2XPGB

Crystal structure of a mhc class i-peptide complex
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
98
structure length
98
Chain Sequence
AQRTPKIQVYSRHPAENGKSNFLNCYVSGFHPSDIEVDLLKNGERIEKVEHSDLSFSKDWSFYLLYYTEFTPTEKDEYACRVNHVTLSQPKIVKWDRD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HLA CLASS I HISTOCOMPATIBILITY ANTIGEN, A-3 ALPHA CHAIN
publication title Structure of Hla-A0301 in Complex with a Peptide of Proteolipid Protein: Insights Into the Role of Hla-A Alleles in Susceptibility to Multiple Sclerosis
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 15
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2010-08-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2xpgB00
3PNWB 2NW3A 5ALBH 4JFDD 5SWZB 1HNFA 2MHAB 3V9FA 4P2QE 1FGVL 2DQFA 5FK9B 3UROR 2B5IC 5CEZD 4HJGB 1FFRA 3VXMB 2YSSA 4EDWL 3V5HB 3VWJB 5CIPA 1KGCE 4O58L 5GS2D 2D7MA 4M1DH 4PRDB 3GBNL 2OTWA 4L29B 2HYMA 1WCQA 5LAXA 3KYNB 4I3RH 1YDPB 1VKXB 4UDUA 1R3LB 4JFYA 3LPGA 1ZA6B 1YMMB 4IRZH 2QSTA 3LKQB 3O4LD 4UDTA 1T22A 2H2PD 1YEIL 3EYVB 1HINL 2V9RA 4Y89A 1IGJB 3E3QE 1BD2D 4JFEA 2DQJL 1WIPA 3TN0C 2EC9T 1S9XB 5T3XE 2X4SB 3MRNA 2ESVB 2O5XH 5ILTH 2VLRD 4MCYA 4YHNA 1P4BL 1YNTB 1S9YB 1QLFB 2VSCA 2O61B 1J1OH 3LV3B 1MIEL 5HHMD 1FG2B 1ZT1A 4TPRH 5ITFA 1SMAA 2UZIH 3GJFA 1C08B 3E2HC 3JV6B 3MJ9L 4KHXL 4E0RB 1WTGT 2DIBA 4Z7VE 2WLZA 4XNQA 2FATL 4APQA 4FQXB 5T1LB 2CIKB 4K9EL 1DVFC 4LEOA 4DGVL 5ACMA 1FSKB 4XVSL 3GK8H 1U8KB 2G2RA 1A3RL 4RDQG 3R0MA 2IQAA 2PNDA 3C5JA 4O4YH 3QZWA 4KRPD 5E00B 3HE6A 3MYJA 1VSCA 1JVKA 1BM3L 1ONQA 3IFPA 2W0LA 3CPLB 3QUYC 1IL1B 1KIUA 1QRND 2DD8L 4PBWD 1IGMH 3WYRA 1F3JA 4R8WL 4CVXA 4YXHL 1HI6A 4LKCA 2QR0B 2Z8SA 1BQHG 2IALA 1NUGA 1XCTA 3I6LD 2FWOA 3OL2A 4N0RA 3NCYP 3GO1H 3KYKL 3S5LG 1R3HA 3HE7B 2YWYA 5I1HL 3P9LA 5J06A 2E9JA 4M62L 5JA9A 2NLJB 2HT3D 4K3DL 1TXKA 2I9TB 1IAIH 2Z35A 4XAKE 2CUMA 3PIQB 3MRIB 4TUJB 4HHAB 1MJUH 4M1CC 1MHHA 2NY5L 4PRIA 5B3NA 4JO4L 3LEXB 2OZ4A 3MRMB 5DS8B 3RY4A 3IDMA 4LBEA 4PJHB 2F8XC 5CEZE 3BWAB 5HGDA 3SE8L 1XEDA 4K23H 1N3NB 4P23A 4PB9H 5DFTA 5F7KC 2F5AH 3U0TB 3ZYZA 1VFBB 5IB2B 4K8RD 1JPST 4HUNB 3MJGX 4K3EL 3M17A 3HLAB 4MGXA 1TPXC 4DUVA 1K8IA 3VFVA 4IOIB 4ZPVA 2EKSB 3RWHB 2VAAA 4W68A 4Y2DB 1BFOA 3ULUD 1WCBA 1IBGH 3S3SA 2J6EH 4WUUB 5I1LB 3QULB 2NY1C 3RWCB 4XHQA 4XHJD 2P7TB 2WBJD 2QHRL 2EICA 3SOBL 3B2UC 1KSRA 3QIBD 1YZZA 3SDAC 2R2CA 4DOHE 4WTZG 1BFVH 1HHKA 1FL3A 2F54E 2M1KA 2AEQH 5E8DL 1YN7A 1S3KL 1T2JA 3GIVB 3DSFL 1BVKA 4G9FA 1FN4A 4LSVL 5E6ZA 4N5EC 3QRFM 5LCVH 2PETA 5CP7A 4BQ6A 3MOQA 4QYOB 5DQJB 4PGCA 3HI6L 5EZLB 5EC2A 1G7IA 5IROA 1IZKA 2IANA 4FQ2L 3KLHD 4PLKD 3W11C 2XTJD 1JNHA 3HI1A 2E7MA 4LLWA 1CXFA 3RGVB 2PTUA 3GSUB 2YPKA 1AXIB 5B38G 4MB4A 5CKGA 4EBQL 5GPRA 2ADGB 3HZKA 3NCYS 2JJSA 5E6IB 3MV9A 5K93A 2G75B 2V5TA 3T4AA 1YQVH 3MJ7B 2FX7L 2DWEB 3LZFL 3KPOB 1F13A 4NUGH 3C5SA 1F3DJ 4N9GB 3TH2T 5CBAA 1DN0B 1ZS8B 1RU9H 4OFVA 2H26A 4LLYB 5BVJA 3GFUA 4ENEC 1N6QL 2P24B 4K7FB 4X6CB 1XF2A 1HKLH 3EYQD 1MY5A 3LRSB 2AXGB 2JCCF 3GSNB 1RULL 3UTZB 4NWTL 1I8KB 2HT4D 1GH7A 3UJJH 3KWWB 4EI6A 3MXVH 5L7XH 4LQFL 1C1EH 4XB7A 3VFOA 4LCCB 5E5MB 2YD2A 3E8UL 4Z7WA 5F9JB 4NQSA 4CBPA 2ITCA 1JGDA 1EEZA 3TO2A 2AXFA 3VFUB 4I4WA 3H9HA 1PX3A 4K55A 2R56L 1W72A 2JELL 1Z3GL 3B2VH 3ESUF 4WI3A 5FDWA 5H8DA 5ICZB 3O3DB 3K7UA 3QIWA 2F19L 1EHLL 5DRZA 1CFSA 4DKFL 2GSIB 1TCRB 3GMPA 3CLFL 1XFPA 4QRUA 5KS9E 1PG7W 1S7WA 3ULVC 1F6AB 3GBML 3B43A 4YDLB 4ODXB 3DETD 4M5ZH 4P2QA 3OKDB 4OJFL 4OCNC 5DJZB 1ZVYA 3KPRA 1IARB 4RMSA 3LKRA 3H9ZA 1M71B 2QQLH 4MDJA 4JO3L 1NCUA 4HAFA 1UZ8A 3QNZB 1D5XA 3VMPA 4OLYH 1C5DB 5KAQG 2R0ZH 3UTSE 1PQZA 2CKBL 3CDGB 3CMOH 3GJEA 1MFAH 4BKLA 3FRPG 4OGXH 1OAZH 3QP3A 3CX5J 1A8JH 4OZHE 4K7PH 1WK0A 2VXUH 5GZNC 4I2XB 1KB9J 1PY4A 3MNVB 4XWOD 4S2SB 5CMAB 4ORZC 3ZE2E 4LARL 3I75B 3QDJD 2AK1L 4L8BA 4OF6A 4PRPB 4ZUUA 4DN3L 1KCUL 3RU8H 1U36A 2X6MA 2V2TB 1MCQA 5CJQL 1NBZB 2XTJE 4O51A 3MUHL 2IFFH 4KXZI 2Y5TB 4R9HA 4MX7B 3DBXA 1SJEB 4HIIA 4L9LB 4RAUB 3W81A 3BIKA 5E2WH 1S8DB 3D85B 1EGJH 5DRXA 4LCIL 3WLBA 5D7IB 1XCQA 1OGAB 1G6RH 5ANME 4Z7VA 3P0YH 3LRHA 2OK0L 2Q7YA 5K9QG 4XNZB 3O2DL 4KQ3L 3BX7C 2C3GA 4WW2B 1ZA3B 3BUTA 4JHZA 4UINL 4ELKB 1R24A 2AJSH 2XV6B 2ARJQ 4L3CA 5DJXA 1MIML 1NLDH 1F00I 2N7AA 4JZOB 3WJJA 5ENWB 5FF6B 1MLBB 3QXDB 1X6NA 2DL9A 3QCVH 4TVPE 2Y6SC 4MHHG 3SO3C 4MD4B 1CICA 1QLRB 4KKNA 1AGCA 3IFLH 4S1SL 1MI5E 3SO5A 1DEDA 4WWKD 5A3ID 5I18H 3LKNB 3SJVE 4NNPH 1LNUA 4O2FA 4P5TD 4PV9B 1OSPH 1WFNA 2QTEA 4DTGH 3RTQD 4WU5B 4TUKH 1KT2B 4ETQB 2GHWB 4KHTL 2A9NH 1T1WB 4N0YL 2QQNL 5F7MC 4J3SA 1IQDB 5D5MF 3WNPA 2APTA 4C4KO 3MACH 4KKBC 1FHGA 1AD9B 4PB0H 3MRCB 3SDDD 1Y18A 3CC5B 5MERA 2NXYD 4I9WE 2NY6B 4OUUB 5IHBA 4RFNB 3J7HA 3W9EA 5BO1H 4ZFOB 3CGTA 3P73A 1KACB 1OPGH 4YXLH 1XGTA 2HLAB 1IC4L 3WN5B 1R3JB 1G9ML 2CLVB 1NKOA 4WGVB 2IAMA 2ICEA 3T65A 3IS0X 5EU7C 3MRJA 5L88H 2BVOB 3MSPA 3TNNB 3FT3A 1BQLL 1PLGH 1EFQA 3WKML 4MXVE 3VGGA 2NCMA 5IG7B 2FHFA 3D3VE 3RNKA 4FXKB 1FNGA 3SCMB 3OKYA 1BD2A 4JKPL 4JO2H 1KULA 4NKOB 1NSNL 3HKFA 1EAPB 1IKFL 4X6DF 2DQDL 2QLVB 1Q1JH 5L2KE 2Y23A 2VLRA 1L9MA 4NM4L 1DN2A 