2XPBA

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
146
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
total genus 47
structure length 146
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xpbA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xpbA02
3UQBA 2Q5AA 2F4EA 2PV3A 1FKSA 3LE4A 2F2DA 2XP7A 2Y78A 2M8JA 2PPOA 2N87A 3ODKA 3O5DA 3O5FA 3O5IA 1JMQA 2ITKA 1D7JA 4W9PA 2XPAA 2LKNA 1NSGA 2L2SA 2PBCA 2IF4A 2PPNA 4JFIA 2DK1A 3VAWA 4DRHA 3PRDA 1FKIA 3IKDA 1J4HA 2DMVA 5HW8A 2MLYA 4GIVA 1PBKA 2KE0A 4JFKA 2YSHA 2LGOA 4DIPA 2VCDA 5HKGA 3MDYB 2OFNA 4NNRA 5HWCA 4QT2A 2YSFA 2XP3A 2MPHA 2PV1A 4ODPA 2RSEA 1FJDA 2MDIA 4C02B 2DWVA 1FKJA 1Q6IA 1M5YA 4TX0A 5I98A 4N19A 1O6WA 1B6CA 3M85A 4REXA 4R0XA 2DK7A 2UZ5A 4JFMA 3TCZA 1QZ2A 4QIBA 2PPPA 3OOBA 1EG3A 2RE3A 4MGVA 4ODMA 4LAXA 5DIVA 2DG3A 1D7HA 1FKGA 1J6YA 2ZR6A 3JYMA 1ZCNA 3KABA 1U79A 4U86A 4ODLA 3O5GA 3RFWA 2F21A 2RUQA 2KR7A 5DITA 1D6OA 3IK8A 1WMVA 4DRIA 4J4NA 4FN2A 3H9RB 4DRQA 1PINA 3TDBA 2E45A 2RQSA 3KADA 2MF9A 3FAPA 3IHZA 3O5OA 4G2PA 4W9QA 2KXQA 5B8IC 3LUOA 1R9HA 3PA7A 1HXVA 1EG4A 4FAPA 4DZ2A 2JX8A 4IQ2A 2MLXA 4IPXA 4ODRA 5HT1A 2ZAJA 3KZ7A 3UI6A 2KO7A 4DROA 4DRNA 5BXJA 1F8AB 4GGQA 4ODQA 4W9OA 4DRPA 1FKTA 3O5LA 3NI6A 4LAVA 1JNSA 3KCEA 4U85A 4JFJA 2XPBA 1J4RA 1EYMA 2DG9A 3O5JA 5HWBA 1L1PA 2FAPA 1FKFA 3GPKA 1TK7A 2JMFA 3UI5A 1N1AA 2ZR4A 2LAJA 4ITZA 1J4IA 2LPVA 2KFWA 3NRKA 4J4OA 4DH0A 1K9QA 2JV4A 1ZK6A 2M08A 4DRMA 2XP5A 3L4HA 1W26A 3UQAA 3O5MA 1QPFA 2ZQVA 4TNSA 3KAGA 4TW6A 3UI4A 1A7XA 1NMWA 3CNGA 1C9HA 1TCOC 2LJ4A 3O5KA 4QT3A 1KT0A 1FKBA 3KACA 2XP6A 1JVWA 5CQ2A 5D75A 4ODNA 3NTPA 2ZR5A 2ZQUA 3O5RA 3RGCA 4TW8A 1BKFA 4TYOA 2VN1A 2JXWA 4JFLA 4LAYA 2PV2A 4JYSA 4LAWA 2XP8A 2AWGA 2M1IA 4DT4A 4G50A 1I5HW 2RUDA 3O5PA 4IQCA 1Y0OA 3TC5A 2MNTA 1NMVA 5HTGA 1FKRA 5J6EA 1QPLA 5HW7A 2D9FA 1Q1CA 2EZ5W 2XP9A 1KT1A 1Q6HA 1ROTA 4TW7A 3KAHA 5HW6A 1BL4A 2DG4A 2DJYA 1P5QA 2RURA 1FKHA 1EQ3A 3JXVA 3JYJA 1F40A 2MLZA 4DRKA 3WH0A 3O5EA 1YW5A 3EY6A 2ZQSA 2YSGA 1FD9A 2FKEA 2RUCA 2ZQTA 1T11A 3IKGA 2K8IA 4BF8A 1Q6UA 4O2TA 2KGJA 3KAFA 1ROUA 4DZ3A 5DIUA 3UF8A 1D7IA 4U84A 2M2AA 3I6CA 1FKDA 1FKKA 4E5RA 4ODOA 3B7XA 2XP4A 1K9RA 1YATA 2M3OW 3CGNA 4DRJA 1FKLA 3CGMA 4ODKA 1WR7A 3M7NA 2JZVA 2YSBA 3KAIA 1FAPA 2L4JA 5GPGA 5HUAA 1JNTA 2M8IA 3UQIA 2YSIA 2KI3A 3O5QA 4MSPA 2BA1A 5AHTA 3PRBA
chains in the Genus database with same CATH superfamily
2Y8NB 2YBUA 3LE4A 1X6NA 2F2DA 1D2KA 2Y78A 2ITKA 5E66A 1D7JA 1W1TA 2PBCA 2IF4A 3VAWA 2DMVA 3RM4A 4WIWA 2LGOA 3MDYB 4L3NA 4NNRA 3MCBA 5HWCA 2MPHA 2PV1A 2RSEA 3MQHA 4TX0A 3PR9A 4N19A 1B6CA 4R0XA 4REXA 3TCZA 1LG2A 2PPPA 2RE3A 1LL4A 4MNKA 1J6YA 4S3KA 3JYMA 2G8ZA 1JNEA 3LKXB 1U79A 2RUQA 1HJWA 2DSZA 4P8XA 4DWSC 2P4VA 3GTYX 1WMVA 1XRVA 4DRQA 1PINA 2MF9A 2KXQA 3LUOA 1R9HA 3PA7A 1FFRA 1O6IA 4ZS6A 1F8AB 2IUZA 3ARUA 4U85A 4MNMA 4JFJA 1J4RA 4KR0B 3QOKA 3CHEA 4PTMA 4ITZA 4MTVA 2KFWA 3NRKA 3AS1A 1SR0A 1QPFA 2ZQVA 1LL7A 2G41A 1LQ0A 4ZPWR 2DPEA 1E6PA 2DSWA 3FSBA 3CNGA 4GLXA 1C9HA 4MAVA 4UDMA 3B9EA 