2XQ6A

Pentameric ligand gated ion channel glic in complex with cesium ion (cs+)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLR4197 PROTEIN
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein
total genus 73
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq6A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq6A01
4A97A 3PMZA 3WTJA 5AFMA 5J5HA 3TLWA 2WZYA 1I9BA 3JAEA 2BR8A 5FJVA 4QH1A 2Y57A 2YKSA 3U8LA 3UU4A 2Y56A 3RHWA 4AFTA 3JADA 4UM1A 3RQWA 5L4HA 2M6IA 3TLVA 3PEOA 4IL4A 4ILCA 2WN9A 4D01A 2XQAA 2BYRA 2LM2A 2BG9E 3WTNA 1OEDA 5J5GA 2ZJVA 2XZ5A 2BR7A 5J5IA 4ZRUA 2XQ8A 4B5DA 5LXBA 2LKHA 5HEGA 5J0ZA 4AFHA 2BG9A 4QABA 4ZK1A 1UX2A 2BYSA 4LMKA 2C9TA 1OEDE 2XQ3A 2MAWA 3EAMA 4HFDA 4HFEA 4LMLA 3U8KA 4ZR6A 2KSRA 2Y58A 2XQ4A 4XHEA 4HQPA 3UQ4A 2VL0A 2WNCA 4BFQA 3WTLA 2BYNA 4TNWA 2Y7YA 4FRRA 2YOEA 4ZK4A 3UU3A 3P50A 5HEJA 2BYQA 2UZ6A 4AFGA 4Z91A 5BP0A 4LMJA 2X00A 3P4WA 4HFCA 5HEUA 3C79A 5AFJA 4ZJTA 3EI0A 3RI5A 2YMDA 3IGQA 2ZJUA 4UM3A 5AFLA 2Y54A 5HEHA 2X00D 4TWHA 3WTOA 4QH4A 4NZBA 3WTKA 5L47A 5TVCA 5BW2A 4ZZCA 3C84A 4HFHA 2XZ6A 2XYSA 4TWDA 2YMEA 5BRXA 5JMEA 4UM3P 5HCMA 4UY2A 5AINA 2XQ5A 3ZKRA 2PGZA 4UM3S 3RQUA 4COFA 5SYOA 3U8JA 5L4EA 4DBMA 5CFBA 4F8HA 5AFMB 4IREA 3SQ6A 3TLSA 4TWFA 1UW6A 4X5TA 3UU5A 2YN6A 3ZDGA 3T4MA 3U8MA 2W8FA 5AFHA 2XQ6A 4IL9A 5HCJA 3SH1A 3WIPA 3LSVA 3UU8A 3SQ9A 3RIFA 4HFBA 2BJ0A 4PIRA 2WNLA 3WTMA 5HEOA 2XNVA 4WV9A 5KZUA 3UU6A 3WTIA 4A98A 4ILBA 3EHZA 4QAAA 3JAFA 3TLTA 3UUBA 4ZJSA 2BG9C 2QC1B 4ALXA 5AFKA 2WNJA 4HFIA 2XNUA 3TLUA 3UQ7A 2M6BA 4Z90A 3GUAA 3SIOA 3U8NA 2BG9B 5CO5A 2XNTA 4XK9A 1UV6A 2LKGA 2PH9A 2XYTA 5J5FA 4ILAA 3RIAA 4QACA 4BQTA 3WTHA 4ZZBA 2LLYA 2XQ9A 4EZ1A 4NPPA 4UXUA 5IUXA 3ZDHA 5KE4A 1OEDC 4QH5A 2BYPA 5AFNA 4TNVA 2XQ7A 5LG3A 2W8GA 1OEDB