3IU4L 3EOAB 3RWDA 4LKXB 3WS3A 3C6LC 4NCC2 3ROLA 3G08B 3AB0C 2NY3C 2YD5A 4NN6B 2EDQA 4LSQL 2A77L 1B9ZA 3ARTA 5T1MB 4M8VA 1IGCL 3T0ED 3PJSA 1KPUB 3MRPB 4JE4B 3UZVB 5EZJA 2A73A 4LPCA 3DVFA 4WHYG 2WIMA 5HHOD 4JN1H 4Y5VC 5DMKB 4Y2OA 3MMEA 4L3AA 2C3VB 1PEWA 1N5YH 2BVEA 1CLYL 3RDTB 4JPVL 2Y36L 1RUKL 3PWPB 4ZD3H 1CFVL 1NGXA 2J8HA 4OD2A 4ZUWB 1R0AL 4JM2C 3MLSL 4S0TD 3F7QA 1Y0LA 3O6LL 4KUZH 1QFUL 1RJZA 1IAOA 3B8YA 4QHMB 4D9RD 3HAEB 3OX8B 3KXFB 3NAAL 4QRSA 2EXYC 4XNUL 4WI9A 3ARZA 5FGCE 4JLRB 4NT6A 2R9HD 2XZQH 1LK2B 4EUPA 1RZGB 1U3YA 3HRZA 5DK0A 3F7YA 2V7NA 3TCLB 1ZLVH 3LN5A 3MLXL 5EIQA 4MXWH 2UY7A 5ITBL 3JWOH 5DGQA 2DB8A 3R8QA 1JRHH 5F93C 1T21B 3CZFA 3ARFA 1JHTA 3RPIA 3LEYH 2YD4A 4NKIL 1EEUA 3EO1A 4C56D 4WFFD 4WU7B 3GKWL 2H3NA 2ZCKL 3NZ8B 4NUJA 1T2QL 3TBTA 1JPGB 4HUMB 4NRZA 3KVQA 3VXSB 1E6OH 2BSRB 3RIFF 4FG6C 5H2BB 5C09D 1RZIA 2P5WD 1JHLH 4RFEA 3GSVA 4F7CB 4UT6H 5TDOA 1RIVL 3DUUB 3ZYOA 4OIIL 2BNRD 3GJFK 1IGFL 5KS9A 3L5XH 1VENA 2R4RH 4HUVA 5C92A 3MC0A 1D6VH 5EO0A 1BBDL 5FUCE 4GBXB 4LVOC 2A6DA 4IRSB 4WDIA 4DEPB 1CDHA 1YC8A 4NPYA 1KTDA 3QNXA 4XPFH 2FD6H 4FXGB 2VDMH 5DUPH 1DQJB 1KCLA 3AAZB 2FIKA 2EYSB 2WBJA 1TIUA 3HFML 3UTSA 4JPWH 4NNYA 1JZ4A 2FJGA 3NCMA 3QIBA 4KV5F 3WD5L 2XICA 2AAVA 1QSFD 1AKJA 3RVUD 2M8XA 3C9NA 4I18B 2EH7L 3IJYB 4GSDL 4OZHA 5D1XD 4KDWA 1Q72H 1PX4A 1M4KA 1AY1H 4QXUH 4LSPH 3QWOB 3BW9A 1H5BC 4NM8H 1TETL 5IEHA 5F1IA 4XVUC 5EBMB 3RP1A 3WDHA 1SJHA 3VD5A 4NZDA 1E6JL 4ZOAA 2B1AH 3WL9A 4HJ0C 1MCEA 3L3KA 3G5ZB 1N59B 4GRMA 4U1MB 1OOAA 5IBUG 3FFCB 3MRDA 2J4WL 4RGMB 3PGCB 4JQVC 4J7RA 1JHKL 5GRZA 2CDFB 4U6XB 4W6WB 1ZT4A 1NAMH 4FP8H 5AYQA 5C0RH 1ACYL 4I0PC 2I5YH 2OP4H 2DJUA 5EOTB 2H1PL 5J12C 3ZHLA 3DX6A 4YO0A 1CG9B 3VI4E 5HYQA 5IGXH 4G6FD 4OZGA 2DKUA 1UENA 3CVHA 4ODWB 3HZMA 3X3GH 3IRPX 1KCRL 1ZT7B 3CLEH 4RMVA 1J1XL 2D7PA 4HMDA 5KSBB 1T4KB 1QHPA 5DHYA 5DD5L 1CU4L 2NXZD 3F7RA 5AD0A 4M7ZB 4IMLA 1WBYB 1KJ2B 4JY6B 5CKAA 4NQDB 1CE6A 4XPBL 5I8KH 5I1CL 1L9NA 3BKMH 2ZUYA 2I9LA 1WBZA 1HSAB 2VB5A 4G8EA 4Z7QE 1K3IA 3OSKA 3VRLF 3VRJB 4YDIH 3VA6A 2BNRE 4M7JH 4A6YL 2PO6C 2DQEL 2X40A 4EIGB 1EXUB 1GIGH 3PF2A 5HVHC 1H8OA 2DJ4A 4L4VE 1OAKH 3QJFA 1HYSC 3OKKB 2XFXA 4PRHB 4N1CA 2VISB 3OAYH 4DJMA 3FFDB 4DQOH 3CIQA 2W0KA 1EPFA 3MV7B 3ALWA 5DK3A 1AGDB 1CXEA 5JPNB 2CPCA 3W2DH 3RI5K 5EFIA 1OTUC 3EOYG 5DC4B 1QSFE 3PV6A 4NP4H 4MJID 4CMHC 3FMGH 4A2MA 4U6VL 5D93C 4Z7UB 4UQ2B 4MLSA 4X9GA 4RAVA 1MQKH 1QFOA 4OFPA 5IQ9A 3D25B 4JRYB 5HJ3B 4KQ4H 5ISZB 1QP1A 5ID1B 4CL7A 1JF1B 3QDJA 4OFKA 3TH4T 3DXAD 3G5YA 5L2KA 3K8KA 2K1MA 1CXLA 3MFGB 5EU5B 2X1PA 2Y07H 4OM0L 5D7KD 3TPUA 3ARQA 3I6KA 4ZXBA 2JIXB 2I07B 2JF1A 5D2NB 5IVZB 2CDEB 5DD0L 2VN7A 1IC5H 4K94C 4LVEA 3JV4B 4BQCA 1LILA 1A7PH 4Y16C 3LOWA 1KJ3L 4XH2B 4Y19B 4AQ1B 5GRJL 4HKZA 2YN3A 2AI0H 3VDCA 1OCWL 1A7OL 4NQCD 5JQ6H 1MVUA 4P59H 4OCYL 1OD9A 4FQ1H 4N0CC 4U1IA 3PHOB 4HUWA 2Z91A 5E1AA 3EO9L 4CNIA 3EKCA 5F72S 1JNNL 1SM3H 1QSEB 4GS7C 1QUNA 4M48L 2R1WA 4M02A 5IW6A 1EIBA 4WCYL 4HS3B 5DEFA 2Q6WA 3BE1H 4EN3D 2HH0L 2FZ3A 1I4FA 1J5OL 4WWKA 1C5BH 3BXNB 4XNXH 1HIML 1BMGA 1U91B 4P5TA 5F9OH 2GITA 4PJ7F 1ITCA 1K4DB 1YEGH 5DWUL 1MWAB 4LRIC 5BOPA 1I1YB 1T5XA 4HPOH 5E99H 4F33B 5I8CA 4NC2B 3C08H 1E4XL 4N0UB 5HD8D 1CTOA 5E95B 2Q8AH 3ROOB 2VLJB 5C9JA 1FH5L 1E27B 5DR5L 1PFCA 2F9BT 2NTFA 1O5DT 1CS6A 4KRNA 4LCYA 1OARL 2RB8A 4JR9H 4JVUA 5C08D 5D2LA 2PW2B 3EDFA 1KIPB 3C2AL 2VXQL 5ID0B 1UB5A 3FQTA 3KDMB 4PJ8B 3CK0H 1C16A 4X83A 5MEPB 3LHPL 2EEAA 4LLVA 3BDYL 4XCNA 4WI2A 2XQBH 4PJIB 3PP3H 4U1NA 5GS0C 2EDLA 4XP4H 1OT1A 2BHYA 4FHBD 5H37G 2WAHA 5GGRY 3WDJA 1KELL 5EU3A 4Y5XA 3VWJC 1CDIA 2DMCA 4PGBA 5CHNB 3MBEB 4GRWB 4Y4HB 4ZFGL 4XMLL 4WIQA 1U8LB 2IG2H 4FA8A 1C7TA 3WS6C 2CR6A 3T0XA 5DQDL 5DT1L 3T2QA 4F8QA 4LSTL 3G04A 2PYFB 2V7HA 1ZHKB 3O3AB 5D96B 5T1KD 2Y25A 3NA9L 1MPAL 3ECBB 4TSBH 4W4OA 5IW1B 4EI5B 1RMFH 4RFOH 1G0DA 4M9PA 1HQ4A 4R2GB 4NZUH 4PGDB 3ARGA 3TN0D 2W9EH 1J0KA 4O2CB 3P4OA 4DGIH 5DMYA 3IVKA 3RUGB 1S9VA 5HHOA 2ZOKA 1T1XA 4NQCE 4FQHB 5FYLH 5FGBA 1L7TH 3ARBC 4L4TD 5TDNB 4WW1A 5DJ8A 5HDQH 2HRPL 5JW4N 2K3TA 4G8GB 4NFDA 1FBIL 3LKSB 3HAEG 5GSVB 4NBZB 1JTOA 2XYCA 1INDH 4OZ4B 4FQXC 4ORGA 1YEFH 3L3DA 2NPLX 1FVEA 5FCUH 1FSKC 2W65B 4KPHH 3BN9C 5BZWB 4X4ME 4ZAKB 3C5ZB 1DVFD 4YNYB 5C0FB 4WUUE 2WIIB 5I75B 4YHYB 2Y06L 3MGOA 1BQSA 1T0MA 2ZCLH 5E8EB 4UU9A 1CYGA 5EOCH 4JHAH 5KVDH 4UNTA 1JV5A 3RL2A 3MNWA 3QUYD 1R5IA 1CR9H 5D7LD 3GI9L 4RISH 2B1HL 4LRNH 5EBWA 4DW2H 1WZ1H 2IF7A 1A3QA 4G42B 4ZS6D 3WIFB 3BD3A 1GHFL 5BMFL 4JFXB 3HE7C 4QTHB 1B0WA 2R1XB 4OIAA 4C56A 3HCVB 2HA1A 2OL3B 3TNMB 3EHBC 4KUCF 3O8XD 1A6WL 3BOVA 4XTRC 2HJFB 1JWSA 3QEQD 1KPVB 1Y6NR 5DJ0A 1F97A 1VGKB 2Q86A 4WO4D 3G6JA 4Z0XA 2P5WA 3MLWL 1ND0A 4L5FH 4PREA 4FQJH 3LS5L 5INCB 1QO3A 1KBGH 4M1CD 2BNRA 1AP2B 3QO0A 4KMLB 5F6IB 4IIQB 4LHUA 3QFDB 3U79A 4JY4B 1MCNA 1R3IH 3MUZ1 2HFEB 1CLOH 4D9LL 4M6ML 4V1DB 4YH6A 1FP5A 3QUZB 2LTQB 1MLCB 3WIHH 3CVHL 2EDDA 1II4E 2YPLB 4FQLL 1DSFH 2IGFH 3B9VA 3KPQB 5E9DB 2FO4B 4XBGB 5FECA 2D9CA 1IGIH 4Y8AA 3MJ8B 4TVPL 4RRPA 4Y2DC 1QSFA 3LKPA 2ZPKL 2Z0BA 5F8QC 3BGFB 5DSCA 3SE4C 4WEBL 3T2OA 3CDFA 5GRYA 4U49A 5AUMB 