1FKBA 1W9VA 3ARTA 2ZQUA 3AS0A 5DO2A 1ZB5A 3AS3A 4JYSA 4LAWA 2AWGA 4DT4A 4G50A 2RUDA 4IQCA 3AQUA 3TC5A 3MQGA 1NMVA 5HTGA 1FKRA 4Z2JA 1LG1A 2XP9A 1KT1A 3KAHA 4L72B 1EQ3A 4NSBA 2EULA 1F40A 1NWUA 1KFWA 2MLZA 4URIA 3MCBB 3I6CA 2WAEA 3B7XA 1K9RA 2M3OW 4NZCA 4WJXA 2L4JA 4Z2IA 2KI3A 3ARRA 3FSCA 2F4EA 2QF8A 2PV3A 3UF8A 3O5FA 3O5IA 4R5EA 1NSGA 3IKDA 4A0UA 1GPFA 2MLYA 4JFKA 2KE0A 2F23A 4HARA 1W1PA 2YSFA 1FJDA 2MDIA 4C02B 2DWVA 1FKJA 5I98A 2WM0A 3M85A 2DK7A 4JFMA 1QZ2A 4ODMA 4Z2LA 3OOBA 4MGVA 5DEZA 4LAXA 2DG3A 3ARWA 2ZR6A 1ZCNA 3WL1A 3O5GA 3RFWA 2F21A 1LL6A 5DITA 1D6OA 4DWSD 3H9RB 3CZ8A 3ARZA 3O5OA 2RQSA 4G2PA 2PN0A 2OWOA 1WAWA 4P8UA 3WD0A 1EG4A 3ARXA 4IQ2A 4ODRA 2ZAJA 3KZ7A 3UI6A 5BXJA 3B9AA 1FKTA 1E9LA 5E5WA 3CH9A 4LAVA 3AROA 2XPBA 2YAJB 2DG9A 4Z2HA 1ITXA 1W1VA 1TK7A 1WB0A 4WK9A 3UQAA 3W4RA 1CTNA 4TNSA 1E6RA 1A7XA 1TFVA 1NMWA 3OA5A 3O5KA 1E6ZA 3RMEA 3KACA 4XAKA 5CQ2A 1RP5A 3NTPA 2ZR5A 2VN1A 2JXWA 4JFLA 3PQHA 5GPRA 1I5HW 2A3EA 1HKJA 1Y0OA 1ZBCA 1JCHB 5J6EA 4ZPTR 4P8VA 1ROTA 2EZ5W 1TR8A 2WK2A 1LJYA 2FDMA 2RURA 1FKHA 4DRKA 3O5EA 1ZL1A 3EY6A 1FD9A 3B9DA 3ALGA 5HWBA 4Q7NA 4BF8A 2KGJA 3KAFA 1ROUA 5HKGA 2M2AA 4MNJA 3RM9A 1FKKA 1W9UA 2ETNA 4DRHA 1WR7A 1OGGA 3KAIA 5HUAA 1JNTA 2M8IA 1OWQA 3ARYA 3UQBA 4WKHA 2Q5AA 2XP7A 1W1YA 3AS2A 2N87A 3ODKA 1HJVA 1JMQA 4HBEA 5B8IC 2XPAA 1GRJA 2PPNA 2L2SA 3ARSA 2DK1A 1EHNA 1FKIA 3PRDA 2PI6A 1J4HA 4GIVA 4IT6A 2YSHA 3BMBA 5U47A 2OFNA 4QT2A 2XP3A 1ZBVA 4ODPA 1GOIA 1Q6IA 1O6WA 4QZVB 2O9OA 5HBFA 3WD3A 4QIBA 2WADA 2AOSA 3CHDA 1D7HA 1VF8A 1WNOA 3KABA 4HBOA 4U86A 4ODLA 1NH6A 2KR7A 4WKAA 3IK8A 1EDQA 1H0GA 4W9QA 2E45A 3IHZA 1HXVA 4DZ2A 2JX8A 1E6NA 2MLXA 2KO7A 4DROA 1HKIA 4DRPA 3KCEA 1HKMA 1EYMA 1L1PA 1FKFA 1K9TA 1NWTA 3GPKA 1ZU8A 2JMFA 3UI5A 1N1AA 3ARVA 2LAJA 1J4IA 3ARQA 4J4OA 1K9QA 2DT1A 2JV4A 1ZK6A 2M08A 4DRMA 3L4HA 1W26A 2B5UB 3KAGA 4TW6A 1UR9A 2LJ4A 1TCOC 4QT3A 3FY1A 1KT0A 4KQZA 1JVWA 4LGXA 5D75A 4AY1A 4ODNA 4TW8A 1BKFA 4TYOA 3LKXA 1H0IA 2PV2A 3WIJA 4W5UA 2XP8A 2M1IA 3BXWA 4S3JA 4DWSB 3G6LA 2D9FA 1Q6HA 4TW7A 1BL4A 2DG4A 2DJYA 1ZBKA 2A3BA 3WQVA 3JYJA 3WH0A 1E44A 2QRVA 2YSGA 2FKEA 1W9PA 2K8IA 4O2TA 4DZ3A 3CHFA 2O92A 3ALFA 4E5RA 1FLCA 3B8SA 3CGNA 1YATA 4Z2GA 2B31A 3CGMA 5GPGA 4Z2KA 1FAPA 2A3CA 3UQIA 2YSIA 3O5QA 4MPKA 4MSPA 2DSUA 3PRBA 1SYTA 1FKSA 2M8JA 2PPOA 3O5DA 1X6LA 4W9PA 2LKNA 4JFIA 3FS8A 1GUVA 5JH8A 1IX5A 5E64A 5HW8A 1HKKA 1NWSA 1PBKA 3PRAA 5E65A 4DIPA 2VCDA 4P8WA 1OGBA 1M5YA 1E15A 2UZ5A 3G6MA 1EG3A 5DIVA 1FKGA 2DT2A 2YBTA 3EIPA 2A3AA 4IT4A 4DRIA 1FFQA 1UR8A 4J4NA 4FN2A 3FAPA 3TDBA 3UI4A 3KADA 4FAPA 2DSVA 3ARPA 4IPXA 5HT1A 4DRNA 1NWRA 2WLYA 4GGQA 1ZBWA 4ODQA 4W9OA 3WD1A 3O5LA 2ESCA 3NI6A 1JNSA 3O5JA 2FAPA 2ZR4A 2DT0A 2LPVA 4DH0A 2XP5A 5DF0A 3O5MA 5E62A 3WD4A 3RM8A 1JNDA 3GU0A 4DWSA 5GQBA 2XP6A 3O5RA 3RGCA 4MNLA 4LAYA 3WQWA 3O5PA 2WLZA 2MNTA 3WKZA 4ZPVR 1XHGA 1QPLA 5HW7A 1Q1CA 5HW6A 4WKFA 1P5QA 3JXVA 1YW5A 2ZQSA 2RUCA 2ZQTA 1T11A 3IKGA 1Q6UA 4A0TA 5DIUA 1D7IA 4U84A 2OLHA 1FKDA 4ODOA 1RD6A 3CHCA 2XP4A 3WL0A 4DRJA 1FKLA 4ODKA 3M7NA 4Q22A 2JZVA 2YSBA 3WD2A 2DT3A 3FXYA 1EIBA 4ML4A 2BA1A 5AHTA 1HJXA
