKKA 2DT3A 1H0IA 1ZL1A 2G41A 3JXVA 1ZBKA 1FKJA 2VN1A 3ARVA 1W9PA 4Z2KA 3OA5A 2DT2A 1H0GA 2PV1A 3FSCA 1LL4A 4TW6A 2KE0A 3CHDA 2XP8A 1FKFA 2E45A 5E5WA 2WLYA 1XHGA 2PN0A 1J4RA 2DSZA 1P5QA 4R5EA 4GIVA 1FKIA 3IK8A 4KR0B 3FXYA 1D6OA 4ODKA 2RURA 1U79A 2DT1A 5HWCA 5HW6A 3ARQA 3CH9A 1JNSA 3MCBA 4DWSA 4WKAA 2MLZA 2A3CA 4TW8A 5HT1A 4A0UA 2DK1A 2LAJA 3O5DA 4A0TA 2KGJA 1NWUA 3TDBA 1LL6A 1EHNA 5E64A 2WK2A 3O5OA 1GOIA 4JFIA 5U47A 1F8AB 4ODOA 4DWSC 3KCEA 1SR0A 2XP3A 1ZB5A 4XAKA 2YAJB 1Q6HA 1ZU8A 3ALFA 2Y78A 2AWGA 3CGMA 3UQAA 3O5RA 1K9TA 1FFRA 4ODPA 4Z2GA 1LQ0A 2ZQSA 4ODNA 1GUVA 3MQHA 2PPPA 4MSPA 1WAWA 3ARUA 3ALGA 1L1PA 4J4OA
chains in the Genus database with same CATH topology
3MQGA 1ROTA 2RUDA 3I6CA 2OLHA 4U84A 2XPBA 1FKRA 3FS8A 1Q6UA 4ODMA 3RM9A 2YBUA 3UQIA 2WADA 3ARRA 3B7XA 4U86A 1I5HW 1R9HA 3KZ7A 4IPXA 3G6LA 3B9EA 3KACA 3O5JA 2IF4A 1Q1CA 3PRAA 3FSBA 3RM8A 5B8IC 2ZR6A 1X6NA 1W1PA 1E15A 4FAPA 1W9VA 2JXWA 2JZVA 3NRKA 1E6PA 5HUAA 5DIUA 3ARYA 3UF8A 3W4RA 2LPVA 4BF8A 1OGBA 1M5YA 2YSBA 1LG2A 3MCBB 3BXWA 4DWSB 1HKJA 1D7HA 3WL0A 5DF0A 2OFNA 4DT4A 4GGQA 3B9AA 3KADA 4Z2LA 2ZQUA 2YBTA 3CZ8A 5HBFA 1K9QA 3O5KA 1FD9A 1QPFA 3WD0A 1E6NA 4DH0A 4MTVA 2WAEA 2DMVA 2D9FA 4NSBA 2ZQTA 4Q7NA 4W9PA 1FKTA 2FKEA 4IT6A 1E6RA 5DO2A 2LKNA 2O9OA 4L72B 2F21A 4HBOA 4WK9A 4IQCA 3LKXA 1FKBA 3O5IA 4P8VA 2YSFA 3WIJA 3O5GA 1WB0A 4KQZA 5HKGA 4ITZA 3FAPA 3WQWA 4HBEA 3O5QA 5AHTA 4QIBA 5HTGA 2WM0A 4L3NA 3AS1A 3M85A 2ITKA 4J4NA 2QF8A 1BL4A 1JNDA 1BKFA 5DEZA 2DJYA 2PV2A 2KR7A 2DSUA 4ZS6A 2A3BA 3MDYB 2BA1A 2XP7A 3ARPA 3G6MA 4NNRA 3CGNA 1NWRA 2DT0A 4ZPWR 1FKHA 2JMFA 5CQ2A 3O5MA 2XP5A 2QRVA 1LG1A 1CTNA 3O5LA 2PPNA 1EYMA 3L4HA 4IQ2A 4TW7A 4MNJA 3RM4A 2YSIA 4MNKA 1HJVA 1C9HA 2DG3A 2RE3A 2DWVA 5J6EA 1EG3A 2JV4A 3PQHA 3CHFA 4MPKA 4DZ3A 1W1TA 4HARA 3ARTA 1JVWA 2MPHA 1KFWA 1A7XA 4LGXA 1ZK6A 2PBCA 5HWBA 2PPOA 1T11A 2MNTA 2KXQA 2WLZA 1LJYA 2M3OW 3UI6A 4O2TA 3WKZA 1JNTA 3CHCA 4W5UA 1UR8A 3NI6A 4G2PA 4DRJA 4ZPVR 2M8JA 1ITXA 5BXJA 1FKDA 3JYJA 1O6IA 2PV3A 3LKXB 1RP5A 1XRVA 4DRHA 2G8ZA 3WD2A 1NH6A 1QZ2A 3AS0A 4ODRA 1EQ3A 2XP6A 1NWSA 2LGOA 5DITA 4TX0A 1W26A 2XP4A 4S3KA 4P8WA 1KT1A 4W9OA 3RFWA 3ARSA 2N87A 1ZBCA 2KFWA 4S3JA 2DG9A 1KT0A 2FAPA 5GPRA 2F2DA 1EDQA 3PR9A 3CHEA 1W1YA 5DIVA 4URIA 1QPLA 4JFMA 2JX8A 2ZQVA 3LE4A 3B9DA 1Y0OA 3EY6A 1D7IA 1J6YA 2Q5AA 3IKDA 