2XPBA

Discovery of cell-active phenyl-imidazole pin1 inhibitors by structure-guided fragment evolution
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
157
structure length
146
Chain Sequence
LPPGWEKAMSRSSGRVYYFNHITNASQWERPSGEPARVRCSHLLVKHSQSRRPSSWRQEKITRTKEEALELINGYIQKIKSGEEDFESLASQFSDCSSAKARGDLGAFSRGQMQKPFEDASFALRTGEMSGPVFTDSGIHIILRTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PEPTIDYL-PROLYL CIS-TRANS ISOMERASE NIMA-INTERACTING 1
publication title Discovery of Cell-Active Phenyl-Imidazole Pin1 Inhibitors by Structure-Guided Fragment Evolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase
total genus 47
structure length 146
sequence length 157
ec nomenclature ec 5.2.1.8: Peptidylprolyl isomerase.
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00397 WW WW domain
A PF00639 Rotamase PPIC-type PPIASE domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.70.10 Mainly Beta Single Sheet Ubiquitin Ligase Nedd4; Chain: W; Ubiquitin Ligase Nedd4; Chain: W; 2xpbA01
3.10.50.40 Alpha Beta Roll Chitinase A; domain 3 Chitinase A; domain 3 2xpbA02
1QPLA 2YSGA 3KACA 4DRNA 2RSEA 4MGVA 3O5FA 3JYJA 2M08A 3O5IA 1Y0OA 1BL4A 1J4IA 4LAWA 4W9QA 5AHTA 1J6YA 2ZR6A 2N87A 3I6CA 2LGOA 4TW8A 1K9QA 2JMFA 3O5EA 4J4OA 3O5DA 2RQSA 2DWVA 1FKGA 2XPBA 4LAVA 2OFNA 2K8IA 3O5QA 3UI5A 3KCEA 5HUAA 3TC5A 1U79A 5HTGA 1T11A 2KXQA 1ZCNA 1D6OA 2MDIA 2PPPA 4JYSA 5J6EA 4ODQA 1Q1CA 4O2TA 4U84A 2VCDA 3O5JA 5HWBA 2XP6A 4U85A 4JFLA 1FKRA 4ODLA 2KGJA 2FAPA 2LJ4A 4REXA 2M1IA 3KAFA 1PINA 1F40A 3NRKA 4ODKA 2DG3A 4ODPA 3L4HA 4DRQA 5HW7A 3EY6A 4DIPA 4NNRA 1F8AB 3LE4A 5HT1A 1KT0A 4E5RA 4DRPA 3UI4A 4G50A 1YW5A 2UZ5A 2YSFA 2KE0A 2XP3A 1FKLA 4ODRA 3M85A 4FN2A 5I98A 3O5GA 3CGMA 2M2AA 2ZQTA 4TX0A 1Q6IA 1JVWA 3KAGA 1FD9A 5CQ2A 2KI3A 1D7HA 2D9FA 3TCZA 2M8JA 2BA1A 2LPVA 5DITA 2MNTA 3O5PA 1J4HA 1FKJA 1B6CA 4DZ2A 2PV3A 2FKEA 2RUDA 3UF8A 3UQAA 3RGCA 1QPFA 1FJDA 5GPGA 1YATA 4DROA 5HW6A 3VAWA 4JFMA 2RUQA 4TW6A 4C02B 1ROTA 2MLXA 4JFIA 4ODMA 2KR7A 1FKKA 1BKFA 4W9PA 1D7IA 4DH0A 1NMVA 3IK8A 3KZ7A 2EZ5W 4IQCA 2PV2A 1Q6UA 2JZVA 4BF8A 3O5KA 5DIVA 2XP4A 3JXVA 4TYOA 2ZAJA 4JFKA 2JX8A 1EG4A 4U86A 4QIBA 4JFJA 4ODOA 1FKDA 1ZK6A 4GGQA 3CNGA 2DG9A 1FKSA 4R0XA 3GPKA 1WR7A 2RUCA 1W26A 1K9RA 4ODNA 4DRJA 1TCOC 2XP7A 2PPOA 3O5RA 2MLYA 3OOBA 2ZQSA 3PA7A 2L4JA 3ODKA 4QT2A 2VN1A 2ZQUA 2YSHA 1JNTA 1FKIA 2XP5A 2DG4A 2Q5AA 4IQ2A 1EQ3A 3PRBA 5DIUA 2Y78A 2RE3A 4TW7A 3O5LA 4GIVA 3IHZA 2DK7A 1N1AA 2KO7A 4MSPA 3TDBA 2AWGA 2ZR4A 2PBCA 1A7XA 2RURA 4QT3A 2ITKA 3FAPA 4LAYA 4G2PA 3WH0A 5D75A 3RFWA 3NTPA 3KAHA 1NMWA 2LKNA 3IKDA 3CGNA 2PV1A 1FAPA 1FKBA 4DT4A 5BXJA 3B7XA 2M8IA 2DMVA 2YSBA 3UI6A 2IF4A 1JNSA 5HW8A 2MPHA 3UQBA 1Q6HA 1L1PA 1FKTA 2E45A 1QZ2A 4DRIA 4TNSA 1KT1A 1I5HW 2M3OW 3MDYB 2ZR5A 1NSGA 3H9RB 2MF9A 3O5OA 3LUOA 3O5MA 3PRDA 2L2SA 3NI6A 4N19A 3KADA 3UQIA 1TK7A 2ZQVA 4ITZA 5B8IC 4DRHA 2YSIA 1EG3A 2F2DA 2DJYA 4DRKA 1D7JA 4IPXA 1WMVA 4J4NA 2MLZA 1O6WA 4LAXA 4DRMA 3KABA 2XP8A 3JYMA 4FAPA 1HXVA 2F21A 1R9HA 5HKGA 3IKGA 5HWCA 2F4EA 3M7NA 1ROUA 4DZ3A 1FKHA 2LAJA 1PBKA 2XP9A 1C9HA 1FKFA 1J4RA 1EYMA 4W9OA 2JXWA 2PPNA 1JMQA 3KAIA 1M5YA 2DK1A 2XPAA 2KFWA 1P5QA 2JV4A