chains in the Genus database with same CATH topology
2Y8NB 2YBUA 3LE4A 1X6NA 2F2DA 1D2KA 2Y78A 2ITKA 5E66A 1D7JA 1W1TA 2PBCA 2IF4A 3VAWA 2DMVA 3RM4A 4WIWA 2LGOA 3MDYB 4L3NA 4NNRA 3MCBA 5HWCA 2MPHA 2PV1A 2RSEA 3MQHA 4TX0A 3PR9A 4N19A 1B6CA 4R0XA 4REXA 3TCZA 1LG2A 2PPPA 2RE3A 1LL4A 4MNKA 1J6YA 4S3KA 3JYMA 2G8ZA 1JNEA 3LKXB 1U79A 2RUQA 1HJWA 2DSZA 4P8XA 4DWSC 1WMVA 1XRVA 4DRQA 1PINA 2MF9A 2KXQA 3LUOA 1R9HA 3PA7A 1FFRA 1O6IA 4ZS6A 1F8AB 2IUZA 3ARUA 4U85A 4MNMA 4JFJA 1J4RA 4KR0B 3QOKA 3CHEA 4PTMA 4ITZA 4MTVA 2KFWA 3NRKA 3AS1A 1SR0A 1QPFA 2ZQVA 1LL7A 2G41A 1LQ0A 4ZPWR 2DPEA 1E6PA 2DSWA 3FSBA 3CNGA 4GLXA 1C9HA 4MAVA 3B9EA 1FKBA 1W9VA 3ARTA 2ZQUA 3AS0A 5DO2A 1ZB5A 3AS3A 4JYSA 4LAWA 2AWGA 4DT4A 4G50A 2RUDA 4IQCA 3AQUA 3TC5A 3MQGA 1NMVA 5HTGA 1FKRA 4Z2JA 1LG1A 2XP9A 1KT1A 3KAHA 4L72B 1EQ3A 4NSBA 1F40A 1NWUA 1KFWA 2MLZA 4URIA 3MCBB 3I6CA 2WAEA 3B7XA 1K9RA 2M3OW 4NZCA 4WJXA 2L4JA 4Z2IA 2KI3A 3ARRA 3FSCA 2F4EA 2QF8A 2PV3A 3UF8A 3O5FA 3O5IA 4R5EA 1NSGA 3IKDA 4A0UA 1GPFA 2MLYA 4JFKA 2KE0A 4HARA 1W1PA 2YSFA 1FJDA 2MDIA 4C02B 2DWVA 1FKJA 5I98A 2WM0A 3M85A 2DK7A 4JFMA 1QZ2A 4ODMA 4Z2LA 3OOBA 4MGVA 5DEZA 4LAXA 2DG3A 3ARWA 2ZR6A 1ZCNA 3WL1A 3O5GA 3RFWA 2F21A 1LL6A 5DITA 1D6OA 4DWSD 3H9RB 3CZ8A 3ARZA 3O5OA 2RQSA 4G2PA 2OWOA 1WAWA 4P8UA 3WD0A 1EG4A 3ARXA 4IQ2A 4ODRA 2ZAJA 3KZ7A 3UI6A 5BXJA 3B9AA 1FKTA 1E9LA 5E5WA 3CH9A 4LAVA 3AROA 2XPBA 2YAJB 2DG9A 4Z2HA 1ITXA 1W1VA 1TK7A 1WB0A 4WK9A 3UQAA 3W4RA 1CTNA 4TNSA 1E6RA 1A7XA 1TFVA 1NMWA 3OA5A 3O5KA 1E6ZA 3RMEA 3KACA 4XAKA 5CQ2A 1RP5A 3NTPA 2ZR5A 2VN1A 2JXWA 4JFLA 3PQHA 5GPRA 1I5HW 2A3EA 1HKJA 1Y0OA 1ZBCA 5J6EA 4ZPTR 4P8VA 1ROTA 2EZ5W 1TR8A 2WK2A 1LJYA 2FDMA 2RURA 1FKHA 4DRKA 3O5EA 1ZL1A 3EY6A 1FD9A 3B9DA 3ALGA 5HWBA 4Q7NA 4BF8A 2KGJA 3KAFA 1ROUA 5HKGA 2M2AA 4MNJA 3RM9A 1FKKA 1W9UA 4DRHA 1WR7A 1OGGA 3KAIA 5HUAA 1JNTA 2M8IA 1OWQA 3ARYA 3UQBA 4WKHA 2Q5AA 2XP7A 1W1YA 3AS2A 2N87A 3ODKA 1HJVA 1JMQA 4HBEA 5B8IC 2XPAA 3ARSA 2PPNA 2L2SA 2DK1A 1EHNA 1FKIA 3PRDA 2PI6A 1J4HA 4GIVA 4IT6A 2YSHA 5U47A 2OFNA 4QT2A 2XP3A 1ZBVA 4ODPA 1GOIA 1Q6IA 1O6WA 4QZVB 2O9OA 5HBFA 3WD3A 4QIBA 2WADA 2AOSA 3CHDA 1D7HA 1VF8A 1WNOA 3KABA 4HBOA 4U86A 4ODLA 1NH6A 2KR7A 4WKAA 3IK8A 1EDQA 1H0GA 4W9QA 2E45A 3IHZA 1HXVA 4DZ2A 2JX8A 1E6NA 2MLXA 2KO7A 4DROA 1HKIA 4DRPA 3KCEA 1HKMA 1EYMA 1L1PA 1FKFA 1K9TA 1NWTA 3GPKA 1ZU8A 2JMFA 3UI5A 1N1AA 3ARVA 2LAJA 1J4IA 3ARQA 4J4OA 1K9QA 2DT1A 2JV4A 1ZK6A 2M08A 4DRMA 3L4HA 1W26A 3KAGA 4TW6A 1UR9A 2LJ4A 1TCOC 4QT3A 3FY1A 1KT0A 4KQZA 1JVWA 4LGXA 5D75A 4AY1A 4ODNA 4TW8A 1BKFA 4TYOA 3LKXA 1H0IA 2PV2A 3WIJA 4W5UA 2XP8A 2M1IA 3BXWA 4S3JA 4DWSB 3G6LA 2D9FA 1Q6HA 4TW7A 1BL4A 2DG4A 2DJYA 1ZBKA 2A3BA 3WQVA 3JYJA 3WH0A 2QRVA 2YSGA 2FKEA 1W9PA 2K8IA 4O2TA 4DZ3A 3CHFA 2O92A 3ALFA 4E5RA 1FLCA 3B8SA 3CGNA 1YATA 4Z2GA 2B31A 3CGMA 5GPGA 4Z2KA 1FAPA 2A3CA 3UQIA 2YSIA 3O5QA 4MPKA 4MSPA 2DSUA 3PRBA 1SYTA 1FKSA 2M8JA 2PPOA 3O5DA 1X6LA 4W9PA 2LKNA 