1QFWM 5IVXB 1MY7A 4HUUB 5HYSA 3B2UD 3ULUF 3D2UB 4HK3N 3SDAD 4PJDB 1IAII 1IKNA 2QQQA 5DO2C 1JE6A 4NIKB 5ESVA 1A1NA 1J05A 1KEGL 4OLUL 2D0HA 2PR4L 3P30H 3TM6A 2FSEA 4JCMA 3OGOE 3BKCH 2RCSL 3MR9B 1TDQA 2GUOA 3BZFA 4LFHD 4N5ED 2XWJA 1G7QA 1RVFL 2QQKL 3DYMA 1Z9MA 2KKQA 3KS0H 1R5WB 1ZHLB 3HR5B 5F8RC 1I7ZA 2V2WA 1B0RB 1L6ZA 1U41A 3K0WA 5EUKA 3VFNB 2A2QT 3RGVC 1BOGA 4JHWL 3W11D 1IQWH 2X4RA 5KN5B 2SEBA 1XGYL 3MTRA 3ZSTA 2X1QA 5JR1L 4W70A 1WZLA 2D4FA 1T1YB 1HWGB 1I7TB 5E6IC 2K9UA 3P11L 1ETZB 4D0CB 4ZNEE 1A4JA 5EZOH 3T04D 3I85A 4DAGL 3U4EB 1FV1B 2PUQT 1UEYA 1I1AB 1YYLL 4H8WL 1G9NC 1CQYA 4ZTPH 5HHNB 1NFDE 1GGIL 3LDBB 5GJSH 1MCHA 2GYSA 3L7EB 1GOFA 5HVGB 1MVFA 1KIQB 1YEEH 3QG6B 5FIEA 3V8OA 3SQOH 5K9JL 3MLZL 4LCCC 3WCYA 3TCXA 4EZMA 4TTDC 1TJIL 4GW4A 4Z5RA 2CMRH 5KSAA 4OZGF 4YGVB 1AQKL 2JJTC 1F4YL 4P3DB 4MAUL 3MV8B 4WNQA 3M1BA 3PHQB 3P4MA 1MFDL 2DTSA 5GJTL 3JV5A 4P2OB 5C07E 1S7QA 1UWGH 2CLZA 4JM4L 3VXUB 1DANT 2BSTA 3QQ3B 4OCWL 1K85A 3OKEB 3BO8A 3FT2A 1K4CB 2I60H 1OP5H 2DBLL 2ATPB 3AREA 1DQQA 5DVLA 1B4JL 1XR8B 4YDLC 4WUKL 3FCTA 1GGBL 3QNYA 4ZPTB 5CGMA 1P2CA 3VGHA 3ULVD 4X6FB 4G7VL 2EDWA 4MJIA 3REVB 1A5FH 5LWYH 2VLKD 4HKBB 1MCCA 1NCBL 5E4IA 4BZ1L 3BYTA 3ESVF 5I8EA 1I9RH 1NUFA 4HZLA 3VRIA 2YN5A 5HYJD 4M8QA 5I76A 3MLRH 2HJKA 4XCCH 4XWGH 4G8FA 1S5HA 4WJ5A 2RHEA 1U8OB 5C6PB 1JPSL 4Z77A 4HIJA 4YDKH 3DXAA 1SVCP 1TZHB 1SYSB 5IB5A 3Q6FA 4MCZA 4YBLB 3TIEB 4JG0H 5IB4A 1F4AA 2WBKA 1OAYH 4S1RL 2YMXL 3FRUA 1MAJA 1MJJB 5IFJB 3GB7B 2XZCH 5GZND 3U1SH 4WHYH 1ZGLA 3UJIL 4G9DB 1QA9B 4MA7H 4HMEA 4P5MA 2OJZH 4GQ9L 5CEYB 2W9DH 4XAWL 1RPQA 2J6EA 4PJAB 1AXSB 2PYED 4NQCA 4JREB 2GJJA 4L9LC 2C9AA 2HG5B 1FORH 3NIDF 3CVIH 1ZEAH 3BGMB 5ESQB 5JMRA 2APWA 5DI8A 35C8H 3WE6B 2GJ6E 4JFOB 4YBHA 3UYRH 4XNZC 5CSZA 5E5RB 4WW2C 2FYYB 2R69L 4KKCC 2PTTB 3ZDZF 3FT4B 4H1LG 4J1UA 3T2PA 4PP1C 2Z9TA 1DE4B 1HE7A 1TJHH 2P1YA 1LO2L 2YUWA 3FB7A 4IMKC 3T4YB 4BSWB 4CADB 4X98A 3G5VB 2GAZB 5FHBH 1JZ2A 1CK0H 2VZVA 1W0VA 1BAFL 3NCCB 3W5NA 5CWSB 4QXGH 3G6DL 3FQRA 2Y6SD 1CGUA 1NMAH 3CH8A 2E3VA 3MV01 3QCTL 3GSQA 3QBTB 4ZO7A 4FFZL 2CXGA 4UOW1 5A40E 3L3GB 4MNHB 1FLTX 3LSOB 4R96A 4OT1L 3T2NH 1FAIL 2MCPL 4B50A 4YE4H 2X89A 4ACPA 7FABL 2A6IB 4PUBL 4NO0B 1A2YB 2OJEB 4GAGH 1TLKA 1LO0L 3IKCB 3P0VH 1C12A 3DX8A 2NY6C 4RFNC 3HC0A 4U6HB 4C59B 3HUJE 4HX1A 4M43L 4KZEH 5KBNC 3A6BL 4UIKH 1KLFA 2VLKE 2KUTA 4MNGA 3KPSD 1BZ9B 5DVOA 4UNUA 3T1WA 4DKEL 3QRGL 4WHTB 4YLQT 1JK8A 3WN5C 4YEEA 3NFNA 2DQIH 5D2LF 3MPCA 1Q9WA 5I15H 3HS0B 2AGJH 1UWEH 4PLNC 5L0QB 1DJSA 1OHQA 2NY0B 2DYPB 1DBJL 4G6JL 4OGAC 4UV4L 2VL5A 4X7TB 1WBXB 5D72L 4ELMB 1ULVA 3FTGB 2W0PA 4XPGL 5E8PA 1NCDH 1AO7B 1FNEA 2XN9E 3SCMC 2FR4B 4KRMB 2XY2A 1DUYB 4LLDA 4I77H 4K94L 3WFBL 4U4BA 3B3IB 1LK3H 3SKNA 5AEAA 3DX9A 2FX9H 3D9AH 12E8H 4MA3B 1ZTXL 1MHPL 1QTYT 5I2IA 4Q9RH 3N50A 3KJ4B 4O2EA 4R90L 3MUGB 4NN6C 2C1PB 5IFHH 4HFUL 2Y7QB 4OSUH 1OM3L 3C6LD 4Z7OE 4H25B 4RQQB 3MYZA 2NY3D 4KVCL 1HDMB 2YUXA 3VH8B 1J18A 1CDYA 3SGDH 4I5BB 4QRPE 4QWWC 5E2TL 1G6VK 1IEHA 1MNUH 3FO9A 1IRAY 3ISWA 1C5CH 4CVUA 4WHDA 2LU7A 4HT1L 3TT1H 1ZXQA 1HZHH 1BZ7B 3H8NA 4OI8A 1G9NH 5C8JB 2VC2L 4HEPG 3RDTC 3IDXL 4KJWC 3CCHB 3S88H 4S0SD 3GSNH 4RWYH 1V8HA 4LOUD 4QGYA 4LSDA 5J3HC 4XCFH 1A7QL 1EFXD 5IHUL 2EYRA 4LIQH 1YN6B 3LMJH 4JM2D 1MCFA 3ZHKA 4M61B 5SX5H 4Q6IB 3WBDA 4TRPH 4NZRH 4AK1A 3QUYA 1A6PA 1A1MB 1KC5L 2CKNA 5K59E 4ZNEA 3IXTB 3RNQB 1EGJA 3D18A 4CMMB 5A2JH 1CFQB 3GMNA 2EXYD 1AQDA 2P4AB 1G6RA 5FYKH 3GI8L 3PWNA 4KI5D 1FYHB 3PGFL 4M1DL 3DRQA 3O6FB 4PTUA 4J4PC 5F7WC 2O5ZH 2W07A 4PJFE 4D8PB 3O8XA 4XMKL 1JWMA 3RWJA 1FC1A 5FO8B 2CDGB 5D9SB 3DHJA 1DFBH 3HR6A 4WO4A 1KEMH 2UZXB 3JTTA 1MJ8L 1ZKAA 4LNRB 4WRLA 1IZJA 4PY8J 5GS0L 3BKJH 4IEFB 1CL7H 2UVFA 2WINB 3SKOB 2B20A 2X42A 1ZANL 4MNQB 3GMQB 4IRJA 5C0BD 5ILTL 1EHXA 1MCLA 2BOCB 3TBVA 3IAGC 4FG6D 4PBVC 3TVMA 5CZVH 2GEEA 2HTLC 3KLSA 1JZ3A 4G7YH 1T03H 4TPRL 1A9BB 2CGRL 3V6FB 4GBXC 2UZIL 5C0CB 1JP5A 4DEPC 5FO9A 2VLLB 3FB8A 3G6JF 4TUOA 5BXFA 4H0IA 4Q9QL 2VDQL 1ZVSA 2UVEA 7CGTA 1KFAL 1CLCA 4BQBA 1A21A 5I1KH 4XGZA 4NQDE 1M7IA 5BVPH 4NQED 4W4NA 5IF0B 3DO7B 1XF4A 4U0QB 1T6VN 1E4XI 1FFNA 4O4YL 3U9PL 3CXDH 1SBSH 4S10A 3W0WD 5SX4H 4I18C 4QHLB 2FJFA 2V5SA 1A47A 2VKWA 4QHNB 3WUWB 2V5RA 1A6AA 1BVLB 3B9KB 2DQHL 4XMPH 5CSBA 3MXWL 3DURA 5DRNB 2ORBL 5HPOA 1I9JH 2EO9A 5FA4B 5LGHL 1IGML 1RY7B 4PJXE 1UACH 1GOGA 1NEZG 1RK1B 5M7QA 3HC3H 2D03L 4PRHE 2ZSWB 1U8JB 2VZ1A 4XVUD 4YXKL 2AJVH 4PJCE 3OR7B 4CU8A 3LKOB 3UBXA 3VFPB 4HJ0D 2J8UE 4LSRL 4G6MH 4WVRA 3MRFA 4RGMC 3UC0H 5F7UA 4PS4L 4BFIA 4AEHH 1MJ7H 1NDMA 1B0GA 5TFSL 4I0PD 2A6JB 5E70A 2D7TH 3EYUL 3BSZH 1T89C 4NSKA 5BS0D 1FZOA 3VGBA 5IB3B 4KI5E 4XC3H 3ABZA 1EBPA 3MLTA 4GMTH 4HC1L 1AR1C 1X7QB 3KNBB 3PL6B 1JGLL 5FYLD 1UWXH 2VKXA 1KB5A 3VWKB 3ZE0F 5F9WB 4X6EB 5KW9H 1I8MB 4JFHE 3BP4A 2IQ9H 1GPOL 3BQUB 1J8HD 4M7ZC 4FFWC 5TE6L 3BZ4B 4QRRE 1MCDA 5IMOB 5F3BA 2IMNA 1IBGL 3V7AE 4L3EB 3WFCL 4ODUB 4M6OL 3GSWA 3QIUB 2OYPA 1F4WL 3S97C 3IJSB 4M4RA 3CH1A 1JTPA 2J5LB 1KUMA 1A14L 4NQUA 5E8OB 5KZCD 1CWVA 2OXHA 3DGGB 5F6HI 4U3XA 1LEIA 2ICWI 4KI1A 4NBXB 3U46B 43C9A 1F2QA 1QSEE 3MODL 5IIEB 