4P8XA 4JFKA 2OWOA 3AS2A 2KO7A 3LUOA 1PINA 1FKSA 1HJXA 4MGVA 2XPAA 3WD3A 2ZAJA 5HW8A 3RMEA 4U85A 1OGGA 4LAVA 1SYTA 2A3AA 4REXA 1WMVA 3UQBA 1LL7A 1YATA 1UR9A 4TYOA 5E66A 1W9UA 4W9QA 1GPFA 1JMQA 4DRNA 4DRPA 3WL1A 4DRIA 3O5FA 1B6CA 1NMVA 4Z2JA 1NWTA 3QOKA 1E9LA 2M2AA 4WJXA 3UI5A 2ZR5A 4AY1A 4WKFA 4DZ2A 4ODQA 1Q6IA 1FJDA 1HKKA 2M1IA 4Z2HA 2M08A 1ROUA 5D75A 3O5EA 3NTPA 1YW5A 2A3EA 5E62A 3M7NA 1TFVA 2VCDA 5GPGA 3ARWA 1K9RA 4C02B 2DG4A 2L4JA 1PBKA 4DWSD 4G50A 2MDIA 4LAYA 1WNOA 2MLXA 5JH8A 4DRMA 1EIBA 3O5PA 4JFLA 3UI4A 5I98A 1VF8A 2L2SA 4QT3A 4E5RA 3KAFA 2K8IA 1TCOC 2YSGA 3WQVA 2IUZA 1IX5A 1FLCA 2MF9A 4DRKA 4GLXA 1ZBVA 2O92A 3PRBA 1J4HA 1FKGA 2RSEA 4JFJA 4QZVB 4Q22A 1OWQA 1NSGA 1NMWA 1E6ZA 4MAVA 2B31A 3KAHA 3WD1A 4ML4A 3KABA 2Y8NB 4WIWA 4LAXA 2PI6A 3AROA 4DRQA 4FN2A 2RUQA 3IKGA 1D7JA 1HKMA 1O6WA 3GPKA 2DK7A 4N19A 2AOSA 4TNSA 1D2KA 4LAWA 3KAIA 1HXVA 3CNGA 3AS3A 1WR7A 4IT4A 3OOBA 2RUCA 2ZR4A 3TCZA 3KAGA 2RQSA 5GQBA 3WD4A 2EZ5W 3H9RB 2F4EA 3ODKA 2FDMA 3FY1A 3WH0A 1FFQA 2DSVA 3AQUA 4MNMA 4ZPTR 2XP9A 4JYSA 2DSWA 1FAPA 4ODLA 4DROA 4R0XA 3JYMA 1TK7A 3IHZA 1HJWA 3PRDA 3ARZA 4QT2A 1J4IA 2YSHA 2KI3A 2LJ4A 2MLYA 1W1VA 4NZCA 1EG4A 1FKLA 3RGCA 3PA7A 3B8SA 3VAWA 1TR8A 5E65A 4WKHA 2M8IA 1HKIA 4P8UA 3ARXA 3TC5A 1N1AA 4PTMA 1JNEA 1RD6A 2ESCA 1ZBWA 1X6LA 1ZCNA 4MNLA 4DIPA 4Z2IA 2DPEA 2UZ5A 1F40A 5HW7A 1FKKA 2DT3A 1H0IA 1ZL1A 2G41A 3JXVA 1ZBKA 1FKJA 2VN1A 3ARVA 1W9PA 4Z2KA 3OA5A 2DT2A 1H0GA 2PV1A 3FSCA 1LL4A 4TW6A 2KE0A 3CHDA 2XP8A 1FKFA 2E45A 5E5WA 2WLYA 1XHGA 1J4RA 2DSZA 1P5QA 4R5EA 4GIVA 1FKIA 3IK8A 4KR0B 3FXYA 1D6OA 4ODKA 2RURA 1U79A 2DT1A 5HWCA 5HW6A 3ARQA 3CH9A 1JNSA 3MCBA 4DWSA 4WKAA 2MLZA 2A3CA 4TW8A 5HT1A 4A0UA 2DK1A 2LAJA 3O5DA 4A0TA 2KGJA 1NWUA 3TDBA 1LL6A 1EHNA 5E64A 2WK2A 3O5OA 1GOIA 4JFIA 5U47A 1F8AB 4ODOA 4DWSC 3KCEA 1SR0A 2XP3A 1ZB5A 4XAKA 2YAJB 1Q6HA 1ZU8A 3ALFA 2Y78A 2AWGA 3CGMA 3UQAA 3O5RA 1K9TA 1FFRA 4ODPA 4Z2GA 1LQ0A 2ZQSA 4ODNA 1GUVA 3MQHA 2PPPA 4MSPA 1WAWA 3ARUA 3ALGA 1L1PA 4J4OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ROT A;  2RUD A;  3I6C A;  4U84 A;  2XPB A;  1FKR A;  4ODM A;  1Q6U A;  3UQI A;  3B7X A;  4U86 A;  1I5H W;  1R9H A;  3KZ7 A;  4IPX A;  3KAC A;  3O5J A;  2IF4 A;  1Q1C A;  5B8I C;  2ZR6 A;  4FAP A;  2JXW A;  2JZV A;  3NRK A;  5HUA A;  5DIU A;  3UF8 A;  2LPV A;  4BF8 A;  