4JFIA 3FS8A 1GUVA 5JH8A 1IX5A 5E64A 5HW8A 1HKKA 1NWSA 1PBKA 3PRAA 5E65A 4DIPA 2VCDA 4P8WA 1OGBA 1M5YA 1E15A 2UZ5A 3G6MA 1EG3A 5DIVA 1FKGA 2DT2A 2YBTA 2A3AA 4IT4A 4DRIA 1FFQA 1UR8A 4J4NA 4FN2A 3FAPA 3TDBA 3UI4A 3KADA 4FAPA 2DSVA 3ARPA 4IPXA 5HT1A 4DRNA 1NWRA 2WLYA 4GGQA 1ZBWA 4ODQA 4W9OA 3WD1A 3O5LA 2ESCA 3NI6A 1JNSA 3O5JA 2FAPA 2ZR4A 2DT0A 2LPVA 4DH0A 2XP5A 5DF0A 3O5MA 5E62A 3WD4A 3RM8A 1JNDA 4DWSA 5GQBA 2XP6A 3O5RA 3RGCA 4MNLA 4LAYA 3WQWA 3O5PA 2WLZA 2MNTA 3WKZA 4ZPVR 1XHGA 1QPLA 5HW7A 1Q1CA 5HW6A 4WKFA 1P5QA 3JXVA 1YW5A 2ZQSA 2RUCA 2ZQTA 1T11A 3IKGA 1Q6UA 4A0TA 5DIUA 1D7IA 4U84A 2OLHA 1FKDA 4ODOA 1RD6A 3CHCA 2XP4A 3WL0A 4DRJA 1FKLA 4ODKA 3M7NA 4Q22A 2JZVA 2YSBA 3WD2A 2DT3A 3FXYA 1EIBA 4ML4A 2BA1A 5AHTA 1HJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UQB A;  2Q5A A;  2F4E A;  2PV3 A;  1FKS A;  3LE4 A;  2F2D A;  2XP7 A;  2Y78 A;  2M8J A;  2PPO A;  2N87 A;  3ODK A;  3O5D A;  3O5F A;  3O5I A;  1JMQ A;  2ITK A;  1D7J A;  4W9P A;  2XPA A;  2LKN A;  1NSG A;  2L2S A;  2PBC A;  2IF4 A;  2PPN A;  4JFI A;  2DK1 A;  3VAW A;  4DRH A;  3PRD A;  1FKI A;  3IKD A;  1J4H A;  2DMV A;  5HW8 A;  2MLY A;  4GIV A;  1PBK A;  2KE0 A;  4JFK A;  2YSH A;  2LGO A;  4DIP A;  2VCD A;  5HKG A;  3MDY B;  2OFN A;  4NNR A;  5HWC A;  4QT2 A;  2YSF A;  2XP3 A;  2MPH A;  2PV1 A;  4ODP A;  2RSE A;  1FJD A;  2MDI A;  4C02 B;  2DWV A;  1FKJ A;  1Q6I A;  1M5Y A;  4TX0 A;  5I98 A;  4N19 A;  1O6W A;  1B6C A;  3M85 A;  4REX A;  4R0X A;  2DK7 A;  2UZ5 A;  4JFM A;  3TCZ A;  1QZ2 A;  4QIB A;  2PPP A;  3OOB A;  1EG3 A;  2RE3 A;  4MGV A;  4ODM A;  4LAX A;  5DIV A;  2DG3 A;  1D7H A;  1FKG A;  1J6Y A;  2ZR6 A;  3JYM A;  1ZCN A;  3KAB A;  1U79 A;  4U86 A;  4ODL A;  3O5G A;  3RFW A;  2F21 A;  2RUQ A;  2KR7 A;  5DIT A;  1D6O A;  3IK8 A;  1WMV A;  4DRI A;  4J4N A;  4FN2 A;  3H9R B;  4DRQ A;  1PIN A;  3TDB A;  2E45 A;  2RQS A;  3KAD A;  2MF9 A;  3FAP A;  3IHZ A;  3O5O A;  4G2P A;  4W9Q A;  2KXQ A;  5B8I C;  3LUO A;  1R9H A;  3PA7 A;  1HXV A;  1EG4 A;  4FAP A;  4DZ2 A;  2JX8 A;  4IQ2 A;  2MLX A;  4IPX A;  4ODR A;  5HT1 A;  2ZAJ A;  3KZ7 A;  3UI6 A;  2KO7 A;  4DRO A;  4DRN A;  5BXJ A;  1F8A B;  4GGQ A;  4ODQ A;  4W9O A;  4DRP A;  1FKT A;  3O5L A;  3NI6 A;  4LAV A;  1JNS A;  3KCE A;  4U85 A;  4JFJ A;  2XPB A;  1J4R A;  1EYM A;  2DG9 A;  3O5J A;  5HWB A;  1L1P A;  2FAP A;  1FKF A;  3GPK A;  1TK7 A;  2JMF A;  3UI5 A;  1N1A A;  2ZR4 A;  2LAJ A;  4ITZ A;  1J4I A;  2LPV A;  2KFW A;  3NRK A;  4J4O A;  4DH0 A;  1K9Q A;  2JV4 A;  1ZK6 A;  2M08 A;  4DRM A;  2XP5 A;  3L4H A;  1W26 A;  3UQA A;  3O5M A;  1QPF A;  2ZQV A;  4TNS A;  3KAG A;  4TW6 A;  3UI4 A;  1A7X A;  1NMW A;  3CNG A;  1C9H A;  1TCO C;  2LJ4 A;  3O5K A;  4QT3 A;  1KT0 A;  1FKB A;  3KAC A;  2XP6 A;  1JVW A;  5CQ2 A;  5D75 A;  4ODN A;  3NTP A;  2ZR5 A;  2ZQU A;  3O5R A;  3RGC A;  4TW8 A;  1BKF A;  4TYO A;  2VN1 A;  2JXW A;  4JFL A;  4LAY A;  2PV2 A;  4JYS A;  4LAW A;  2XP8 A;  2AWG A;  2M1I A;  4DT4 A;  4G50 A;  1I5H W;  