2XPGA

Crystal structure of a mhc class i-peptide complex
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
274
structure length
274
Chain Sequence
b'GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-3 ALPHA CHAIN
publication title Structure of Hla-A0301 in Complex with a Peptide of Proteolipid Protein: Insights Into the Role of Hla-A Alleles in Susceptibility to Multiple Sclerosis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 73
structure length 274
sequence length 274
ec nomenclature
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xpgA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2xpgA01
4NNYB 1ERNA 5JTWA 5JORB 5D71H 1UB6B 4XXDB 3L3KB 4EOWH 1QVOA 4Z0XB 3QEQA 4YUEL 1EFXD 4HS3A 1GIGH 4OM1H 4QHKI 1YECH 1CE1H 4U2YA 3EO1A 3T4AA 1R24B 4JN1H 4Y7MA 3QIWB 4QOKD 1F2QA 4Z7NE 4K8RH 4JZJC 4KJQD 3JUYA 4PJ7E 2IH1B 2J4WL 4ZXBA 2EIBA 4QGTA 1KC5H 1ZWIB 1IAMA 4QXGH 4HXBH 1KLGA 4NHUB 1U8NB 4TSAL 2FLBT 3MFGB 4X4XA 4V2CB 3QHZH 4ISVA 4BFBD 3SDAA 4YDJB 1TMCB 4UIMA 1BBJA 1T5WB 4YHLH 2JF1A 3GSOB 4P5KB 3OZ9L 5KVFL 5I1KL 2QV2A 5IMKB 2CO7B 2EDBA 5ERWB 1Z9SA 5DVLA 2A1WL 1HHGA 3HZMB 3GBMH 5EUOA 2XQBL 3VI3F 3ECBB 4TULH 2X4NB 3FQNA 3H9HB 5HGHA 3O4OC 3WIFA 3ARBD 4HXAL 3IXAA 5ID1A 1J05B 4WGVB 1JMZA 4MVBA 4A6YH 1FH5H 2DQUL 4X4ME 5E5MB 5KSBA 3G04A 5ICZA 5A16B 1QSED 1NMCC 1KT2B 3FFCE 2BHUA 2NY1C 4H0IA 1IC7H 1T66C 1A47A 1S9YB 1JCKA 3JV4A 5E08L 5KOMC 3U0WH 4WNQB 5JOPE 1OP5K 5E03A 3QFDB 1DR9A 2VR4A 4JRXA 3MYJB 1T0NB 4GS7C 5DHXB 3WXVL 2UY7A 3B8YA 2PTVA 4PJGA 2P42B 1RK0A 1AD9A 4XP5L 2EDJA 5F89A 5I6XB 1J0JA 1UM6H 4TNWK 3UTSA 4G6JL 1XGQB 2CJUL 3FB7B 5FCSH 2FX8L 1YQVL 5IMOA 3QUYC 4OI8A 1V7ML 4EQ3A 2CKBA 5GS1B 4QRPA 4WW1A 5J11C 5F6IC 5F3HA 1YNLH 3V4UL 3IU4L 3DX7B 1S7TA 3LKOA 5EZOL 1N4XL 3C5SA 3MUJA 4U05A 5SWSA 2B2XL 1T1XB 3E3QC 4I0PC 2BSRA 4FQ1L 4NCC1 4P2OD 4Z9KB 4PJEF 2F5BH 2IPUK 4OJFL 5DJYA 2K3TA 3HS0A 1U8PB 3QG7H 4M61B 1N6QL 1ZT7B 4OQTL 4HZLB 3NGBB 3MJ9L 3VRLF 1H0DA 4HIJB 4JO1L 4PJBE 4RZCA 3BO8A 1H5BA 4P3WA 4XWGH 1YEGL 5GS2D 1G0YR 2AJZB 4O5LL 4KROD 1NGYB 4DN4L 1T3FA 5DI8B 1FV1B 1EVUA 1SJVA 1MJUH 2GSGA 4G8GA 2PTTA 1Z9MA 5DEZA 4LLUB 3VXTB 3KLDA 2A74A 4YDIH 4JKPH 3L3IB 1ND0B 4S1DD 4OLUH 2VDQH 5EORH 3KWWB 5GGVL 5K9JH 5ITFB 3TLRA 4P23C 3NBNA 3K8KA 3BWAB 1LWRA 1KB5L 3VFGH 5J56B 4PJXF 3CDGB 4KQ4H 3EIFA 4P9HH 1ADQL 4XMKL 1D5IL 4XTRC 3QEGH 3AB0C 2NTSP 2ENSA 1CDIA 2IPKA 4R4NC 2PNDA 1KNOA 3VWJA 3C6LD 3SKMA 3VXMD 1KCKA 4JPWL 3MRQA 3MLYL 4KKCD 3OJDB 2V5MA 3FB8B 4OZHE 4HEPG 1T22B 1NC2B 1KN2H 1E4XI 1OQOA 1IGTA 1F4WL 1KN4H 3TPUB 5J6GA 3PP4H 4N8VA 3ZDZE 2AEQH 3BDXA 1DQML 2XTJE 3OXSB 3GSXB 1S9KC 1NGPL 1V3JA 4ZYKA 3ZSTA 1A6AA 4JZOB 4N90D 4X9IA 1CF8H 4NKIH 5JUEH 1RURH 3ZTNH 1LO5A 1YDPA 4L1HA 4F15C 4J3VA 5DEGA 5FYJH 4WUUA 1LILA 1RIHL 2CDGA 2VDNH 4KGJA 3TO2A 2RBLA 2UZXB 3BDBA 3DO3A 1RUMH 2XA3A 4ESKA 2IF7A 4TUKH 5ITBL 5FKAA 4HUWA 4DKFL 1MREH 1QSZA 2CGRL 1NANI 2HKHH 1OAYL 3O2DA 5JXED 2CLZA 1PJ9A 5JDSA 1PX3A 3QDHA 1F4YL 1DANU 1FVCB 1C5DB 5FECB 2OK0L 5BS0D 1J7VR 1QBBA 1XGUB 2X6MA 4WI9A 5AEAA 5FV1L 3TT1H 4G7YL 3MLUL 5FO9B 3HC4H 5HPOA 3QR2A 1EGJL 3EGSB 5BQ7B 3FMGH 1HI6A 5D1XB 1UZ8A 4D3CL 4HPOL 4ODWB 2Q20A 1OTSD 1ZS8A 3RA7L 1BM3H 1JHKL 2ARJB 2EEAA 5E99H 3VFSA 3VGEA 1A1NA 4H20L 1PVHA 4Z7WF 2VXVL 4OGAC 2GAZA 1JF6A 5ECJE 3E2HC 4LVNC 4UU9B 4M03A 3SDXF 5CJQH 5I73B 3MODH 2NX5D 1T4KA 3BKYH 4N8CL 4YDKH 1AY1H 5DSCB 2FD6L 4IOIA 1G0DA 4LCCA 1I1AD 4MA8H 5BO1H 2R2BB 4R96B 4CW1B 4KZEL 2ITDB 1ONQA 3C87A 2FGWL 1E28B 1F42A 4JRWA 5IVZA 4JLRB 3UDWC 2VAAB 3IFOB 4XVTH 5C7XL 3HR6A 2AK1L 1T89A 2I60H 1VACA 3FT4A 3FAXA 5HYIA 3T1WA 5TF1L 4QOKE 2QSVA 3STZA 2F53B 3B9DA 3AM8A 4NJAH 4P2QB 3K3QA 5JR1H 3QUMB 2E5EA 4WV1B 2XI9A 2VXSH 5B4MC 3BW9A 3MXVL 4RFOL 5FHBL 4JM2F 4WWKD 4TQEL 2VL5A 5CAYB 3UAJD 5T1MA 4XB8A 2UWEE 2ATPA 2ZCHL 2JJTA 4OFIA 5I9QB 5C0IA 4QWWD 4YDVB 5EU7C 3IAQA 3IDYC 3MXWH 4C59B 3QEQD 3U9UB 2BNQA 1CR9H 3MNZA 2IAMC 4MA1C 3LKNB 5HYQB 2GK2A 3M07A 1OWRM 4PREB 1VADA 2BSSA 5IV2B 2MNUA 1CE6A 2WBJB 3ESUF 4JZNB 4ZD3H 4XP9L 3MGOB 3QXAB 4CVXA 1WAAA 5C3TA 1QSEE 1DVFA 3IS1X 5BOZG 4LSQL 4UIMB 4ZXBD 43CAA 2HTLD 2XTJC 3W2DL 5C6WH 4F7MB 2K9UA 3IF1B 4N0UB 2DKSA 4LRIA 4U1JB 4DGYH 5CGMA 1BD2A 3P0VL 5J9PB 3D25B 4DUXA 4X6DA 5MENA 5I15H 1WWWX 3B43A 1NL0L 1X7QB 5EUOB 1WT5A 4BK5A 1LQVA 2B1AL 2EKSA 3S4SB 4I18C 3FQNB 2WW8A 3O2VL 5HGHB 2LABA 5L7XH 4OD3L 5AYUL 3VXSB 4XVSL 3TESA 1T21B 1GVIA 2EEDA 2G60H 5DD5H 3MLXL 3QXWA 2ZKHL 5IW1B 3LEVL 5E8EB 3G5ZA 4PJCE 1HXMA 3GJFA 5E6IB 2YA1A 3MJ8B 4XZUB 1KCRH 3JV4B 2XPGB 4OLVH 3V6ZB 2OR9H 3VGAC 2JCCA 3RAJL 1A6ZB 2CK0L 4XNMA 3P3YA 2QQNL 1VB9A 5J1SC 4HIEA 4RMRA 4MNHA 1BQHG 1Z5LA 1A9EB 4Y8DC 4J3TA 2ARWA 1TVHB 3GMNB 5DMYA 4JRXD 5JIHA 2W0FA 1Q72H 4WO4B 1T04B 4PRIB 1T03H 1IBGH 3GI9H 1T2XA 1U2CA 4NZUL 3UTSD 3OX8B 5D5MF 4LLMA 1LO0H 3V0WH 1Q1JH 3U6RA 1D6EB 1KCVL 5T3XH 4QRPD 2VN7A 2OR7A 5DJYB 2XRAL 5IBUG 2BRRH 4Q9CA 4WEBH 3BEVB 4YQXH 2EO1A 5SWSD 3I84A 4KJQC 1M71A 5DRWA 5EU6A 3VWKD 3SY0B 2FR4B 3S3SA 3CSGA 1CL7I 1RZJC 4M5ZH 1HEZB 2VLMD 2FCBA 3MA7B 3EJYD 5F88B 1D5ZB 4O2FA 1DLFL 1YPZA 3KJ6H 3LQAL 