1FRGH 3PP4H 2COQA 3C60A 5H37H 2EDXA 4ZFZB 4OUOA 1N7MH 1P1ZA 2EDOA 5ESAA 3BUYB 4D3CL 3ARDA 3SDYH 1IAMA 2VLKA 3CFEA 5HBBA 1HYSD 4JKKA 1RZ7H 4UUJA 1L7IH 3BJ91 5TPWH 2VIRB 1XGQA 2NW2B 5HYJA 1LEGB 4HG4K 2YA1A 1WVZA 3UTQB 2VZSA 2I24N 3LH2H 4BH7A 2JB6A 4DVBA 3E6FB 3KJ6H 2E6QA 1U8QB 4E41D 1AC0A 5F1OB 1OTUD 3T0VA 5IB1B 1EVTC 3F7PC 4AT6A 2JK5B 4LPWA 1TNMA 4ZS7H 3JWDL 2BVQA 1Z0NA 1MREL 1XZ0B 3HPLB 5F3HA 2XN9A 1V7NL 4KTEL 3HI5H 3IDNB 4LP5A 1WZKA 3NBNA 3L3OA 2ED7A 4TOYH 5L9DL 4NDMA 3OAZH 2DN7A 3P77B 2HAZA 2IADB 1T5WB 1MCJA 1BIIA 1D6EB 1NCAL 1BECA 5TF1H 1YECL 5ICXA 4GH7B 3QDGB 3TZVC 5D2NC 4CVWA 5TE7L 3TA3B 4IS6A 3MRQB 1FGNL 3HAEH 1U8PA 3NCBB 3VGEA 2LVEA 3QI9D 3G6AA 5ADPH 5DJ6A 5TQ2L 2AKRB 2BNQB 2X9YA 3IB4A 2GT9A 3O2VH 1VACA 3MO1B 3OPZH 4Y16D 4C83B 4X4YB 4Y4KA 5KSUB 4RGOL 5EUOF 3SPVB 4ZNCD 4LLQA 3J8F7 4UNVA 5GISH 1F58L 1HH9A 4EOWL 3AU1A 2CKBB 2NR6C 4N0CD 5JHDE 5DC9B 4O02L 3DMMA 1G7HB 5FYLE 5HHQB 1F4HA 1RUAH 3ILPB 1EV2E 2DQCL 1YJDL 1CD1A 5FA3A 5C0IA 1MRFH 4L8DA 4CU7A 1T1ZA 4FABH 5EOQL 5EZIL 1QSZA 2MQ0A 4NO5B 5DURB 3S37X 1P7QD 2G9HB 3PDOA 1QR1A 4Z18A 2AK4D 4OTXH 4W81A 4BUGA 1FFOB 5CINL 3U0WH 4X7DC 4HULB 5F1SA 1U0QA 4HH8A 4DZBB 1NAMA 2WSKA 1N26A 1ITBB 1HH6B 3QO1B 3STLA 4TULH 4UQ3A 5DJYB 3H3BC 3RA7H 4NWUH 4I3GA 2NW3B 1MAMH 1MFAL 2YPVL 2FJHA 4G8GE 1CDJA 5HI3D 2DQFB 2FBJL 1F11B 1IM3A 1INQB 2VXUL 3VXTB 1JCKA 3FAWA 2YSSB 3EYOB 5CIPB 1DQDL 4PJ8C 1N5AA 2OTWB 2QKIA 3ZKXB 5LAXB 1IAKA 3FQXA 1X5AA 4GG6E 1IFHH 3EZ8A 1XR9A 1AFVL 4F58L 1G1CA 4YHPA 4UDTB 3PABA 5SWZD 5IQ7L 4F7TB 1ZWIA 4JFEB 3MBEC 2B0SH 4Y4HC 3OR6B 3UYOD 3D0LA 1PG7H 1U3ZA 1KJMA 3D69A 3MRNB 5I6XB 3VWJD 5JLZA 1FAKT 3NCJL 3M8OL 4N1HB 4UT9H 4XRCB 5DUML 4H88H 4YHNB 1MELA 1EUTA 3WXWH 2E8ZA 3VCLA 5D96C 1YMMD 1ZT1B 2ADFH 2HVJB 3VH8G 5IBLC 4UTAL 3U2SB 4EI5C 4ZTOH 2AJZA 3MCKA 4XNQB 3TT3L 3S37L 4R2GC 3TFKC 5CSGA 4XP1H 4APQB 3RY6C 3C8DA 2NZ9C 3AS1A 2ESVD 3NTCL 3V6BR 1A1OA 4LEOB 2ICES 3U82B 3FQWA 4PJXA 1LO4L 1QKZH 3VI3F 2IQAB 4P4RA 5AG8A 5I18L 3C5JB 3VJ6B 1DBML 3QZWB 2PCPA 3QHZH 3EAKA 3BP7B 3HE6B 3MYJB 1ONQB 4PJCA 3ARBD 3IFPB 4U2YA 1NCCH 3MRHB 1YMHA 2J8UA 1DDHB 2WP3T 4CVXB 5D1ZA 1HI6B 2ATKA 1M7XA 1KJ2H 4FQXD 4QHKI 4ZAKC 3OB8A 3C5ZC 2OQJA 4JM2A 2IALB 4KFZC 3VE0A 5I1GL 4JFFE 4F9PA 5I75C 4YHYC 2X4UA 3WFDL 1A0QL 1WEJH 3BN9D 3O3EA 2FWOB 3TBSA 3QPXH 5KVEH 2DMBA 5DD6A 1R3HB 2XA8H 4OLZH 3BMVA 1W8OA 4GG8A 5TH2A 1VPOL 3K2UL 2J3SA 3NIGF 1N0LA 4OCSL 5IJVA 4NC1C 2Z35B 3V5KA 3HMWH 5CJXC 1UKTA 4PRIB 1S7RB 4UOW0 4EDXB 2DMKA 4J8RA 1MH5A 1PLGL 3BZEA 5HGDB 4QRRA 4P23B 2VUYA 2ZOLA 3HE7D 4ZFOL 1W0WA 2JJWA 1BQHA 1KLGA 4G6AC 3M17B 1URLA 5ADOH 2AXHA 1WITA 5C0BA 4XTRD 5IWLC 1K8IB 3RZCA 3BP6B 4Z6AT 4JFPA 1CT8B 2VSDA 1RZJC 2EO1A 3JTSA 3OXSA 5F6IC 1BFOB 3BRDA 4IIQC 2IPTH 4GQPH 1WCBB 4H5SA 4DK3A 4K2UH 3QHFH 1Q9LA 1F3RB 3H0TA 3QUZC 2LTQC 2XKNB 1WT5A 4G3YL 5DUBA 4LU5L 4YHOH 1UM4H 3EDJA 3LCYA 4M5YH 1MFBH 1KB5L 1HHKB 2XRAH 1BZQK 3HNSL 4QTIL 4ZD3L 1KJVA 4R7NA 1YN7B 2BOBA 2QJDA 4NBYB 3EOTH 5GQBA 1FN4B 4J6RH 3O41A 1K8DA 4DKDC 4OZIB 3BGFC 3L3IA 3OJDA 5CP7B 3O0RL 4KUZL 5KVMC 4PGCB 1A7RL 5EC2B 3IDYB 1UA6H 1G7IB 5DEZA 2IANB 5F7NC 1MCOH 3B9AA 1GC1C 1NMBL 1JNHB 3HI1B 4QOKE 5D8JL 1YPZF 5E08H 4P57A 1OP9A 4LLWB 1ADQH 3V6OE 1H5BA 4YFEA 4MS8C 1H3VA 1R6VA 2YPKB 1RFDH 1CGYA 1QQDA 4X7SH 2WUCH 2J12B 4KTDH 4I3SH 3RWGB 4MXWL 5DO2D 3MV9B 3SDCD 3JWOL 2H45A 1RD6A 1TITA 3NMEA 2R2EB 3BIAX 3MRLA 4KY1L 2OI9B 4GXUM 4JPKH 4RNRA 3C5SB 4UB0H 5AZ2H 3IFOA 3CZJA 3LEYL 4Z0BH 4H1LH 5JW5A 1GJIA 1RHFA 2WV3A 4OCLC 5BVJB 1NQBA 3FB6B 5L6YL 3EYSH 3RGVD 4I0PA 4LGSB 1XF2B 5BS0A 4QRQA 4OF7A 4EI6B 1TTFA 4TYUA 5JHDA 1FZKA 1ZK9A 5E6ID 1ZLWH 4Z7WB 4XP6H 3IF1A 1JGDB 3U0PA 1EEZB 5JHLH 1X3DA 3TO2B 2AXFB 5C0JA 5B38A 2G5BB 1I1AC 3H9HB 2NY4B 2LVCA 4XP9H 4HLJA 4U1GB 2V5YA 3BEVA 5MEQA 4JANA 4PJEE 2A9MH 1XGUB 3LDBC 4JDTL 5FDWB 3AS2A 5DD1H 4MXQC 3UAJC 3ME0A 2ZJSH 3QIWB 4F57H 4HIXH 4AENA 3MOAL 3GMPB 3GSOA 1PAMA 2ED9A 1S7WB 3KPNA 4TTDD 5JDSB 5ERWA 3DYPA 3LD8B 1OW0C 5F1KC 5IBTL 4P2QB 4P2OC 5ALCL 1KTLA 4PLJC 3KPRB 4XVJH 1JGUL 4HKJA 1Q72L 3Q0HA 3QQNA 4MDJB 2BVPA 4OLWL 3LS4H 3REWA 1RURL 1INEL 2Z8RA 4TQEL 1UZ8B 1D5XB 4LSPL 5D71H 3GJEB 2APFA 3VW3L 4BKLB 1FYTE 4GG6A 2HWZL 2AV7A 3CFJA 3LN4A 2HKFH 5B8CA 4RMTA 1VB9A 3N85L 2BVUA 3WLWC 5BV7H 1RUPH 1OD7A 4E41A 2OCFD 1BEYH 4KTYA 3L5HA 4OZFG 1ES0A 1WQVT 1RAMA 1FPTL 4L8BB 4E9LA 4JPIA 1IC7L 5JIHA 1NUNB 4Z78A 4JEGB 4HMCA 1NAML 3U30B 1QBLH 2R1YA 3MGTA 3QDAA 3RWIA 4O51B 3ULVF 3H6JA 2MQ3A 5C2BH 5GHWH 5GGRB 5DZLA 2HT2C 4NZTL 4HIIB 4H20L 4YBLC 32C2A 1EA9C 4PBXA 3DRTA 2DL2A 4KK9C 3WIHA 4BFEA 1TZIA 2L7JA 2AV1A 3ZKQD 5DRXB 1LO5B 3WLBB 1H0DA 4OV5B 4HW6A 1NC2A 3CLEL 5EO9A 4Z7VB 1E4WH 3FRPA 2ADIA 3EYFA 4A6YB 1CXHA 2ZWLT 3QI9A 2NQCA 3ZT6A 1JTTA 4ONHB 4QHUA 3L5WA 2DQUH 4Y16A 3UJTH 4JREC 4ALAH 1T3FA 4ODSL 4NQXA 1R24B 5ETUA 4L3CB 5DJXB 5J0BA 5IMLA 4X80H 3BKML 1KN4H 3CSBA 3JVGC 3D85D 3UCRA 4EQ2A 5KVFL 1UB6A 2FDBP 2DAVA 1ZLVK 1OGAD 4PGJA 1I1FB 2W60A 1CICB 2AJ3A 5GGTH 1JI2A 4NOBA 4RX4D 3HNVL 3O6KL 4KKCD 5DZOA 3O11A 2OL3H 4JFFA 1LNUB 4O2FB 4PP1D 1EZVY 1P7QA 4LPVA 3U4AA 2VLMD 2AK4A 5I1AA 3FL7A 4POZC 