2RUD A;  3O5P A;  4IQC A;  1Y0O A;  3TC5 A;  2MNT A;  1NMV A;  5HTG A;  1FKR A;  5J6E A;  1QPL A;  5HW7 A;  2D9F A;  1Q1C A;  2EZ5 W;  2XP9 A;  1KT1 A;  1Q6H A;  1ROT A;  4TW7 A;  3KAH A;  5HW6 A;  1BL4 A;  2DG4 A;  2DJY A;  1P5Q A;  2RUR A;  1FKH A;  1EQ3 A;  3JXV A;  3JYJ A;  1F40 A;  2MLZ A;  4DRK A;  3WH0 A;  3O5E A;  1YW5 A;  3EY6 A;  2ZQS A;  2YSG A;  1FD9 A;  2FKE A;  2RUC A;  2ZQT A;  1T11 A;  3IKG A;  2K8I A;  4BF8 A;  1Q6U A;  4O2T A;  2KGJ A;  3KAF A;  1ROU A;  4DZ3 A;  5DIU A;  3UF8 A;  1D7I A;  4U84 A;  2M2A A;  3I6C A;  1FKD A;  1FKK A;  4E5R A;  4ODO A;  3B7X A;  2XP4 A;  1K9R A;  1YAT A;  2M3O W;  3CGN A;  4DRJ A;  1FKL A;  3CGM A;  4ODK A;  1WR7 A;  3M7N A;  2JZV A;  2YSB A;  3KAI A;  1FAP A;  2L4J A;  5GPG A;  5HUA A;  1JNT A;  2M8I A;  3UQI A;  2YSI A;  2KI3 A;  3O5Q A;  4MSP A;  2BA1 A;  5AHT A;  3PRB A; 
#chains in the Genus database with same CATH topology
 2Y8N B;  2YBU A;  3LE4 A;  1X6N A;  2F2D A;  1D2K A;  2Y78 A;  2ITK A;  5E66 A;  1D7J A;  1W1T A;  2PBC A;  2IF4 A;  3VAW A;  2DMV A;  3RM4 A;  4WIW A;  2LGO A;  3MDY B;  4L3N A;  4NNR A;  3MCB A;  5HWC A;  2MPH A;  2PV1 A;  2RSE A;  3MQH A;  4TX0 A;  3PR9 A;  4N19 A;  1B6C A;  4R0X A;  4REX A;  3TCZ A;  1LG2 A;  2PPP A;  2RE3 A;  1LL4 A;  4MNK A;  1J6Y A;  4S3K A;  3JYM A;  2G8Z A;  1JNE A;  3LKX B;  1U79 A;  2RUQ A;  1HJW A;  2DSZ A;  4P8X A;  4DWS C;  2P4V A;  3GTY X;  1WMV A;  1XRV A;  4DRQ A;  1PIN A;  2MF9 A;  2KXQ A;  3LUO A;  1R9H A;  3PA7 A;  1FFR A;  1O6I A;  4ZS6 A;  1F8A B;  2IUZ A;  3ARU A;  4U85 A;  4MNM A;  4JFJ A;  1J4R A;  4KR0 B;  3QOK A;  3CHE A;  4PTM A;  4ITZ A;  4MTV A;  2KFW A;  3NRK A;  3AS1 A;  1SR0 A;  1QPF A;  2ZQV A;  1LL7 A;  2G41 A;  1LQ0 A;  4ZPW R;  2DPE A;  1E6P A;  2DSW A;  3FSB A;  3CNG A;  4GLX A;  1C9H A;  4MAV A;  4UDM A;  3B9E A;  1FKB A;  1W9V A;  3ART A;  2ZQU A;  3AS0 A;  5DO2 A;  1ZB5 A;  3AS3 A;  4JYS A;  4LAW A;  2AWG A;  4DT4 A;  4G50 A;  2RUD A;  4IQC A;  3AQU A;  3TC5 A;  3MQG A;  1NMV A;  5HTG A;  1FKR A;  4Z2J A;  1LG1 A;  2XP9 A;  1KT1 A;  3KAH A;  4L72 B;  1EQ3 A;  4NSB A;  2EUL A;  1F40 A;  1NWU A;  1KFW A;  2MLZ A;  4URI A;  3MCB B;  3I6C A;  2WAE A;  3B7X A;  1K9R A;  2M3O W;  4NZC A;  4WJX A;  2L4J A;  4Z2I A;  2KI3 A;  3ARR A;  3FSC A;  2F4E A;  2QF8 A;  2PV3 A;  3UF8 A;  3O5F A;  3O5I A;  4R5E A;  1NSG A;  3IKD A;  4A0U A;  1GPF A;  2MLY A;  4JFK A;  2KE0 A;  2F23 A;  4HAR A;  1W1P A;  2YSF A;  1FJD A;  2MDI A;  4C02 B;  2DWV A;  1FKJ A;  5I98 A;  2WM0 A;  3M85 A;  2DK7 A;  4JFM A;  1QZ2 A;  4ODM A;  4Z2L A;  3OOB A;  4MGV A;  5DEZ A;  4LAX A;  2DG3 A;  3ARW A;  2ZR6 A;  1ZCN A;  3WL1 A;  3O5G A;  3RFW A;  2F21 A;  1LL6 A;  5DIT A;  1D6O A;  4DWS D;  3H9R B;  3CZ8 A;  3ARZ A;  3O5O A;  2RQS A;  4G2P A;  2PN0 A;  2OWO A;  1WAW A;  4P8U A;  3WD0 A;  1EG4 A;  3ARX A;  4IQ2 A;  4ODR A;  2ZAJ A;  3KZ7 A;  3UI6 A;  5BXJ A;  3B9A A;  1FKT A;  1E9L A;  5E5W A;  3CH9 A;  4LAV A;  3ARO A;  2XPB A;  2YAJ B;  2DG9 A;  4Z2H A;  1ITX A;  1W1V A;  1TK7 A;  1WB0 A;  4WK9 A;  3UQA A;  3W4R A;  1CTN A;  4TNS A;  1E6R A;  1A7X A;  1TFV A;  1NMW A;  3OA5 A;  3O5K A;  1E6Z A;  3RME A;  3KAC A;  4XAK A;  5CQ2 A;  1RP5 A;  3NTP A;  2ZR5 A;  2VN1 A;  2JXW A;  4JFL A;  3PQH A;  5GPR A;  1I5H W;  2A3E A;  1HKJ A;  1Y0O A;  1ZBC A;  1JCH B;  5J6E A;  4ZPT R;  4P8V A;  1ROT A;  2EZ5 W;  1TR8 A;  2WK2 A;  1LJY A;  2FDM A;  2RUR A;  1FKH A;  4DRK A;  3O5E A;  1ZL1 A;  3EY6 A;  1FD9 A;  3B9D A;  3ALG A;  5HWB A;  4Q7N A;  4BF8 A;  2KGJ A;  3KAF A;  1ROU A;  5HKG A;  2M2A A;  4MNJ A;  3RM9 A;  1FKK A;  1W9U A;  2ETN A;  4DRH A;  1WR7 A;  1OGG A;  3KAI A;  5HUA A;  1JNT A;  2M8I A;  1OWQ A;  3ARY A;  3UQB A;  4WKH A;  2Q5A A;  2XP7 A;  1W1Y A;  3AS2 A;  2N87 A;  3ODK A;  1HJV A;  1JMQ A;  4HBE A;  5B8I C;  2XPA A;  1GRJ A;  2PPN A;  2L2S A;  3ARS A;  2DK1 A;  1EHN A;  1FKI A;  3PRD A;  2PI6 A;  1J4H A;  4GIV A;  4IT6 A;  2YSH A;  3BMB A;  5U47 A;  2OFN A;  4QT2 A;  2XP3 A;  1ZBV A;  4ODP A;  1GOI A;  1Q6I A;  1O6W A;  4QZV B;  2O9O A;  5HBF A;  3WD3 A;  4QIB A;  2WAD A;  2AOS A;  3CHD A;  1D7H A;  1VF8 A;  1WNO A;  3KAB A;  4HBO A;  4U86 A;  4ODL A;  1NH6 A;  2KR7 A;  4WKA A;  3IK8 A;  1EDQ A;  1H0G A;  4W9Q A;  2E45 A;  3IHZ A;  1HXV A;  4DZ2 A;  2JX8 A;  1E6N A;  2MLX A;  2KO7 A;  4DRO A;  1HKI A;  4DRP A;  3KCE A;  1HKM A;  1EYM A;  1L1P A;  1FKF A;  1K9T A;  1NWT A;  3GPK A;  1ZU8 A;  2JMF A;  3UI5 A;  1N1A A;  3ARV A;  2LAJ A;  1J4I A;  3ARQ A;  4J4O A;  1K9Q A;  2DT1 A;  2JV4 A;  1ZK6 A;  2M08 A;  4DRM A;  3L4H A;  1W26 A;  2B5U B;  3KAG A;  4TW6 A;  1UR9 A;  2LJ4 A;  1TCO C;  4QT3 A;  3FY1 A;  1KT0 A;  4KQZ A;  1JVW A;  4LGX A;  5D75 A;  4AY1 A;  4ODN A;  4TW8 A;  1BKF A;  4TYO A;  3LKX A;  1H0I A;  2PV2 A;  3WIJ A;  4W5U A;  2XP8 A;  2M1I A;  3BXW A;  4S3J A;  4DWS B;  3G6L A;  2D9F A;  1Q6H A;  4TW7 A;  1BL4 A;  2DG4 A;  2DJY A;  1ZBK A;  2A3B A;  3WQV A;  3JYJ A;  3WH0 A;  1E44 A;  2QRV A;  2YSG A;  2FKE A;  1W9P A;  2K8I A;  4O2T A;  4DZ3 A;  3CHF A;  2O92 A;  3ALF A;  4E5R A;  1FLC A;  3B8S A;  3CGN A;  1YAT A;  4Z2G A;  2B31 A;  3CGM A;  5GPG A;  4Z2K A;  1FAP A;  2A3C A;  3UQI A;  2YSI A;  3O5Q A;  4MPK A;  4MSP A;  2DSU A;  3PRB A;  1SYT A;  1FKS A;  2M8J A;  2PPO A;  3O5D A;  1X6L A;  4W9P A;  2LKN A;  4JFI A;  3FS8 A;  1GUV A;  5JH8 A;  1IX5 A;  5E64 A;  5HW8 A;  1HKK A;  1NWS A;  1PBK A;  3PRA A;  5E65 A;  4DIP A;  2VCD A;  4P8W A;  1OGB A;  1M5Y A;  1E15 A;  2UZ5 A;  3G6M A;  1EG3 A;  5DIV A;  1FKG A;  2DT2 A;  2YBT A;  3EIP A;  2A3A A;  4IT4 A;  4DRI A;  1FFQ A;  1UR8 A;  4J4N A;  4FN2 A;  3FAP A;  3TDB A;  3UI4 A;  3KAD A;  4FAP A;  2DSV A;  3ARP A;  4IPX A;  5HT1 A;  4DRN A;  1NWR A;  2WLY A;  4GGQ A;  1ZBW A;  4ODQ A;  4W9O A;  3WD1 A;  3O5L A;  2ESC A;  3NI6 A;  1JNS A;  3O5J A;  2FAP A;  2ZR4 A;  2DT0 A;  2LPV A;  4DH0 A;  2XP5 A;  5DF0 A;  3O5M A;  5E62 A;  3WD4 A;  3RM8 A;  1JND A;  3GU0 A;  4DWS A;  5GQB A;  2XP6 A;  3O5R