1EHAA 2R0LL 3LKSB 4G8GB 3BZ4B 3MV8A 4WI3A 3VXME 4JE4B 3LQAC 3GSUA 5I1DB 3F65A 1JK8A 1MPAH 2VMFA 3QDJA 2XACC 5DJ2A 4UV4H 1MI5A 5J89A 5H94B 2FJFA 2X9YA 4K94H 3S8WA 3WJJC 5C0EB 4CDGC 1A3LH 5FOBA 3VI4E 4GG6A 1A7RH 1JNNL 4F3FB 2FSEB 3HNSL 3ARBC 4RGMB 3NIFF 4UNVA 1U3ZA 2GCYA 5BV7L 1KPUB 4N90E 2GJ6E 1B0GA 5BV7C 1XF1A 3PHOA 5E00B 3TNNA 1FFNB 5KG9B 3PWPB 4PGDB 1Y18A 1E4KC 4AM0B 2NQCA 4R97C 1JFMA 3BKCL 5FGBC 5J6GB 1FBIH 1F5WA 3ARWA 3F6LA 3MLVL 3WUZA 1LO4H 1N59A 2IPTL 4X8XA 5INDB 5TFSH 1FSKB 1I8LA 5KS9B 5BS0E 2ZSWB 4IOFD 3WFCL 3HE6B 1WEJH 1IGYA 3NFPA 3CVHL 4ZS7H 4L9DA 4HWZB 3KPOB 3Q3GB 2FECI 4R3SA 4OLZL 2E7LC 1A2YB 1RIVL 1VFAA 1AIFB 2WWMD 1BBDH 4C4KO 2PN5A 4P2OC 4XGZB 3UTOA 4WUUD 2BCKB 1RJYB 2ZCLH 4GRMB 4ZFGH 3IDJB 5B38B 5D2NE 3RKDD 2X9XA 5CFHA 1F4XH 1NFDF 2NX5E 4KKLD 4GO6B 5JDSB 5E8OA 4OGXH 1U92B 2Y06L 1KBGH 2J8UF 4U1SA 3T0ED 3DGGA 4RISL 4DN3L 2BP3A 4KROC 5KVDH 1ZK9A 3BP5A 4AEIL 2FBJL 4Q9RL 5ENWA 2IC2A 2X70A 4N1EA 2UVEA 3HE7A 4L4VB 4DOHB 3NABH 5K33A 4S1DC 4X99B 4U1IB 3SHSA 1BPVA 1ZS8B 35C8H 4YHKH 4CAGA 5EO0B 2GY5A 4HSQA 4ZFFB 2DQCH 1S3KH 4JREC 4QYOA 5GGRB 1JPGB 4LPVA 4ZOCA 3T3ME 5BMFL 3WN5B 2IANA 1A4JA 2RGSA 4KRMB 4U49A 4YWGL 4UMGA 4G8EB 2Y36H 4NN7B 4M1DL 1HCVA 4XHQA 5TQ2H 3KPTA 3MLZL 2EDHA 5EC1B 3HA0A 4NO2A 4H1LB 5I0ZA 2DOCA 1UM4H 3V6OA 3L5XH 1DUZB 5DR5L 3LKRB 4PGZA 5IVXA 4TOYH 3QEQE 3C6LC 3KHQA 4L3EB 1B3JA 5AD0A 4YC2C 1J11A 3STZB 4QNPE 4KKCC 3W39B 3ARZA 1YN6A 5IBTL 3WS3B 1CGUA 3IJSA 3QI9A 4N1HB 5D72L 2QTEA 5L88L 5FO7B 5DA4A 5EBMB 5F7MC 4U6VL 5TE6L 5IHUH 2JKXA 4XNYL 3QP3A 2IFFL 4U6YB 3T8XB 2B20A 5DURD 1MUJB 3MNWA 4LSPH 4Q7DA 3V6FA 5F7DA 5DD3L 1BGXL 1P7KA 4PJXA 5T1DL 4WCYH 3FOMB 2BVQA 4WHYH 1UA6H 3MLSL 3VDAA 2CR6A 2XWBA 4LSTL 1ORQA 1CZ8L 3LN4A 5DGQA 3QJHB 4N0CA 3H3PL 3GIVB 4FP8H 2BNQD 4ONFH 1WFNA 4M6OL 4JZJB 3RI5F 5JXEC 5IB3A 1Y0LA 1ACZA 1QPPA 1T7YA 3IETA 4LCWD 3UBXG 2O93L 4FQCH 1GGIL 5KSBE 1ZANH 1DVFD 5FA4A 3WFHA 1JV5B 1NCBH 1YUHA 4J8RA 5CJOL 4EVNB 3H9SA 4IDJH 5IMLA 1UM5H 4N0FB 5HYSA 3H8NA 3U4EA 4UAOC 1KJ3L 4XMLL 3MZTA 3R8QA 3PE9A 2YEZA 3KVQA 4KDTC 1L4IA 4JQXC 1OTSC 4GW5B 4LQFL 1IAIM 5FHAH 2DWDB 3GM8A 1R5VB 4AMKL 2ZG2A 3ZDXF 1FG9C 4JRXE 1QKZL 2ESVD 1OGTA 4PJGE 1GGBL 1HXMB 4HMDA 1L7IH 3E0GA 3VXOA 1I1AC 2EDTA 3F5WB 1UC6A 3UTSE 5FGCB 3V7AE 3VCLA 2KUTA 4G8FA 1FYTD 1S7RA 1FQ9C 1A02N 2DRUA 1C12B 2AK4D 3DUSB 4QRPE 3WFDL 3RWGB 2WUBL 3OAYH 4HIEB 5DGRA 1F4HA 1GH7A 2FJHA 4YFEA 4XH2B 3KYMB 2NY5H 1J8KA 5SWSE 2APBA 2VQUA 4FXKA 4X6CA 3WCYA 1AP2A 3SJVB 5IB5B 4ZTOH 1MFDL 5CD3A 3KYKH 1IT9H 4GS7B 4U4BA 3I50L 4OAWB 2VLME 2YD8A 5F44A 4GT7A 1EXUA 4G80B 1JYXA 4WWKC 4JO3H 2XKUA 3UAJC 5BOPA 4HFUL 5IGXL 2IH3B 5ANMA 1UCBL 3KS0H 3PGDA 3MV01 1ZLWK 3VG0H 1KJ2H 2PYEB 4EUPA 5I8CB 2ICES 3DV4B 4LARH 1YEHH 1MRCL 3SDYL 1J1OH 3GMPB 3SDXA 6FABL 1NEUA 5F6IB 3GRWA 3EYOA 4ZQKA 3TWCH 1NUDA 3LIZL 4P57B 3HLAA 2E3VA 5DQDL 1NCAL 2O5XL 1R3KA 1AXSA 5EU6B 2X4PA 2CUMA 1MJJA 5E2WH 2B0SH 5IP4A 4KVNH 4M43H 1F6FB 4O2FB 2FGZA 4ZXBC 4F58L 4JM4H 1R3JB 4KRLB 3MACH 2HTLC 3KDMA 3LD8C 4Q97A 3GHEL 5LBSL 4C56A 4OGYL 4AEHL 1A3RH 1CVRA 2NLJB 4FNLH 2Z93A 3U9PL 3W5MA 1MQKH 1MY5A 4JM2A 1UJ3B 5HHMA 2Z31D 2Z35B 2JB6A 1XR8A 1TZIB 4ZNEA 2MCPH 3QDJD 2IADA 3PWUA 1KIRA 1Z3GL 3VJ6B 1MI5D 3DOSA 5ESVA 3ULVL 5E56A 2KDGA 4OV5B 1QR4A 3G6DL 4HPYL 2FLRT 2HFEA 5I1HH 1CIUA 3HCVB 1FJ1A 3TJEL 2H1PH 3F7RA 5LG1A 3AMLA 5CBEB 1INDH 2EDEA 4U1LA 3HHRB 3JWOH 3O9WD 5E1AB 3TJHA 1WWCA 2FO1A 4NQXB 1MCEA 2OI9A 4WUUE 5IT2L 1U93A 3TYGL 2R4RH 2CLRB 4M3KB 1IARB 1G6RH 2Z4QA 1N59B 3V5DA 1MJ8L 2QQLH 2OXGA 4OZGA 3T0EE 3HAEG 3MCKA 5EOQL 1D9KA 3UYRH 5F1IA 1B0RB 5E9DA 2IGFH 4MA7L 4ZUTB 2MKLC 2VR5A 2DQFA 3D85B 3P9MB 1R3LA 4S1QL 3QUKB 4ODVL 1TJGL 1QYGH 2CKBL 1VFAB 4DVBA 4QEGA 3NPSB 4P99A 1YC8A 2XWJA 3FFCB 4BKLB 4LSRL 4F15B 2DQDL 1O5DT 1FCCA 2VC2H 2AJVH 4H5SA 2I27N 5EBWA 5DJXA 3OKOB 3V8OA 4M62L 5E8OB 3FO9A 2A77L 3VWKC 5F96H 3TH3T 5DMIL 3V52H 2OMNA 2ZUSA 1D5BB 5B3NA 2BVYA 4HMCA 5CSGA 1OB1A 4YGVA 3PGCB 3EJYC 1N2RB 3BP4A 1NDMB 4JFEA 2X70B 5JW3H 2AJXH 3MV7B 4HC1A 5KZCD 4I48A 3FRPA 1QLEH 1XCQB 4ZOEA 2YD3A 3AS2A 4DVRH 4G8IB 4A2LA 3REVA 1H3PL 2EIEA 1RPQA 5GRWA 2BVPA 4U1NB 4MJ5A 3ILPA 5I71C 5D5MA 4GKSA 1CGSH 1SBSH 4XPGH 3ARPA 1SEQL 4NFDA 1JGEA 3GSQA 1LP9F 5DUMH 3S98A 3LVEA 3EFDL 2P8LB 4NO2B 1TVDA 1MHHB 1JWMA 2KKQA 4DTGH 5GS3A 3O3DB 3VRJA 2VLRB 3BEWB 5I1CL 4PPTA 1A0QL 3TBWB 4FRWA 4Y5YB 3JWDH 3D9AH 4JCMA 3K2UH 3QI9B 2CLVA 3Q2CA 4NM4L 2BNQE 4I3SL 1U58B 5JXAL 3L3HB 3UP1A 3P0YL 2J12B 3DRQA 5I66B 4LCWE 3PABB 4JN2A 3WLBB 5KSVA 1RUQH 4JGMA 2YHGA 2Q7YA 4L8CB 4X0KA 1FN4A 4XXCA 3DX9A 5B21A 3DBXA 5DS8A 2X1PA 4XCCL 5GGSA 4LLYB 1GC1L 1IEHA 1EAPB 1FC2D 5AAMA 3N50A 2WWMC 3VD5A 3LEYL 1C7SA 1Y6KR 1HH6B 4PG9A 4ZFOB 5MENE 1GC1C 5ICXA 4PP1D 3BHBB 3IDYB 3WHE0 3FO0L 1K8DB 1W0WA 1H3TA 3RKDC 2IAMB 2ESVE 4LAQH 1AKJB 3RGHA 4R4FL 3OXRA 1Y0LB 4KKLC 3NZHH 1WLHA 3KJ4C 4UDUB 3S37X 1RI8A 3O2DL 4N0CD 4TUJA 4Y5XC 3T0EC 1XF2B 5TQ0H 4KZDH 3KPRA 1BAFH 1FYTE 2APTA 5FA4B 3IDMA 1RULH 5EN2A 3PP3K 2WIMA 1XGRA 2ZUQC 3SDCA 5E4EB 1KCGC 3X14A 4G6KH 2MQ0A 4TNVK 1HHHA 3EFFB 3MCLL 3UC0H 4XCEB 3P4NA 1OAXH 1ZT4B 1RZ8A 2R0ZL 2H2SD 3IKKA 4JKLA 3H9SD 5SWQB 3TP4A 3DARA 2Q86A 2YRZA 5BRZA 1IAII 3L5JA 3PL6D 4Z77A 2E9WA 4D8PA 2XY2A 3STBA 5C0JA 2PR4H 3QYCA 1P4LB 4KTEL 3FL7A 4LGSB 1X4ZA 2ZNWA 4BH8B 1YMHA 5SX5H 2VITA 4E41A 1BZ7B 3N1PC 3RWJA 2H3NA 3LCYA 3S3JA 1ZMYA 3BMVA 1QQDA 4N0YH 2AV1A 1VSCA 4LCCC 1P84K 3RZWA 4FQXB 2VB5A 2YPKB 3EYSL 3LQZB 2J8UA 2WY3A 3BXNB 4W68A 4FZ8L 3FN0H 4EN3B 2FIRT 1U2HA 2LU7A 5BZWA 3ZE2F 2E27L 4HLZG 4DGIH 3WO3B 4Y2DA 5FAAA 4QTIH 3X3GH 2R1WB 5JHDB 1YNKL 1Q0YL 1EXUB 4XNUH 1I7UA 1WITA 1FVEA 3B9KA 4PP8C 2AGJH 4OLXL 2YRPA 3U48A 3V0AC 2V5SA 2OR8A 4XT1C 3O11A 3H3BC 4F33A 4OF3A 2D3VA 1CGVA 4IS6B 1KCSL 1YPZE 5C6TL 4LSVH 4LVOC 4BZ2H 4Y5VB 3DTXB 1P2CA 3SGDH 3WUWB 1DQTA 5J06A 2VISB 2B1HL 3QDJE 1MI5E 4O9HH 4MX7A 2APVA 4RNRB 3VG9C 4YHOL 1ZA6B 1H3UA 2OTUA 1U9KA 1KJVA 5ACMA 5IIEA 1RU9L 1FZJB 2HWZL 1S7SA 1KFAH 3CU1A 3CX5K 4UINL 1NLDH 1ZLSH 1JGUH 3H0TA 1QFWH 4OZIA 1RFDH 1DVFC 2Z93B 4RFNC 1D6VH 5EIIA 4HT1H 3IXTA 5C0RH 5HHMB 4CL7A 4F9PC 2HVKA 3ARED 5ETUA 1OARH 4LRIC 5IEKA 2XN9B 4DEPB 5I1EL 4KPHL 3RDTD 1J0KA 3W11D 3ZKQD 2LVEA 4J1UA 4LVEA 1NBYB 4NRYA 2JELL 3RIFF 4JM2D 1WT5C 1JYNA 1FL3B 4PJ8B 5F97E 3IDUA 3UTTA 4O2CA 3MOAL 3VFNA 1F45A 4P46B 3VH8B 3MJ7A 3KPPB 1OW0A 1GRWA 4ODXB 4U1LB 3CSYB 3ZE0F 4KV5F 2AJYH 1NGWA 3VI3E 4K8RD 5I1IL 2RJMA 1SYVB 5JLZA 1M7IA 3LOWA 1WF5A 1HHKB 3SO3B 2ZJSL 5IF0B 4LLAA 3TJHD 1BHGA 3HMWL 3BD3A 4DK3A 4R97B 5DD6A 4J7RA 2VYRE 3O6FA 5E2UL 3MRLA 1UT9A 2HJLB 4L4JA 2WUCH 1AC0A 1FGVH 1INQA 2OL3B 4NUGL 4JG0H 4J2XA 1R3LB 5CP7B 2D7OA 1T2QL 1X5GA 4XNXL 1D9KD 5C09D 1S5HB 4APQD 4Z6AT 4K7PX 1MWAL 3KPQA 1MCJA 3L6FA 2VXQL 2VXUL 4FOMA 1ZLUK 5LVEA 4NZTH 3RZCC 1I8IB 2HH0L 4MWFA 3FN3A 3CXDH 3ZT6A 4Y4FA 3QB7C 1IKFL 1S7VA 4POUB 5IG7A 3RWEA 1GYAA 4KHXL 2FZ3A 1ZHNB 1YYMH 3DVNB 4MAYA 1G7PA 4NO3B 3SGJA 1FPTL 3H7BA 2YUVA 3PIQB 1HYSD 3ZSSA 4PUBH 1KIQA 2GUOA 5DMKB 4Y4HA 4Q6IC 5HHPA 4JO2L 4NQDA 3HR5A 3BYTA 4NGHL 5GSVB 3REVB 3VFUB 1ZGLB 4PY8J 3V6OE 3QDGA 1GZQA 5A1AA 2GITB 3VRLE 4E5XB 4F2MA 5DF0A 4JDZB 5CD5D 3B4NA 5IVXE 2P5WA 2Z31C 1NBZA 3PXHA 4FFYL 4N5UA 3ILPB 4UOW0 4JREB 5I30L 5JO5B 1CBVL 4UQ2A 1DN0B 3RU8L 1UXSA 2J4WH 2JLLA 5EIQA 1FNEB 1O7SA 4WU5A 3U46A 1I3GL 2IG2H 5ALCH 2NZIA 2IBGA 5D7IA 1TZGL 2XYCA 3GFUA 3Q6GL 1T7VA 3RGVA 3O9WC 1I1RA 5I1KH 3C60B 1AQDB 2W65A 3OKEA 1A8JH 5FKPA 1UKSA 4JPIA 4UQ3B 3LS4L 4PJXE 3C6LB 4HUXA 4RGND 3TZVC 4MNGE 1FL6A 3BSZH 3JV5A 2FJGB 4PB0H 3W9DB 4IDLA 3HZYA 3WS6C 2HYMA 5GRJL 5J12B 1QR1A 1QFUL 4I5BA 4PJHF 3JTSA 2XG5A 4WWID 1EA9C 1QLRA 2GTZA 2QR0B 2Q7YB 5D8JL 2JIXB 5ICYB 5GSRB 1T0MA 5DFVD 4NQSA 4HBQA 1X6LA 4LLVA 5C07D 2J88H 3QWOA 1Q94B 3RX5A 4PG9B 3H9SE 5CBAB 3OKNA 2UUDH 2WWKT 1A6UL 4NUJB 3K7UA 1CIDA 3QFJA 1RUAH 5I2IA 1ACYL 5CJXC 3CFBA 4U1KB 3C9NA 1IJ9A 4MJIA 3I9GL 1FVDB 3KPMA 3BMWA 2KPNA 4FQHA 3WD5L 1IC1A 2IBZY 4NZRL 1HXYA 2Z8VC 4HQQL 3WHXB 1DN2A 2EYSB 4OCWH 3GKWH 1I3RB 3S36L 2OZ4L 4Q74A 1HOCA 2ICWI 2DQGL 3MRRB 3QCTH 4G6JH 1OLLA 2DYPB 2CJUH 4YHZH 3MR9B 1XGRB 4I3RL 1V7MH 5CJ8A 1HHHB 1IM3A 4P2YA 3S4SG 1QLFA 1S7QA 5E6ZA 3VW3H 4J6RH 4OUUA 3QIBA 5EZOH 2E7MA 2ICEA 4MJ6A 3F7PC 3A67L 3SDCD 4NO5A 4Z77B 4G9DA 4JRYA 4M7LH 4OJFH 4ZTPL 3CX2A 4YXHL 3U79A 3WSQH 1NCDL 5DHVA 4YE4L 2JJSA 5D7JD 1TITA 3UTZB 1PYWA 5FYJD 2DI9A 3FCTB 4F37F 5BRZD 2VITB 4E41B 4FTVA 1RZFL 1RZGB 3TNMB 2ADIA 2NX5B 1QQDB 4JJ5A 2J1KA 4OCYL 1MHCB 2H9GB 4PBVC 5LGJA 1I1AB 3OL2A 4NNXB 5E1HB 2Q6WA 5DHYA 5ANME 3AVEA 2VXTL 1KPRA 2FB4H 1EV2E 5CSZB 4UDTA 3SDXE 1UXWB 3CZJA 3V6OC 1UCTA 3EYUH 2F54B 2H8PB 3V7AG 4JPKL 5GGVH 1GHFH 3L3GA 4XNQA 2WBWB 2WIIA 1ZHBA 4GLRH 3RX8A 3UPAA 1OD7A 3IS0X 4Y2DD 3UPCA 3O6KH 3O11B 1DQDL 3V4PH 3KPLA 4CJ1A 4UIKH 25C8L 2P48B 3A6CH 2OJEB 3MSPA 5T1KB 3AU1B 3VFWB 2JTDA 1BVLB 2GJZA 1OAQL 4U6TA 1J0YA 4C56E 3Q1SL 1HIMH 1PQZA 3T2QA 3AXLB 1LP9A 4GFTB 4JPWH 1WBZB 4KHTL 5DQ9A 4K3GA 5AYQA 3OB0K 2CMRH 3VFRA 3RVVD 1FNGB 4NSKA 3VFTB 4LBEA 4ZNEE 1CD9B 2DBLL 3BZFA 1I9JH 2X4QB 4HGWB 2EH7L 4N0CC 2E8ZA 2PF6A 3H0TB 3FO1A 2L4OA 4CVZB 4D94A 1NGPH 5HVHB 5JW5B 3LDBC 4AT6B 4H8WL 3W9EA 3ROOB 5C0AB 1PG7W 4NM8L 1X5ZA 1LD9B 3GSNH 4XI5C 1YY8A 2H2SC 4KQ3H 5T1LB 1MCHA 3QPXL 3O0RL 2X9WA 3MGAA 3NPZB 1BWWA 2BJML 4WHTB 2ADGB 5C71A 3PL6C 4NKDB 5EA0L 2QADB 3N85L 1RMFL 4F7EA 5F6HJ 5EC2A 1N6UA 1I1CA 3WFEH 4BH7B 5C09E 3BPNC 3NVQA 4J3OC 1T7WA 5TH2B 1LNUB 4OD1L 2P47B 3F58H 1C1EL 3DURA 3MLUH 5GGTA 5EWIH 2V2TA 2FHFA 4RA0C 2F5AL 1JF1A 1I9IL 1ZSDB 4LKCA 4ZOAA 4WTWA 4D3CH 5IB2B 2R8SL 2WV3A 1X44A 3I6LE 2DLTA 1KXVC 4QRSB 4H20H 3G6JA 4Y1AA 5EUKA 4BUHA 3BP7A 4MD0B 4LDOB 1S9VA 3ARGB 1HZHH 3HC3L 2AJSH 5EU3A 2AEWA 3D48R 5KSAB 1RY7B 3RY6A 5DWUL 5D7SL 4PGBA 2EYTA 3IB4A 4FQLL 2FGWH 1FFPA 5EPMA 4IRJB 4ZODA 2ED8A 1K4DA 4X4ZA 5KSUB 3QPQD 4UNUA 4N9GA 4TTDC 1MVUA 3M1BA 5DRZA 2V6HA 1G0XA 5DRNA 5E8DL 4U1MA 2DDQL 3CMOL 2Q87A 1KB9J 2MPAL 2I9LA 3QRGL 4YAQA 3B9VA 4GMTL 4Y4FD 3O3BA 2BNRD 4R9HA 5AZ2L 5EZIL 5D5ME 2NY0B 3CZFB 3G9AB 1DQLH 3MXVH 5I74C 4HUVA 4NZJA 5ADPL 3QQ4A 1FZMA 1WWBX 5C08D 1UH4A 5C0DA 4MAYD 2JJVA 4N5ED 4PV8A 4MMZC 3DRTA 3HAEH 1BFOB 3DXAA 3RNKB 1JZ8A 1JRHH 2SEBB 3AREC 5D71L 4RGNE 4Y4HD 1KJ2A 3BZEA 2MQ3A 3RDTC 