chains in the Genus database with same CATH superfamily
1QPLA 3ARTA 4L72B 4R5EA 3ALFA 4ZPVR 2YSGA 3KACA 4DRNA 1LG2A 2RSEA 3GU0A 4HBEA 4MGVA 2PI6A 1ZBKA 4NZCA 3O5FA 3B9AA 1O6IA 3JYJA 3WQVA 4WJXA 2M08A 4MAVA 3O5IA 1Y0OA 4A0UA 1BL4A 4WK9A 1J4IA 2DSZA 4LAWA 4P8VA 4W9QA 5AHTA 1J6YA 2ZR6A 2N87A 3I6CA 2LGOA 4TW8A 1K9QA 2JMFA 1JNDA 2OLHA 1ZL1A 3O5EA 4J4OA 1LL4A 3O5DA 2A3AA 2RQSA 3ARYA 1GPFA 2DWVA 1FKGA 2XPBA 2DPEA 1JCHB 4LAVA 3G6LA 2OFNA 2K8IA 3O5QA 3FS8A 3KCEA 3UI5A 5HUAA 3TC5A 1U79A 5HTGA 1T11A 2KXQA 1UR8A 1ZCNA 2A3BA 3AS2A 1D6OA 2MDIA 2PPPA 4HBOA 4JYSA 4S3KA 1NWUA 1K9TA 4QZVB 5J6EA 3PRAA 2B31A 4ODQA 1Q1CA 4O2TA 4U84A 4Z2IA 3WKZA 2VCDA 3O5JA 3CH9A 5HWBA 1EIBA 2XP6A 3FSBA 2Y8NB 4MPKA 4U85A 4JFLA 3WL1A 3WD1A 1H0IA 1NWTA 2ESCA 4XAKA 3B8SA 4WKAA 1FKRA 3WD0A 4ODLA 4URIA 2KGJA 3FY1A 1W1VA 1LJYA 2FAPA 3OA5A 2LJ4A 4REXA 2M1IA 4A0TA 3KAFA 1PINA 4IT4A 1TR8A 3PQHA 1F40A 3NRKA 4ODKA 2DG3A 4ODPA 1E44A 5JH8A 3MCBB 3L4HA 4DRQA 1LG1A 1E6PA 4NSBA 5HW7A 2B5UB 1E6RA 3CHDA 3EY6A 4WKFA 4DIPA 1HKIA 4NNRA 4UDMA 1F8AB 1ZBVA 3LE4A 5HT1A 3LKXB 1KT0A 4ZPTR 4E5RA 4DRPA 2OWOA 2EULA 2G8ZA 1EHNA 3UI4A 3MQHA 4G50A 1YW5A 2UZ5A 2YSFA 1X6LA 2KE0A 1ZBWA 2XP3A 2ETNA 5GQBA 1FKLA 5GPRA 4ODRA 1IX5A 3WQWA 3M85A 4FN2A 1NH6A 4ZPWR 5I98A 1W9VA 3O5GA 3CGMA 2A3EA 2M2AA 1HJWA 2ZQTA 4TX0A 1Q6IA 1W9PA 4Z2GA 3LKXA 3WD4A 2DT1A 3AS0A 1JVWA 3KAGA 1FD9A 5CQ2A 2KI3A 1XHGA 1D7HA 2D9FA 4Z2JA 5E5WA 3TCZA 2M8JA 2BA1A 2LPVA 5DITA 1E6NA 2MNTA 3GTYX 3O5PA 1J4HA 1FFQA 1FKJA 1OWQA 2P4VA 4KQZA 1B6CA 4DZ2A 2PV3A 2FKEA 2RUDA 3UF8A 2DT2A 3UQAA 3RGCA 3WD2A 3RM4A 1QPFA 1W1YA 4WKHA 1FJDA 5GPGA 1YATA 3ARXA 4DROA 2YBTA 5HW6A 3VAWA 1SYTA 4JFMA 2RUQA 4TW6A 4C02B 2QF8A 2QRVA 4Q22A 2DT3A 1ROTA 2MLXA 4JFIA 4ODMA 2KR7A 1FKKA 1BKFA 4MNKA 3WD3A 1ITXA 4W9PA 1E15A 1D7IA 4DH0A 1W1TA 1NMVA 3IK8A 3KZ7A 2EZ5W 2WADA 4IQCA 2PV2A 2AOSA 1LL6A 1Q6UA 1H0GA 2JZVA 4BF8A 4MNMA 2YAJB 3O5KA 3CHEA 3ARWA 5DIVA 2XP4A 3JXVA 4MNJA 4TYOA 3BXWA 2ZAJA 4DWSC 2PN0A 4JFKA 2JX8A 4DWSB 1EG4A 4U86A 4QIBA 1ZU8A 4JFJA 4ODOA 1OGBA 1FKDA 1ZK6A 4GGQA 1E6ZA 3CZ8A 3CNGA 2DG9A 3QOKA 1FKSA 4R0XA 3ARZA 1ZBCA 1VF8A 3GPKA 1WR7A 2RUCA 1W26A 1K9RA 2WAEA 4ODNA 5DEZA 4DRJA 1TCOC 1KFWA 2XP7A 2PPOA 3O5RA 2WM0A 2MLYA 3OOBA 2ZQSA 3PA7A 2L4JA 3ODKA 4QT2A 4GLXA 2VN1A 4IT6A 2ZQUA 2YSHA 1JNTA 1FKIA 4S3JA 2XP5A 4Z2KA 4DWSA 1HKKA 2DG4A 4Q7NA 2Q5AA 4IQ2A 1EQ3A 3ARQA 3PRBA 3BMBA 3MCBA 5DIUA 2Y78A 2RE3A 4TW7A 3O5LA 4MNLA 3B9DA 4GIVA 3IHZA 2DK7A 3AS3A 1N1AA 2KO7A 3ALGA 4MSPA 3TDBA 1W1PA 4LGXA 1ZB5A 2AWGA 2ZR4A 2PBCA 1LQ0A 1WAWA 1A7XA 2RURA 4QT3A 1D2KA 3CHCA 3AS1A 2ITKA 3ARUA 3FAPA 4LAYA 4G2PA 3EIPA 1RP5A 4KR0B 3WH0A 1NWSA 5DF0A 5D75A 1CTNA 4W5UA 3RFWA 4Z2HA 3NTPA 4ML4A 3KAHA 4P8WA 1NMWA 1RD6A 3ARRA 3WL0A 2LKNA 4P8XA 3IKDA 3CGNA 5DO2A 2PV1A 1FAPA 1FKBA 4DT4A 3RM8A 5BXJA 3B7XA 2M8IA 2DMVA 1WNOA 2YSBA 3UI6A 2IF4A 1JNSA 2F23A 2MPHA 5HW8A 3UQBA 2O92A 5E62A 1Q6HA 1L1PA 1FKTA 2E45A 3ARVA 1QZ2A 1GOIA 4DRIA 4TNSA 3RM9A 5E65A 1KT1A 1I5HW 1HKJA 1NWRA 4MTVA 2M3OW 1FFRA 4AY1A 3MDYB 2DSVA 2ZR5A 3B9EA 1NSGA 3H9RB 2MF9A 3O5OA 