1M5Y A;  2YSB A;  1D7H A;  2OFN A;  4DT4 A;  4GGQ A;  3KAD A;  2ZQU A;  1K9Q A;  3O5K A;  1FD9 A;  1QPF A;  4DH0 A;  2DMV A;  2D9F A;  2ZQT A;  4W9P A;  1FKT A;  2FKE A;  2LKN A;  2F21 A;  4IQC A;  1FKB A;  3O5I A;  2YSF A;  3O5G A;  5HKG A;  4ITZ A;  3FAP A;  3O5Q A;  5AHT A;  4QIB A;  5HTG A;  3M85 A;  2ITK A;  4J4N A;  1BL4 A;  1BKF A;  2DJY A;  2PV2 A;  2KR7 A;  3MDY B;  2BA1 A;  2XP7 A;  4NNR A;  3CGN A;  1FKH A;  2JMF A;  5CQ2 A;  3O5M A;  2XP5 A;  3O5L A;  2PPN A;  1EYM A;  3L4H A;  4IQ2 A;  4TW7 A;  2YSI A;  1C9H A;  2DG3 A;  2RE3 A;  2DWV A;  5J6E A;  1EG3 A;  2JV4 A;  4DZ3 A;  1JVW A;  2MPH A;  1A7X A;  1ZK6 A;  2PBC A;  5HWB A;  2PPO A;  1T11 A;  2MNT A;  2KXQ A;  2M3O W;  3UI6 A;  4O2T A;  1JNT A;  3NI6 A;  4G2P A;  4DRJ A;  2M8J A;  5BXJ A;  1FKD A;  3JYJ A;  2PV3 A;  4DRH A;  1QZ2 A;  4ODR A;  1EQ3 A;  2XP6 A;  2LGO A;  5DIT A;  4TX0 A;  1W26 A;  2XP4 A;  1KT1 A;  4W9O A;  3RFW A;  2N87 A;  2KFW A;  2DG9 A;  1KT0 A;  2FAP A;  2F2D A;  5DIV A;  1QPL A;  4JFM A;  2JX8 A;  2ZQV A;  3LE4 A;  1Y0O A;  3EY6 A;  1D7I A;  1J6Y A;  2Q5A A;  3IKD A;  4JFK A;  2KO7 A;  3LUO A;  1PIN A;  1FKS A;  4MGV A;  2XPA A;  2ZAJ A;  5HW8 A;  4U85 A;  4LAV A;  4REX A;  1WMV A;  3UQB A;  1YAT A;  4TYO A;  4W9Q A;  1JMQ A;  4DRN A;  4DRP A;  4DRI A;  3O5F A;  1B6C A;  1NMV A;  2M2A A;  3UI5 A;  2ZR5 A;  4DZ2 A;  4ODQ A;  1Q6I A;  1FJD A;  2M1I A;  2M08 A;  1ROU A;  5D75 A;  3O5E A;  3NTP A;  1YW5 A;  3M7N A;  2VCD A;  5GPG A;  1K9R A;  4C02 B;  2DG4 A;  2L4J A;  1PBK A;  4G50 A;  2MDI A;  4LAY A;  2MLX A;  4DRM A;  4JFL A;  3O5P A;  3UI4 A;  5I98 A;  2L2S A;  4QT3 A;  4E5R A;  3KAF A;  2K8I A;  1TCO C;  2YSG A;  2MF9 A;  4DRK A;  3PRB A;  1J4H A;  1FKG A;  2RSE A;  4JFJ A;  1NSG A;  1NMW A;  3KAH A;  3KAB A;  4LAX A;  4DRQ A;  4FN2 A;  2RUQ A;  3IKG A;  1D7J A;  1O6W A;  3GPK A;  2DK7 A;  4N19 A;  4TNS A;  4LAW A;  3KAI A;  1HXV A;  3CNG A;  1WR7 A;  3OOB A;  2RUC A;  2ZR4 A;  3TCZ A;  3KAG A;  2RQS A;  2EZ5 W;  3H9R B;  2F4E A;  3ODK A;  3WH0 A;  2XP9 A;  4JYS A;  1FAP A;  4ODL A;  4DRO A;  4R0X A;  3JYM A;  1TK7 A;  3IHZ A;  3PRD A;  4QT2 A;  1J4I A;  2YSH A;  2KI3 A;  2LJ4 A;  2MLY A;  1EG4 A;  1FKL A;  3RGC A;  3PA7 A;  3VAW A;  2M8I A;  3TC5 A;  1N1A A;  1ZCN A;  4DIP A;  2UZ5 A;  1F40 A;  