4EOWL 3W11C 4NQDD 1QBML 3EHBD 2G2RA 4RRPG 3QDGD 3SGKA 1YY9D 4JM2C 2W9LA 5GIRB 2HTKC 1CD1A 2P5WD 4OM1L 5D6CA 3P4OB 3UMTA 3DPBA 1YECL 5ESQA 1DUYA 4EDXB 5A40E 1A1MB 3FO2A 3OWEA 4H1LG 5TDPA 1CE1L 3MREB 5T3XD 2BVEA 1UYWH 5GGUB 1NGXA 4JN1L 4PJ5A 5D7LD 1T1WA 1N64L 5DLML 3W2DH 4C58B 4Y19A 5C07E 1KC5L 2R2HA 4K8RC 5H35B 1ZVSA 2BOCB 4HXBL 3DNKA 4IRSA 1PW3A 4QHUB 1IFHL 1JZ7A 5CKAA 4ZUSA 5EU5B 3QHZL 3TJHC 1KOAA 4YHLL 2GW5A 5K9OA 1HILA 2OI9C 4LK4A 5MEOA 3HZYB 1LE9A 4FFWD 3M45A 1MCWM 1OF2A 3HB3D 5EBLA 4XC1H 3UEZA 3D0VA 5BXFA 3L3JA 2ZOKB 3GBML 3JTSB 4J3UA 5SX4H 1UEYA 3DVFA 4TULL 4NRXB 5MI0C 1MFCH 1D9KC 4NQSB 4APQC 1QEWB 4LLVB 5C92A 5KANG 4Q9BA 3L1OL 2DMKA 5DJAA 4L4TA 1FH5L 4GRLA 2CK0H 3IJHA 4YK4B 4B5EA 5DK2B 2R4SH 3PHQB 1IC7L 1K3ZA 4ZPVB 1LEKB 3U0WL 5F7LB 5GGVY 1LDPH 4X80H 1G7JA 5BRZE 4MJID 2OQJB 3B3IB 4L29B 1KJMB 2N1KA 1G6RA 3LZFL 4DFHA 1HYSC 4MD5A 3T0EB 2BSTB 4HH9B 5F71A 1IM9A 2VE6B 2XWTA 1TZHB 4OI9A 3UPRB 4GW1B 1S7QB 3ARDB 2ICCA 4HC1L 1IQDB 1UM6L 4J4PA 4PJAF 4TSCH 4W81A 2ZUQB 3O4LA 5HXMA 1KCVH 1HINH 5CD5C 4NO5B 1G1YA 1KCLA 4P4KA 1LO2H 2J8UE 4H0HB 3SCMC 4Z8FH 2W38A 4G7VL 3QIBD 3G5XA 3W5NA 2NW2A 3BP6B 3GUTB 1U8OB 5DO2D 2AAVA 4WTZG 4JRYD 2MJWA 2ADIB 4Q58C 4PBWD 4PRAA 2F5BL 3BE1H 4MXWH 3BIKA 3QG7L 3V7MA 1DJSA 5JOFB 2A73B 2EC9U 4GSDH 1G7HA 1TPXC 2N7BA 4MLIA 3V5KA 1PKQE 1X9QA 4TYUA 4XWGL 1M6OB 1EK3A 1E4WL 1A9BB 4Z7NF 1A7BA 3VMNA 5C6PB 3OJVC 3H9YA 4CN4A 2YWZA 1YNTA 1BOYA 4NN5C 5TGBA 2FEDD 3V9FA 3V2AR 1J8HD 4JPVH 3D3VD 3BZDA 4YDIL 3QUZA 4JKPL 4QY8A 1A4KA 2ZOLA 1PZ5B 3HNSH 4QRRB 4OLUL 2VDQL 5EORL 4DAGH 2C3HA 4X5WA 1K85A 3ARXA 3FOLA 2Y5TA 4DQOH 4F9LA 5K9JL 4NP4H 4NT6B 2GJZB 1D5XB 4XHJD 3ARUA 3MRDA 4HK3J 4L9LC 5DFVC 5DURB 3QNZB 3LEXA 4KQ4L 4Z78B 4OZIE 1ZHLB 5CMAB 3MRMB 5EO9B 4P9HL 2IFGA 2WQRA 3QEGL 4P9HC 2Y5EA 2A6JB 2CIIA 2KZWA 3T04D 5CEXB 4A2MA 3EO0A 4DUWA 1NCNA 1KULA 5EBGA 2HVJA 5J8OA 1RJCA 5KOVC 3BH8A 1E6JH 5HGBA 4M9PA 2CXKA 4NIKB 2QEJA 3QNXA 1ZGLP 1BX2B 5IFAH 3PWJA 4PGEA 4HLZH 1EX0A 4NKMA 3MV9D 5C0BD 5DUPH 3CVHH 4R7DA 5J57B 3F7VA 3PP4L 1SEBB 4GXUN 4RFNB 1DBBH 2AEQL 4MB4A 3U7WL 5D9SB 2MSPA 2YBRA 1RZIB 2DQIH 4M1GL 1CF8L 4NKIL 5JUEL 3QO1A 1RURL 3ZTNL 1FIEA 1F6AA 1YJDC 1UWGH 5CUSH 5FA3A 1QFHA 5D7JC 2ATKA 3CJJA 1X5LA 2VDNL 2ESVB 4CU7A 3SDDA 1RUML 2X1QA 5F9DC 3AROA 3P73B 1G84A 1BZ9A 3QG6A 4TUKL 1FLTX 2VUYA 3BKMH 1EHLH 4JDTH 1O7VA 1MREL 3STLA 1N5AB 2HKHL 4C55A 2H32B 2YR3A 1FYTB 3ZDXE 1VGKA 3RL1B 1MLCB 2AK4B 5DUBB 4ZFZA 3L3DB 4P0DA 4QXUH 4K07A 3HZKA 4Y1AB 4OCMC 3BP7B 3HC4L 2BNRE 1R5WA 4PJBF 4WFGD 1IGFH 5BMFH 3FMGL 4M1CD 2F8OA 4HCRH 4L3CB 5EU3B 3L7EB 1BLNA 4Y2DC 3MRJB 1JFQH 1JHTB 1M7DA 3I2CH 3QO0A 5C08E 4XBGB 3BISA 5E99L 4PGBB 1JUFB 3MLZH 3OF6A 3QIUA 1NC4A 3TIEA 3I6GA 2VABB 4EI5B 3QA3B 5GPRA 3LB6D 5CJQL 1BQLH 3BKYL 4YDKL 1AY1L 3DMMA 3MMEA 4PRHA 1MVUB 5CLWA 5DR5H 3WIIH 1HSAB 1CGXA 4MA8L 4LCUB 1P1ZA 3QH3A 4NQDE 3RZCB 4MQXD 3TV3H 1CLOH 3CAFA 3QDGE 2O61B 4S11A 2P5WE 3RVVC 4AIZA 5DEFB 4NKQB 4Z5RB 4XVTL 3RI5K 5D72H 5SV4A 2I60L 4HUVB 5T3XE 1N8ZA 5D7LE 3ARFB 3LMJL 5TE6H 3UJIL 3UX9B 1DLHB 3VGBA 4NJAL 5D93C 3NTCH 2DN7A 3ROLB 3GJEA 5JR1L 3RHWF 1JWSA 3SKOB 3DXAB 2ZP0T 1AGBB 1KF9B 2OLDA 1Q8MA 4OZHF 4Q6IB 5GRZA 4LP4A 5HYJA 3MRHA 1QRNA 4WGWB 3I02B 3MLSH 2XQYG 4C83A 3JV0A 1FO0B 4HK3N 2P5EA 2Z31B 4UT9L 5CILH 1PY4A 3ZDZF 1DUYB 3H3PH 3HKFA 1P7HL 4KRNA 5E2JA 3MXWL 3NZ8B 2G75B 3QISA 3BD4A 1CR9L 1IL1B 1T1WB 2DTSA 2NTFA 1MHPH 1S8DB 3RNQA 3X12A 3FT2A 4R0LC 3IRZA 1P7QD 1OW0C 4KRPD 4PJ5D 4LLDB 5CJOH 2FATH 3VA2C 3IT8D 3CXHK 4NFBA 3MUY1 1BQHA 2AV7B 4WUKH 4HKJB 3BQUB 4XMLH 5MEOB 4IRSD 3PQYA 3HI5L 3OPZL 2HP4A 3C2SA 4DGYL 1JBJA 3F62A 2A6DB 3TZVB 2HLFD 3L3JB 5I15L 1G7MA 1W8OA 4LVHC 4MJIE 3QXDB 2IWGA 2NY2D 3ABZA 3BVNB 1B4JH 5FFLA 3HZVA 4PRDA 5L7XL 4S1SH 4HG4J 5DD5L 5DZNA 5HHOB 4JANB 5J6HB 2EIDA 1PLGH 5DVNA 4ONGH 3RJQB 1IILE 1QP1A 4M6NH 1QG3A 3QPQC 4JVPA 3WJLA 4L4TD 1KCRL 4HWBA 4Y16B 4FQQA 4YBLC 2X4OA 4GRLD 2BXYA 2OR9L 2A6IA 1ZXQA 1DFBH 4FMKA 4Y4FC 2W60B 4JRYE 3CUPA 2GHWB 2MWCA 3QUXD 3I50H 5HVWA 1EEYA 3C6SB 2XA8L 2PW2A 3QUMH 4YHNA 1IM9B 1IC5H 4WW2A 3UO1H 2X44D 4JO4H 2HA1A 5SV3A 3SPVB 3JSSA 4NN6B 3GSRA 4MAYC 5DVKA 4N5EC 3X11A 3SGJC 3ETBF 4QHKJ 3GEWB 1XIWB 3TA3A 1Q72L 3ALWA 3WNKA 2OS7A 1EJ6A 4AJ0A 1T03L 1ZEAH 1IBGL 4P4KB 3GI9L 3BJLA 4Y4HC 4PJDA 2BDNH 4J4PD 1J8HE 1DANT 3D3VE 3G5XB 3S96A 2CRYA 2D0HA 3O4LD 1YY9C 2QL1A 1LO0L 3V0WL 1Q1JL 2C3VA 2VQTA 1HK6A 1MH5B 5T3XL 1V5JA 4GUPB 2X42A 1AHWA 1JTTA 4Q0XH 4XP4H 1FFRA 2BRRL 3CFJA 1JPSH 4WEBL 3LHPH 2W0LA 3VXQB 1GZPA 5ALBH 3BIAX 1TETH 5LBSH 4XPAL 4MB3A 4M5ZL 3MRIB 4AEHH 1MCKA 4IIQA 5EZJB 3U9PH 1VENA 4PJEB 1YNTB 1SYSB 3KJ6L 3S37H 5KN5B 1LP9E 4MA3A 5EFIA 4LASH 5C2UB 4QHNB 3AY4C 4O51A 5ID0B 4FFWC 2DMCA 2NMSA 4QXWA 3HB3C 4P2RA 4I0KA 4EUPG 4L8SA 4KXZI 3ULVH 4UV4L 3MQIA 5IFJB 3PXJA 5CCKH 3R1GH 4L8BA 4ELMF 3MRDB 1A3LL 3MV9E 2FO4B 5C0BE 1A7RL 1T1YA 2ITCB 4FXGB 4K94C 2BHYA 1HH9A 3R0NA 4EEEA 1TQCB 5C0ND 4CVWA 3WUWG 3ZKND 2M8XA 3TN0A 3FQRB 4ODSH 4IMLB 1JGDA 5DMJB 4X5LA 4P59H 4WY7L 2Z92B 1D5MA 4Z7VA 1VESA 4TSBH 4ZUUA 1UVQA 4KMTH 2HVJB 5DJ8A 1ZOXA 5GQBA 3D39A 4MNGB 