chains in the Genus database with same CATH superfamily
3PMZA 1HNWT 4DV0T 5L4HA 2CXFA 2VURA 4EAHA 3ANWA 3AAEB 2ZLYA 1CHUA 4TV9E 3KDSE 3CMLA 2KWIB 4JI2T 5J5IA 3ZCIA 4CN6A 3OTOT 4PJNA 4B3ST 3G06A 4AFHA 5HXSA 2IDOB 3EAMA 2LSKA 4XBFB 2KSRA 4XHEA 2D0TA 4GIWA 2HPLA 4U7IA 4E7ZA 2X9XA 5CGMA 1SE7A 3HKBE 5HXHA 3EI0A 2VKHA 3ZT5A 1HG5A 2C0SA 4P09A 2RPAA 5AQSB 5CJ5A 5ETWA 4YHHT 3GA8A 2H3RA 3RC3A 1XWMA 1KEYA 5AQUB 4FJOA 2UXDT 4IT4A 3EDUA 4B3TT 3VR9A 2LRLA 2DCFA 3LSVA 4MALA 4JUYA 4BJMA 2BJ0A 5AQFB 4YT0A 4L5GA 2ZM8A 3AECA 3ZSTA 2K24A 3R6NA 4ZS3A 2H7OA 2Y48B 1N34T 4CN4A 3ESLA 1L0VA 1BR4A 3QNUA 4EZ1A 5KE4A 3UUNA 2E2AA 3ZYMA 1ZOYA 5AFNA 3CK6A 2KXPB 2W8GA 2ACXA 3NKZA 2KLQA 4DV4T 3AE2A 4NXMT 1D1AA 1ZKEA 3FHNA 3RKOA 3O4XE 4IL4A 5HWXA 2BYRA 3OYZA 1MMNA 3PU8A 3ZMVB 2V7MA 5JDNA 3KINB 2D2SA 4X1YE 5HWYA 2ZJVA 3HA4A 4ZHQE 1UGOA 2W2UA 3MA9A 2XAFB 1LKXA 3RGLA 2FJEA 3PUVF 2LOSA 2CEAA 2JMKA 5FMNA 2LRKA 1YKEB 2BYNA 1WCRA 4U33A 3P50A 5BP0A 3ONJA 3CX8B 4DBQA 4X64T 2VKOA 3AXJB 3ONLC 5JQGE 3ZT6A 2B1EA 1MMDA 4MLKA 4ISTA 5AQPB 3TLSA 2NTYA 4TWFA 2V6YA 2CE7A 4UV9B 3RKGA 4AQYT 4QXCB 2XHEB 2XAJB 5HXEA 3JAFA 1WFDA 4KHPT 1VCTA 2V7KA 2K48A 1BR2A 2A2FX 5AQMB 2EHOC 1KK7A 4BQTA 4KX6A 2W0GA 4C90A 1OEDC 1D0XA 4H63V 3O9XA 5AQGB 2GK9A 4GKKT 4L9IA 2NW9A 3ZEFB 5DJQC 3LK42 4UM1A 4KP3C 4TN7B 4ILCA 4LF6T 5KX5E 4O4LE 2LEHA 2DI4A 5LGTB 2CBJA 3MK7C 2E8IA 1IZNB 4HKAA 4JI6T 4H9RC 3E22E 3PU3A 4OFZA 2MAWA 4ILUA 4ISSA 2Y7YA 1V9DA 1KF6A 2E9XD 4DR2T 5L3CB 3QUJA 5JDGA 3NRXA 1FIOA 3N2KE 3IGQA 5C8YE 3C4WA 2X51A 4AKRB 2UU9T 3RC8A 3ZYKA 4ZZCA 2X0LB 2AE9A 4LFAT 3I9YA 3OKQA 2IUBA 4UM3S 2E5LT 3ETVA 3OVUA 1FEWA 4JI0T 2WWUA 2IC6A 4ZI2C 2LSYA 3H3AA 2EHOB 3N9PA 4DNDA 2KT9A 4MFRA 2WNLA 4IIJE 3UUXB 5C3JA 2X9WA 4H9NC 4X66T 4O4HE 5TAOA 4A98A 2BS4A 4QAAA 2X66A 4U7YA 2IHR1 2QRXA 