5HW7 A;  1FKK A;  3JXV A;  1FKJ A;  2VN1 A;  2PV1 A;  4TW6 A;  2KE0 A;  2XP8 A;  1FKF A;  2E45 A;  1J4R A;  1P5Q A;  4GIV A;  1FKI A;  3IK8 A;  1D6O A;  4ODK A;  2RUR A;  1U79 A;  5HWC A;  5HW6 A;  1JNS A;  2MLZ A;  4TW8 A;  5HT1 A;  2DK1 A;  2LAJ A;  3O5D A;  2KGJ A;  3TDB A;  3O5O A;  4JFI A;  1F8A B;  4ODO A;  3KCE A;  2XP3 A;  1Q6H A;  2Y78 A;  2AWG A;  3CGM A;  3UQA A;  3O5R A;  4ODP A;  2ZQS A;  4ODN A;  2PPP A;  4MSP A;  1L1P A;  4J4O A; 
#chains in the Genus database with same CATH topology
 3MQG A;  3EIP A;  1ROT A;  2RUD A;  3I6C A;  2OLH A;  4U84 A;  2XPB A;  1FKR A;  3FS8 A;  1Q6U A;  4ODM A;  3RM9 A;  2YBU A;  3UQI A;  2WAD A;  3ARR A;  3B7X A;  4U86 A;  1I5H W;  1R9H A;  3KZ7 A;  4IPX A;  3G6L A;  3B9E A;  3KAC A;  3O5J A;  2IF4 A;  1Q1C A;  3PRA A;  3FSB A;  3RM8 A;  5B8I C;  2ZR6 A;  1X6N A;  1W1P A;  1E15 A;  4FAP A;  1W9V A;  2JXW A;  2JZV A;  3NRK A;  1E6P A;  5HUA A;  5DIU A;  3ARY A;  3UF8 A;  3W4R A;  2LPV A;  4BF8 A;  1OGB A;  1M5Y A;  2YSB A;  1LG2 A;  3MCB B;  3BXW A;  4DWS B;  1HKJ A;  1D7H A;  2P4V A;  3WL0 A;  5DF0 A;  2OFN A;  3GU0 A;  4GGQ A;  4DT4 A;  3B9A A;  3KAD A;  4Z2L A;  2ZQU A;  2YBT A;  3CZ8 A;  5HBF A;  1K9Q A;  3O5K A;  1FD9 A;  1QPF A;  3WD0 A;  1E6N A;  4DH0 A;  4MTV A;  2WAE A;  2DMV A;  2D9F A;  4NSB A;  2ZQT A;  4Q7N A;  4W9P A;  1FKT A;  2FKE A;  4IT6 A;  1E6R A;  5DO2 A;  2LKN A;  2O9O A;  4L72 B;  2F21 A;  4HBO A;  4WK9 A;  4IQC A;  3LKX A;  1FKB A;  3O5I A;  4P8V A;  2YSF A;  3WIJ A;  3O5G A;  1WB0 A;  4KQZ A;  5HKG A;  4ITZ A;  3FAP A;  3WQW A;  4HBE A;  3O5Q A;  5AHT A;  4QIB A;  5HTG A;  2WM0 A;  4L3N A;  3AS1 A;  3M85 A;  2ITK A;  4J4N A;  2QF8 A;  1BL4 A;  1JND A;  1BKF A;  5DEZ A;  2DJY A;  2PV2 A;  2KR7 A;  2DSU A;  4ZS6 A;  2A3B A;  3MDY B;  2BA1 A;  2XP7 A;  3ARP A;  3G6M A;  4NNR A;  3CGN A;  1NWR A;  2DT0 A;  4ZPW R;  1FKH A;  2JMF A;  5CQ2 A;  3O5M A;  2XP5 A;  2QRV A;  1LG1 A;  1CTN A;  3O5L A;  2PPN A;  1EYM A;  3L4H A;  4IQ2 A;  4TW7 A;  4MNJ A;  3RM4 A;  2YSI A;  4MNK A;  1HJV A;  1C9H A;  2DG3 A;  2RE3 A;  2DWV A;  5J6E A;  1EG3 A;  2JV4 A;  3PQH A;  3CHF A;  4MPK A;  4DZ3 A;  1W1T A;  4HAR A;  3ART A;  1JVW A;  2MPH A;  1KFW A;  1A7X A;  4LGX A;  1ZK6 A;  2PBC A;  5HWB A;  2PPO A;  1T11 A;  2MNT A;  2KXQ A;  2WLZ A;  