4HD9A 4HJGB 2CDEA 3UBXI 4HFWB 1T5XB 3MRFA 5KVGH 1HHJA 4C54A 4FN0A 3D2UD 1FBIL 1Q9KA 2F74A 2ZUUA 1TVBA 5LGHH 5GHWH 4X6EB 1MOEA 4U1GC 1WC7B 2FBOJ 3NA9H 5TFSL 4E0RA 3LDBB 5FF6A 4CU6A 3L9RA 2D7QA 3SQOH 3HUJA 3VU2A 3IYLW 1U3HA 4ZS7L 4WFGE 3QIBC 2VLJA 5F7KC 2ARJQ 4MDJA 4XC3H 3HI1A 4M62H 4YHIB 4ORZC 1BBDL 3PL6B 3EDKA 4H88H 3PNWA 3MRPB 5DMIH 1CDBA 4ERSL 2ZCLL 4ZFGL 2JJSC 4K3HA 2FRGP 3EOBB 5DK0B 3KG5A 5JQHC 1F4XL 2VDKH 3GMMB 3BPNB 1NUNB 4FFVD 4V1DB 1YMMA 4ONHA 1KBGL 2IJ0C 2NXZB 5EU4B 2UVFA 1HHIA 3HZKB 1R3HB 1H3PH 3IKCB 3MNVB 3OR7B 5I18H 4PGCA 1WIOA 3VD7A 3NABL 5DZLA 3TBVB 1M4KA 1ZHKA 3FQWA 5CHNA 35C8L 4YHKL 4QCIB 5F9WB 3HG1A 1SEQH 2BVOB 2V7NA 4OKVA 5A2JH 4LMQE 1S3KL 1PG7X 4S2SB 3ZL4L 4D0CB 4NQCD 1E4JA 1CFSB 1WICA 4XHJC 3S5LA 4PRHB 2Y36L 5BW7A 5TDNB 5CWSB 4LSUL 3QIUD 3OF6D 4CKVX 5TQ2L 1NC4D 1FHGA 1YEJH 5E7FA 2X7LA 2FNBA 1A0QH 5L9DH 1AO7D 5DT1H 3KPSA 3DMMD 4Z7WB 4R26H 3OKLB 3O3AB 3L5XL 1QBAA 4P5MA 4TOYL 1N8ZB 2VLLA 4YHMH 3VD9A 1YZZA 3FRPG 3MRNB 1EBAA 5I74B 1SJXA 1IAOA 1IQWH 1XR9B 3GSVA 4PJ5E 3I85A 5DJ0A 5IB1B 4XNZC 4TPRH 5DDHA 4ZOBA 4D0DB 5L8JB 4PV9A 5HI4D 3P11L 5TPWL 1PAMA 4C83B 2N56A 4OZFB 1CK0H 3G5VA 3LEYH 5KJRH 1YQ2A 3AREB 4FHBD 4LSPL 1NLBH 2VLKA 5HYJD 3JTCA 1OT1A 3Q6FA 1QRND 5IB4A 4WCYL 2BY3A 3QCUH 3ZKMD 4K7PH 1X5KA 3KYNA 2UY6A 2P5ED 1UA6L 1P84J 3OAZH 1G7IA 4HIXH 3BUYB 5DC0A 3OAYK 4FP8L 3VXUA 1S7UB 4ONFL 1JN6A 4AIOA 1I7TA 4YGAB 4C4KT 4OBRA 5GGTL 4HIHA 3DSFL 4L4TE 4FQCL 5CGTA 2VWEC 1TFHA 3MGTA 3AS3A 4YPGA 1F02I 2GQHA 1NCBL 4IDJL 1BJMA 1UM5L 3OR6B 3BI9X 4KTDH 3PQYD 4M1CC 3OKDB 3HZVB 1J0ZA 1KXTB 5IOPA 1A6TB 5GJSH 3GIZH 5MI0B 4FZEH 5I17B 4PRPA 4Z76A 1C08B 3LB6C 1T0PB 43C9B 4APQB 4O2EA 1S9WB 1L7IL 1ITCA 1RHHA 1U8QB 3WHE1 3NOIA 4H1LH 1JPFB 4NYLA 4XP1H 4ELKA 1W0VA 3MRBA 4MQXC 3O4LE 2XFXB 1FG2A 4FQQB 3UJJH 3P9LB 1LE5A 3RUGA 3T4YA 4ODBD 3TVMD 3G6AA 4KJYA 4A6YB 2E27H 5JW4N 4KUZH 1W72A 1MJ7H 5D96C 1Q0YH 3MUHL 5D6DC 4PR5A 4GKZB 4EXPX 2PYFA 1I1FB 3GSRB 3TBSA 2NY5C 1U8JB 4ZTOL 4K2UH 3KYKL 1IT9L 1RZKH 3LKQA 3MRGA 1N3NA 1AGDB 1DTUA 2G5BA 4B7IA 5DD0L 1DQJA 3OGOE 4QNPF 1C16B 3EZJB 2H26B 2VRAA 4PJDB 3TBTA 5E8PB 1R5IA 4JO3L 4HUKB 3TA3D 3RIFK 3VG0L 1KJ2L 1EHNA 1YEKH 4LARL 1YEHL 3BT2H 1J1OL 5I75C 3SCMB 2YD9A 4OZ4A 3OHXA 1OPGH 1X5XA 3D69B 1RU9H 2HWZH 4NQEA 2NY3B 3CH1A 1TCRA 4UINH 5DYOA 3U0PB 2P1YA 1DBKH 3FQTB 1WUNT 5ACZA 1CG9B 1IRAY 4ZPTA 4M43L 1FFQA 2EIZA 3RWIA 2XNAA 4KRPC 3FQXB 4PRBA 1TPXB 2A83A 5HGAB 3RWCB 4JM4L 1Z6JT 4G5ZH 2V7HA 4MA3B 5EUOF 4AENB 3MACL 4YJZL 1I8KB 2VQ1B 1IAKB 3B6SB 1FNSH 5IQ7H 4PLJD 3ULVF 3QAZB 4FNLL 3P30L 2HLFC 1MQKL 2BMKB 3VFOB 3MOAH 2EDLA 2NY2C 5KSBF 2W07A 1SM3H 3K1KC 2CRMA 5FXCH 1J10A 2W91A 1KG0B 5CIPA 4P2RD 2MCPL 1MCPH 4ZDHB 2XY1A 1OCWH 1JIBA 4NC2B 4Z7UB 5I1AB 4L9LB 1SVCP 4ZNCD 3U4AA 5I1HL 5EOTB 3GHBH 2H1PL 2JJUA 3PGFH 1SY6A 1WBYB 2IQ9L 2PO6A 3JWOL 4KC3B 1NJ9B 2V2XB 5DQJB 3JWOC 4ZO6A 1DDHA 3QUXC 3GGWA 3IAGC 2R4RL 1CGWA 4GRWB 5K9KA 4LFHD 4BYHA 3UTPD 1JHLH 5F21B 5IEHB 1G6RL 2ID5A 2QQLL 2X1OA 4MQ7A 4QRTA 1HKFA 3EOAB 4ZMAT 3I75A 1U8IA 3UYRL 3L9RB 4Q2ZA 3QRFM 2IGFL 2WZPD 5HGGS 3GSWA 3V4VH 2ZUVA 3CFKA 4J4PC 5D7KD 3OGCA 1GGCH 1QYGL 3VXRB 2OSLB 4KK5D 3OAUH 2X89A 1WTGT 4MAUH 1U3HD 3ARYA 1DZBA 5FDWA 1B88A 4U6XA 3RIAF 2VC2L 5D7JB 2AJVL 1YEFL 4P5TD 4NQCE 1SJHA 2R2EA 5IKCB 1FRGH 1FPTH 3EYFA 4NO0B 1YMMB 3F7QA 4G6FD 4RMTA 4OSUH 2JJWA 3DYPA 5F96L 3V52L 1LK2B 1QNZH 2APFA 3O8XB 1A1OB 2YRLA 4HS8H 1AO7E 4RWYH 1LEGA 5EO1B 4NNYA 5JW3L 2A9NL 1JZ4A 2AJXL 4JHBA 2VAJA 4I3GA 5JORA 1D7FA 1NFDB 1UB6A 4XXDA 2C5DC 3L3KA 4HUMB 5CHNB 1ZVYA 1CBVH 4Z0XA 1QBLH 4JKWA 3S5LB 5JNYB 2PW1B 2MQCA 3HG1D 2QKIB 1R24A 3Q6GH 3QIWA 1SBSL 5C0NC 4XPGL 5DD1H 4IMKA 3EO9H 4U0RB 5DUML 3RPIB 4G59A 3KPSB 1ZWIA 3JV6B 3U2SB 4BQ8A 1OVZA 4NHUA 1PKQB 5HYJE 1QRNE 3ES6B 4HGMA 1MHEB 4HWEH 4DTGL 1P9MA 4YDJA 2NR6D 4GQ9H 3TFKA 1TMCA 1T5WA 1FNLA 2P5EE 4P5KA 1UZ6F 3ZHLA 1P69B 5IMKA 3JWDL 5EZLB 4YHYC 5IHZB 3D9AL 1X4XA 3K2UL 2E7CA 5ERWA 5KS9F 1QFUH 3OJ2C 3JWDC 4JFDB 3ECBA 1UENA 5ISZD 2X4NA 4YR6B 4PV9B 3H9HA 3RTQC 3T09A 4HMEA 4BSJA 3G5VB 3FONB 1V3KA 5L6YH 1CLZH 2AABH 3FZUD 2DQEH 4UOW1 1J05A 1RUQL 5E5MA 5DFTA 5F1KC 4QF1B 5LAXB 1TENA 4X7TB 1KT2A 3PQYE 5C0CB 1UG9A 4NC1E 5CSBA 4F37K 3GMLB 1G7IB 4XRCB 1S9YA 1TLKA 3VGFA 2VLKD 1BVZA 5J13B 2AEPH 4WNQA 5FK9B 1QUNA 4JFQB 3GK8H 3QFDA 4LAQL 3GM0A 4POZD 5CEYB 3NFNB 3NZHL 4AK1A 3MYJA 1T0NA 3DGCR 4R0LB 5TQ0L 3VXUD 4KZDL 2QQKH 3NAAL 1XGQA 1RULL 3VFVB 3FN9A 4K3DH 4YXHH 1CTNA 3B9EA 4G6KL 5GS1A 4PP2B 1NCDH 2XT1B 1H15A 3UC0L 1X5HA 3EOTH 1MAKA 3O81A 2XZCL 5IOPB 4YBHA 3DX7A 1CQYA 4NQVB 2OXHA 1T1XA 4B50A 5BJTB 1U8PA 3EBAA 1G6VK 2HJKB 2PR4L 4M61A 4UT6H 4OD2B 3QIUC 1ZT7A 4M7JH 5HGDB 4HZLA 2DIJA 4HIJA 2KBGA 4HIIB 1KXQE 3KR3H 4JQVC 1EO8H 4N0YL 3DMMC 1HWHB 3C5ZC 5FUOL 2AJZA 1NGYA 1W72B 5DI8A 1FV1A 4JB9H 4PR5B 5DFWH 4LLUA 3VXTA 4PTTB 3FN0L 2BNRB 3NH7H 2PYFB 1ND0A 4G3YL 1RD6A 1DQDH 4DGIL 1N3NB 3MRGB 4UNTA 2YD7A 5GISH 1S5IL 4QTIL 3RY4A 3X3GL 2W9DL 3D0LB 4HCRA 1MCFA 4XNUL 1CXEA 3KWWA 1DBJH 4JY6B 5C08B 3K4AA 4RQQB 2AGJL 5ITFA 3BWAA 4FQ2H 5HI4C 4DGVH 2MOVA 1A6PA 4G9FD 1PKOA 1IGCH 1UEMA 