2XPOA

Crystal structure of a spt6-iws1(spn1) complex from encephalitozoon cuniculi, form ii
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
139
structure length
139
Chain Sequence
MDPGTVLEISRSLKKRMQDILKKDNANNLEGRPATGKIENVEEISDILMSKALQESLLDEGILDEIKGWLEPLPDKSMPNIKIRKRLLDVLKTMKIHKEHLVTSGVGKIVYFYSINPKESKEVRASAKALVQKWTNEVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IWS1
publication title The Structure of an Iws1/Spt6 Complex Reveals an Interaction Domain Conserved in Tfiis, Elongin a and Med26
pubmed doi rcsb
source organism Encephalitozoon cuniculi
molecule tags Transcription
total genus 57
structure length 139
sequence length 139
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08711 Med26 TFIIS helical bundle-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 2xpoA00
1Z9EA 3F9KC 3HPHE 2XPNA 1WJTA 2XPLA 3U88C 3HPGG 3O8ZA 3OAKA 1EO0A 2XPOA 2B4JC 2N3AB 3NFQA 2XPPA
chains in the Genus database with same CATH superfamily
4W9YA 4LQGA 3HPHE 3VRRA 2XPNA 3HMJG 3U88C 2OOTA 5F09A 2C6CA 3D7HA 1CX8A 4NGQA 3SJXA 4NGTA 4A4CA 4P4JA 3S9MA 5ELYA 4BPUB 3O8ZA 1FBVA 2N3AB 3NFQA 2JBJA 5HKYA 3RBUA 4GPLB 3OB2B 3IWWA 4NGRA 3D7DA 3BUNB 3D7GA 3PLFB 1YVHA 3SJEA 3VRQA 3F9KC 3VGOA 3OAKA 2B4JC 4OC2A 1Z8LA 2XEFA 4OC4A 3PFVA 2DLAA 3S9LA 3KASA 5BY0A 4OC5A 3FECA 2VKZG 3FF3A 1DE4C 4OC3A 5HKZA 3PT1A 4JYWA 1Z9EA 2Y1MA 4P4IA 2PVWA 4P4BA 4OC0A 3BUOB 2OR4A 3SJGA 3S9NA 3ZNIA 3BUMB 4A4BA 5F13A 4NGMA 4X3RA 3FEDA 2UV8G 2JBKA 2C6PA 2XEIA 3VRPA 4NGSA 4NGPA 3OB1B 3BUXB 3VRNA 4BPXB 4P4FA 2CBLA 4OMEA 2XEGA 1B47A 5J3XA 3BUWB 3HPGG 1EO0A 3OP0A 4OC1A 3FEEA 3D7FA 2Y1NA 1WJTA 2C6GA 3BI1A 4MCQA 3BXMA 2CIJA 4P4EA 3VROA 3BI0A 4P44A 2PVVA 4RR2B 5AXIA 2XEJA 4P45A 4P4DA 4BTFA 2XPOA 4JZ0A 5D29A 4BPWB 4MCPA 3SJFA 3BHXA 4NGNA 2XPLA 4MCRA 5HKWA 4MCSA 2XPPA
chains in the Genus database with same CATH topology
1Z9EA 3F9KC 3HPHE 2XPNA 1WJTA 2XPLA 3U88C 3HPGG 3O8ZA 3OAKA 1EO0A 2XPOA 2B4JC 2N3AB 3NFQA 2XPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z9E A;  3F9K C;  3HPH E;  2XPN A;  1WJT A;  2XPL A;  3U88 C;  3HPG G;  3O8Z A;  3OAK A;  1EO0 A;  2XPO A;  2B4J C;  2N3A B;  3NFQ A;  2XPP A; 
#chains in the Genus database with same CATH topology
 4W9Y A;  4LQG A;  3HPH E;  3VRR A;  2XPN A;  3HMJ G;  3U88 C;  2OOT A;  5F09 A;  2C6C A;  3D7H A;  1CX8 A;  4NGQ A;  3SJX A;  4NGT A;  4A4C A;  4P4J A;  3S9M A;  5ELY A;  4BPU B;  3O8Z A;  1FBV A;  2N3A B;  3NFQ A;  2JBJ A;  5HKY A;  3RBU A;  4GPL B;  3OB2 B;  3IWW A;  4NGR A;  3D7D A;  3BUN B;  3D7G A;  3PLF B;  1YVH A;  3SJE A;  3VRQ A;  3F9K C;  3VGO A;  3OAK A;  2B4J C;  4OC2 A;  1Z8L A;  2XEF A;  4OC4 A;  3PFV A;  2DLA A;  3S9L A;  3KAS A;  5BY0 A;  4OC5 A;  3FEC A;  2VKZ G;  3FF3 A;  1DE4 C;  4OC3 A;  5HKZ A;  3PT1 A;  4JYW A;  1Z9E A;  2Y1M A;  4P4I A;  2PVW A;  4P4B A;  4OC0 A;  3BUO B;  2OR4 A;  3SJG A;  3S9N A;  3ZNI A;  3BUM B;  4A4B A;  5F13 A;  4NGM A;  4X3R A;  3FED A;  2UV8 G;  2JBK A;  2C6P A;  2XEI A;  3VRP A;  4NGS A;  4NGP A;  3OB1 B;  3BUX B;  3VRN A;  4BPX B;  4P4F A;  2CBL A;  4OME A;  2XEG A;  1B47 A;  5J3X A;  3BUW B;  3HPG G;  1EO0 A;  3OP0 A;  4OC1 A;  3FEE A;  3D7F A;  2Y1N A;  1WJT A;  2C6G A;  3BI1 A;  4MCQ A;  3BXM A;  2CIJ A;  4P4E A;  3VRO A;  3BI0 A;  4P44 A;  2PVV A;  4RR2 B;  5AXI A;  2XEJ A;  4P45 A;  4P4D A;  4BTF A;  2XPO A;  4JZ0 A;  5D29 A;  4BPW B;  4MCP A;  3SJF A;  3BHX A;  4NGN A;  2XPL A;  4MCR A;  5HKW A;  4MCS A;  2XPP A; 
#chains in the Genus database with same CATH homology
 1Z9E A;  3F9K C;  3HPH E;  2XPN A;  1WJT A;  2XPL A;  3U88 C;  3HPG G;  3O8Z A;  3OAK A;  1EO0 A;  2XPO A;  2B4J C;  2N3A B;  3NFQ A;  2XPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...