3K8MA 3O81A 4WI4A 5EU6E 2OTUB 4GMSH 5GRVK 3W2DL 1F6LL 3I2CL 5L2JB 1RZJH 3R4DA 4CW1B 4LRIA 5MERB 2V2XA 1MCPH 4XVTH 1JI1A 3RQ3A 3X11B 3OAUH 4OF5A 1MQKL 3AS0A 1PVHA 4LEXH 3CX5K 3VG0H 5FYKE 3RZWA 3NACL 2NY7L 2MKLC 4LPYA 4UV7H 2IAMB 2ICEB 3T65B 5FM8A 2BHUA 1DBBH 2EEDA 1JYXA 4CUCA 3OHXA 3FT3B 1DBAH 1EEQA 2FB4H 1LDPH 2EE9A 2VXSH 1WFTA 3GRWH 1QACA 2UV3A 1FNGB 5FK9A 1ZLUH 2NY6D 5C0AE 1D5ZA 3EFDL 3UMTA 2YBRA 3VWJA 3M07A 1JZ5A 3GDBA 2VLRB 3ZE2F 3SEPA 5L0QC 2NY0C 3KYNA 1YDPA 3GIZL 3RWDB 2WZPD 3WS3B 3ROLB 3U7YH 2P8MA 4NRXA 5T5FH 4KZDH 3HG1E 4IHOB 2R8SH 5DMIL 3T0BA 4KXZH 4M00A 4FFYL 1YMMA 2P49B 2F54B 1I85A 4OGAD 5DHXB 2WANA 3HZYA 4WV1A 2YA2A 4K3JL 15C8H 3PJSB 3H3PH 4R3SB 5GGUA 3TESA 5EZJB 2A73B 4HWEL 3EUUA 3BPOB 4FZEH 4M6NH 4ZOEA 5INDB 2VR4A 1N0XL 3PQYE 3MMEB 3KJ4C 3UP1A 4CRPA 4Y7MA 3S6CA 3UTTE 5IKCB 1BLNA 3T77A 1S9YA 1QLFA 4ZQKA 3QDMD 1NGXB 3MLUL 3LV3A 2D2OA 3GEWB 3ARBA 1Y0LB 4R4FL 5E99L 3P9MA 1RJZB 3I3BA 4X9BA 4D0DA 4KAQL 2NYYC 4DFIA 3UPRA 2CIKA 3BAEH 4NT6B 5I16A 1TJGL 1U95A 4EUPB 1FLRL 5DK0B 3HRZB 3RDTD 2GQHA 2V7NB 5IHLB 2W59A 3LN5B 4JN2A 3PWPD 4F9LA 1U2HA 5J3HD 4H0GA 5LGJA 5E00A 1MWAL 5A16A 4WGWB 4J2XA 1IGYA 4Q6IC 4BUHA 1XGPB 5HGHA 3CZFB 3IFNL 3ARFB 2VDLH 3RPIB 1UKQA 1XIWB 5IJKA 3EO1B 5JXEC 5KG9A 3VD7A 2H3NB 3BT2H 1LVEA 4YX2L 4BFGA 3TBTB 4NRZB 2JCCE 4JM2F 3O6FC 5F7EH 1RZIB 4U2ZA 3V8CA 3HE7A 2EDJA 3BI9X 4RFEB 3DARA 4YQXL 4J4PD 3GSVB 2B2XH 5TDOB 2PTVA 3OAYK 1S9KC 1EEYA 5JOPE 3DPBA 1YNKH 1YNLH 3STBA 5KS9B 3SGDI 1IM9B 1AGEA 3DI3B 4HUVB 1IAIM 5IT2L 4RDQF 5EO0B 4ERSL 2A6DB 3MRMA 4K9EC 2UZYB 2X1XR 3LEVH 1F4XH 4NPYB 1KTDB 3QNXB 4AJ0A 1KXTB 3WNNA 1N3NA 2EXWC 3VXSD 3FB5B 4AMKH 3SGKC 1NUDA 2FIKB 3UTSB 5IB2A 4QY8A 4NNYB 1CF8L 1Y6KR 1AI1H 1B6UA 5T5NF 1YUHA 2CJUL 3QB7C 1AKJB 1L7TL 3A6CL 3H2WA 4YC2B 3V0VA 2HTLD 4N9OB 2EDNA 1RJLA 3QH3A 4OZHB 3LIZH 3NH7L 2GK0A 2FIRT 3B9DA 3QQ9C 2EKSA 5CD3B 1G0YR 1ZGLM 1INDL 3ULUH 1CLZH 1OT2A 3WFEH 4LSSL 3FN0L 2DIAA 4QT5A 3BW9B 4BJLA 3LPFA 2DM2A 3THML 2FEEL 5IEHB 1HCVA 5F1IB 3QULA 3V0AC 1FDLL 2P44B 2ZSVA 3LQZA 4HLZG 4X99A 3RWCA 1SJHB 3SE4A 3V4UH 4ZFFB 2X41A 1BP3B 1VFMA 2XTJB 4UTBH 3WL9B 3L3KB 4JQXC 2HLFC 4JCLA 4HIEA 3QDME 4GRMB 4AL8H 3B9KC 2V6HA 3MLVL 4Y1AE 3F7VB 3MBXH 4JHAL 4BZ2L 2NX5D 3MRDB 1T2XA 1UJTA 1BREA 4JKWA 5FAAA 3SDCA 4HWBH 5FYJH 1CL7I 2M2DA 1ZT4B 1JZ7A 4U7SA 3GZKA 4WI7A 3UZQA 4LDEB 4HV8A 4XP5L 4YO0B 1NBVL 2NNAB 4ZOCA 4OZGB 1CQKA 4EVNB 1K5NA 3CVHB 3DECA 3HZMB 1LP9F 3ZT5A 3GSUA 3R0NA 5I66B 5J4MA 4YFLI 2VXVL 5BQ7A 2UWEA 4HQQL 2ADGA 4QF1B 4OLXH 4L5FL 5T1DL 5DF0A 5L8JB 1EJOL 2G75A 5MHSD 3MJ7A 1Q94B 4N0FA 4AIXA 1MFCH 1MI5B 2IPKA 4YHLH 5IFAL 4EJ1C 2MKWA 1B88A 3SJVB 1HYRC 2FECL 4XC1H 1I3RA 4LLYA 3PL6C 2I9LB 1WBZB 5KJRH 4G8EB 3QEGH 3VWKC 4K7FA 4X6CA 1AR1D 1FVDA 5JOEA 3LRSA 3MA7A 2VDOH 4YUEH 5F9WC 3W39A 1J11A 1DSFL 5DLML 3BQUC 5EU6A 2BZDA 4P9HL 5KVGL 4UI2A 4MAYA 1T6WA 1UVQB 5ABDE 2X4TA 5E5MA 2V17L 5J11B 4FFWD 4YHKL 5KTEL 1ZGLP 3VFUA 3QJFB 5SWSD 2JJTA 3P2TA 2XFXB 3SE9H 3PP3K 1HK6A 2VDPH 3QIUC 3BEWA 1RZFH 2OXGA 1A7NH 4DZ8A 1S7TB 2DLIA 3LQAH 4PTTA 2J5LC 3VFSA 3O3DA 5D5ME 3JUYA 3OB0H 2KZWA 3VGAB 1I7UA 1FE8H 3P3YA 4PG2A 5EFIB 5JOFB 3BZDA 3PV6B 4AEEA 1DQLL 1HQRA 4P9MH 3VMNA 3H42L 1M6OA 2F5BL 3DJ9A 3D3VB 3NABL 3OG4B 3BKCL 4XCEA 5IQ9B 5DJZA 5C0AA 1KF9B 4X7EC 2JJVA 1P9MC 3QDJB 2QSCH 4OQTH 4NNXA 4WFEE 3MV7D 1H15A 2X4NA 3TLRA 4CJ1A 5L2KB 1GGYA 1GC1L 4OGYL 2FH8A 3CDGA 3PWJB 5D7JC 3TPUB 4KC3B 3I6KB 4ZXBB 5ACZB 1S5IL 5M94B 1KCSL 3V5DA 1LGVA 5MENE 3TO4A 4X6DE 4EDWH 1U93A 5EZOL 2YKLL 4HKZB 4O58H 2BP3A 3IGAB 4JRYD 5CMAA 4LQ1A 1T66C 3GBNH 4PJGF 5ISZD 2V9TA 3AS3A 3ES6A 2DI7A 1UADC 4U1IB 4D94A 3TA3C 2Z91B 1E4JA 4CNIB 3UTTA 3TZVD 2JIXD 1HINH 2R1WB 4D0BA 1S8DA 5IW6B 2DQJH 1RZKC 4GAJL 4NYLA 5DEFB 4JFEE 5KAQF 3W5MA 4Y19D 1OGAA 2Q6WB 2AEWA 2CRIA 2GJZB 5C6TL 4RX4A 5DC0A 3QUXD 1I4FB 5B39B 1EO7A 3QG7L 1P4BH 4WWKB 5FGCB 4L9DA 3SN6N 1UXWB 4P5TB 1UWGL 1MIEH 1PZ5A 1ZA3A 1CFNA 2GITB 2HFFA 3GMLB 3EOBA 5FB8A 4IMKA 2NR6D 1T5XB 1U92B 3MJ9H 4KHXH 2A38A 5I8CB 5B22A 1NEUA 4HH9B 5CP3H 3L95B 4X6BB 3RAJL 5C9JB 2FATH 1EO8H 2WQ8A 2NTFB 3CD4A 4K9EH 2H9GA 4HG4J 3H9SD 1QLRA 5C86A 4M9OA 4DGVH 3TJEL 5D2LB 1QG3A 4XVSH 1A3RH 1CI5A 3WXVL 3ZYJA 1UB5B 3FQTB 4PV9A 1OSZA 1I9RL 1C16B 2ZZUT 2ZNXA 1BM3H 2NZIA 4RGNE 4M1GH 4LLVB 2HP4A 2YHGA 1KT2A 1JGVH 4XCNB 5D7SL 2VH5L 3K1KC 2CSPA 3X12A 4R8WH 3GMRA 3MRKA 4U1NB 4YDKL 3DVGA 3QHTC 4YXHH 2VLJD 3VA2C 4Q2ZA 5EU3B 1SYVA 3ARSA 4Y5XB 1A4KA 4PGBB 4LCUA 3ZKXC 3MRCA 3RVXC 1RK0B 3KYKH 1PKQE 1DP0A 4PJ8D 3U1SL 4HGKC 4P3CL 4FTVE 1TVHB 1N4XL 2OJZL 2XOTA 1A22B 1T83A 3F62A 3KR3L 4M62H 3G04B 1WTLA 2W0FB 2V7HB 4K3DH 2HLAA 4P4KD 3IXAB 4NKMA 1IVLA 2CLVA 4BA8A 4DKAA 2NY5H 5D70L 4JO4H 3V4VL 4JRXE 3TNNA 5I6XC 1H3WM 4XNYL 4WWID 3F58L 3MBED 3SE8H 3UYRL 5IG7A 3ARGB 3T09A 3GHBL 3P4OB 5EC1A 4PYGA 4FXKA 3IVKB 5HHOB 2ZOKB 3VFGL 1T1XB 4K3EH 4KV5E 1DQTA 5IESL 2P42B 5C0EA 3KPPA 1I75A 3VG9B 4WW1B 2DIJA 3ZHDA 1D5BA 5DJ8B 3EOAA 4FN0A 5LG1A 3D39E 5IBLD 1U8IA 3QDMA 4N8PA 4APQC 4EI5D 4ZSOE 3QEHA 4ORGB 5T1MA 4B5EA 3L3DB 1FVEB 3SGJA 4R2GD 1ZHBA 3FQUB 3RIAF 1YY8A 3TFKD 4UT7H 5T3ZE 2NZ9D 3MRPA 