5C86A 4ZSOE 1BF8A 1EVTC 4LSVL 3W0WB 4RMUA 4BZ2L 3IVKB 3ZKMC 1WAAF 4UUJB 4ZAKB 5HI5D 4P2RE 4JFFB 1FNFA 3DLQR 4HUUB 5K59F 4O9HL 3NCJH 3OJDA 4ORGB 3QXVA 3WDIA 2XNAB 3MBEA 1MAMH 1T22A 1NC2A 4X6DF 2Y4SA 1KFAL 2DJUA 1HSBB 5EIVA 4NBYB 5JHLH 5F8QC 1ZLSL 2R0WH 2X09A 1JGUL 5DZOA 3DV6B 1QFWL 1RFDL 3OXSA 3GSXA 5F7EH 4WFED 1D6VL 4HT1L 1WTLA 4Z7VE 5C0RL 1N0LA 4XAWL 3CVIH 4RAUB 4DKDC 5EA0H 5GRVL 3JZ7A 4NC1C 1OARL 3N85H 4NCC2 5DJ6A 3D39E 3UTPE 1GAFH 1I1YB 5EULV 5BZDB 4K7FB 3MLPA 3QUMA 4JKMA 3G5YB 1B90A 2JCCF 2FIKB 3T2NH 2Q8BH 1MFEH 2WAHA 4PJ9D 1MCRA 4GMSH 1I9IH 2YS4A 5D7KE 1NMBH 4LCYB 2ZWLT 1FC1A 3L5IA 1FVCA 3LQMA 2CH8A 5FECA 1H3VA 3TVMC 1XGUA 2HT4D 5ABDE 5HSFA 4HWBL 3P4MB 4RA3A 3GGWB 3WJLC 5FO9A 2PO6D 4KGLA 1FORH 3K0WA 1QFOA 3EGSA 1NDGB 3W82A 5BQ7A 1SJEB 4GG8B 1BZQK 1WK0A 4ODWA 4MQ7B 3ERYA 1EMTH 1DCLA 3GBNH 2ARJA 2WUCL 1MFBH 2A2QT 1FGVL 4WW2C 1TQBB 3FJTA 4OLYL 3MA9L 4RBPK 4UU9A 3GSWB 4P48A 2ADJB 3CFKB 3UXFA 5CINH 3GRWH 5DSCA 4I4WB 1G9MH 3TA3C 4I9WD 5E8DH 5BVPH 4R96A 2DDQH 4CW1A 2MPAH 2ITDA 4NZTL 4YIQB 3W81A 2L0DA 1U36A 1L0QA 3CXDL 2EZ0D 4JLRA 3V8CA 5IFHH 2VAAA 3IFOA 2R2EB 5EZIH 3F8UB 3GZKA 5FYLH 1YPZF 4JFXB 5ADPH 3HG1E 1AHWC 3FRUB 3H9ZA 4LU5H 3U83A 4P2QA 5H2BB 1RZJH 5D1ZA 4G6AD 4LF3B 4WV1A 1NCTA 1Q38A 4HHAB 1A21A 4PUBL 3WO4C 4LDLB 3ARQA 4IIQC 4EBQH 1QBMH 4GG6F 2NY6B 4X7SH 3S9DB 1XF5B 1FFOB 1U91B 4YDVA 2EXWD 2BERA 5GRUH 1F8TH 1YA5A 3JTTB 2P8MB 1DP0A 4P3DB 5L2KD 3U9UA 2DS4A 3NMEA 1EPFA 1FLRH 3L3OB 3BPOC 4L8SC 5JDJA 5ISZE 3BAEL 3LKNA 5HYQA 5KW9L 2UUDK 1N64H 4FABH 5HDBF 5DLMH 5ESAB 1IKNC 4PREA 3IU3B 1AE6L 5IV2A 3DIFB 2WBJA 1AI1L 2IG2L 1I9RH 4JZNA 5ALCL 2VDPL 3MGOA 3QXAA 1IFHH 3QIWD 4C57C 4TUOB 2DQHL 3LS5H 5I8KH 1RQ5A 4F7MA 3LPGA 3IF1A 2VLKE 4N0UA 3MROB 5LGKA 4U1JA 2CR3A 1TTUA 1FL5B 5J9PA 2BNUB 3HNVH 3D25A 1A7OH 1BIHA 3N0PB 1L0XA 2J6EH 1X7QA 3BSZL 3C2AH 4PB0L 3S4SA 4JGJA 2JK5B 2O5YH 2YN5A 4JVUA 2ICWB 2BVTA 3VXUE 3VXSA 1T21A 4BA8A 4HJJH 3L1OH 3QCVL 1WZMA 4J3XA 5INCB 5IW1A 4XNZB 1MCIA 5FCUL 5E8EA 5JIIA 1AC6A 4PIRF 2K7PA 3VFPB 4MHHI 2J88L 5E6IA 4KK5C 3MJ8A 4XZUA 4CMHB 2XPGA 3MJ6A 4MSWB 3V6ZA 2MTPA 5C0FB 3EUUA 2R1YB 1RUAL 1A6ZA 4P5TC 4YFDB 3MX0A 5LWYH 3LZFH 4Q9QL 5I0DA 4F80A 2J2ZA 4KUCF 3GKWL 4OCWL 1A9EA 4HC1H 5D2LA 4ZUVB 2FWOB 1TVHA 3GMNA 5FO8A 3D1MC 1FE8L 3QCTL 4LEXH 3CH8A 4WO4A 2OM5A 1T04A 4YHZL 4PRIA 1URLA 5DVMA 1IGML 4O58H 4PGJA 4QRQB 4RSVA 1H15B 4G7VH 3RUGE 2IALB 5D1QB 3VW3L 2YMXH 4J6RL 3OX8A 4D9LL 1ORSB 1D6EA 4M7LL 3WSQL 1HDMB 3NACH 3BEVA 2IQAB 5I76A 2I07A 5IVXF 1OP3K 3E1F1 2NYYD 5IVNA 3UZVB 2COQA 1OWWA 4G9FE 4PJIB 3SY0A 2FR4A 3MRKB 1E4WH 1HEZA 2PXYD 3MA7A 1ITBB 5F88A 1D5ZA 3LKSA 3BZ4A 2FB4L 4WI4A 2X4UB 3BYYA 5IR1B 3VGHA 4EXKA 2F8VA 4YDLB 4WENB 4YO0B 5I1DA 3J7HA 5D96B 3EYUL 3C5JB 3HFMH 3KYOB 4YBQD 1CICB 4HJ0D 1RJZB 1GHFL 5H94A 3DO7B 1X5YA 3PJSA 1Q9LB 4X6FB 5C0EA 2BOBA 1NGQH 4F3FA 2FSEA 3O6KL 5E8NB 1RIUH 1BIIB 1G9EA 3V4PL 1JWUB 3FZUC 4UIKL 3A6CL 3O45B 3VD4A 4WFEE 4HK0B 1NUFA 5B8CC 4LSSH 1KPUA 3CDCA 2GI7A 1F6LL 1HIML 5DVOA 1VEPA 2VDMH 1ZT1B 5E00A 2C4FT 2R23B 1RK1B 1DE4A 3CFIC 1FFNA 2QHRH 5SWZB 5KG9A 3PWPA 4PGDA 3ARSA 2CMRL 3MBEB 4UI2A 4AM0A 1UJTA 1U8MB 2BY2A 4HBCH 4NDMB 1I9JL 1QO3A 4YEFA 1NH6A 1P7QB 4KRPB 3U7WH 1NC2D 5INDA 3B5TA 3I6KB 2RIKA 5KS9A 1PY9A 2ZSWA 2EDXA 3HE6A 4M1GH 3K74B 4P4RA 2PCPB 4Y4KB 2GJ6D 1H8SA 2DQTH 1CD0A 4ZS6D 4HWZA 1AFVH 3KPOA 3GSNL 5DJ6B 3Q3GA 4OQ1A 3OSKA 3O3EB 4KQ3L 1A2YA 4LHQB 4M48H 1XGPB 4WDIB 1AIFA 4FA8A 4RAHA 5HDLA 4WU7B 4RAVB 3KXFB 4XGZA 2BCKA 3QEHB 1RJYA 4GRMA 3IDJA 5B38A 5E2VH 2DWEB 3WFEL 2GIYA 4D0BB 3MFFB 2N4IA 1WQVT 1U92A 3KLAB 4I9WE 5GJTH 1HNFA 4X6CF 3F58L 4AEEA 3L7FB 3KLHD 5EWIL 2XZQH 2Y07H 1MEXH 5IROA 5CKGA 4BQ9A 2AJ3B 4ENED 4F7TB 2OJZL 4L4VA 4X99A 4U1IA 1AR1D 1YEEH 4J3WA 1TJIH 4UTAH 5EO0A 5BVJB 4ZFFA 3CMGA 1EEUA 5GGRA 1JPGA 3N1MC 5D1XD 3IFLH 1HZHL 3JBG7 4WVRA 3WN5A 2RHEA 2AJSL 1MCSA 4W70A 4G8EA 4RRPA 5HPMB 3DX6B 1MRFH 1NAMB 4NOFA 5HY9B 4S0UC 4MS8D 5L0QC 2BY1A 4RFEB 3LSOB 5EC1A 2GSIB 4BQ6A 3MZGB 3H6JA 4H1LA 4OFYA 4LKXB 1DUZA 3LKRA 5E94B 5CEZH 5L2KE 3MO1B 4L3EA 3CXHJ 3X13B 3LMJH 3UJIH 4ODTH 2LU3A 2E6QA 1CXHA 3W39A 2EE9A 2Y7QB 4X7CC 1IZJA 3WS3A 5D1ZB 3CFDA 1EJOH 4X98B 1QSFB 1DQLL 4XP6H 2FYYA 5I1LB 2F53D 3U0TB 2P24A 5FO7A 5EBMA 4P2QD 2YA2A 4HH8A 4U6YA 3T8XA 3TO4B 4CN1A 3SBWA 4OM0H 1IMHC 4FFEX 4CN6A 2YD1A 1K2DB 1MUJA 2EXYD 1JRHL 4UT9H 4F7CA 4Z7OF 5A2LH 3BDYL 5A2KH 3L5WB 3FOMA 4K71C 4GBXC 3BN9C 1U8KB 3TT3H 2CRZA 3QJFB 3QJHA 5T5FL 2WK2A 3GIVA 1CDUA 5TE7H 4DKAA 2H41A 1ZLWH 4JZJA 4PJ9C 1UYWL 3OB8A 1OL0A 5HHQB 3ZDYE 1MVFA 2R69H 5AZEH 5JPNB 2WBJD 3HI5H 1SY6L 3OPZH 2HT4C 4ELME 4OZGF 2F15A 1JV5A 3SDAD 2PO6C 3ZE1E 4EVNA 4N0FA 4URTB 2ZCKH 1E27B 3S35X 4GW5A 1H3XA 1T20B 4XC1L 2DWDA 1R5VA 3D2UB 2A9ML 1EEZB 3B8SA 3UTQB 4BQCA 4WTXA 3RTQB 3ULVD 2EYRB 4XCYA 3LN5B 2IMMA 1MFCL 2E6PA 1I4FB 3F5WA 4MVBD 1IEBB 4WTZA 1PG7H 3WNNA 3EZ8A 4M9OA 1C12A 2EZ0C 4PJHB 3DUSA 3RWGA 1BP3B 4GXUM 2R4SL 5E6ID 5E5UB 4F57H 5DJZB 1TDQA 2XA8H 4XH2A 3KYMA 3MRCB 1Q9OB 2DB8A 3CK0H 1LDPL 1QHOA 4X80L 5D2LB 4MXVE 1C5BL 3SJVA 5FO8B 3VFMB 5IB5A 3GMQB 5TDOA 4G6AC 4X6BB 4OCRH 