2XPPA

Crystal structure of a spt6-iws1(spn1) complex from encephalitozoon cuniculi, form iii
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
137
structure length
137
Chain Sequence
b'GTVLEISRSLKKRMQDILKKDNANNLEGRPATGKIENVEEISDILMSKALQESLLDEGILDEIKGWLEPLPDKSMPNIKIRKRLLDVLKTMKIHKEHLVTSGVGKIVYFYSINPKESKEVRASAKALVQKWTNEVFK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IWS1
publication title The Structure of an Iws1/Spt6 Complex Reveals an Interaction Domain Conserved in Tfiis, Elongin a and Med26
pubmed doi rcsb
source organism Encephalitozoon cuniculi
molecule tags Transcription
total genus 58
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2010-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08711 Med26 TFIIS helical bundle-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.930.10 Mainly Alpha Up-down Bundle Transcription Elongation Factor S-II; Chain A Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 2xppA00
3HPHE 2XPOA 3NFQA 3F9KC 2XPNA 2N3AB 1WJTA 3O8ZA 3U88C 3OAKA 1EO0A 2B4JC 2XPLA 1Z9EA 3HPGG 2XPPA
chains in the Genus database with same CATH superfamily
4X3RA 3VRRA 2XPOA 3OAKA 4P4BA 2CIJA 4NGQA 4OC4A 4OMEA 2DLAA 4BPWB 3PT1A 2Y1NA 3SJGA 3D7GA 4OC5A 2UV8G 5HKWA 4P4IA 3SJXA 3NFQA 3IWWA 3D7FA 3PLFB 4W9YA 3FF3A 4NGMA 3HPHE 4P44A 3OB2B 3KASA 3BUNB 4OC0A 3HMJG 2XPLA 2C6PA 3HPGG 2VKZG 4GPLB 3BHXA 1WJTA 3BUMB 3S9MA 2B4JC 2CBLA 3S9NA 2C6CA 4MCRA 2N3AB 4P4EA 3BUXB 3RBUA 3VRQA 5HKZA 1CX8A 3FEEA 2XPNA 3OP0A 4P45A 3SJEA 3VGOA 2JBJA 4OC2A 2XEFA 4A4CA 4P4DA 2XEJA 2XEIA 3D7HA 3FEDA 5F09A 5HKYA 3U88C 4JYWA 4JZ0A 4NGRA 2JBKA 4A4BA 3BXMA 2PVVA 4NGSA 4BPUB 4LQGA 1YVHA 2XEGA 1EO0A 3BI1A 3SJFA 3O8ZA 4OC3A 4MCQA 4MCPA 3FECA 2OR4A 4NGPA 3S9LA 1FBVA 4P4JA 3ZNIA 3OB1B 5F13A 2Y1MA 2XPPA 1B47A 5AXIA 3VRNA 3D7DA 4OC1A 5J3XA 4NGNA 5ELYA 4BTFA 5D29A 3PFVA 4RR2B 2PVWA 4MCSA 4BPXB 1Z8LA 3BI0A 3BUOB 3VRPA 5BY0A 1DE4C 3BUWB 3F9KC 4NGTA 2C6GA 4P4FA 2OOTA 1Z9EA 3VROA
chains in the Genus database with same CATH topology
3HPHE 2XPOA 3NFQA 3F9KC 2XPNA 2N3AB 1WJTA 3O8ZA 3U88C 3OAKA 1EO0A 2B4JC 2XPLA 1Z9EA 3HPGG 2XPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HPH E;  2XPO A;  3NFQ A;  3F9K C;  2XPN A;  2N3A B;  1WJT A;  3O8Z A;  3U88 C;  3OAK A;  1EO0 A;  2B4J C;  2XPL A;  1Z9E A;  3HPG G;  2XPP A; 
#chains in the Genus database with same CATH topology
 4X3R A;  3VRR A;  2XPO A;  3OAK A;  4P4B A;  2CIJ A;  4NGQ A;  4OC4 A;  4OME A;  2DLA A;  4BPW B;  3PT1 A;  2Y1N A;  3SJG A;  3D7G A;  4OC5 A;  2UV8 G;  5HKW A;  4P4I A;  3SJX A;  3NFQ A;  3IWW A;  3D7F A;  3PLF B;  4W9Y A;  3FF3 A;  4NGM A;  3HPH E;  4P44 A;  3OB2 B;  3KAS A;  3BUN B;  4OC0 A;  3HMJ G;  2XPL A;  2C6P A;  3HPG G;  2VKZ G;  4GPL B;  3BHX A;  1WJT A;  3BUM B;  3S9M A;  2B4J C;  2CBL A;  3S9N A;  2C6C A;  4MCR A;  2N3A B;  4P4E A;  3BUX B;  3RBU A;  3VRQ A;  5HKZ A;  1CX8 A;  3FEE A;  2XPN A;  3OP0 A;  4P45 A;  3SJE A;  3VGO A;  2JBJ A;  4OC2 A;  2XEF A;  4A4C A;  4P4D A;  2XEJ A;  2XEI A;  3D7H A;  3FED A;  5F09 A;  5HKY A;  3U88 C;  4JYW A;  4JZ0 A;  4NGR A;  2JBK A;  4A4B A;  3BXM A;  2PVV A;  4NGS A;  4BPU B;  4LQG A;  1YVH A;  2XEG A;  1EO0 A;  3BI1 A;  3SJF A;  3O8Z A;  4OC3 A;  4MCQ A;  4MCP A;  3FEC A;  2OR4 A;  4NGP A;  3S9L A;  1FBV A;  4P4J A;  3ZNI A;  3OB1 B;  5F13 A;  2Y1M A;  2XPP A;  1B47 A;  5AXI A;  3VRN A;  3D7D A;  4OC1 A;  5J3X A;  4NGN A;  5ELY A;  4BTF A;  5D29 A;  3PFV A;  4RR2 B;  2PVW A;  4MCS A;  4BPX B;  1Z8L A;  3BI0 A;  3BUO B;  3VRP A;  5BY0 A;  1DE4 C;  3BUW B;  3F9K C;  4NGT A;  2C6G A;  4P4F A;  2OOT A;  1Z9E A;  3VRO A; 
#chains in the Genus database with same CATH homology
 3HPH E;  2XPO A;  3NFQ A;  3F9K C;  2XPN A;  2N3A B;  1WJT A;  3O8Z A;  3U88 C;  3OAK A;  1EO0 A;  2B4J C;  2XPL A;  1Z9E A;  3HPG G;  2XPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...