3LUOA 3O5MA 2DT0A 3PRDA 3AQUA 2L2SA 3ARSA 3NI6A 2DSWA 3WIJA 4N19A 3KADA 2YBUA 3UQIA 1TK7A 3ARPA 2FDMA 3W4RA 5HBFA 2ZQVA 1HKMA 4ITZA 5B8IC 2O9OA 4DRHA 2YSIA 1EG3A 4Z2LA 2F2DA 2DJYA 1HJXA 4DRKA 4PTMA 2WLYA 1GUVA 1D7JA 3PR9A 4IPXA 5U47A 1WMVA 4HARA 4J4NA 2MLZA 4WIWA 3FSCA 1GRJA 1TFVA 1O6WA 3FXYA 2WLZA 4LAXA 1E9LA 4DRMA 3KABA 2XP8A 1JNEA 3JYMA 2WK2A 4FAPA 1W9UA 1HXVA 2F21A 1R9HA 1EDQA 2DSUA 5HKGA 3RMEA 1UR9A 2A3CA 3IKGA 5HWCA 1X6NA 2F4EA 2G41A 3M7NA 1ROUA 3CHFA 4DZ3A 1FKHA 5E66A 2LAJA 1PBKA 2XP9A 1C9HA 1FKFA 1OGGA 1J4RA 1WB0A 1HJVA 1EYMA 4W9OA 4DWSD 2JXWA 1LL7A 1XRVA 2PPNA 4P8UA 4ZS6A 1FLCA 1JMQA 3AROA 3KAIA 3MQGA 1M5YA 1SR0A 5E64A 3G6MA 4L3NA 2DK1A 2XPAA 2IUZA 2KFWA 1P5QA 2JV4A
chains in the Genus database with same CATH topology
1QPLA 3ARTA 4L72B 4R5EA 3ALFA 4ZPVR 2YSGA 3KACA 4DRNA 1LG2A 2RSEA 4HBEA 4MGVA 2PI6A 1ZBKA 4NZCA 3O5FA 3B9AA 1O6IA 3JYJA 3WQVA 4WJXA 2M08A 4MAVA 3O5IA 1Y0OA 4A0UA 1BL4A 4WK9A 1J4IA 2DSZA 4LAWA 4P8VA 4W9QA 5AHTA 1J6YA 2ZR6A 2N87A 3I6CA 2LGOA 4TW8A 1K9QA 2JMFA 1JNDA 2OLHA 1ZL1A 3O5EA 4J4OA 1LL4A 3O5DA 2A3AA 2RQSA 3ARYA 1GPFA 2DWVA 1FKGA 2XPBA 2DPEA 4LAVA 3G6LA 2OFNA 2K8IA 3O5QA 3FS8A 3KCEA 3UI5A 5HUAA 3TC5A 1U79A 5HTGA 1T11A 2KXQA 1UR8A 1ZCNA 2A3BA 3AS2A 1D6OA 2MDIA 2PPPA 4HBOA 4JYSA 4S3KA 1NWUA 1K9TA 4QZVB 5J6EA 3PRAA 2B31A 4ODQA 1Q1CA 4O2TA 4U84A 4Z2IA 3WKZA 2VCDA 3O5JA 3CH9A 5HWBA 1EIBA 2XP6A 3FSBA 2Y8NB 4MPKA 4U85A 4JFLA 3WL1A 3WD1A 1H0IA 1NWTA 2ESCA 4XAKA 3B8SA 4WKAA 1FKRA 3WD0A 4ODLA 4URIA 2KGJA 3FY1A 1W1VA 1LJYA 2FAPA 3OA5A 2LJ4A 4REXA 2M1IA 4A0TA 3KAFA 1PINA 4IT4A 1TR8A 3PQHA 1F40A 3NRKA 4ODKA 2DG3A 4ODPA 5JH8A 3MCBB 3L4HA 4DRQA 1LG1A 1E6PA 4NSBA 5HW7A 1E6RA 3CHDA 3EY6A 4WKFA 4DIPA 1HKIA 4NNRA 1F8AB 1ZBVA 3LE4A 5HT1A 3LKXB 1KT0A 4ZPTR 4E5RA 4DRPA 2OWOA 2G8ZA 1EHNA 3UI4A 3MQHA 4G50A 1YW5A 2UZ5A 2YSFA 1X6LA 2KE0A 1ZBWA 2XP3A 5GQBA 1FKLA 5GPRA 4ODRA 1IX5A 3WQWA 3M85A 4FN2A 1NH6A 4ZPWR 5I98A 1W9VA 3O5GA 3CGMA 2A3EA 2M2AA 1HJWA 2ZQTA 4TX0A 1Q6IA 1W9PA 4Z2GA 3LKXA 3WD4A 2DT1A 3AS0A 1JVWA 3KAGA 1FD9A 5CQ2A 2KI3A 1XHGA 1D7HA 2D9FA 4Z2JA 5E5WA 3TCZA 2M8JA 2BA1A 2LPVA 5DITA 1E6NA 2MNTA 3O5PA 1J4HA 1FFQA 1FKJA 1OWQA 4KQZA 1B6CA 4DZ2A 2PV3A 2FKEA 2RUDA 3UF8A 2DT2A 3UQAA 3RGCA 3WD2A 3RM4A 1QPFA 1W1YA 4WKHA 1FJDA 5GPGA 1YATA 3ARXA 4DROA 2YBTA 5HW6A 3VAWA 1SYTA 4JFMA 2RUQA 4TW6A 4C02B 2QF8A 2QRVA 4Q22A 2DT3A 1ROTA 2MLXA 4JFIA 4ODMA 2KR7A 1FKKA 1BKFA 4MNKA 3WD3A 1ITXA 4W9PA 1E15A 1D7IA 4DH0A 1W1TA 1NMVA 3IK8A 3KZ7A 2EZ5W 2WADA 4IQCA 2PV2A 2AOSA 1LL6A 1Q6UA 1H0GA 2JZVA 4BF8A 4MNMA 2YAJB 3O5KA 3CHEA 3ARWA 5DIVA 2XP4A 3JXVA 4MNJA 4TYOA 3BXWA 2ZAJA 4DWSC 4JFKA 2JX8A 4DWSB 1EG4A 4U86A 4QIBA 1ZU8A 4JFJA 4ODOA 1OGBA 1FKDA 1ZK6A 4GGQA 1E6ZA 3CZ8A 3CNGA 2DG9A 3QOKA 1FKSA 4R0XA 3ARZA 1ZBCA 1VF8A 3GPKA 1WR7A 2RUCA 1W26A 1K9RA 2WAEA 4ODNA 5DEZA 4DRJA 1TCOC 1KFWA 2XP7A 2PPOA 3O5RA 2WM0A 2MLYA 3OOBA 2ZQSA 3PA7A 2L4JA 3ODKA 4QT2A 4GLXA 2VN1A 4IT6A 2ZQUA 2YSHA 1JNTA 1FKIA 4S3JA 2XP5A 4Z2KA 4DWSA 1HKKA 2DG4A 4Q7NA 2Q5AA 4IQ2A 1EQ3A 3ARQA 3PRBA 3MCBA 5DIUA 2Y78A 2RE3A 4TW7A 3O5LA 4MNLA 3B9DA 4GIVA 3IHZA 2DK7A 3AS3A 1N1AA 2KO7A 