4OAWA 4R2GB 4NNPH 1T1ZB 4RDQG 4G80A 3DYOA 2AXFB 5GGSY 2APWA 1HQRB 3DUUA 4R4BB 5E2TH 2IH3A 1WZLA 4TSCL 5FDYA 3EJZD 2PYEA 3HC0A 4PRID 3DV4A 5I8CA 3QUYA 4KI1A 1S9XB 1HINL 1CTOA 3GMPA 5IJKA 2EXWC 1LO2L 3RWFB 3FFDB 4Z8FL 3INUH 2GK0A 4P57A 2C1OB 2V17H 5I76B 2I07B 3GMRB 4XPFH 3QDMB 4NQCB 2CPCA 4XPAH 3BE1L 4LQ1A 3QIWC 4CADB 4MXWL 4IMKC 3MC0A 3U36B 4GSDL 4GAYB 1R3JA 2LAAA 4DFIA 4OQTA 3RWDB 1AO7B 3Q5OA 4OIIH 4KH2A 1CYGA 3C5ZB 2EDFA 5IW6A 2DD8H 2NLJA 2VKXA 4G8GD 5GZND 1OGAB 1B0WA 1WBXB 1UJ3A 1ZGLM 3QXUA 3PJSB 4JPVL 2Z35A 1TZIA 2BOBB 3T65B 4YFLF 4AL8H 3VJ6A 4DAGL 3HPLB 1K8IB 4XX1G 2OTPA 2YD5A 12E8H 4P23A 2CIKB 4DQOL 4OV5A 4NP4L 4M7KH 4WY7H 3TPUE 3HCVA 5CBEA 1A7QL 1AD0B 1NCUA 1DE4B 5E1AA 2ICWJ 4NQXA 1YN7B 3KNBB 3ORJA 2F8XC 1BF2A 4V2BA 4I13B 3VWJD 4S10A 4KK9D 1QO3B 3RVXD 3WEXB 2CLRA 3PWPD 4HV8B 4GH7B 3B5GA 3I3BA 2MCG1 1LMKA 5M94B 5DK3A 4ALAH 8CGTA 1E6JL 3LKPB 4JDVB 5KBNC 2YKLH 5IFAL 3FB5A 4PTUB 1B0RA 4P4RB 1KYOK 1C5CH 5DUPL 4ZUTA 3D85A 3P9MA 1BFTA 3QUKA 2ZG1A 5DJDA 1DBBL 2R39A 5AAWA 2ZG3A 3HE6D 1MIMH 5DHVH 2YPLB 1RV6X 4XCFH 4HAGA 1AQKH 2DQIL 3FFCA 4BKLA 5GS1C 4ERSH 5F1NB 3TCLB 2YXFA 1C8PA 1UWGL 1I85C 3ZMRA 5CUSL 4DZ8B 5DRXB 5HD8D 3RVUD 5C9KA 1SMOA 3OKOA 3WE6B 1L9MA 4MNQB 4PY7B 2NYYC 3O2WH 4EDWL 4LFHG 5GGQH 1D5BA 3BKML 1EHLL 4JDTL 2PXYC 3PGCA 3ZLQC 1N2RA 1NDMA 3PUCA 4R7NB 2CXGA 4IRZH 3MV7A 4HS6B 1GPOH 3TVMB 3U1SH 1XCQA 5C2BL 5F6HI 1MCWW 4QXUL 2HJFA 4G8IA 5E0QA 4YBQC 4HJ0C 4FQIH 1EUTA 3ZL4H 1IGFL 3ZTJG 4HCRL 3SOBL 1E4XH 4U1NA 2F53E 1JFQL 3BRGC 3I2CL 4LSUH 4P2QE 1WIUA 4NBZB 3RY5A 2X4TB 3E2HA 1NFKA 4LRNH 1V7NH 2P8LA 2VDRL 1BQLL 1MHHA 2EE6A 1IGJA 3WIIL 3QZWB 3WKMH 4DJMA 3TV3L 1CLOL 3O3DA 4JG1H 2VLRA 3BEWA 2E9JA 3TBWA 2XKNB 3UDWA 4Y5YA 4OFYD 3B83A 4OZIF 3CFDB 2HFTA 5LQBH 3PV6B 4L3ED 1AGFB 1HQ4B 1P5UA 2FYYB 2CDFB 1U58A 2R0KH 3L3HA 2P24B 1NANH 1BFSA 5EOCJ 1INEH 5DTFB 1EZVY 1WCBB 3P11H 5TPWH 5I66A 3NTCL 3PABA 3WLBA 5F3BA 4L8CA 4F7CB 3T77B 4MCYB 1BVKB 2ERJC 2EC9T 4OCSH 4ZS6C 3S5LG 2CSPA 2MHAB 4ZSOB 4N0UE 4LLYA 1EAPA 4CUCA 2D03H 3ZYOA 1HH6A 1W2KT 4ZFOA 1P4BH 3BHBA 5CILL 5EUOE 1K8DA 1AJ7H 2IAMA 3BPOB 1AKJA 1A6WH 4JFYB 3ULVE 1V3MA 3T0WA 4K3EH 4UDUA 5GGTH 3VXSE 3DSFH 4GAGH 3UYOD 1MHPL 4W4NA 1XF2A 2H32H 3TYFA 4CGTA 3HI6H 2V5YA 4OF7A 4JY5H 2DJ4A 3KLHC 1M05B 2FATL 4OB5H 1OSZB 4ENEC 1UADC 4WUKL 5H37G 3EFFA 1BD2D 4XCEA 1ZT4A 5MEND 5SWQA 3CFEA 4JHWH 2DF3A 5D2NC 5JPMB 5D1XC 1NGZB 3P0GB 4XPHH 4XCYB 2WM0A 3O4OB 1B4JL 4Y88A 1DEDA 4S1SL 1P4LA 4BH8A 1PLGL 3SE4C 4MS8C 1BZ7A 5IWLC 1JNHA 4PRIE 4I2XB 1NMCB 1CFNB 3VXNB 4ONGL 2NY1B 4M6NL 5JW4Q 3EDDA 1UKTA 4LPYA 4FQXA 1JL8A 2YPKA 3LQZA 3MBXH 4U1HB 3BXNA 3RRQA 3MOBH 4LHUA 4P5TB 2NZ9D 4EN3A 1T66D 1DFBL 1NCWL 5TDOB 4MXQA 4JAMB 3SO5A 1RHFA 3BGMB 4XB7A 5DD0H 2R1WA 5JHDA 1TTGA 1AGEB 3QUML 1IC5L 4PB9H 3SJVD 3D87B 3UO1L 3DUUB 1LEIB 4JO4L 1BWMA 1T7XA 4WV1C 3MLTB 1CFQA 3HC0B 3QUYB 3P40A 4QWWC 1CFTB 1ZEAL 2ZSVB 4IS6A 2HG5B 2QSQA 5J11B 3N1GC 5E5RB 1F11B 2HFFB 1FO0H 4G8GE 4LNVA 2GK0B 2BDNL 3E6HB 4Y5VA 4WJ5B 3DTXA 5D7IF 5I9QC 3WUWA 3PG2A 4I0PB 5CS7A 2VISA 4MQTB 4JFOB 1PDKA 4PJAB 4Q0XL 4XP4L 4H25B 4JCLA 4RNRA 1ZA6A 2D7TH 2D0FA 1JPSL 1ES0B 3LHPL 3KAAA 4QHLA 4QLRA 5EU6D 3T3PE 1FZJA 4PJFB 5ALBL 1TETL 2X1WL 3ZKXC 5I1GH 3QWRA 2WBJC 4BFIA 4V3EB 4X4YB 5IW6B 2UYLB 4BSVB 3MUGB 4IEFB 3P30H 3NCCB 1MCLA 3SDAC 4J3SA 3S37L 3MV8D 3VD3A 4NQUA 3QT2A 4LASL 3DX8B 5B22A 2XN9A 3F7YB 3L95B 3PWPE 4PDCE 3LPFA 3C08H 1UB5A 5L8KB 1NBYA 3UBXB 1UQSB 1FL3A 4PJ8A 4P23B 1K6QH 1NSNH 1FZKB 3WJJA 3IDGA 5CCKL 3R1GL 5ISZB 5C0GA 2EDDA 2OCFD 3ULVC 4PJ7B 2WANA 1UZ6E 4P46A 3VH8A 3WIHH 4R8WH 3KPPA 5L2JB 1KB5B 2RCSH 4MVBC 4ODXA 5DMGD 2IQ9H 4G42B 5KS9E 3RBSA 3CSYA 2FEEL 3VE0B 4NRZB 4ODSL 1J12A 3LV3B 2Q76B 5B8CB 3AB0B 1K4CB 1QSEA 3RIAK 4P59L 1SYVA 2WNGA 4GW4B 1EERB 1CU4L 5E6IC 4TSBL 1S7XB 1HHKA 1F58H 4KMTL 5IF0A 1J86A 3IDIB 3R0MA 2J6EA 2HJLA 3FB5B 4OFPA 1RJLB 1EEQA 1CL7H 3LH2H 1PSKH 1FGNH 5KVGL 2OL3A 3WV0A 5M7QA 1E6OH 3BIBX 3ME0A 5CP7A 5LGHL 5DJDB 5GHWL 3SKNB 5I1JL 3NA9L 1S5HA 3LRSB 3TBYB 3EJZC 4PJCA 2X4RB 4QRUB 1UACH 4YFLI 1TNNA 4XBPB 3SQOL 1I8IA 4KY1H 2PETA 2KL6A 4XWOD 1KEMH 5CGYD 2E7LA 1YEFH 4DOHE 5FYKH 4XC3L 2HLAB 2AXGB 2QHLA 2X40A 4H88L 4NWTH 1ZHNA 1EFQA 3DVNA 2VDKL 1GL4B 2A9NH 3M17B 4NO3A 1FZOB 3RPKA 4LDEB 2W9EH 3PIQA 4S1RL 2X4SB 4XPTH 1H5BC 5DJCB 5DMKA 4LPCA 1ED3A 3DHJA 3NN8B 3WL9B 4RMQA 2HJFB 1S7WA 4M6MH 1GOFA 2FL5B 3IFNH 4M02A 5GSVA 3VFUA 1XGYH 2Q3ZA 1ZGLA 3HE7D 3MV7D 5GZNC 2GITA 4KUCD 1WV7T 4E5XA 2P7TB 4WI8A 4JDZA 5I18L 4L3EE 1OD9A 4RX4A 5KAQG 5MERB 1KTDA 5JO5A 1JPTH 4U7SA 1DN0A 5JW4M 3E2HB 4LVNB 2IAND 3K2MC 1FNEA 2LE9A 3ZHKA 3GNMH 1XZ0B 4PJBB 4G9FB 1LO3H 1IGJB 4RGMC 5C70A 1YEJL 5JIKA 5L9DL 3C60A 1AQDA 5DT1L 1MF2H 3DROB 1V05A 4R26L 4UQ3A 3VWJC 4KK9C 3C6LA 5C8JB 3RVXC 2VLRD 4YHML 4NKOA 2FJGA 3QULB 3OKKB 3W9DA 4PFEA 3QI9D 3M8OH 4HKXA 4IOFC 1WAAE 5F3BB 1IQWL 4RIRB 2QR0A 2J8HA 1F97A 1CVSC 5K59E 3FQUB 4TPRL 1XMWA 2JIXA 5ICYA 1FSKC 5GSRA 1U3YA 5I16B 1G9NH 1QACA 3HE6C 3MTRA 1CK0L 1BD2E 4KWUA 5AWNL 1Q94A 5KJRL 4X6DE 5CBAA 4HAFA 3HAEB 1NLBL 3TCXA 3WMSA 4NUJA 1NAKH 4K71B 4MA1B 4GBXB 