1LJY A;  2M3O W;  4UDM A;  3UI6 A;  4O2T A;  3WKZ A;  1JNT A;  3CHC A;  4W5U A;  1UR8 A;  3NI6 A;  4G2P A;  4DRJ A;  4ZPV R;  2M8J A;  1ITX A;  5BXJ A;  1FKD A;  3JYJ A;  1O6I A;  2PV3 A;  3LKX B;  1RP5 A;  1XRV A;  1GRJ A;  4DRH A;  2G8Z A;  3WD2 A;  1NH6 A;  1QZ2 A;  3AS0 A;  4ODR A;  1EQ3 A;  2XP6 A;  1NWS A;  2LGO A;  5DIT A;  4TX0 A;  1W26 A;  2XP4 A;  4S3K A;  4P8W A;  1KT1 A;  4W9O A;  3RFW A;  3ARS A;  2N87 A;  1ZBC A;  2B5U B;  2KFW A;  4S3J A;  2DG9 A;  1KT0 A;  2FAP A;  5GPR A;  2F2D A;  1EDQ A;  3PR9 A;  3CHE A;  1W1Y A;  5DIV A;  4URI A;  1QPL A;  4JFM A;  2JX8 A;  2ZQV A;  3LE4 A;  3B9D A;  1Y0O A;  3EY6 A;  1D7I A;  1J6Y A;  2Q5A A;  3IKD A;  4P8X A;  4JFK A;  2OWO A;  3AS2 A;  2KO7 A;  3LUO A;  1PIN A;  1FKS A;  1HJX A;  4MGV A;  2XPA A;  3WD3 A;  2ZAJ A;  5HW8 A;  3RME A;  4U85 A;  1OGG A;  4LAV A;  1SYT A;  2A3A A;  4REX A;  1WMV A;  3UQB A;  1LL7 A;  1YAT A;  1UR9 A;  4TYO A;  5E66 A;  1W9U A;  4W9Q A;  1GPF A;  1JMQ A;  4DRN A;  4DRP A;  1E44 A;  3WL1 A;  4DRI A;  3O5F A;  1B6C A;  1NMV A;  4Z2J A;  1NWT A;  3QOK A;  1E9L A;  2M2A A;  4WJX A;  3UI5 A;  2ZR5 A;  4AY1 A;  4WKF A;  4DZ2 A;  4ODQ A;  1Q6I A;  1FJD A;  1HKK A;  2M1I A;  4Z2H A;  2M08 A;  1ROU A;  2ETN A;  5D75 A;  3O5E A;  3NTP A;  1YW5 A;  2A3E A;  5E62 A;  3M7N A;  3GTY X;  1TFV A;  2VCD A;  5GPG A;  3ARW A;  1K9R A;  4C02 B;  2DG4 A;  2L4J A;  1PBK A;  4DWS D;  4G50 A;  2MDI A;  4LAY A;  1WNO A;  2MLX A;  5JH8 A;  2F23 A;  4DRM A;  1EIB A;  3O5P A;  4JFL A;  3UI4 A;  5I98 A;  1VF8 A;  2L2S A;  4QT3 A;  4E5R A;  3KAF A;  2K8I A;  1TCO C;  2YSG A;  2EUL A;  3WQV A;  2IUZ A;  1IX5 A;  1FLC A;  2MF9 A;  4DRK A;  4GLX A;  1ZBV A;  2O92 A;  3PRB A;  1J4H A;  1FKG A;  2RSE A;  4JFJ A;  4QZV B;  4Q22 A;  1OWQ A;  1NSG A;  1NMW A;  1E6Z A;  4MAV A;  2B31 A;  3KAH A;  3WD1 A;  4ML4 A;  3KAB A;  2Y8N B;  1JCH B;  4WIW A;  4LAX A;  2PI6 A;  3ARO A;  4DRQ A;  4FN2 A;  2RUQ A;  3IKG A;  1D7J A;  1HKM A;  1O6W A;  3GPK A;  2DK7 A;  4N19 A;  2AOS A;  4TNS A;  1D2K A;  4LAW A;  3KAI A;  1HXV A;  3CNG A;  3AS3 A;  1WR7 A;  4IT4 A;  3OOB A;  2RUC A;  2ZR4 A;  3TCZ A;  3KAG A;  2RQS A;  5GQB A;  3WD4 A;  2EZ5 W;  3H9R B;  2F4E A;  3ODK A;  2FDM A;  3FY1 A;  3WH0 A;  1FFQ A;  2DSV A;  3AQU A;  4MNM A;  4ZPT R;  2XP9 A;  