4DMVA 3AEAA 2IIUA 1KNZA 1OXZA 4GK5E 4YSXA 5J5FA 2UUCT 2E9XB 3N9OA 5L2LA 4MBQA 4JBWF 3KFWX 1R8IA 3TLWA 2BR8A 1M7KA 4EEBA 2YKSA 4QXBB 3Q5DA 1U5PA 2WM9A 2L8KA 2VVNA 3PEOA 2CBIA 5HAXA 5JVDE 1NENA 3WTNA 4HFVA 3EDVA 2LHNA 5JREA 1UX4A 4O2BE 4EIWA 5LJNA 2HN1A 4LMLA 5IWAT 3ZLIA 3ZMZB 4ZXLA 3FZLB 2BYQA 3ZN0B 4KMCA 3F57A 3BQKA 2LT3A 4UM3A 1B7TA 3P4SA 2CPTA 4PFPA 4KBMB 3I1AA 4IE0A 2BKNA 4YJ2E 4DIDB 3KV5A 2KINB 1YKHB 2C5IT 3EUHA 4H63H 2C5JA 3ZKRA 4U2ZA 2W8FA 3AA0B 2UXXB 4TUYE 4PIRA 3P8CD 3UU6A 4AQFA 2RP4A 2XJ7A 3AE8A 4ZJSA 2E5VA 2WB5A 4HFIA 4UVAB 3GUAA 1KNPA 2W62A 4XK9A 2LKGA 4E7SA 4QACA 4P1NA 5AQKB 3KVBA 5BR8T 2WP9A 5LG3A 2MPKA 5LP6E 5JR9B 5J5HA 2DLRA 5C2TA 1HCIA 2E9XA 5HYAA 5FXWA 2N9DA 3B5MA 2MOZA 1HX8A 2CRBA 1VRBA 2WBLA 2LE8A 1T98A 2XQ8A 2P9BA 2WDQA 3KV9A 5BMVE 3JCFA 2QA7A 2XQ3A 4YJ3E 1YXRA 3PTRB 4YXDA 4JEUB 4U2YA 4F6RC 4CN1A 5FXXA 3UQ4A 1UK5A 3L8RA 1XMOT 4ANJA 4KUMB 1S35A 5AQLB 3P4WA 3N9LA 3N9NA 4UV8B 2CM0A 2Q9QD 1QSDA 1W9RA 4LFCT 3AAIA 2R6GF 1MNDA 3U8JA 2AXDS 3PUZF 3AB3B 3AE5A 5JDLA 3N5LA 1UX5A 4WW0A 3PDYA 5ADXL 2CLYC 3ZC1A 4DUZT 2DL1A 4DVDA 4AKLA 4MHCA 4HWFA 2X9HA 1BR1A 4K0UA 3HI2A 2BG9B 2W4XA 2K3WA 3AEGA 4X20E 4CZZB 5HXCA 5LGUB 3P7IA 4AKIA 3OYXA 3AE3A 1HTJF 5AFMA 2ZM2A 3L3PA 3EABA 4HN9A 3EVYA 2LM2A 5LJMA 4KI0F 1G73A 1IBLT 3MZKB 5LB7B 2JQKA 2C9TA 3A7MA 3AEFA 3ABVA 5L3GB 5ABEA 4X65T 2X00A 5HXRA 2JPFA 1FMWA 3IBPA 5CA0E 4UVCB 4BAYB 2ZJUA 3VR8A 3ZT7A 3NBXX 2WS3A 4HWCA 4JI1T 1HNXT 3NRYA 3H37A 3HKCE 3J7Yq 1JNRA 2XQ5A 5KXJA 2PGZA 3ZMTB 5CFBA 1MIWA 4F8HA 4K0KT 4ASKA 3VRAA 2YN6A 3ZDGA 1US7B 3WIPA 3SH1A 3UU8A 5JTGA 5LG4A 2CWOA 5L3DB 5AQNB 1Z8UA 3BK9A 2QC1B 2BZBA 4O8SA 4X1IE 2XQYA 4AI6A 4ILAA 5J2UE 2NTXA 4DV5T 5JRCB 3C4XA 1ZEEA 5L3BB 5FY7A 2FUPA 4ZI3C 1XDPA 2W00A 2N2NA 4UF0A 1IBMT 1I94T 3RHWA 4AFTA 4JI5T 