A;  3RGC A;  4MNL A;  4LAY A;  3WQW A;  3O5P A;  2WLZ A;  2MNT A;  3WKZ A;  4ZPV R;  1XHG A;  1QPL A;  5HW7 A;  1Q1C A;  5HW6 A;  4WKF A;  1P5Q A;  3JXV A;  1YW5 A;  2ZQS A;  2RUC A;  2ZQT A;  1T11 A;  3IKG A;  1Q6U A;  4A0T A;  5DIU A;  1D7I A;  4U84 A;  2OLH A;  1FKD A;  4ODO A;  1RD6 A;  3CHC A;  2XP4 A;  3WL0 A;  4DRJ A;  1FKL A;  4ODK A;  3M7N A;  4Q22 A;  2JZV A;  2YSB A;  3WD2 A;  2DT3 A;  3FXY A;  1EIB A;  4ML4 A;  2BA1 A;  5AHT A;  1HJX A; 
#chains in the Genus database with same CATH homology
 2Y8N B;  2YBU A;  3LE4 A;  1X6N A;  2F2D A;  1D2K A;  2Y78 A;  2ITK A;  5E66 A;  1D7J A;  1W1T A;  2PBC A;  2IF4 A;  3VAW A;  2DMV A;  3RM4 A;  4WIW A;  2LGO A;  3MDY B;  4L3N A;  4NNR A;  3MCB A;  5HWC A;  2MPH A;  2PV1 A;  2RSE A;  3MQH A;  4TX0 A;  3PR9 A;  4N19 A;  1B6C A;  4R0X A;  4REX A;  3TCZ A;  1LG2 A;  2PPP A;  2RE3 A;  1LL4 A;  4MNK A;  1J6Y A;  4S3K A;  3JYM A;  2G8Z A;  1JNE A;  3LKX B;  1U79 A;  2RUQ A;  1HJW A;  2DSZ A;  4P8X A;  4DWS C;  1WMV A;  1XRV A;  4DRQ A;  1PIN A;  2MF9 A;  2KXQ A;  3LUO A;  1R9H A;  3PA7 A;  1FFR A;  1O6I A;  4ZS6 A;  1F8A B;  2IUZ A;  3ARU A;  4U85 A;  4MNM A;  4JFJ A;  1J4R A;  4KR0 B;  3QOK A;  3CHE A;  4PTM A;  4ITZ A;  4MTV A;  2KFW A;  3NRK A;  3AS1 A;  1SR0 A;  1QPF A;  2ZQV A;  1LL7 A;  2G41 A;  1LQ0 A;  4ZPW R;  2DPE A;  1E6P A;  2DSW A;  3FSB A;  3CNG A;  4GLX A;  1C9H A;  4MAV A;  3B9E A;  1FKB A;  1W9V A;  3ART A;  2ZQU A;  3AS0 A;  5DO2 A;  1ZB5 A;  3AS3 A;  4JYS A;  4LAW A;  2AWG A;  4DT4 A;  4G50 A;  2RUD A;  4IQC A;  3AQU A;  3TC5 A;  3MQG A;  1NMV A;  5HTG A;  1FKR A;  4Z2J A;  1LG1 A;  2XP9 A;  1KT1 A;  3KAH A;  4L72 B;  1EQ3 A;  4NSB A;  1F40 A;  1NWU A;  1KFW A;  2MLZ A;  4URI A;  3MCB B;  3I6C A;  2WAE A;  3B7X A;  1K9R A;  2M3O W;  4NZC A;  4WJX A;  2L4J A;  4Z2I A;  2KI3 A;  3ARR A;  3FSC A;  2F4E A;  2QF8 A;  2PV3 A;  3UF8 A;  3O5F A;  3O5I A;  4R5E A;  1NSG A;  3IKD A;  4A0U A;  1GPF A;  2MLY A;  4JFK A;  2KE0 A;  4HAR A;  1W1P A;  2YSF A;  1FJD A;  2MDI A;  4C02 B;  2DWV A;  1FKJ A;  5I98 A;  2WM0 A;  3M85 A;  2DK7 A;  4JFM A;  1QZ2 A;  4ODM A;  4Z2L A;  3OOB A;  4MGV A;  5DEZ A;  4LAX A;  2DG3 A;  3ARW A;  2ZR6 A;  1ZCN A;  3WL1 A;  3O5G A;  3RFW A;  2F21 A;  1LL6 A;  5DIT A;  1D6O A;  4DWS D;  3H9R B;  3CZ8 A;  3ARZ A;  3O5O A;  2RQS A;  4G2P A;  2OWO A;  1WAW A;  4P8U A;  3WD0 A;  1EG4 A;  3ARX A;  4IQ2 A;  4ODR A;  2ZAJ A;  3KZ7 A;  3UI6 A;  5BXJ A;  3B9A A;  1FKT A;  1E9L A;  5E5W A;  3CH9 A;  4LAV A;  3ARO A;  2XPB A;  2YAJ B;  2DG9 A;  4Z2H A;  1ITX A;  1W1V A;  1TK7 A;  1WB0 A;  4WK9 A;  3UQA A;  3W4R A;  1CTN A;  4TNS A;  1E6R A;  1A7X A;  1TFV A;  1NMW A;  3OA5 A;  3O5K A;  1E6Z A;  3RME A;  3KAC A;  4XAK A;  5CQ2 A;  1RP5 A;  3NTP A;  2ZR5 A;  2VN1 A;  2JXW A;  4JFL A;  3PQH A;  5GPR A;  1I5H W;  2A3E A;  1HKJ A;  1Y0O A;  1ZBC A;  5J6E A;  4ZPT R;  4P8V A;  1ROT A;  2EZ5 W;  1TR8 A;  2WK2 A;  1LJY A;  2FDM A;  2RUR A;  1FKH A;  4DRK A;  3O5E A;  