4IOFC 2QHRH 3SOBH 3K46A 5BRZE 2ARWA 4OFYD 5J6GA 2YD3A 1T0MB 1SY6L 3HE6C 4M93B 3S36X 4UU9B 1G9MC 3T2NL 3PWPA 1JV5B 3K8LA 5E8DH 3RL2B 3MNWB 1VFUA 4X7FC 3DSFH 3PWLA 1R5IB 4PP2A 4RIRA 5A2LH 4G9FE 1Z9SA 5DRWA 5EBWB 5IV2B 3HAEA 3B83A 3C5ZD 4FQ2H 4R0LA 1U6AH 4C56B 5BJTA 1H3TA 3CFBA 4V2BA 5D1QB 2EE3A 3MRGA 5MI0B 4BZYA 5T33L 4F80A 5DJ0B 4EBQH 3G6JB 3N9GH 4Z0XB 4PREB 2BX5A 1JFQL 4AH2A 3QEUA 1BQUA 4POUB 2FX7H 2Z31A 5JW4R 1QO3B 3LZFH 1OP5K 2BNRB 3QO0B 3WHXA 4P23C 1FIGL 3ULSA 3LN9A 4LHUB 4L4VB 3CUPB 4WU7A 1TTUA 5FUZL 4OCRL 2XWTA 2YR3A 1ROWA 3VRLE 1XH3A 2FX9L 1RULH 2J7LA 12E8L 1NCWL 4G6AD 4NWTH 3VXSA 5HXMA 5H2BA 2IBGA 5D5MA 5MEOB 5F7DB 4J3TA 3E8UH 4AIOA 1QSFB 3LKPB 4X0KA 4WEUD 4GW1B 5TJWK 1TZGL 3DV4B 2R56H 1S9WA 2ARJA 4GUPA 5DSCB 3V0WH 4OZFH 3TBWB 2JELH 1Z3GH 5I73B 3S36L 4C55A 3PXHA 4V1DD 5JUEL 3QUZD 1DR9A 4MQSB 2C1OA 2F19H 4JGJA 2YPLD 5HYSB 4PJHF 1QSVA 3S88L 1VADA 5E9DD 5CZKA 3CLFH 1A9EB 2E9BA 1F5WA 3VXRE 5HVFB 2R0WL 1A1NB 1J05B 3BHBA 2FSEB 3BZFB 3LMJL 3IJYA 2XWJB 4OJFH 3IDYC 3S3PA 1G7QB 2NX5A 2R0LL 1HOCA 3NA4A 4JO3H 3KPRE 5MENA 1I7ZB 4X6DA 2V2WB 4DK6A 5EUKB 4NQTA 3QWOA 1BOGB 3DV6B 2CKBH 2X4RB 1UQSA 2SEBB 3D2UD 2V9QA 1QBBA 2BSSA 5FYKL 5I19L 1NGZA 3DOSA 5AYUL 4X5XB 3ZE1F 2EDRA 5C3TA 4MS8D 2JJSC 2X4OA 5LBSL 4I13B 1C7SA 3SGEH 2H6PB 2OI9C 4G43A 4XB8A 1IT9L 2AS5M 1AGBA 1D9KA 1KG0B 1A4JB 3RVWC 4MSWA 3OF6D 1X5ZA 3T3PF 4LARH 3VDBA 3MUY1 4YAQA 2AK1H 4KMTH 4DN3H 1N6UA 1JNLL 1KCUH 2HJLB 4WFGE 1SQ2N 5CJQH 4XBEL 3VD9A 1R3KA 4LGRB 2C4FT 2KBGA 4LAQL 1MCKA 5FDYA 4PGEA 4Z5RB 5FV1L 4LCIH 5KSAB 3QA3A 3ALPA 3L5IA 5CZVL 3UDWA 5LQBH 2NY4C 2OR9L 2OK0H 3O2DH 4U1GC 4WNQB 1T4KA 3M1BB 3P4MB 4KQ3H 1X5YA 1MCBA 2UWEF 1NDGB 3T0DA 5HPMA 4N90E 1S7QB 2CXKA 1KJ2A 4PJ7E 4JY6A 5SWSA 2XZAL 4JZNA 1FFQA 3UAJD 3BO8B 3FT2B 3SE3C 1MIMH 1QBAA 3AREB 1DQQB 5DJCA 1UYWL 2PKDA 3ZTNL 4XXCA 4LASH 2E27L 1G7LA 3FO2A 2LE9A 1KENH 3LD8C 3FCTB 1QYGL 1OLLA 3QNYB 3VD3A 4X6CF 3VDAA 5I1JH 1JN6A 4S1SH 1BGXL 4YWGL 3UYPA 2XG5A 1JWUB 4P2OD 1YY9D 1ED3A 4KUCD 3QAZC 1M7DA 5I8EB 4PLJD 5GGSA 5T5NG 1A3LL 3VXUD 4HZLB 3VRIB 2IH1A 4U1KB 3MA9L 3OKKA 4UILL 2RQ8A 1PKQA 2HJKB 4G8FB 1S5HB 1AE6L 3N1MC 3FFDA 4FTVA 1K2DA 4N0YH 4Z77B 2QQNH 4CU6A 1BIHA 4HIJB 3O2WL 3MV7A 1TQCB 1AGDA 1DL7L 3Q6FB 1QLEL 5IB4B 1Q0YH 2VN4A 6FABH 3FRUB 3E3QC 4ZOBA 4G6ML 3DX7A 1J0HA 4JFDE 4JRXA 4Z7UA 4AEHL 2LAAA 3INUL 3MJ6A 3U30C 3MROA 4P5MB 1V05A 3BVNA 5BCAA 1BX2A 3AM8C 3TIDA 1BHGA 1MCWM 1IC4H 5ISZA 4NQCB 2D7TL 5F89B 1G9MH 1MRCL 2AJUL 5H35B 2F74A 4JKLA 2Y9RT 2ZUWA 2HT2D 5EIIA 5DGRA 1KXVC 1BQLH 1VGEL 5DI8B 4KK9D 2CIIA 4NJAL 3D39A 3K81A 3TZVA 4F2MA 2I07A 3O4LE 5CSZB 4F15B 5KW9L 4ZSOA 2VWEE 2C3XA 4JKPH 4MJ4A 5B39G 2H32H 3JV4A 3CFCL 1NSNH 4J1UB 1BD2E 1Z9OA 1IKFH 4FRWA 4JDZA 3S4SG 3GMOB 3CU7A 1FO0A 2W92A 5SX5K 3FB7B 4NHUB 4NM4H 2DLGA 4TSCH 5BRZA 1L4IA 3QUXA 4PJ5D 4X98B 4FQIL 4R97B 2VLRE 3WJJC 1WGOA 2E6PA 1W0VB 2A77H 4LSQH 4RA0C 5I17A 1ADQA 1CICC 5HHME 1WUNT 1IGCH 1F90L 3VD4A 3ZKMD 2FEEI 1CTNA 3DROA 3GSQB 1NAKL 4FFVC 3VMOA 4GRLB 5FYJD 3P4NA 1LO3L 4PRBA 3H9SA 5D7IF 3TP4A 1GAFH 4R96B 1CLYH 3S96B 1BJMA 4JPVH 2Y36H 1OAXL 1RUKH 5EU4A 3BXNA 1RZ7L 4H1LA 4XCYB 2QV2A 1CFVH 4WW2F 4DUWA 4POZD 5HHXL 1KPRA 1BJ8A 1R0AH 3MLSH 1FL5A 1YC7A 3O6LH 2EZ0C 1QFUH 1C12B 2FHCA 3DX8B 1F45A 2PXYB 3NAAH 4HK0B 1QRNE 1QZ1A 2VLJA 3HC0B 3TF7C 1SEQL 2VDKL 1KNOA 2DM4A 3QJHB 4M6AA 4MNGB 4JGMA 4EXKA 2PW2A 1JK8B 1KIPA 2DRUA 5GGVL 3Q1SH 3NFNB 4RCAA 4ZUVA 3I6LE 4XXDA 2IAMC 3I84A 1Q9WB 1LD9A 4NO0D 5ITBH 1RZ8B 4JFQB 1O0VA 2VL5B 5E2JA 1K6QH 5DMGC 1XF5A 1ZHNA 4P4KA 4PJIA 1FNEB 2GFBA 4NKIH 3VFMA 5K33A 1A6VL 1G84A 2FECI 2Y4SA 4LLDB 1L0QA 3MRBA 2ZCKH 4ESKA 1T2QH 3SKNB 2A83A 5CHNA 3MBEA 5E6YA 3DX9B 3S35X 4HPYL 4HLZH 1EVUA 1BOYA 5I2IB 2DDQL 4OB5H 4O2EB 3DHMA 4JKMA 3I50L 1QFWL 4TNWF 1I9IL 2CRMA 2QBWA 3HRPA 1RIVH 2DYPD 1DQMH 3LVEA 4OIIH 1LE5B 1ZHKA 1CD9B 1JPTL 1CE1L 3VXRA 1AO7D 1MFEL 3FO9B 2EDFA 3ZDXF 3BPOC 4EI5A 43CAA 5DJAA 1RZKL 2DQGH 4PGDA 5FO7A 3ULUE 3RY6A 4FZ8H 4Y8DC 1K3ZA 3Q48A 3HFMH 3I6GA 2H8PA 2DQTL 2EYRB 1VA9A 4GJTB 5TDNA 4FQQB 1NCTA 2EH7H 4GSDH 5DJ2A 3QWQB 4LCWD 1MOEA 4DGYL 1PSKL 4PGZA 5J1AA 3RKDC 3T8XA 1U42A 5D6DA 2D0FA 4UBDD 1UWXK 4OIBA 2AABL 3D18B 2P8LB 3GMNB 1TETH 1AQDB 1G6RB 2NYYD 1KIRA 2RBLA 4MD0A 4JQIL 1CFTA 2F53D 3C5ZA 4BK5A 3PWNB 5C0FA 3BPNB 5JXAH 3WMSA 1NFDB 4PTUB 2UYLA 3FOMA 1AD0A 4P3WA 3QFJD 4L8SB 4JB9L 3O8XB 3K74B 1JWMB 3RWJB 4GXVH 3T1FA 4PRAA 3ARFC 2WK2A 4BH8A 4WO4B 2J4WH 1XIWC 3JTTB 1P4IH 1JHKH 3IDJA 2X4PB 4LHUG 3LAFA 3S35L 4I8DA 3WEXB 5C70A 2H1PH 1X5GA 5GGTA 2DI8A 1PG7L 4R26L 5C07B 4ZODA 4JFXA 3QUMH 4IRJB 1J88A 4QTHA 1YEKL 1XF3A 4PJ7A 3O6FD 4N8CL 4HKXB 4H88L 4JDVA 3TVMB 4J3WA 1KCRH 4OZGE 3QUKA 3TGXA 5FUOL 4ISVA 4YPJA 2ZKHH 2ICWJ 1KPVA 1J1XH 4XX1G 5IM7B 5IWLA 4KU1A 1CU4H 1AJ7L 2GSGB 2A74A 2AEPL 3FB8B 3RL1A 4TUOB 4Y4FD 5BXFB 4XPBH 4MB5A 5B4MC 1MHCB 2NMSA 4MNQD 4XGZB 4BSVA 5I1CH 1M7IB 4JY4A 4J23A 2EXWD 2HFEA 4V1DA 3U6RA 1FFNB 3HZVA 1MLCA 4WY7L 3OAZK 3RX7A 4YC2C 4HBCL 4JZJA 4IDJL 2FJFB 3KPQA 5E9DA 3RJDA 5KSVA 5C0CD 4OD3L 4A6YH 1A6AB 4MA8L 2DQEH 3DURB 4J12A 3QQ9D 3TWCL 5I8OL 3FQNA 4S1DD 4JFDA 4MYWB 