4FI5A 3U3IA 4P0BA 2XQAA 2Q9QA 3AA7B 5LOVE 3T8OA 4GYRA 4B5DA 5LMUT 3K1SA 4AIUA 2L3LA 4EXTA 4ZK1A 2IC9A 2V5CA 2FJBA 4ZR6A 1FMVA 3WTLA 2DNXA 3RH3A 3BQIA 4ADZA 5FL1A 4CI3B 4EB6E 2CMRA 2JIWA 2HHHT 3K8PC 3R84B 4TWDA 5HCMA 2DWGA 4I55E 3RQUA 2W67A 5CA1E 4DBMA 2WY2A 5EK3A 4AXPA 3RRCA 4IREA 2WZHA 2V7LA 1UW6A 1WR0A 4X5TA 2UUAT 5L3EB 3A8YC 1YQ3A 3RYCE 4IE7A 3F2EA 4PFOA 3N2GE 2BDEA 2XASB 3PUSA 4LF4T 2NR4A 3ZC0A 2BKOA 3SIOA 5E0OA 2PJQA 4QX7B 3AEDA 2OV9A 1W0AA 4I0UA 4ZZBA 2LLYA 3RYHE 5IUXA 2XY8B 4NXNT 3MACA 3NWIA 3JC6C 5KDMC 2MYSA 3K3QC 4V1Av 4HWHA 3ZSSA 3RF1A 5DQVA 4EOZB 3PJAJ 5JH7E 3J9X1 1MNEA 3NZQA 3K3NA 3RIUA 3AE6A 1Z0PA 2ZM0A 5EK4A 4AQFC 1WYBA 2XAGB 1NWMX 1T72A 1U4QA 4UELA 1GQEA 2YDRA 2XQ4A 2HN2A 3RLFF 2WDVA 3UU3A 1M62A 4X1KE 2EHOD 3SRZA 2Y54A 4JI4T 3CWZB 3WTOA 3WTKA 5BW2A 4EYUA 5AQIB 2V6XA 5JMEA 5AQHB 1NEKA 2V8SV 5LGNB 3U8MA 2Z6EA 4CQIA 4UIGA 4U72A 2SPCA 2LOPA 4QHOA 3ONXA 4WYVA 1O3XA 1YQ4A 2V7IA 4TZ4C 1UV6A 3AXJA 5F8PA 1JNZA 2WMOA 4IE4A 2VQET 4L0RA 2JQ9A 2NP9A 2NOXA 1E1HB 1OEDB 1IJ6A 3UUMA 3P4RA 1HG2A 2WQYA 3JADA 2VK9A 4A56A 2WN9A 3O1JA 3CX6B 1MMGA 3KBUA 4KHZF 1KNRA 4EZ4A 3VU7H 2BR7A 3GN5B 1J5WA 4LF5T 3SS1A 2VL8A 2JMHA 4QABA 2XAQB 2BYSA 4HFDA 2YDSA 4TV8E 4TNWA 1OWAA 4ZK4A 1AJ3A 2UZ6A 4PK6A 3IF8B 4LMJA 1N36T 3SOLA 5LBMA 3L09A 4TWHA 4GK0E 3C84A 2YMEA 5IHYA 5LHHB 3KV4A 5H6RB 3PUGA 4NUVA 4Z8XA 4BJNA 4TX5A 5AFHA 2BS2A 3VRBA 2XNVA 2YK0A 3OJAA 2J4GA 4ALXA 5FY1A 3LBXB 1SHZC 1CUNA 5J1GA 3BQLA 5CO5A 3RIAA 1D1BA 3NZPA 5FVKA 1XZYA 5JDMA 4QH1A 2A72A 3VKGA 1E7PA 2EHOA 2ZM6T 5AQOB 3DP7A 3CQCB 2X67A 1LVFA 1OEDA 2YU2A 5J5GA 5AQTB 2I6HA 3PUQA 5LMNT 1D0YA 4JLEA 4DR3T 1J1JA 4LMKA 2VKDA 3TKLB 3AE7A 3MXZA 2YOEA 3KVAA 3VHLA 5HEJA 3GN5A 3PV0F 1I6ZA 4Z91A 4HTEA 1UCUA 4ZJTA 2XUEA 4A5XA 5FL0A 5LCYA 4XAXB 2FBWA 3I0QA 3DJBA 