2XPNA

Crystal structure of a spt6-iws1(spn1) complex from encephalitozoon cuniculi, form i
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
138
structure length
138
Chain Sequence
MDPGTVLEISRSLKKRMQDILKKDNANNLEGRPATGKIENVEEISDILMSKALQESLLDEGILDEIKGWLEPLPDKSMPNIKIRKRLLDVLKTMKIHKEHLVTSGVGKIVYFYSINPKESKEVRASAKALVQKWTNEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IWS1
publication title The Structure of an Iws1/Spt6 Complex Reveals an Interaction Domain Conserved in Tfiis, Elongin a and Med26
pubmed doi rcsb
source organism Encephalitozoon cuniculi
molecule tags Transcription
total genus 62
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08711 Med26 TFIIS helical bundle-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 2xpnA00
2XPLA 3OAKA 3HPHE 2B4JC 2XPNA 3HPGG 2N3AB 3O8ZA 3F9KC 2XPPA 3U88C 1Z9EA 1WJTA 3NFQA 2XPOA 1EO0A
chains in the Genus database with same CATH superfamily
4X3RA 1Z8LA 4GPLB 5D29A 3S9LA 2PVWA 2XPOA 4BPXB 3VRPA 3S9MA 2PVVA 3U88C 5ELYA 3BI1A 4OC4A 3PT1A 4NGPA 4P4FA 4MCRA 2N3AB 3D7FA 3BXMA 3SJFA 3SJEA 3FECA 2XPPA 4NGMA 5BY0A 2XEJA 3VROA 3BUWB 5F09A 1B47A 3D7GA 2C6PA 2CIJA 3IWWA 2XEIA 4A4BA 2XEGA 3FEDA 3KASA 4OC5A 3RBUA 4BPWB 3F9KC 3SJGA 3HMJG 4P4EA 3D7DA 4P4IA 1CX8A 3OB2B 1DE4C 4BTFA 3PLFB 4OC1A 2JBKA 3BUXB 2XPNA 4JZ0A 3HPHE 5J3XA 2XPLA 4P4BA 2Y1MA 3S9NA 3BI0A 4OC0A 3VGOA 5F13A 4OC2A 1Z9EA 3VRRA 5HKYA 3OP0A 3SJXA 2VKZG 2XEFA 4BPUB 2Y1NA 3D7HA 4OMEA 4P4JA 4NGQA 3FEEA 4JYWA 3NFQA 5HKWA 5HKZA 2C6GA 3OB1B 4A4CA 4P4DA 4NGSA 4LQGA 1YVHA 4P44A 4MCQA 2OOTA 1FBVA 5AXIA 3BHXA 3FF3A 2DLAA 4MCSA 4NGTA 4P45A 4NGRA 4OC3A 2JBJA 4W9YA 3VRNA 2OR4A 3BUNB 3VRQA 4MCPA 3BUMB 1WJTA 4RR2B 3ZNIA 3BUOB 3OAKA 2B4JC 3HPGG 2C6CA 3O8ZA 3PFVA 2UV8G 4NGNA 2CBLA 1EO0A
chains in the Genus database with same CATH topology
2XPLA 3OAKA 3HPHE 2B4JC 2XPNA 3HPGG 2N3AB 3O8ZA 3F9KC 2XPPA 3U88C 1Z9EA 1WJTA 3NFQA 2XPOA 1EO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XPL A;  3OAK A;  3HPH E;  2B4J C;  2XPN A;  3HPG G;  2N3A B;  3O8Z A;  3F9K C;  2XPP A;  3U88 C;  1Z9E A;  1WJT A;  3NFQ A;  2XPO A;  1EO0 A; 
#chains in the Genus database with same CATH topology
 4X3R A;  1Z8L A;  4GPL B;  5D29 A;  3S9L A;  2PVW A;  2XPO A;  4BPX B;  3VRP A;  3S9M A;  2PVV A;  3U88 C;  5ELY A;  3BI1 A;  4OC4 A;  3PT1 A;  4NGP A;  4P4F A;  4MCR A;  2N3A B;  3D7F A;  3BXM A;  3SJF A;  3SJE A;  3FEC A;  2XPP A;  4NGM A;  5BY0 A;  2XEJ A;  3VRO A;  3BUW B;  5F09 A;  1B47 A;  3D7G A;  2C6P A;  2CIJ A;  3IWW A;  2XEI A;  4A4B A;  2XEG A;  3FED A;  3KAS A;  4OC5 A;  3RBU A;  4BPW B;  3F9K C;  3SJG A;  3HMJ G;  4P4E A;  3D7D A;  4P4I A;  1CX8 A;  3OB2 B;  1DE4 C;  4BTF A;  3PLF B;  4OC1 A;  2JBK A;  3BUX B;  2XPN A;  4JZ0 A;  3HPH E;  5J3X A;  2XPL A;  4P4B A;  2Y1M A;  3S9N A;  3BI0 A;  4OC0 A;  3VGO A;  5F13 A;  4OC2 A;  1Z9E A;  3VRR A;  5HKY A;  3OP0 A;  3SJX A;  2VKZ G;  2XEF A;  4BPU B;  2Y1N A;  3D7H A;  4OME A;  4P4J A;  4NGQ A;  3FEE A;  4JYW A;  3NFQ A;  5HKW A;  5HKZ A;  2C6G A;  3OB1 B;  4A4C A;  4P4D A;  4NGS A;  4LQG A;  1YVH A;  4P44 A;  4MCQ A;  2OOT A;  1FBV A;  5AXI A;  3BHX A;  3FF3 A;  2DLA A;  4MCS A;  4NGT A;  4P45 A;  4NGR A;  4OC3 A;  2JBJ A;  4W9Y A;  3VRN A;  2OR4 A;  3BUN B;  3VRQ A;  4MCP A;  3BUM B;  1WJT A;  4RR2 B;  3ZNI A;  3BUO B;  3OAK A;  2B4J C;  3HPG G;  2C6C A;  3O8Z A;  3PFV A;  2UV8 G;  4NGN A;  2CBL A;  1EO0 A; 
#chains in the Genus database with same CATH homology
 2XPL A;  3OAK A;  3HPH E;  2B4J C;  2XPN A;  3HPG G;  2N3A B;  3O8Z A;  3F9K C;  2XPP A;  3U88 C;  1Z9E A;  1WJT A;  3NFQ A;  2XPO A;  1EO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...