2XPPA

Crystal structure of a spt6-iws1(spn1) complex from encephalitozoon cuniculi, form iii
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
137
structure length
137
Chain Sequence
GTVLEISRSLKKRMQDILKKDNANNLEGRPATGKIENVEEISDILMSKALQESLLDEGILDEIKGWLEPLPDKSMPNIKIRKRLLDVLKTMKIHKEHLVTSGVGKIVYFYSINPKESKEVRASAKALVQKWTNEVFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IWS1
publication title The Structure of an Iws1/Spt6 Complex Reveals an Interaction Domain Conserved in Tfiis, Elongin a and Med26
pubmed doi rcsb
source organism Encephalitozoon cuniculi
molecule tags Transcription
total genus 58
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08711 Med26 TFIIS helical bundle-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 2xppA00
2XPLA 2XPPA 3F9KC 2XPNA 3OAKA 3U88C 2B4JC 2XPOA 3HPHE 1EO0A 3NFQA 1Z9EA 2N3AB 3O8ZA 3HPGG 1WJTA
chains in the Genus database with same CATH superfamily
3F9KC 3SJFA 3IWWA 3FECA 1CX8A 3O8ZA 4JYWA 1DE4C 4X3RA 3VROA 4GPLB 3S9LA 4MCSA 4OC5A 5AXIA 4P4BA 3BUXB 2XPNA 2XEGA 4W9YA 4OMEA 4NGNA 2Y1NA 2XEFA 3OB2B 3SJEA 5BY0A 2XEJA 2PVWA 4NGRA 3VGOA 2XPLA 2XPPA 5ELYA 3FEDA 3OAKA 5F13A 3HPHE 2CBLA 3RBUA 2C6CA 5F09A 3PLFB 3VRRA 2DLAA 4A4BA 1EO0A 4P4EA 4JZ0A 3BUWB 3BUNB 3D7GA 2B4JC 1Z9EA 4BPXB 3BI0A 3ZNIA 2OOTA 2UV8G 4OC2A 3PFVA 2N3AB 2XEIA 1FBVA 3OP0A 3BUMB 4P4JA 3BI1A 4P45A 2Y1MA 1Z8LA 4OC4A 4P44A 3D7HA 4MCRA 4BPUB 2JBKA 3SJXA 4NGTA 3VRQA 4NGMA 3S9NA 4P4DA 1YVHA 4RR2B 4OC0A 3BHXA 3OB1B 5J3XA 3KASA 4OC3A 4P4FA 4A4CA 2CIJA 3NFQA 5HKYA 3HPGG 5D29A 3BUOB 3U88C 3FEEA 3BXMA 3D7DA 4NGSA 4OC1A 3HMJG 2C6PA 4MCPA 5HKZA 3PT1A 4LQGA 2JBJA 2OR4A 3S9MA 4NGPA 4NGQA 3D7FA 5HKWA 4P4IA 4BTFA 2XPOA 2VKZG 3SJGA 3VRNA 3VRPA 1B47A 2C6GA 4BPWB 4MCQA 1WJTA 2PVVA 3FF3A
chains in the Genus database with same CATH topology
2XPLA 2XPPA 3F9KC 2XPNA 3OAKA 3U88C 2B4JC 2XPOA 3HPHE 1EO0A 3NFQA 1Z9EA 2N3AB 3O8ZA 3HPGG 1WJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XPL A;  2XPP A;  3F9K C;  2XPN A;  3OAK A;  3U88 C;  2B4J C;  2XPO A;  3HPH E;  1EO0 A;  3NFQ A;  1Z9E A;  2N3A B;  3O8Z A;  3HPG G;  1WJT A; 
#chains in the Genus database with same CATH topology
 3F9K C;  3SJF A;  3IWW A;  3FEC A;  1CX8 A;  3O8Z A;  4JYW A;  1DE4 C;  4X3R A;  3VRO A;  4GPL B;  3S9L A;  4MCS A;  4OC5 A;  5AXI A;  4P4B A;  3BUX B;  2XPN A;  2XEG A;  4W9Y A;  4OME A;  4NGN A;  2Y1N A;  2XEF A;  3OB2 B;  3SJE A;  5BY0 A;  2XEJ A;  2PVW A;  4NGR A;  3VGO A;  2XPL A;  2XPP A;  5ELY A;  3FED A;  3OAK A;  5F13 A;  3HPH E;  2CBL A;  3RBU A;  2C6C A;  5F09 A;  3PLF B;  3VRR A;  2DLA A;  4A4B A;  1EO0 A;  4P4E A;  4JZ0 A;  3BUW B;  3BUN B;  3D7G A;  2B4J C;  1Z9E A;  4BPX B;  3BI0 A;  3ZNI A;  2OOT A;  2UV8 G;  4OC2 A;  3PFV A;  2N3A B;  2XEI A;  1FBV A;  3OP0 A;  3BUM B;  4P4J A;  3BI1 A;  4P45 A;  2Y1M A;  1Z8L A;  4OC4 A;  4P44 A;  3D7H A;  4MCR A;  4BPU B;  2JBK A;  3SJX A;  4NGT A;  3VRQ A;  4NGM A;  3S9N A;  4P4D A;  1YVH A;  4RR2 B;  4OC0 A;  3BHX A;  3OB1 B;  5J3X A;  3KAS A;  4OC3 A;  4P4F A;  4A4C A;  2CIJ A;  3NFQ A;  5HKY A;  3HPG G;  5D29 A;  3BUO B;  3U88 C;  3FEE A;  3BXM A;  3D7D A;  4NGS A;  4OC1 A;  3HMJ G;  2C6P A;  4MCP A;  5HKZ A;  3PT1 A;  4LQG A;  2JBJ A;  2OR4 A;  3S9M A;  4NGP A;  4NGQ A;  3D7F A;  5HKW A;  4P4I A;  4BTF A;  2XPO A;  2VKZ G;  3SJG A;  3VRN A;  3VRP A;  1B47 A;  2C6G A;  4BPW B;  4MCQ A;  1WJT A;  2PVV A;  3FF3 A; 
#chains in the Genus database with same CATH homology
 2XPL A;  2XPP A;  3F9K C;  2XPN A;  3OAK A;  3U88 C;  2B4J C;  2XPO A;  3HPH E;  1EO0 A;  3NFQ A;  1Z9E A;  2N3A B;  3O8Z A;  3HPG G;  1WJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...