3ALGA 4MSPA 3TDBA 1W1PA 4LGXA 1ZB5A 2AWGA 2ZR4A 2PBCA 1LQ0A 1WAWA 1A7XA 2RURA 4QT3A 1D2KA 3CHCA 3AS1A 2ITKA 3ARUA 3FAPA 4LAYA 4G2PA 1RP5A 4KR0B 3WH0A 1NWSA 5DF0A 5D75A 1CTNA 4W5UA 3RFWA 4Z2HA 3NTPA 4ML4A 3KAHA 4P8WA 1NMWA 1RD6A 3ARRA 3WL0A 2LKNA 4P8XA 3IKDA 3CGNA 5DO2A 2PV1A 1FAPA 1FKBA 4DT4A 3RM8A 5BXJA 3B7XA 2M8IA 2DMVA 1WNOA 2YSBA 3UI6A 2IF4A 1JNSA 5HW8A 2MPHA 3UQBA 2O92A 5E62A 1Q6HA 1L1PA 1FKTA 2E45A 3ARVA 1QZ2A 1GOIA 4DRIA 4TNSA 3RM9A 5E65A 1KT1A 1I5HW 1HKJA 1NWRA 4MTVA 2M3OW 1FFRA 4AY1A 3MDYB 2DSVA 2ZR5A 3B9EA 1NSGA 3H9RB 2MF9A 3O5OA 3LUOA 3O5MA 2DT0A 3PRDA 3AQUA 2L2SA 3ARSA 3NI6A 2DSWA 3WIJA 4N19A 3KADA 2YBUA 3UQIA 1TK7A 3ARPA 2FDMA 3W4RA 5HBFA 2ZQVA 1HKMA 4ITZA 5B8IC 2O9OA 4DRHA 2YSIA 1EG3A 4Z2LA 2F2DA 2DJYA 1HJXA 4DRKA 4PTMA 2WLYA 1GUVA 1D7JA 3PR9A 4IPXA 5U47A 1WMVA 4HARA 4J4NA 2MLZA 4WIWA 3FSCA 1TFVA 1O6WA 3FXYA 2WLZA 4LAXA 1E9LA 4DRMA 3KABA 2XP8A 1JNEA 3JYMA 2WK2A 4FAPA 1W9UA 1HXVA 2F21A 1R9HA 1EDQA 2DSUA 5HKGA 3RMEA 1UR9A 2A3CA 3IKGA 5HWCA 1X6NA 2F4EA 2G41A 3M7NA 1ROUA 3CHFA 4DZ3A 1FKHA 5E66A 2LAJA 1PBKA 2XP9A 1C9HA 1FKFA 1OGGA 1J4RA 1WB0A 1HJVA 1EYMA 4W9OA 4DWSD 2JXWA 1LL7A 1XRVA 2PPNA 4P8UA 4ZS6A 1FLCA 1JMQA 3AROA 3KAIA 3MQGA 1M5YA 1SR0A 5E64A 3G6MA 4L3NA 2DK1A 2XPAA 2IUZA 2KFWA 1P5QA 2JV4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QPL A;  2YSG A;  3KAC A;  4DRN A;  2RSE A;  4MGV A;  3O5F A;  3JYJ A;  2M08 A;  3O5I A;  1Y0O A;  1BL4 A;  1J4I A;  4LAW A;  4W9Q A;  5AHT A;  1J6Y A;  2ZR6 A;  2N87 A;  3I6C A;  2LGO A;  4TW8 A;  1K9Q A;  2JMF A;  3O5E A;  4J4O A;  3O5D A;  2RQS A;  2DWV A;  1FKG A;  2XPB A;  4LAV A;  2OFN A;  2K8I A;  3O5Q A;  3UI5 A;  3KCE A;  5HUA A;  3TC5 A;  1U79 A;  5HTG A;  1T11 A;  2KXQ A;  1ZCN A;  1D6O A;  2MDI A;  2PPP A;  4JYS A;  5J6E A;  4ODQ A;  1Q1C A;  4O2T A;  4U84 A;  2VCD A;  3O5J A;  5HWB A;  2XP6 A;  4U85 A;  4JFL A;  1FKR A;  4ODL A;  2KGJ A;  2FAP A;  2LJ4 A;  4REX A;  2M1I A;  3KAF A;  1PIN A;  1F40 A;  3NRK A;  4ODK A;  2DG3 A;  4ODP A;  3L4H A;  4DRQ A;  5HW7 A;  3EY6 A;  4DIP A;  4NNR A;  1F8A B;  3LE4 A;  5HT1 A;  1KT0 A;  4E5R A;  4DRP A;  3UI4 A;  4G50 A;  1YW5 A;  2UZ5 A;  2YSF A;  2KE0 A;  2XP3 A;  1FKL A;  4ODR A;  3M85 A;  4FN2 A;  5I98 A;  3O5G A;  3CGM A;  2M2A A;  2ZQT A;  4TX0 A;  1Q6I A;  1JVW A;  3KAG A;  1FD9 A;  5CQ2 A;  2KI3 A;  1D7H A;  2D9F A;  3TCZ A;  2M8J A;  2BA1 A;  2LPV A;  5DIT A;  2MNT A;  3O5P A;  1J4H A;  1FKJ A;  1B6C A;  4DZ2 A;  2PV3 A;  2FKE A;  2RUD A;  3UF8 A;  3UQA A;  3RGC A;  1QPF A;  1FJD A;  5GPG A;  1YAT A;  4DRO A;  5HW6 A;  3VAW A;  4JFM A;  2RUQ A;  4TW6 A;  4C02 B;  1ROT A;  2MLX A;  4JFI A;  4ODM A;  2KR7 A;  1FKK A;  1BKF A;  4W9P A;  1D7I A;  4DH0 A;  1NMV A;  3IK8 A;  3KZ7 A;  2EZ5 W;  4IQC A;  2PV2 A;  1Q6U A;  2JZV A;  4BF8 A;  3O5K A;  5DIV A;  2XP4 A;  3JXV A;  4TYO A;  2ZAJ A;  4JFK A;  2JX8 A;  1EG4 A;  4U86 A;  4QIB A;  4JFJ A;  4ODO A;  1FKD A;  1ZK6 A;  4GGQ A;  3CNG A;  2DG9 A;  1FKS A;  4R0X A;  3GPK A;  1WR7 A;  2RUC A;  1W26 A;  1K9R A;  4ODN A;  4DRJ A;  1TCO C;  2XP7 A;  2PPO A;  3O5R A;  2MLY A;  3OOB