4JYS A;  2DSW A;  1FAP A;  4ODL A;  4DRO A;  4R0X A;  3JYM A;  1TK7 A;  3IHZ A;  1HJW A;  3PRD A;  3ARZ A;  4QT2 A;  3BMB A;  1J4I A;  2YSH A;  2KI3 A;  2LJ4 A;  2MLY A;  1W1V A;  4NZC A;  1EG4 A;  1FKL A;  3RGC A;  3PA7 A;  3B8S A;  3VAW A;  1TR8 A;  5E65 A;  4WKH A;  2M8I A;  1HKI A;  4P8U A;  3ARX A;  3TC5 A;  1N1A A;  4PTM A;  1JNE A;  1RD6 A;  2ESC A;  1ZBW A;  1X6L A;  1ZCN A;  4MNL A;  4DIP A;  4Z2I A;  2DPE A;  2UZ5 A;  1F40 A;  5HW7 A;  1FKK A;  2DT3 A;  1H0I A;  1ZL1 A;  2G41 A;  3JXV A;  1ZBK A;  1FKJ A;  2VN1 A;  3ARV A;  1W9P A;  4Z2K A;  3OA5 A;  2DT2 A;  1H0G A;  2PV1 A;  3FSC A;  1LL4 A;  4TW6 A;  2KE0 A;  3CHD A;  2XP8 A;  1FKF A;  2E45 A;  5E5W A;  2WLY A;  1XHG A;  2PN0 A;  1J4R A;  2DSZ A;  1P5Q A;  4R5E A;  4GIV A;  1FKI A;  3IK8 A;  4KR0 B;  3FXY A;  1D6O A;  4ODK A;  2RUR A;  1U79 A;  2DT1 A;  5HWC A;  5HW6 A;  3ARQ A;  3CH9 A;  1JNS A;  3MCB A;  4DWS A;  4WKA A;  2MLZ A;  2A3C A;  4TW8 A;  5HT1 A;  4A0U A;  2DK1 A;  2LAJ A;  3O5D A;  4A0T A;  2KGJ A;  1NWU A;  3TDB A;  1LL6 A;  1EHN A;  5E64 A;  2WK2 A;  3O5O A;  1GOI A;  4JFI A;  5U47 A;  1F8A B;  4ODO A;  4DWS C;  3KCE A;  1SR0 A;  2XP3 A;  1ZB5 A;  4XAK A;  2YAJ B;  1Q6H A;  1ZU8 A;  3ALF A;  2Y78 A;  2AWG A;  3CGM A;  3UQA A;  3O5R A;  1K9T A;  1FFR A;  4ODP A;  4Z2G A;  1LQ0 A;  2ZQS A;  4ODN A;  1GUV A;  3MQH A;  2PPP A;  4MSP A;  1WAW A;  3ARU A;  3ALG A;  1L1P A;  4J4O A; 
#chains in the Genus database with same CATH homology
 3MQG A;  1ROT A;  2RUD A;  3I6C A;  2OLH A;  4U84 A;  2XPB A;  1FKR A;  3FS8 A;  1Q6U A;  4ODM A;  3RM9 A;  2YBU A;  3UQI A;  2WAD A;  3ARR A;  3B7X A;  4U86 A;  1I5H W;  1R9H A;  3KZ7 A;  4IPX A;  3G6L A;  3B9E A;  3KAC A;  3O5J A;  2IF4 A;  1Q1C A;  3PRA A;  3FSB A;  3RM8 A;  5B8I C;  2ZR6 A;  1X6N A;  1W1P A;  1E15 A;  4FAP A;  1W9V A;  2JXW A;  2JZV A;  3NRK A;  1E6P A;  5HUA A;  5DIU A;  3ARY A;  3UF8 A;  3W4R A;  2LPV A;  4BF8 A;  1OGB A;  1M5Y A;  2YSB A;  1LG2 A;  3MCB B;  3BXW A;  4DWS B;  1HKJ A;  1D7H A;  3WL0 A;  5DF0 A;  2OFN A;  4DT4 A;  4GGQ A;  3B9A A;  3KAD A;  4Z2L A;  2ZQU A;  2YBT A;  3CZ8 A;  5HBF A;  1K9Q A;  3O5K A;  1FD9 A;  1QPF A;  3WD0 A;  1E6N A;  4DH0 A;  4MTV A;  2WAE A;  2DMV A;  2D9F A;  4NSB A;  2ZQT A;  4Q7N A;  4W9P A;  1FKT A;  2FKE A;  4IT6 A;  1E6R