2XPOA

Crystal structure of a spt6-iws1(spn1) complex from encephalitozoon cuniculi, form ii
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
139
structure length
139
Chain Sequence
MDPGTVLEISRSLKKRMQDILKKDNANNLEGRPATGKIENVEEISDILMSKALQESLLDEGILDEIKGWLEPLPDKSMPNIKIRKRLLDVLKTMKIHKEHLVTSGVGKIVYFYSINPKESKEVRASAKALVQKWTNEVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of an Iws1/Spt6 Complex Reveals an Interaction Domain Conserved in Tfiis, Elongin a and Med26
pubmed doi rcsb
source organism Encephalitozoon cuniculi
molecule tags Transcription
molecule keywords IWS1
total genus 57
structure length 139
sequence length 139
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08711 Med26 TFIIS helical bundle-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 2xpoA00
1WJTA 3NFQA 3F9KC 3HPGG 1Z9EA 2XPNA 2N3AB 2XPOA 2XPLA 3O8ZA 3HPHE 3OAKA 2XPPA 3U88C 2B4JC 1EO0A
chains in the Genus database with same CATH superfamily
4NGNA 1FBVA 4NGPA 4W9YA 5F13A 4GPLB 2PVVA 2JBJA 4OC5A 4P4IA 2PVWA 4OC0A 3SJEA 3BUWB 3SJGA 3VRRA 2VKZG 5D29A 3KASA 4LQGA 3HPHE 3NFQA 4NGSA 4P4FA 4OC2A 3BHXA 4P4DA 3O8ZA 1Z8LA 3HMJG 4P45A 4A4CA 2OR4A 3F9KC 2XPOA 2C6PA 3U88C 2JBKA 3OB2B 3BUMB 2XEJA 3PLFB 5AXIA 5BY0A 3VGOA 3D7FA 3FECA 3FEDA 3D7HA 3VRQA 3BUNB 2UV8G 4BTFA 5HKWA 4RR2B 3FF3A 3FEEA 5HKYA 5F09A 3SJXA 2CIJA 4BPXB 3VROA 2XPNA 3BI0A 2Y1NA 4MCQA 4NGRA 3S9MA 2C6GA 3HPGG 3BUOB 4A4BA 5ELYA 5HKZA 1WJTA 4MCSA 1Z9EA 4NGTA 2CBLA 3OB1B 4MCRA 3VRPA 2XEGA 4OC3A 4OC4A 4BPUB 1B47A 3D7GA 3OAKA 2N3AB 3SJFA 3S9LA 3BI1A 4X3RA 4P44A 4NGMA 4JYWA 1EO0A 3OP0A 4P4EA 3BUXB 2Y1MA 3D7DA 4P4JA 4NGQA 3ZNIA 2XPPA 1YVHA 1DE4C 3VRNA 5J3XA 4OMEA 4OC1A 2XPLA 2OOTA 3S9NA 2B4JC 2XEFA 3BXMA 4BPWB 1CX8A 3IWWA 3RBUA 4P4BA 4MCPA 3PT1A 3PFVA 2XEIA 2DLAA 4JZ0A 2C6CA
chains in the Genus database with same CATH topology
1WJTA 3NFQA 3F9KC 3HPGG 1Z9EA 2XPNA 2N3AB 2XPOA 2XPLA 3O8ZA 3HPHE 3OAKA 2XPPA 3U88C 2B4JC 1EO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WJT A;  3NFQ A;  3F9K C;  3HPG G;  1Z9E A;  2XPN A;  2N3A B;  2XPO A;  2XPL A;  3O8Z A;  3HPH E;  3OAK A;  2XPP A;  3U88 C;  2B4J C;  1EO0 A; 
#chains in the Genus database with same CATH topology
 4NGN A;  1FBV A;  4NGP A;  4W9Y A;  5F13 A;  4GPL B;  2PVV A;  2JBJ A;  4OC5 A;  4P4I A;  2PVW A;  4OC0 A;  3SJE A;  3BUW B;  3SJG A;  3VRR A;  2VKZ G;  5D29 A;  3KAS A;  4LQG A;  3HPH E;  3NFQ A;  4NGS A;  4P4F A;  4OC2 A;  3BHX A;  4P4D A;  3O8Z A;  1Z8L A;  3HMJ G;  4P45 A;  4A4C A;  2OR4 A;  3F9K C;  2XPO A;  2C6P A;  3U88 C;  2JBK A;  3OB2 B;  3BUM B;  2XEJ A;  3PLF B;  5AXI A;  5BY0 A;  3VGO A;  3D7F A;  3FEC A;  3FED A;  3D7H A;  3VRQ A;  3BUN B;  2UV8 G;  4BTF A;  5HKW A;  4RR2 B;  3FF3 A;  3FEE A;  5HKY A;  5F09 A;  3SJX A;  2CIJ A;  4BPX B;  3VRO A;  2XPN A;  3BI0 A;  2Y1N A;  4MCQ A;  4NGR A;  3S9M A;  2C6G A;  3HPG G;  3BUO B;  4A4B A;  5ELY A;  5HKZ A;  1WJT A;  4MCS A;  1Z9E A;  4NGT A;  2CBL A;  3OB1 B;  4MCR A;  3VRP A;  2XEG A;  4OC3 A;  4OC4 A;  4BPU B;  1B47 A;  3D7G A;  3OAK A;  2N3A B;  3SJF A;  3S9L A;  3BI1 A;  4X3R A;  4P44 A;  4NGM A;  4JYW A;  1EO0 A;  3OP0 A;  4P4E A;  3BUX B;  2Y1M A;  3D7D A;  4P4J A;  4NGQ A;  3ZNI A;  2XPP A;  1YVH A;  1DE4 C;  3VRN A;  5J3X A;  4OME A;  4OC1 A;  2XPL A;  2OOT A;  3S9N A;  2B4J C;  2XEF A;  3BXM A;  4BPW B;  1CX8 A;  3IWW A;  3RBU A;  4P4B A;  4MCP A;  3PT1 A;  3PFV A;  2XEI A;  2DLA A;  4JZ0 A;  2C6C A; 
#chains in the Genus database with same CATH homology
 1WJT A;  3NFQ A;  3F9K C;  3HPG G;  1Z9E A;  2XPN A;  2N3A B;  2XPO A;  2XPL A;  3O8Z A;  3HPH E;  3OAK A;  2XPP A;  3U88 C;  2B4J C;  1EO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...