A;  2ZQS A;  3PA7 A;  2L4J A;  3ODK A;  4QT2 A;  2VN1 A;  2ZQU A;  2YSH A;  1JNT A;  1FKI A;  2XP5 A;  2DG4 A;  2Q5A A;  4IQ2 A;  1EQ3 A;  3PRB A;  5DIU A;  2Y78 A;  2RE3 A;  4TW7 A;  3O5L A;  4GIV A;  3IHZ A;  2DK7 A;  1N1A A;  2KO7 A;  4MSP A;  3TDB A;  2AWG A;  2ZR4 A;  2PBC A;  1A7X A;  2RUR A;  4QT3 A;  2ITK A;  3FAP A;  4LAY A;  4G2P A;  3WH0 A;  5D75 A;  3RFW A;  3NTP A;  3KAH A;  1NMW A;  2LKN A;  3IKD A;  3CGN A;  2PV1 A;  1FAP A;  1FKB A;  4DT4 A;  5BXJ A;  3B7X A;  2M8I A;  2DMV A;  2YSB A;  3UI6 A;  2IF4 A;  1JNS A;  5HW8 A;  2MPH A;  3UQB A;  1Q6H A;  1L1P A;  1FKT A;  2E45 A;  1QZ2 A;  4DRI A;  4TNS A;  1KT1 A;  1I5H W;  2M3O W;  3MDY B;  2ZR5 A;  1NSG A;  3H9R B;  2MF9 A;  3O5O A;  3LUO A;  3O5M A;  3PRD A;  2L2S A;  3NI6 A;  4N19 A;  3KAD A;  3UQI A;  1TK7 A;  2ZQV A;  4ITZ A;  5B8I C;  4DRH A;  2YSI A;  1EG3 A;  2F2D A;  2DJY A;  4DRK A;  1D7J A;  4IPX A;  1WMV A;  4J4N A;  2MLZ A;  1O6W A;  4LAX A;  4DRM A;  3KAB A;  2XP8 A;  3JYM A;  4FAP A;  1HXV A;  2F21 A;  1R9H A;  5HKG A;  3IKG A;  5HWC A;  2F4E A;  3M7N A;  1ROU A;  4DZ3 A;  1FKH A;  2LAJ A;  1PBK A;  2XP9 A;  1C9H A;  1FKF A;  1J4R A;  1EYM A;  4W9O A;  2JXW A;  2PPN A;  1JMQ A;  3KAI A;  1M5Y A;  2DK1 A;  2XPA A;  2KFW A;  1P5Q A;  2JV4 A; 
#chains in the Genus database with same CATH topology
 1QPL A;  3ART A;  4L72 B;  4R5E A;  3ALF A;  4ZPV R;  2YSG A;  3KAC A;  4DRN A;  1LG2 A;  2RSE A;  3GU0 A;  4HBE A;  4MGV A;  2PI6 A;  1ZBK A;  4NZC A;  3O5F A;  3B9A A;  1O6I A;  3JYJ A;  3WQV A;  4WJX A;  2M08 A;  4MAV A;  3O5I A;  1Y0O A;  4A0U A;  1BL4 A;  4WK9 A;  1J4I A;  2DSZ A;  4LAW A;  4P8V A;  4W9Q A;  5AHT A;  1J6Y A;  2ZR6 A;  2N87 A;  3I6C A;  2LGO A;  4TW8 A;  1K9Q A;  2JMF A;  1JND A;  2OLH A;  1ZL1 A;  3O5E A;  4J4O A;  1LL4 A;  3O5D A;  2A3A A;  2RQS A;  3ARY A;  1GPF A;  2DWV A;  1FKG A;  2XPB A;  2DPE A;  1JCH B;  4LAV A;  3G6L A;  2OFN A;  2K8I A;  3O5Q A;  3FS8 A;  3KCE A;  3UI5 A;  5HUA A;  3TC5 A;  1U79 A;  5HTG A;  1T11 A;  2KXQ A;  1UR8 A;  1ZCN A;  2A3B A;  3AS2 A;  1D6O A;  2MDI A;  2PPP A;  4HBO A;  4JYS A;  4S3K A;  1NWU A;  1K9T A;  4QZV B;  5J6E A;  3PRA A;  2B31 A;  4ODQ A;  1Q1C A;  4O2T A;  4U84 A;  4Z2I A;  3WKZ A;  2VCD A;  3O5J A;  3CH9 A;  5HWB A;  1EIB A;  2XP6 A;  3FSB A;  2Y8N B;  4MPK A;  4U85 A;  4JFL A;  3WL1 A;  3WD1 A;  1H0I A;  1NWT A;  2ESC A;  4XAK A;  3B8S A;  4WKA A;  1FKR A;  3WD0 A;  4ODL A;  4URI A;  2KGJ A;  3FY1 A;  1W1V A;  1LJY A;  2FAP A;  3OA5 A;  2LJ4 A;  4REX A;  2M1I A;  4A0T A;  3KAF A;  1PIN A;  4IT4 A;  1TR8 A;  3PQH A;  1F40 A;  3NRK A;  4ODK A;  2DG3 A;  4ODP A;  1E44 A;  5JH8 A;  3MCB B;  3L4H A;  4DRQ A;  1LG1 A;  1E6P A;  4NSB A;  5HW7 A;  2B5U B;  1E6R A;  3CHD A;  3EY6 A;  4WKF A;  4DIP A;  1HKI A;  4NNR A;  4UDM A;  1F8A B;  1ZBV A;  3LE4 A;  5HT1 A;  3LKX B;  1KT0 A;  4ZPT R;  4E5R A;  4DRP A;  2OWO A;  2EUL A;  2G8Z A;  1EHN A;  3UI4 A;  3MQH A;  4G50 A;  1YW5 A;  2UZ5 A;  2YSF A;  1X6L A;  2KE0 A;  1ZBW A;  2XP3 A;  2ETN A;  5GQB A;  1FKL A;  5GPR A;  4ODR A;  1IX5 A;  3WQW A;  