4OM1L 3W9DA 1T04B 3GRWA 2XTJC 1NLBL 2LFGA 2R2BA 2EC9U 3CFKA 5KVEL 4QXWA 2QSQA 5D4QA 5I30L 3D2UA 3UBXB 1GSMA 2HLFD 1FCCA 2XNAB 1OGTB 3L7FA 1FNHA 4PY7A 3MRFB 4YDVA 4U6VH 4LCWE 5JDJA 3R8BB 2GJ6B 1X4XA 3OXRA 4HK3J 1NDMB 1LDSA 1B0GB 3O4LA 3I3DA 1WSST 3DGCR 3MR9A 3ZYIA 3KHQA 3OF6A 5F96L 1UJ3A 1ZHLA 4DUXA 4NSKB 3AY4A 3BJLA 3HR5A 1FZOB 4KRLB 5FXCH 1DLFL 2I25N 2C26A 3NIDE 3QDJE 1NEZA 5F71A 1JIBA 1NL0L 4BFBD 5CZXC 3VFRA 5KN5A 2O26U 4UAOB 5CCKL 4U1HA 4P2YA 5EH1A 1KB5B 1U8MA 1V7ML 5FGRA 1I7TA 3NFPA 3BP4B 3ZDZE 1QNZL 5J13B 2OZ4L 1U3HB 1I8LA 1KJ3H 3IAPA 5GGQL 5GRJH 1SHMA 4G8IB 1JZ6A 1OCWH 1FV1A 2L4OA 4K2UL 4G5ZL 3ZO0A 4LPTA 4LVHB 4LLUA 3PL6D 4LMQE 4XPTL 3L7EA 5HY9A 1JNNH 3VWKD 1LEIB 2Q87A 4M48H 4R4NC 43C9B 3KPLA 3BQUD 5J11C 4WCYH 3C60B 4YZFF 4YGVA 5FKAA 1P1ZB 3OGCB 5T3ZL 3WO3B 1EUUA 5ESAB 1QRNA 2HH0H 1FO0L 3HUJB 3MCLH 2ZP0T 4WFHD 1MUJA 4L3ED 3ARDB 4OKVA 2VLKB 1J5OH 4P2OA 4UUJB 5KSBF 1HIMH 1UA6L 1UZ6F 2DM3A 1XGQB 4YHML 5HYJB 5DWUH 3JBG7 3QR2A 1Z0MA 1HXYA 1RHHA 1OTSD 1K4CA 4BH7B 2ATPA 2JB6B 1MAKA 2K7QA 4MZ2A 1E4XH 1G0XA 1CZ8L 4CVZA 4X7SL 1XR8A 1FH5H 5DR5H 1ZSDA 3ULVH 2XN9B 1OARH 4X6FA 3L3OB 4NDMB 2FRGP 4PYHA 2QADB 4H8WC 4UB0L 3C2AH 4HKBA 5D2LE 4PIRF 1BIIB 3QQ4A 1B3JA 3LHPH 4X9IA 5I71B 3BDYH 4MQ7A 4ZXBC 4P2RD 3BH9A 3EYSL 4AEFA 4DWHA 1MCRA 2OLDA 4TSAL 5D7JD 4IS6B 1H3PH 4JJ5A 4PG9A 3TIEA 1KELH 3G6AB 5DJ6B 4FQCL 4IOSD 3P9WB 4QRPB 1CDBA 2GT9B 2XXMB 1VACB 1MJJA 4XMLH 3VGFA 4Y4KB 5JHLL 3QXTA 1V3JA 2BCKA 4LLQB 3H7BA 4YHZL 1BF2A 4MJ5A 4GAYB 1T66D 4G9DA 1QA9A 4P46B 4Z7UF 5DQDH 5LXGL 5DT1H 1HH9B 4MVBC 4LSTH 3QDGD 3AU1B 3RWEB 3R06A 1TVBB 4M7KH 3SHSA 4PJ5A 3DMMB 1Q9KB 4HIXL 2OM5A 2IEPA 2HG5A 4NHCL 2HKHH 3U7WL 2MNUA 1BJ1H 5ESQA 2VZOA 3F12A 5C0IB 4L8DB 4QHKJ 2BNQD 3RGHA 4HJJL 1JMXA 5J1TC 4WWKC 5F97E 3VFTA 3T0EE 1QR1B 3FT4A 1W72L 3DWTA 4ZDHB 4HWBA 2N1KA 5HHOE 3RIFK 1NAMB 3LS4L 3OKNA 3STLB 5D71L 4UQ3B 1MEXL 1MCSA 4PJFB 2HRLA 1FBIH 4HS8L 3S98A 1Q38A 2VE6A 2FJHB 1SBBA 3IU3B 1MRDL 2VXTL 4U1JB 4I48A 4HAGA 2WWKT 1IM3B 2JTDA 2LQRA 5BV7L 5EB9A 1BEYL 4D9RE 1N5AB 2Y06H 4WFHE 1S7XB 3OZ9L 3DTXB 3L3GA 1IAKB 3FQXB 1RUML 1T20A 3VFWA 1XR9B 4NO3B 1RIHL 4U6YA 2YD1A 3PABB 4NO0A 1KXQE 3V52L 4Y5XC 3GI9H 1ZWIB 3EW3B 2B1HH 5FUCC 3GUTA 4KKAC 3AC0A 3OTTA 3D0LB 1KJMB 3D69B 5BMFH 5SV3A 5JLZB 3CJJA 2OSLA 1O7SA 5DDHA 5DK2A 1FNSL 5T3XL 4QNPF 3U4BH 3QCUL 3RVXD 4Q97A 4C56E 4WFFE 4GW5A 4MD5B 5EWIL 4ODVL 3VCLB 3UJTL 5EOCJ 3PE9A 3MLWH 5C09E 2AJZB 3G6JE 3IDGA 3LS5H 4GKSB 2EYTA 2P5WE 2DYPA 3H9YA 3MCKB 4X5WA 5EPMA 1U8HA 1WBXA 2NY3B 4JY5L 5DXWA 4ELMA 1A6UL 3ARGC 4QCIA 4DCQA 1N8ZB 2VQUA 1PZUB 3ZKND 3GSRA 5JNYA 4PJIF 3FQWB 4PJXB 1DUYA 2YOCA 1VEMA 5TE4L 1QEWA 4NOFA 4D9LH 4M6MH 5A1AA 5BZDA 3K80A 3CVHH 5FGBC 4N8VB 2D7QA 2PCPB 5CILL 3VG9C 3GSXB 4GRWF 4HGWB 2P43B 3SDXA 4PJCB 1OB1A 4YBQC 1JMZA 4OQTA 1F8TL 4TVPH 1YMHB 2J8UB 4QO1A 5HHVL 1CVSC 5D1ZB 4E42A 3MFFA 4GMSL 2ATKB 1HDMA 1NGWA 1S7UA 2E7BA 2ZPKH 4APQD 4M7LL 2IJ0C 4I5BA 2OQJB 1S7SA 4IJ3B 4LCWA 2VDRL 2VR5A 1H9VA 2X4UB 4WEBH 2E7CA 3O3EB 4Z7NF 3TBSB 1ZLWK 3L9RA 4M93C 1OAUL 4IOFD 5DD6B 1BZ7A 3I02A 4XVTL 3WIIL 4NCDA 5C8JA 4XBPB 3CCHA 4GG8B 5TH2B 2F53A 3HE6D 4LEXL 5JIKA 1OVZA 3FN3A 3OJ2C 5IJVB 3UTPD 1R5VB 2PW1B 3RUGF 1Z5LB 5C0ND 1UXSA 3V5KB 3CU1A 4FNLL 3QFJA 4JO1L 2AQ2A 4OLUH 1JL8A 2PR4H 4MLIA 5GRUL 4KVNL 2RCSH 1TCMA 5I1EH 4J8RB 1RVFH 2QQKH 3NIFF 4M61A 3L3JA 2DBJA 3BZEB 1SEBA 1LDPL 2VQ1A 2VXSL 4QRRB 5C7XL 3GRWL 1A1MA 2AERT 5F9DC 1E4KC 2GK2A 3P0GB 1OQOA 2DLEA 5D1QC 5CEZL 5MI0C 3EJYC 1BQHB 1KLGB 5E4EB 3ZDYF 1XGYH 1AC6A 3C6SB 2MWCA 5JR1H 1QOKA 3ZE0E 3NCEB 5HGBB 3RZCB 2R4SL 5GRWA 5IHZA 3P11H 4JFPB 3U7YL 2VABB 4PRID 3G5XA 4Q0XL 5FO8A 3P4LA 1PKOA 3JTSB 3OXSB 1U8NA 2R2HA 4JG1L 4DAGH 3MJ9A 3KS0J 1QD0A 4H5SB 2APBA 5CP3A 1YYLH 4H8WH 15C8L 1Q9LB 2AP2A 3FO1A 4Y4FA 3BH8B 3QXAB 1GGIH 2WINA 4OD1L 5DUBB 4MNQA 5K9JH 4J3UA 3MLZH 5DD3L 2ZCHL 4LLMA 4XPAL 5E2VL 2X4QA 4R7NB 3ZTJG 2BOBB 3RTQA 1AQKH 1F4YH 3CXHK 3O41B 4MAUH 1K8DB 1PYWA 4XPHH 2CK0L 1MFDH 3H7LA 3L3IB 3OJDB 5C0CA 5I73C 5GJTH 3MLYL 2VL4A 2ZUTA 1RUQL 1M1SA 4JM4H 3IT8D 3T0WA 4OCWH 1CXIA 1FJ1A 3BAEL 1W8NA 1AHWC 3RBSA 1P7KA 3SDDA 2DBLH 1IKNC 5EA0L 4ZYKA 5IF0A 4C4KT 2A0LC 3BPLB 4QXTA 3CDCA 4WUKH 1GGBH 4WI6A 4QHLA 2DTML 4JQXA 2EKJA 3MRLB 4G7VH 3QYCA 4RNRB 1ZMYA 4TTGA 1NCBH 4MJIE 3IFOB 4BZ1H 2AJXL 1NBYA 2Q8BL 5JW5B 2IAND 1A6ZA 5E8NA 1SMOA 1J7VR 4HIHB 3BT2L 4MWFA 5BS0B 2XQYG 5HHPA 1M05B 1D5IL 5C0DA 4QRQB 2ZG2A 4PR5B 4GLRI 3DXAE 5JHDB 1FZKB 3G9AB 3LKOA 4S1RH 3VFPA 3HMXH 2YMXH 5IVXF 2D7NA 5D7KE 3IF1B 3RBGA 1YNKL 5C0JB 5EUOE 4KDTA 3GNML 2MPAL 3OKLA 4PJDF 2EDHA 3EDKA 3UJIH 3BEVB 4PPTA 5MEQB 1HN1A 4JANB 2KZ1B 1W0YT 3T0EA 1F4XL 4XAWH 4U7KA 2F8OA 4WI8A 5HI4C 4F7EB 4YDJA 4OF3A 3GSOB 3GM8A 5KSAC 3PWVB 4K8RL 5HYEA 2B4CL 3WNLA 4D9QD 3VWKA 1MFNA 4N1EA 5ERWB 2D9QB 2R69H 4QEGA 2NY4D 4U1LA 1KTLB 5CFHA 1YYML 4F7MB 1X5FA 3AGVA 3TYGH 3IDIA 2BVPB 2PF6A 3ULUL 1LO2H 3REWB 1CLZL 5HVHB 4EKXA 5GIRA 3AREC 1DBKL 4ODUA 1ZLUK 4KJYA 2C3WA 4GG6B 3ZL4L 2AV7B 3LN4B 2OMNA 1BAFH 3MOBL 4HWZA 3NPSB 5B8CB 1L0YA 4WI5A 4UTBL 5IP4A 1I1CA 3SGEI 4MQXC 5GS3A 3G6DH 4P99A 4HXAL 4P2QD 5GS1A 