1ZL1 A;  3EY6 A;  1FD9 A;  3B9D A;  3ALG A;  5HWB A;  4Q7N A;  4BF8 A;  2KGJ A;  3KAF A;  1ROU A;  5HKG A;  2M2A A;  4MNJ A;  3RM9 A;  1FKK A;  1W9U A;  4DRH A;  1WR7 A;  1OGG A;  3KAI A;  5HUA A;  1JNT A;  2M8I A;  1OWQ A;  3ARY A;  3UQB A;  4WKH A;  2Q5A A;  2XP7 A;  1W1Y A;  3AS2 A;  2N87 A;  3ODK A;  1HJV A;  1JMQ A;  4HBE A;  5B8I C;  2XPA A;  3ARS A;  2PPN A;  2L2S A;  2DK1 A;  1EHN A;  1FKI A;  3PRD A;  2PI6 A;  1J4H A;  4GIV A;  4IT6 A;  2YSH A;  5U47 A;  2OFN A;  4QT2 A;  2XP3 A;  1ZBV A;  4ODP A;  1GOI A;  1Q6I A;  1O6W A;  4QZV B;  2O9O A;  5HBF A;  3WD3 A;  4QIB A;  2WAD A;  2AOS A;  3CHD A;  1D7H A;  1VF8 A;  1WNO A;  3KAB A;  4HBO A;  4U86 A;  4ODL A;  1NH6 A;  2KR7 A;  4WKA A;  3IK8 A;  1EDQ A;  1H0G A;  4W9Q A;  2E45 A;  3IHZ A;  1HXV A;  4DZ2 A;  2JX8 A;  1E6N A;  2MLX A;  2KO7 A;  4DRO A;  1HKI A;  4DRP A;  3KCE A;  1HKM A;  1EYM A;  1L1P A;  1FKF A;  1K9T A;  1NWT A;  3GPK A;  1ZU8 A;  2JMF A;  3UI5 A;  1N1A A;  3ARV A;  2LAJ A;  1J4I A;  3ARQ A;  4J4O A;  1K9Q A;  2DT1 A;  2JV4 A;  1ZK6 A;  2M08 A;  4DRM A;  3L4H A;  1W26 A;  3KAG A;  4TW6 A;  1UR9 A;  2LJ4 A;  1TCO C;  4QT3 A;  3FY1 A;  1KT0 A;  4KQZ A;  1JVW A;  4LGX A;  5D75 A;  4AY1 A;  4ODN A;  4TW8 A;  1BKF A;  4TYO A;  3LKX A;  1H0I A;  2PV2 A;  3WIJ A;  4W5U A;  2XP8 A;  2M1I A;  3BXW A;  4S3J A;  4DWS B;  3G6L A;  2D9F A;  1Q6H A;  4TW7 A;  1BL4 A;  2DG4 A;  2DJY A;  1ZBK A;  2A3B A;  3WQV A;  3JYJ A;  3WH0 A;  2QRV A;  2YSG A;  2FKE A;  1W9P A;  2K8I A;  4O2T A;  4DZ3 A;  3CHF A;  2O92 A;  3ALF A;  4E5R A;  1FLC A;  3B8S A;  3CGN A;  1YAT A;  4Z2G A;  2B31 A;  3CGM A;  5GPG A;  4Z2K A;  1FAP A;  2A3C A;  3UQI A;  2YSI A;  3O5Q A;  4MPK A;  4MSP A;  2DSU A;  3PRB A;  1SYT A;  1FKS A;  2M8J A;  2PPO A;  3O5D A;  1X6L A;  4W9P A;  2LKN A;  4JFI A;  3FS8 A;  1GUV A;  5JH8 A;  1IX5 A;  5E64 A;  5HW8 A;  1HKK A;  1NWS A;  1PBK A;  3PRA A;  5E65 A;  4DIP A;  2VCD A;  4P8W A;  1OGB A;  1M5Y A;  1E15 A;  2UZ5 A;  3G6M A;  1EG3 A;  5DIV A;  1FKG A;  2DT2 A;  2YBT A;  2A3A A;  4IT4 A;  4DRI A;  1FFQ A;  1UR8 A;  4J4N A;  4FN2 A;  3FAP A;  3TDB A;  3UI4 A;  3KAD A;  4FAP A;  2DSV A;  3ARP A;  4IPX A;  5HT1 A;  4DRN A;  1NWR A;  2WLY A;  4GGQ A;  1ZBW A;  4ODQ A;  4W9O A;  3WD1 A;  3O5L A;  2ESC A;  3NI6 A;  1JNS A;  3O5J A;  2FAP A;  2ZR4 A;  2DT0 A;  2LPV A;  4DH0 A;  2XP5 A;  5DF0 A;  3O5M A;  5E62 A;  3WD4 A;  3RM8 A;  1JND A;  4DWS A;  5GQB A;  2XP6 A;  3O5R A;  3RGC A;  4MNL A;  4LAY A;  3WQW A;  3O5P A;  2WLZ A;  2MNT A;  3WKZ A;  4ZPV R;  1XHG A;  1QPL A;  5HW7 A;  1Q1C A;  5HW6 A;  4WKF A;  1P5Q A;  3JXV A;  1YW5 A;  2ZQS A;  2RUC A;  2ZQT A;  1T11 A;  3IKG A;  1Q6U A;  4A0T A;  5DIU A;  1D7I A;  4U84 A;  2OLH A;  1FKD A;  4ODO A;  1RD6 A;  3CHC A;  2XP4 A;  3WL0 A;  4DRJ A;  1FKL A;  4ODK A;  3M7N A;  4Q22 A;  2JZV A;  2YSB A;  3WD2 A;  2DT3 A;  3FXY A;  1EIB A;  4ML4 A;  2BA1 A;  5AHT A;  1HJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...