3M85 A;  4FN2 A;  1NH6 A;  4ZPW R;  5I98 A;  1W9V A;  3O5G A;  3CGM A;  2A3E A;  2M2A A;  1HJW A;  2ZQT A;  4TX0 A;  1Q6I A;  1W9P A;  4Z2G A;  3LKX A;  3WD4 A;  2DT1 A;  3AS0 A;  1JVW A;  3KAG A;  1FD9 A;  5CQ2 A;  2KI3 A;  1XHG A;  1D7H A;  2D9F A;  4Z2J A;  5E5W A;  3TCZ A;  2M8J A;  2BA1 A;  2LPV A;  5DIT A;  1E6N A;  2MNT A;  3GTY X;  3O5P A;  1J4H A;  1FFQ A;  1FKJ A;  1OWQ A;  2P4V A;  4KQZ A;  1B6C A;  4DZ2 A;  2PV3 A;  2FKE A;  2RUD A;  3UF8 A;  2DT2 A;  3UQA A;  3RGC A;  3WD2 A;  3RM4 A;  1QPF A;  1W1Y A;  4WKH A;  1FJD A;  5GPG A;  1YAT A;  3ARX A;  4DRO A;  2YBT A;  5HW6 A;  3VAW A;  1SYT A;  4JFM A;  2RUQ A;  4TW6 A;  4C02 B;  2QF8 A;  2QRV A;  4Q22 A;  2DT3 A;  1ROT A;  2MLX A;  4JFI A;  4ODM A;  2KR7 A;  1FKK A;  1BKF A;  4MNK A;  3WD3 A;  1ITX A;  4W9P A;  1E15 A;  1D7I A;  4DH0 A;  1W1T A;  1NMV A;  3IK8 A;  3KZ7 A;  2EZ5 W;  2WAD A;  4IQC A;  2PV2 A;  2AOS A;  1LL6 A;  1Q6U A;  1H0G A;  2JZV A;  4BF8 A;  4MNM A;  2YAJ B;  3O5K A;  3CHE A;  3ARW A;  5DIV A;  2XP4 A;  3JXV A;  4MNJ A;  4TYO A;  3BXW A;  2ZAJ A;  4DWS C;  2PN0 A;  4JFK A;  2JX8 A;  4DWS B;  1EG4 A;  4U86 A;  4QIB A;  1ZU8 A;  4JFJ A;  4ODO A;  1OGB A;  1FKD A;  1ZK6 A;  4GGQ A;  1E6Z A;  3CZ8 A;  3CNG A;  2DG9 A;  3QOK A;  1FKS A;  4R0X A;  3ARZ A;  1ZBC A;  1VF8 A;  3GPK A;  1WR7 A;  2RUC A;  1W26 A;  1K9R A;  2WAE A;  4ODN A;  5DEZ A;  4DRJ A;  1TCO C;  1KFW A;  2XP7 A;  2PPO A;  3O5R A;  2WM0 A;  2MLY A;  3OOB A;  2ZQS A;  3PA7 A;  2L4J A;  3ODK A;  4QT2 A;  4GLX A;  2VN1 A;  4IT6 A;  2ZQU A;  2YSH A;  1JNT A;  1FKI A;  4S3J A;  2XP5 A;  4Z2K A;  4DWS A;  1HKK A;  2DG4 A;  4Q7N A;  2Q5A A;  4IQ2 A;  1EQ3 A;  3ARQ A;  3PRB A;  3BMB A;  3MCB A;  5DIU A;  2Y78 A;  2RE3 A;  4TW7 A;  3O5L A;  4MNL A;  3B9D A;  4GIV A;  3IHZ A;  2DK7 A;  3AS3 A;  1N1A A;  2KO7 A;  3ALG A;  4MSP A;  3TDB A;  1W1P A;  4LGX A;  1ZB5 A;  2AWG A;  2ZR4 A;  2PBC A;  1LQ0 A;  1WAW A;  1A7X A;  2RUR A;  4QT3 A;  1D2K A;  3CHC A;  3AS1 A;  2ITK A;  3ARU A;  3FAP A;  4LAY A;  4G2P A;  3EIP A;  1RP5 A;  4KR0 B;  3WH0 A;  1NWS A;  5DF0 A;  5D75 A;  1CTN A;  4W5U A;  3RFW A;  4Z2H A;  3NTP A;  4ML4 A;  3KAH A;  4P8W A;  1NMW A;  1RD6 A;  3ARR A;  3WL0 A;  2LKN A;  4P8X A;  3IKD A;  3CGN A;  5DO2 A;  2PV1 A;  1FAP A;  1FKB A;  4DT4 A;  3RM8 A;  5BXJ A;  3B7X A;  2M8I A;  2DMV A;  1WNO A;  2YSB A;  3UI6 A;  2IF4 A;  1JNS A;  2F23 A;  2MPH A;  5HW8 A;  3UQB A;  2O92 A;  5E62 A;  1Q6H A;  1L1P A;  1FKT A;  2E45 A;  3ARV A;  1QZ2 A;  1GOI A;  4DRI A;  4TNS A;  3RM9 A;  5E65 A;  1KT1 A;  1I5H W;  1HKJ A;  1NWR A;  4MTV A;  2M3O W;  1FFR A;  4AY1 A;  3MDY B;  2DSV A;  2ZR5 A;  3B9E A;  1NSG A;  3H9R B;  2MF9 A;  3O5O A;  3LUO A;  3O5M A;  2DT0 A;  3PRD A;  3AQU A;  2L2S A;  3ARS A;  3NI6 A;  2DSW A;  3WIJ A;  4N19 A;  3KAD A;  2YBU A;  3UQI A;  1TK7 A;  3ARP A;  2FDM A;  3W4R A;  5HBF A;  2ZQV A;  1HKM A;  4ITZ A;  5B8I C;  2O9O A;  4DRH A;  2YSI A;  1EG3 A;  4Z2L A;  2F2D A;  2DJY A;  1HJX A;  4DRK A;  4PTM A;  2WLY A;  1GUV A;  1D7J A;  3PR9 A;  4IPX A;  5U47 A;  1WMV A;  4HAR A;  