A;  5DO2 A;  2LKN A;  2O9O A;  4L72 B;  2F21 A;  4HBO A;  4WK9 A;  4IQC A;  3LKX A;  1FKB A;  3O5I A;  4P8V A;  2YSF A;  3WIJ A;  3O5G A;  1WB0 A;  4KQZ A;  5HKG A;  4ITZ A;  3FAP A;  3WQW A;  4HBE A;  3O5Q A;  5AHT A;  4QIB A;  5HTG A;  2WM0 A;  4L3N A;  3AS1 A;  3M85 A;  2ITK A;  4J4N A;  2QF8 A;  1BL4 A;  1JND A;  1BKF A;  5DEZ A;  2DJY A;  2PV2 A;  2KR7 A;  2DSU A;  4ZS6 A;  2A3B A;  3MDY B;  2BA1 A;  2XP7 A;  3ARP A;  3G6M A;  4NNR A;  3CGN A;  1NWR A;  2DT0 A;  4ZPW R;  1FKH A;  2JMF A;  5CQ2 A;  3O5M A;  2XP5 A;  2QRV A;  1LG1 A;  1CTN A;  3O5L A;  2PPN A;  1EYM A;  3L4H A;  4IQ2 A;  4TW7 A;  4MNJ A;  3RM4 A;  2YSI A;  4MNK A;  1HJV A;  1C9H A;  2DG3 A;  2RE3 A;  2DWV A;  5J6E A;  1EG3 A;  2JV4 A;  3PQH A;  3CHF A;  4MPK A;  4DZ3 A;  1W1T A;  4HAR A;  3ART A;  1JVW A;  2MPH A;  1KFW A;  1A7X A;  4LGX A;  1ZK6 A;  2PBC A;  5HWB A;  2PPO A;  1T11 A;  2MNT A;  2KXQ A;  2WLZ A;  1LJY A;  2M3O W;  3UI6 A;  4O2T A;  3WKZ A;  1JNT A;  3CHC A;  4W5U A;  1UR8 A;  3NI6 A;  4G2P A;  4DRJ A;  4ZPV R;  2M8J A;  1ITX A;  5BXJ A;  1FKD A;  3JYJ A;  1O6I A;  2PV3 A;  3LKX B;  1RP5 A;  1XRV A;  4DRH A;  2G8Z A;  3WD2 A;  1NH6 A;  1QZ2 A;  3AS0 A;  4ODR A;  1EQ3 A;  2XP6 A;  1NWS A;  2LGO A;  5DIT A;  4TX0 A;  1W26 A;  2XP4 A;  4S3K A;  4P8W A;  1KT1 A;  4W9O A;  3RFW A;  3ARS A;  2N87 A;  1ZBC A;  2KFW A;  4S3J A;  2DG9 A;  1KT0 A;  2FAP A;  5GPR A;  2F2D A;  1EDQ A;  3PR9 A;  3CHE A;  1W1Y A;  5DIV A;  4URI A;  1QPL A;  4JFM A;  2JX8 A;  2ZQV A;  3LE4 A;  3B9D A;  1Y0O A;  3EY6 A;  1D7I A;  1J6Y A;  2Q5A A;  3IKD A;  4P8X A;  4JFK A;  2OWO A;  3AS2 A;  2KO7 A;  3LUO A;  1PIN A;  1FKS A;  1HJX A;  4MGV A;  2XPA A;  3WD3 A;  2ZAJ A;  5HW8 A;  3RME A;  4U85 A;  1OGG A;  4LAV A;  1SYT A;  2A3A A;  4REX A;  1WMV A;  3UQB A;  1LL7 A;  1YAT A;  1UR9 A;  4TYO A;  5E66 A;  1W9U A;  4W9Q A;  1GPF A;  1JMQ A;  4DRN A;  4DRP A;  3WL1 A;  4DRI A;  3O5F A;  1B6C A;  1NMV A;  4Z2J A;  1NWT A;  3QOK A;  1E9L A;  2M2A A;  4WJX A;  3UI5 A;  2ZR5 A;  4AY1 A;  4WKF A;  4DZ2 A;  4ODQ A;  1Q6I A;  1FJD A;  1HKK A;  2M1I A;  4Z2H A;  2M08 A;  1ROU A;  5D75 A;  3O5E A;  3NTP A;  1YW5 A;  2A3E A;  5E62 A;  3M7N A;  1TFV A;  2VCD A;  5GPG A;  3ARW A;  1K9R A;  4C02 B;  2DG4 A;  2L4J A;  1PBK A;  4DWS D;  4G50 A;  2MDI