3QCUL 4U1KA 3RVUC 5HD8C 4K7PL 4M7ZC 1FVDA 4OZHB 2YUWA 4RGOH 3S7GA 2Y9RT 4FQJH 3WHXA 3ZYIA 2EYSA 1K9TA 3TYFB 1DSFL 1I3RA 4HIXL 5HBBA 3K80A 1DBAH 1XF3B 3BOVA 4PJ9B 5JXEA 2D31B 3MRRA 2LVCA 3NAAH 4P3CL 4UB0H 2DYPA 3OG6B 2Y72A 3G6JF 4TRPH 3MR9A 4TVPL 2XTJB 4KAQH 5HDOA 5IK3B 3RP1A 4EIZC 5BS0A 5FGCE 3OB0H 2JCCE 2XZCH 1KENH 3CFEB 2W1NA 4CMMB 2ZUYA 4QT5B 4LLQB 3SGEH 4I18B 4KTDL 3T0BA 3NFSL 4JQXA 5C9JA 3SJVE 3UTZA 4E42B 5GJSL 3FCTA 2OMBA 1JNHB 1RZGA 3WN5C 3GIZL 3RX7A 4FZEL 3TNMA 2NX5A 1MHCA 2H9GA 5FUOH 4I1NB 1I1AA 4EKXA 4NNXA 1A64A 1P4IH 5IMMB 4XP1L 32C2B 3VGAB 2HAZA 4MCZB 5C3LD 3UJJL 2AQ2A 5CP3H 4LHUB 5CSZA 4G3YH 3RL2B 2C1PB 1UXWA 3UZEA 1T89C 4FQXD 4YNYB 4ZUWB 1S5IH 1N7ML 2F54A 4KUZL 4PLNC 2W9DH 1MJ7L 4BJLA 2H8PA 5B39B 1TNMA 5EU6E 3AM8C 4EN3D 5HJ3B 4MXQD 4D2NA 2ADFH 4NWUH 2ED7A 3ULUH 4HKZA 4K2UL 1CFQB 1RZKL 2K7QA 5JHDD 1N6VA 4WWKA 1U8HB 4OZFH 2OJEA 5T1KA 3AU1A 4GQPH 3VFWA 1BVLA 3MV8E 4YLQT 1ZV5A 2JJTC 4QXTB 1EFXB 1KELH 3GJFK 3SBWC 1YEKL 3HTLX 1N5YH 3CC5B 2GKIA 3AXLA 3GB7B 3BT2L 1WBZA 2P8PB 5L2KB 4HKBB 1FNGA 1J1PL 4QOKB 2JB5H 3VFTA 4QHLB 1OPGL 4GG6E 4DZBA 1VPOH 2X4QA 4HGWA 1JNJA 2GFBB 2YUXA 3HPJB 1TJHH 4BFIB 1DBKL 1BREA 5FYLD 3F12B 5FUZH 2NW3B 5FUCE 4CVZA 5JW5A 4AT6A 4XAWH 2UWEB 3ROOA 1A7PH 3QWRD 1SHMA 5C0AA 4ETYA 4G5ZL 5HDBE 4C56D 5KTEH 4LNRB 2IBZX 5IJVB 1LD9A 1F3DH 4X7DC 4Z95H 2Y6SD 1UB5B 1FNSL 4CNIB 5IQ7L 5T1LA 3U4BH 4IHOB 5HHMD 4LPWA 3G08B 1F3RB 2W59A 1HKLH 3QQ3A 2QJDA 4WHTA 3IDGB 2ADGA 5ACLA 5C0GB 2X10A 2XN9D 4NKDA 3WFBH 3UROR 1SM3L 3ARBB 4BH7A 1KTKE 1MCPL 4I77L 4PJ8D 3T1FA 1OCWL 2DIBA 4JFHD 2I9TB 1QSEB 5TH2A 1LNUA 4P46D 4DCQB 4HWBH 3QEUB 5BV7B 1UH3A 3OQ3B 3GHBL 5F7UA 2BC4A 2VZOA 3KPNB 3PGFL 1ZSDA 3DVIA 3T2PA 3S34H 4ELMB 5IB2A 2NZ9C 2E8YA 3IGAB 4QRSA 2D2OA 3GMOB 4OLYH 3MA9H 4MD0A 4M00A 3ARGA 4LIQH 3OKMB 1JHLL 1FIGH 4PD4K 2DIAA 1NFIB 1R3IL 5KSAA 2RFXB 3BPCB 4PJCB 5E9DD 5ADOH 5F9OH 3ISWA 3MV7E 3UYPA 3V4VL 1CDHA 4IRJA 3CVHB 5KSUA 1GGCL 1VHPA 1MCNA 1ZKAA 3CGTA 4P2OB 5IJKC 5JMRA 3OAUL 4KKNA 4MAUL 3I6LD 4NCDA 4MDIB 2IANE 2E7HA 2WSKA 1FRGL 3CZFA 3VGGA 3VWKA 2V5TA 1KTLB 1U95B 4OSUL 3NCFB 1ED3B 4KROB 1CXKA 2ORBH 1QNZL 1IEAB 2PXYB 1S7WB 2DBJA 4HS8L 4JFED 4RWYL 3V0VA 3U7YH 1BFOA 3RNKA 2SEBA 2WLYA 3E6FB 2VLRE 3BAEH 1KTDB 5KW9H 1P5VA 1AH1A 1BQUA 1UJ3C 5GIRA 2NNAB 4LEOB 1AE6H 3P4OA 2XOTA 1QBLL 1AI1H 1FP5A 2VDPH 3SKUD 4EDXA 4RX4D 1A1MA 4UILH 1UFUA 3MREA 2OTWB 1T80A 5GGUA 3SE8H 5DMGC 2E6JA 2DQHH 1JZ2A 5DD1L 3WNOA 3EO9L 3AAZB 5FUCC 1UKQA 1B2WH 5H35A 1MCCA 2BOCA 2YD2A 5T5NG 1OTTD 4QHUA 2X2YA 3SKJL 4OKDA 3VXMB 4HWEL 4L5FH 5EU5A 4YC2B 5MEQB 4GQ9L 4G43B 3C60D 4NKOB 2ZUXA 4PYGA 4JFZH 3HRPA 5EU7E 4GRWH 2QSCH 2F19H 4HKXB 1MLBB 3D18B 3JUZA 3IDNB 3CCHB 3QCVH 5EG6C 2ZOKA 3PWNA 3FB6B 5FCUH 3PWLA 4NRXA 1EO5A 4K23H 1I8LC 3ZTJH 5LKNA 1QA9A 2G9HB 2XQYK 3DUHA 1QEWA 5KVEL 1Z2KA 3KGRA 5L6YL 1CLZL 2AABL 2X1XR 3THML 2DQEL 1L6XA 2GJ6B 4HGKC 2ERJB 2AKRA 1LQSR 1RAMA 4XWOC 2JIXD 5CGYC 4L8DB 2I25N 1YJDH 2R9HD 1YYLL 3NPSC 5DK2A 5IUSA 3PHQA 3N9GH 4Q9QH 4HX1B 4ZPVA 3OJMB 1LEKA 5ILTH 2AEPL 3QSKB 4NHCH 1FE8H 2OQJA 3B3IA 4L29A 3GK8L 1GCFA 1KJMA 4ETQB 5CJ5A 5F7FA 5E24E 3P77A 3T0EA 1IGMH 4Y5XA 2BSTA 5BS0B 4HH9A 2VE6A 3KPRD 1TZHA 3UPRA 4GW1A 5IQ9B 2Z91B 3ARDA 1OQXA 1IQDA 2DYPD 4D9LH 2QQKL 3PWVB 3HE7C 4OF6A 3ARRA 2YK1H 3CIQA 4UAOB 4E9LA 4K3DL 2FX7H 4JJHA 3DETD 5C9JB 4X6CE 3EOTL 1NMAH 1Q9WA 3WNMA 5D2NB 3BP6A 2NY7H 1U8OA 3GUTA 2W0PA 5JHDE 5GRYA 2B8OT 4ACPA 1XGTB 1REIA 1RSFA 3OTTA 3MPCA 4UT6L 5JOFA 2A73A 1G7QB 4M7JL 1BMGA 4E41D 2AXHA 3V6BR 2C3WA 2A6KB 1ZLVH 4XBEH 3KR3L 5FB8B 4FS0A 1EO8L 1WJ3A 1NUGA 1M6OA 5HVGB 1A9BA 4LLWB 1U6AH 1PEZA 2OP4H 4X9HA 3BKJL 8FABB 4JB9L 2GTWB 2VO5A 4Y5YC 3ULUF 3NH7L 4HKZB 3QI9C 2F54D 4QRRA 1PZ5A 3BH9A 5H37H 4R90H 5FYLE 5GISL 4WWKB 3B9KD 1DBJL 4PRNB 3K8LA 5F7NC 4NT6A 4BUGA 1D5XA 7FABH 4FQ2L 3S35H 2WP3T 4U31A 2VKWA 4DGVL 3TEUA 3QNZA 4Z78A 1ZHLA 1OSPH 3TF7A 1A6VL 3IDXH 5CMAA 3MRMA 5EO9A 4Y0GA 2YC1A 5T1KD 1IGCL 4PP1C 1QVOB 5HHME 2ZUTA 3ZO0A 3QEQB 5JA9A 4HS3B 4FFZH 3CNKA 4N8PA 4ZFOL 1BJ1J 1IAIH 2XN9E 2A6JA 4DZBB 5CEXA 4HF5H 4LMQI 1Q0XH 3EO1B 3T4AB 4BK4A 4Z7OE 5CEZD 3NCJL 4JFHE 3SE3A 1MAML 4P9MH 1BX2A 4ZXBB 3ZKXB 3LD8B 2EE2A 4LCWA 1KLGB 4KI5D 4RDQF 5JHLL 1I3VA 4H8WC 4X4XB 2R0WL 1SEBA 4ISVB 2VUOA 1KB9K 3SDAB 5D9SA 1BBJB 4CU8A 3CLEL 5F7EL 1H3GA 4F9PA 5C0AD 1RZIA 3QQ3B 2CKNA 5E4EC 1JGLH 4FG6D 3X17A 3CVIL 5E4IA 4UZGA 2EE3A 1HHGB 5T1LD 4OCXH 1GAFL 4OZGE 4TVSa 3T1FB 3UTTD 1CN4A 2ESVA 4Y2OA 3REWA 3HN3A 5E9DE 4NZDA 3VDBA 2XIDA 3P73A 2QADD 3WIFB 2PTUA 3IXAB 1ODAA 3T2NL 5ID1B 2Q8BL 4GJTB 3QDAA 1MFEL 5E70A 2BC4B 2FX9H 1N5AA 4GMSL 5KSBB 1DEEA 3A6OA 2H32A 3G04B 1NMBL 5ICZB 1FYTA 1W72H 2OJZH 2UZIH 3DI3B 3RL1A 1MLCA 1IZKA 1JTOA 1QFWM 4WW2F 2AK4A 5DUBA 3L3DA 1RVFL 2E7LE 4FQXC 4HULB 5MEPA 1MCDA 3T0XA 4LCIL 2NCMA 2DI8A 1PBYA 1FORL 1CFVH 2VH5H 1U41A 1ZTXH 5DXWA 4EN3C 4L3CA 4MXQC 3L7EA 3O6FD 4JRXB 4PJDF 4JVWA 4KK8D 3MRJA 1JHTA 3S88H 1EMTL 3GBNL 4PJGB 3O3UN 4XBGA 3P2TA 1RK0B 2Q8AH 1AD9B 1JUFA 4OGZA 1MFBL 4CVUA 3ARGD 3HMXH 4JFEE 4YXKH 5F89B 4XAKD 2VABA 4EI5A 1HE7A 3QA3A 4NOBA 3UTSB 1XEDA