4J4N A;  2MLZ A;  4WIW A;  3FSC A;  1GRJ A;  1TFV A;  1O6W A;  3FXY A;  2WLZ A;  4LAX A;  1E9L A;  4DRM A;  3KAB A;  2XP8 A;  1JNE A;  3JYM A;  2WK2 A;  4FAP A;  1W9U A;  1HXV A;  2F21 A;  1R9H A;  1EDQ A;  2DSU A;  5HKG A;  3RME A;  1UR9 A;  2A3C A;  3IKG A;  5HWC A;  1X6N A;  2F4E A;  2G41 A;  3M7N A;  1ROU A;  3CHF A;  4DZ3 A;  1FKH A;  5E66 A;  2LAJ A;  1PBK A;  2XP9 A;  1C9H A;  1FKF A;  1OGG A;  1J4R A;  1WB0 A;  1HJV A;  1EYM A;  4W9O A;  4DWS D;  2JXW A;  1LL7 A;  1XRV A;  2PPN A;  4P8U A;  4ZS6 A;  1FLC A;  1JMQ A;  3ARO A;  3KAI A;  3MQG A;  1M5Y A;  1SR0 A;  5E64 A;  3G6M A;  4L3N A;  2DK1 A;  2XPA A;  2IUZ A;  2KFW A;  1P5Q A;  2JV4 A; 
#chains in the Genus database with same CATH homology
 1QPL A;  3ART A;  4L72 B;  4R5E A;  3ALF A;  4ZPV R;  2YSG A;  3KAC A;  4DRN A;  1LG2 A;  2RSE A;  4HBE A;  4MGV A;  2PI6 A;  1ZBK A;  4NZC A;  3O5F A;  3B9A A;  1O6I A;  3JYJ A;  3WQV A;  4WJX A;  2M08 A;  4MAV A;  3O5I A;  1Y0O A;  4A0U A;  1BL4 A;  4WK9 A;  1J4I A;  2DSZ A;  4LAW A;  4P8V A;  4W9Q A;  5AHT A;  1J6Y A;  2ZR6 A;  2N87 A;  3I6C A;  2LGO A;  4TW8 A;  1K9Q A;  2JMF A;  1JND A;  2OLH A;  1ZL1 A;  3O5E A;  4J4O A;  1LL4 A;  3O5D A;  2A3A A;  2RQS A;  3ARY A;  1GPF A;  2DWV A;  1FKG A;  2XPB A;  2DPE A;  4LAV A;  3G6L A;  2OFN A;  2K8I A;  3O5Q A;  3FS8 A;  3KCE A;  3UI5 A;  5HUA A;  3TC5 A;  1U79 A;  5HTG A;  1T11 A;  2KXQ A;  1UR8 A;  1ZCN A;  2A3B A;  3AS2 A;  1D6O A;  2MDI A;  2PPP A;  4HBO A;  4JYS A;  4S3K A;  1NWU A;  1K9T A;  4QZV B;  5J6E A;  3PRA A;  2B31 A;  4ODQ A;  1Q1C A;  4O2T A;  4U84 A;  4Z2I A;  3WKZ A;  2VCD A;  3O5J A;  3CH9 A;  5HWB A;  1EIB A;  2XP6 A;  3FSB A;  2Y8N B;  4MPK A;  4U85 A;  4JFL A;  3WL1 A;  3WD1 A;  1H0I A;  1NWT A;  2ESC A;  4XAK A;  3B8S A;  4WKA A;  1FKR A;  3WD0 A;  4ODL A;  4URI A;  2KGJ A;  3FY1 A;  1W1V A;  1LJY A;  2FAP A;  3OA5 A;  2LJ4 A;  4REX A;  2M1I A;  4A0T A;  3KAF A;  1PIN A;  4IT4 A;  1TR8 A;  3PQH A;  1F40 A;  3NRK A;  4ODK A;  2DG3 A;  4ODP A;  5JH8 A;  3MCB B;  3L4H A;  4DRQ A;  1LG1 A;  1E6P A;  4NSB A;  5HW7 A;  1E6R A;  3CHD A;  3EY6 A;  4WKF A;  4DIP A;  1HKI A;  4NNR A;  1F8A B;  1ZBV A;  3LE4 A;  5HT1 A;  3LKX B;  1KT0 A;  4ZPT R;  4E5R A;  4DRP A;  2OWO A;  2G8Z A;  1EHN A;  3UI4 A;  3MQH A;  4G50 A;  1YW5 A;  2UZ5 A;  2YSF A;  1X6L A;  2KE0 A;  1ZBW A;  2XP3 A;  5GQB A;  1FKL A;  5GPR A;  4ODR A;  1IX5 A;  3WQW A;  3M85 A;  4FN2 A;  1NH6 A;  4ZPW R;  5I98 A;  1W9V A;  3O5G A;  3CGM A;  2A3E A;  2M2A A;  1HJW A;  2ZQT A;  4TX0 A;  1Q6I A;  1W9P A;  4Z2G A;  3LKX A;  3WD4 A;  2DT1 A;  3AS0 A;  1JVW A;  3KAG A;  1FD9 A;  5CQ2 A;  2KI3 A;  1XHG A;  1D7H A;  2D9F A;  4Z2J A;  5E5W A;  3TCZ A;  2M8J A;  2BA1 A;  2LPV A;  5DIT A;  1E6N A;  2MNT A;  3O5P A;  1J4H A;  1FFQ A;  1FKJ A;  1OWQ A;  4KQZ A;  1B6C A;  4DZ2 A;  2PV3 A;  2FKE A;  2RUD A;  3UF8 A;  2DT2 A;  3UQA A;  3RGC A;  3WD2 A;  3RM4 A;  1QPF A;  1W1Y A;  4WKH A;  1FJD A;  5GPG A;  1YAT A;  3ARX A;  4DRO A;  2YBT A;  5HW6 A;  3VAW A;  1SYT A;  4JFM A;  2RUQ A;  4TW6 A;  4C02 B;  2QF8 A;  2QRV A;  