A;  4LAY A;  1WNO A;  2MLX A;  5JH8 A;  4DRM A;  1EIB A;  3O5P A;  4JFL A;  3UI4 A;  5I98 A;  1VF8 A;  2L2S A;  4QT3 A;  4E5R A;  3KAF A;  2K8I A;  1TCO C;  2YSG A;  3WQV A;  2IUZ A;  1IX5 A;  1FLC A;  2MF9 A;  4DRK A;  4GLX A;  1ZBV A;  2O92 A;  3PRB A;  1J4H A;  1FKG A;  2RSE A;  4JFJ A;  4QZV B;  4Q22 A;  1OWQ A;  1NSG A;  1NMW A;  1E6Z A;  4MAV A;  2B31 A;  3KAH A;  3WD1 A;  4ML4 A;  3KAB A;  2Y8N B;  4WIW A;  4LAX A;  2PI6 A;  3ARO A;  4DRQ A;  4FN2 A;  2RUQ A;  3IKG A;  1D7J A;  1HKM A;  1O6W A;  3GPK A;  2DK7 A;  4N19 A;  2AOS A;  4TNS A;  1D2K A;  4LAW A;  3KAI A;  1HXV A;  3CNG A;  3AS3 A;  1WR7 A;  4IT4 A;  3OOB A;  2RUC A;  2ZR4 A;  3TCZ A;  3KAG A;  2RQS A;  5GQB A;  3WD4 A;  2EZ5 W;  3H9R B;  2F4E A;  3ODK A;  2FDM A;  3FY1 A;  3WH0 A;  1FFQ A;  2DSV A;  3AQU A;  4MNM A;  4ZPT R;  2XP9 A;  4JYS A;  2DSW A;  1FAP A;  4ODL A;  4DRO A;  4R0X A;  3JYM A;  1TK7 A;  3IHZ A;  1HJW A;  3PRD A;  3ARZ A;  4QT2 A;  1J4I A;  2YSH A;  2KI3 A;  2LJ4 A;  2MLY A;  1W1V A;  4NZC A;  1EG4 A;  1FKL A;  3RGC A;  3PA7 A;  3B8S A;  3VAW A;  1TR8 A;  5E65 A;  4WKH A;  2M8I A;  1HKI A;  4P8U A;  3ARX A;  3TC5 A;  1N1A A;  4PTM A;  1JNE A;  1RD6 A;  2ESC A;  1ZBW A;  1X6L A;  1ZCN A;  4MNL A;  4DIP A;  4Z2I A;  2DPE A;  2UZ5 A;  1F40 A;  5HW7 A;  1FKK A;  2DT3 A;  1H0I A;  1ZL1 A;  2G41 A;  3JXV A;  1ZBK A;  1FKJ A;  2VN1 A;  3ARV A;  1W9P A;  4Z2K A;  3OA5 A;  2DT2 A;  1H0G A;  2PV1 A;  3FSC A;  1LL4 A;  4TW6 A;  2KE0 A;  3CHD A;  2XP8 A;  1FKF A;  2E45 A;  5E5W A;  2WLY A;  1XHG A;  1J4R A;  2DSZ A;  1P5Q A;  4R5E A;  4GIV A;  1FKI A;  3IK8 A;  4KR0 B;  3FXY A;  1D6O A;  4ODK A;  2RUR A;  1U79 A;  2DT1 A;  5HWC A;  5HW6 A;  3ARQ A;  3CH9 A;  1JNS A;  3MCB A;  4DWS A;  4WKA A;  2MLZ A;  2A3C A;  4TW8 A;  5HT1 A;  4A0U A;  2DK1 A;  2LAJ A;  3O5D A;  4A0T A;  2KGJ A;  1NWU A;  3TDB A;  1LL6 A;  1EHN A;  5E64 A;  2WK2 A;  3O5O A;  1GOI A;  4JFI A;  5U47 A;  1F8A B;  4ODO A;  4DWS C;  3KCE A;  1SR0 A;  2XP3 A;  1ZB5 A;  4XAK A;  2YAJ B;  1Q6H A;  1ZU8 A;  3ALF A;  2Y78 A;  2AWG A;  3CGM A;  3UQA A;  3O5R A;  1K9T A;  1FFR A;  4ODP A;  4Z2G A;  1LQ0 A;  2ZQS A;  4ODN A;  1GUV A;  3MQH A;  2PPP A;  4MSP A;  1WAW A;  3ARU A;  3ALG A;  1L1P A;  4J4O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...