5JTWA 3QCTH 4E41B 4V2CB 2V5MA 4FFZH 3NPZB 1ES0B 4ZFZA 3UO1L 4JPIB 2HFGL 4M03A 3F5WB 2FX8H 1KGCD 4OT1H 1FAIH 2R1YB 3MGTB 3RWIB 2YXFA 4NJ9L 5C08E 7FABH 1TQCC 2BY1A 1YEDA 4OCXL 2YD9A 1S7VA 32C2B 3T3MF 1FQ9C 1E28A 1S78C 1LO0H 3GMMB 3AMKA 3H3KA 1TZIB 4P2RA 5EORL 2Z8VC 5C09A 1H0DB 2OBGA 2BY2A 3HPJB 5D7JA 2R23A 1NC2B 4RMQA 2NY2B 1NCNA 3EYFB 1X5LA 2EE2A 3QI9B 4M43H 4XT1C 3A6BH 3IDNA 4DKEH 3QRGH 4GOSA 2HFTA 4MNGE 2DLTA 3BN3B 4K07A 4ODHL 4O9HH 2I26N 3GHEL 1T5WA 2FO1A 2EH8L 4P2CG 4OZFA 5DHVH 4DVRL 2KQMA 2YRZA 3D48R 5E7BA 5IMLB 1DBJH 4G6JH 4UV4H 5KJRL 1NGPL 5CJBA 5D72H 1EHAA 4XPGH 1CIUA 1T0PB 3L6FA 1UB6B 5C9KA 4F15C 5I1IH 2P46B 1WAAF 2AJ3B 1I3GL 3WKNA 3BPCA 5F1NB 4CN6A 3ARVA 3VI3E 4K94H 3WFBH 3O11B 1ORQA 4JHBA 4JFFB 1E0OB 1G9EA 5B21A 4HBQA 3AUVA 5KSUA 1ZTXH 1MHPH 3CX2A 3FKUS 4O5LH 4R97C 5D1XA 3O9WB 3SPVA 4R90H 2FL5A 2NY1D 4NKDA 1A7NL 1Q0XL 5FKPA 4GAFB 3ALXA 4KVCH 3JWNC 4BM7A 1KCKA 4L4TE 1CICD 5E2TH 4PJAF 1HHGA 3ILPA 3JWDC 3C8KA 3TV3L 2IC2A 3EO0A 5HVWA 4GRLC 2LU4A 1BWMA 4P9ML 4IDLA 3QWRD 3IDXH 4FFVD 1ACZA 2HMIC 4LSUL 4LF3B 3NIGE 5FHAL 4JFZL 3BRGC 1IGTA 1A7QH 5AZEL 1WWBX 4OQTL 3NFSL 3MX0A 5IHUH 2HVKB 2JB5L 4LLAA 1EMTL 5DJYA 4HSQA 4XAKD 5AWNL 2A1WL 2PXYC 1HSBB 2KDGA 3WSQL 2EZ0D 2ID5A 2OTPA 1KC5H 2J1KA 2YK1L 3D5OF 1D5ZB 1F11A 1INQA 2YBRB 5D7LE 3VXTA 3EYOA 3E6HA 3GI8H 3O2DA 4NGHL 2ED8A 3PGFH 2UUDH 5C6WH 3QXUA 1YEJL 2WLYA 3FN9A 2P8MB 4NRXB 2IAMD 4XMKH 1TQBB 4LGPB 4ENED 2F15A 1YJDC 1KCVH 3QEQE 1MJ8H 1V5JA 2MSPA 3HZYB 5DMGD 4WV1B 3O3UN 2RFXA 3EFFB 2RR3A 5GS0H 2DLFH 4F7TA 5GGUB 4U33A 3OR6A 4OQ1A 3DVNA 5J1SC 5JPMB 4U7MA 2APVA 4N8VG 1ZANH 3Q3GB 3EZJB 1U58A 4XRCA 3FONA 4QOKB 1AGFB 1ORSB 1UM6L 3WNKA 1BLNB 3T77B 1XGRA 4ZQKB 3FO0L 1V3KA 1GGCL 4XZUA 2HVJA 2CGRH 2F54D 3D87B 2H41A 3ARBB 3N1QC 2QHLA 3U2SA 3P9MB 4AIZA 2N56A 1KLUA 4D0DB 3L3HA 4ZO9A 4Q9QH 2VDQH 2IPUG 4Y5YA 1KFAH 1EO8L 1YPZE 3UPRB 4ELMF 5I16B 1U95B 2GTZB 3L1OH 1CGSL 5FCSH 4MDIA 4JN2B 3VJ6A 4HCRH 3U9PH 3AXLB 3IETA 3SKJH 4R6UA 5LGJB 3BP7A 4PRNB 5A16B 2CRZA 1IGYB 4M1GL 5HGHB 1WZMA 3MRHA 1JGVL 2ILLA 2DQHH 4Z76A 3MXWH 3KYOA 3SDXF 2ORBH 4UOJA 1DDHA 5LGHH 5J6HA 3O6ML 5KG9B 3RKDD 3EDDA 5EUOA 4ZS6C 4MA1B 4OLEA 3V7AG 3BPNC 2AQ3A 2D03H 4PJEB 1A02N 4YXKH 5HI5C 4GXUN 2H32A 3SY0B 4L8SC 3O8XC 3TEUA 4LSRH 4WO4C 1EK3A 1EEYB 1X9QA 4UMGA 4PS4H 1FVCA 3ARFD 5HDBF 1CBVL 1AGEB 3OB0K 2BDNL 1XIWD 2Z4QA 4X7CC 3U36A 5A43C 5TFSH 3WFHA 1S7RA 4EDXA 4YK4B 5A2KH 1YEHL 4IRJC 4ONFL 3EYUH 3TBYA 4FXLA 1J8KA 3ZZ1A 1HEZB 4JRWA 2XXCB 4HC1H 3TVMC 5TQ0L 3WNOA 4QY8B 1JGLH 4EN3A 5HGGS 5IMKB 3HC4L 2GW5A 1YUHB 1J1PL 1FYTB 5HDLA 2WQRA 3UEZA 3V0VB 1IM9D 1GPOH 1RJLB 3BP6A 3QH3B 2GK0B 1CT8A 5TE6H 3D0VB 2D7OA 2BFVH 1N64L 3PV7A 2O5YL 3FOLA 4QT5B 3WFCH 5DQ9A 4HXBL 4M6OH 4UT7L 2I27N 5B4MD 2ZSVB 3LQZB 4X99B 1CFBA 1F4WH 4JVWA 2XKNA 3RVVC 5HGAA 2BRRH 3UTSD 4G80A 2WUBL 4LPUA 1A14H 5C08A 1OAQH 3KYMA 1JUFA 4H26A 1AKJD 4HIEB 2ZUUA 2AJYL 5ICYA 1HKFA 3MODH 3FJTA 4P0DA 1HXMB 4DN4H 1QBML 3MZTA 3SDCB 4OZIA 5TDPA 1AXTL 4YIQA 3JSSA 3ULVE 4D3CH 2R15A 2CK2A 4KKBD 4HV8B 4XI5C 5JW3L 2WWKO 1U6AL 4YPGA 2EIZA 3X17A 4ZMAT 5B3JF 1HWHB 1K5NB 5HYJE 1FNLA 2R39A 5JQHC 2BVTA 1NGQL 3V7MA 2QL1A 4PJBA 5BQ7B 2UWEB 4JJHA 1UGNA 3AVEA 3N9GL 3RWGA 3JWDH 4Z95L 5FM5O 1MREH 4S1QL 2WNGA 1ODAA 1V7NH 4KTEH 5MP6L 4AEIL 2R2EA 5T1KA 5L9DH 4N0FB 5IBUB 2IPKB 2F58H 4AG4H 1NCAH 1I3RB 1YECH 3RJQB 3FB6A 2J88L 4UAOC 3TN0A 1GZQA 2VO5A 3R1GL 1FVDB 4HS6A 2G60L 3TYFA 2C5DC 5TE7H 3MA7B 3W39B 3EGSA 5CZXD 4X4ZA 1FGNH 2PYEE 3S9DB 5EU6B 4B0MM 2X10A 5J13C 1U3HC 4TVPD 4MAYB 25C8L 3JZ7A 5TQ2H 3VGDA 4CKVX 2X4TB 3MNZA 3BKYL 4L4TA 1QFPA 2ZNWA 1KN2H 1DUZA 1UT9A 5CBEA 4Z9KB 4RGOH 1MI5D 5CD5C 2G5BA 1KOAA 3E0GA 2L0DA 3BEWB 3SJVD 5JZ7C 1CGXA 1B2WL 4DZ8B 1DEEB 3V0WL 1F58H 1XGUA 4LVHC 4PTTB 4EOWH 3VFSB 3JXAA 3OKOA 4ODTL 1DVFA 2FGWL 1I7UB 4O02H 1X5KA 3L5JA 2DQCH 1YJDH 3SE3A 3C60C 4Z8FL 3JWOC 1HQRB 4R4ND 1WF5A 5E7FA 3IS1X 5A2IH 5EOQH 5EZIH 5JDSA 1EHNA 1M6OB 3I9GH 2BHZA 3ARDC 4XCEB 5ALBL 1FL6A 5J9PA 4I9WD 5EBLA 5C0AB 5CINH 2BNUA 5D7LA 4U1SA 4OBSA 4NNXB 1BF8A 5LKNA 1H15B 2X4NB 2XWBB 3RY5A 4YHIA 5K9OA 3BP5A 4E5XA 2JE8A 3QUMA 2YPVH 3HG1B 4I3RL 3X14A 1UH3A 2AQ1A 2FBJH 3QEQA 3V5DB 4K71B 4HFWA 2QADC 3D3VD 4IRZL 3TO4B 4J3XA 1U93B 2OS7A 1XF1A 1DQDH 4GKNA 2NTSP 3BESR 4KMTL 5I71C 1G7MA 3PQYB 4X4XA 5L2KD 3EJZC 5FEBA 3ES6B 2O5XL 3KPSE 1AFVH 1KTKE 4F58H 3AM8A 3UTTB 2C3HA 4ZXBD 1KTRL 5GGRA 4M3KB 5IQ7H 2E9IA 1QHOA 1DCLA 5IOPB 4D0BB 1J1OL 1X4YA 1X5HA 1UCBH 4KGLA 1LO5A 4I0KA 4KROB 4NYLB 4Y4KC 4OV5A 1CIDA 5EU7E 5LQBL 4IRSC 1RIUH 5DEGA 1GGTA 3NCJH 4A6YA 3M8OH 4P46C 5DUMH 3NN8A 1YPZA 4ONHA 2AW2A 1CDCA 2EEBA 3IKKA 1PZ5B 3JV0A 1CFNB 4MVBD 2HFFB 5C0GA 3DMMC 3EOBB 5FB8B 1WC7A 2DWDA 5FV2A 3S34H 3GK8L 4YEFA 4UTAH 5DJDB 1D5MA 1EX0A 3S37H 3TT3H 1QVOA 4LASL 1ZV5A 1QRKA 3SDAA 1KENL 3NTCH 1I1FA 3UXFA 2H9GB 1BFSA 5I1JL 1LO4H 5TF0A 5DTFA 1DBMH 1IEAB 1OSZB 3QWRA 1IEBB 4L1HA 2Z92A 2JCCB 3KPMA 3RWFA 3VXNA 3RRQA 1K9TA 4KH2A 3KLDA 1P4LA 3GO1L 3X12B 3GMRB 3MRKB 2OTUA 3DVGB 1LEKA 4OLVH 4YR6A 4Q2ZB 5E1HB 3K2MC 1SYVB 5L2JA 1Q0YL 4CW1A 5I1GH 6FABL 1A4KB 2MQCA 3WFDH 1A0QH 1IAIL 4LCUB