4Q22 A;  2DT3 A;  1ROT A;  2MLX A;  4JFI A;  4ODM A;  2KR7 A;  1FKK A;  1BKF A;  4MNK A;  3WD3 A;  1ITX A;  4W9P A;  1E15 A;  1D7I A;  4DH0 A;  1W1T A;  1NMV A;  3IK8 A;  3KZ7 A;  2EZ5 W;  2WAD A;  4IQC A;  2PV2 A;  2AOS A;  1LL6 A;  1Q6U A;  1H0G A;  2JZV A;  4BF8 A;  4MNM A;  2YAJ B;  3O5K A;  3CHE A;  3ARW A;  5DIV A;  2XP4 A;  3JXV A;  4MNJ A;  4TYO A;  3BXW A;  2ZAJ A;  4DWS C;  4JFK A;  2JX8 A;  4DWS B;  1EG4 A;  4U86 A;  4QIB A;  1ZU8 A;  4JFJ A;  4ODO A;  1OGB A;  1FKD A;  1ZK6 A;  4GGQ A;  1E6Z A;  3CZ8 A;  3CNG A;  2DG9 A;  3QOK A;  1FKS A;  4R0X A;  3ARZ A;  1ZBC A;  1VF8 A;  3GPK A;  1WR7 A;  2RUC A;  1W26 A;  1K9R A;  2WAE A;  4ODN A;  5DEZ A;  4DRJ A;  1TCO C;  1KFW A;  2XP7 A;  2PPO A;  3O5R A;  2WM0 A;  2MLY A;  3OOB A;  2ZQS A;  3PA7 A;  2L4J A;  3ODK A;  4QT2 A;  4GLX A;  2VN1 A;  4IT6 A;  2ZQU A;  2YSH A;  1JNT A;  1FKI A;  4S3J A;  2XP5 A;  4Z2K A;  4DWS A;  1HKK A;  2DG4 A;  4Q7N A;  2Q5A A;  4IQ2 A;  1EQ3 A;  3ARQ A;  3PRB A;  3MCB A;  5DIU A;  2Y78 A;  2RE3 A;  4TW7 A;  3O5L A;  4MNL A;  3B9D A;  4GIV A;  3IHZ A;  2DK7 A;  3AS3 A;  1N1A A;  2KO7 A;  3ALG A;  4MSP A;  3TDB A;  1W1P A;  4LGX A;  1ZB5 A;  2AWG A;  2ZR4 A;  2PBC A;  1LQ0 A;  1WAW A;  1A7X A;  2RUR A;  4QT3 A;  1D2K A;  3CHC A;  3AS1 A;  2ITK A;  3ARU A;  3FAP A;  4LAY A;  4G2P A;  1RP5 A;  4KR0 B;  3WH0 A;  1NWS A;  5DF0 A;  5D75 A;  1CTN A;  4W5U A;  3RFW A;  4Z2H A;  3NTP A;  4ML4 A;  3KAH A;  4P8W A;  1NMW A;  1RD6 A;  3ARR A;  3WL0 A;  2LKN A;  4P8X A;  3IKD A;  3CGN A;  5DO2 A;  2PV1 A;  1FAP A;  1FKB A;  4DT4 A;  3RM8 A;  5BXJ A;  3B7X A;  2M8I A;  2DMV A;  1WNO A;  2YSB A;  3UI6 A;  2IF4 A;  1JNS A;  5HW8 A;  2MPH A;  3UQB A;  2O92 A;  5E62 A;  1Q6H A;  1L1P A;  1FKT A;  2E45 A;  3ARV A;  1QZ2 A;  1GOI A;  4DRI A;  4TNS A;  3RM9 A;  5E65 A;  1KT1 A;  1I5H W;  1HKJ A;  1NWR A;  4MTV A;  2M3O W;  1FFR A;  4AY1 A;  3MDY B;  2DSV A;  2ZR5 A;  3B9E A;  1NSG A;  3H9R B;  2MF9 A;  3O5O A;  3LUO A;  3O5M A;  2DT0 A;  3PRD A;  3AQU A;  2L2S A;  3ARS A;  3NI6 A;  2DSW A;  3WIJ A;  4N19 A;  3KAD A;  2YBU A;  3UQI A;  1TK7 A;  3ARP A;  2FDM A;  3W4R A;  5HBF A;  2ZQV A;  1HKM A;  4ITZ A;  5B8I C;  2O9O A;  4DRH A;  2YSI A;  1EG3 A;  4Z2L A;  2F2D A;  2DJY A;  1HJX A;  4DRK A;  4PTM A;  2WLY A;  1GUV A;  1D7J A;  3PR9 A;  4IPX A;  5U47 A;  1WMV A;  4HAR A;  4J4N A;  2MLZ A;  4WIW A;  3FSC A;  1TFV A;  1O6W A;  3FXY A;  2WLZ A;  4LAX A;  1E9L A;  4DRM A;  3KAB A;  2XP8 A;  1JNE A;  3JYM A;  2WK2 A;  4FAP A;  1W9U A;  1HXV A;  2F21 A;  1R9H A;  1EDQ A;  2DSU A;  5HKG A;  3RME A;  1UR9 A;  2A3C A;  3IKG A;  5HWC A;  1X6N A;  2F4E A;  2G41 A;  3M7N A;  1ROU A;  3CHF A;  4DZ3 A;  1FKH A;  5E66 A;  2LAJ A;  1PBK A;  2XP9 A;  1C9H A;  1FKF A;  1OGG A;  1J4R A;  1WB0 A;  1HJV A;  1EYM A;  4W9O A;  4DWS D;  2JXW A;  1LL7 A;  1XRV A;  2PPN A;  4P8U A;  4ZS6 A;  1FLC A;  1JMQ A;  3ARO A;  3KAI A;  3MQG A;  1M5Y A;  1SR0 A;  5E64 A;  3G6M A;  4L3N A;  2DK1 A;  2XPA A;  2IUZ A;  2KFW A;  1P5Q A;  2JV4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...