4NZBA 4JEHB 3DTOA 2LHRA 4HFHA 3C50A 5BRXA 4DV3T 3CPZA 4B6XA 4GKJT 3ZJ2A 3T4MA 3CX7B 4NIQA 4DR1T 3AA6B 3ANWB 4DR4T 2Q9QC 5FVLA 4YHJA 5KZUA 4QKNA 1T7SA 3UFEA 3QB5K 2XSBA 4Z90A 2BS3A 4DR6T 2XNTA 3C98B 3W15B 2XYTA 1WLXA 5AQRB 5LA6E 2VQFT 3WI3A 1QLBA 4TNVA 3WAJA 2BVLA 4ZEYA 3RPUA 4O2AE 1YD8G 5GONE 3KBTA 2M6IA 4OK0A 4DV2T 2JJ9A 1MIYA 5AFUL 2W61A 3PE0A 3L39A 3SFDA 4QXHB 2CWYA 4OYJA 1IAPA 1IJ5A 1UX2A 3ZMSB 4EEDA 2XTLA 3H3MA 2XSAA 3PUYF 2Y58A 2VL0A 4OYKA 2J62A 3E0ZA 2MTQA 3UULA 2LSGA 3AEBA 4IDQA 4I50E 5HEUA 5AFJA 5JR9A 3RI5A 2MBGA 4CI2B 3Q5XA 2WWVA 3CQGB 5DABA 5L47A 5TVCA 2XPKA 1XMQT 1MIVA 1D1CA 2JRKA 3FBLA 4COFA 3B57A 2BBJA 4LFBT 2NW7A 4DR5T 4DMWA 5AQJB 2UXBT 2V26A 3HKDE 2IW5B 2H88A 3O1HA 5L3FB 3RIFA 3PJAA 3WTMA 2C5KT 3WTIA 4DV6T 4O4IE 2CLYB 3RIUC 3C4ZA 2B76A 1LRZA 2RA1A 4IDZA 2XQ9A 3ZDHA 4CXXA 2KMFA 5AQVB 2OLTA 2XQ7A 3WTJA 4LF7T 1MMAA 5FJVA 2Y56A 3RQWA 2VKJA 3QB5A 5CB4E 2A3DA 3I9WA 2D5UA 4G63A 5EZYE 4EGWA 2LM9A 2LKHA 2V6YB 1UURA 2BG9A 4JV5T 2L9QA 3KV6A 2UXCT 1ZHCA 3T1YT 4DV1T 3AA1B 3ETUA 4HQPA 2YINA 1HS7A 4YTMA 2WU2A 4PK4A 5JDQA 3AE1A 4ERRA 4ZI3D 4DBRA 3FXEB 5L4EA 3ZN1B 1W09A 1HFAA 4HEAA 2KZ7B 1VOMA 4HE8A 4UEMA 4HGAA 2BVMA 3E08A 4HFBA 1Y64B 4JI8T 4YTNA 1UUSA 3TLTA 2WNJA 3K3OA 4EZHA 2WZIA 4PJLA 2WAUA 2V7JA 4B3RT 2CXDA 1XNQT 3AVRA 4UXUA 1EZ3A 2DHRA 2JQQA 5J2TE 4UVBB 4H9OC 1IBKT 3RRWA 2XM1A 3V5SA 4I43B 2VASA 4PNIA 1BR0A 2BG9E 3CVRA 4AQGA 2DWKA 4NUUA 3FZFB 1G8XA 4WBOA 5KMGP 5LNKA 4HFEA 2XZEA 4IHJE 5F5WA 3U8KA 5JRCA 2VB6A 1S94A 4PJJA 1X79A 2Y6XA 2ZMAA 2X0YA 3LJCA 4WZXA 4AKHA 4UXNB 5LHIB 5HEHA 2XM2A 5EK2A 4QX8B 5FXVA 2FJDA 2W66A 3CQXC 4IGUA 4GOUA 3IA3A 5ABGA 3JC6D 4JI3T 1KFYA 4UR9A 5SYOA 2QVAA 1D0ZA 3AVSA 3SQ6A 5A1LA 2KNDA 4HWIB 3UU5A 5HCJA 4M1PA 1ZP0A 2PBIA 3T1HT 3HL6A 1W0BA 4DUYT 2WSSV 1T8BA 4U31A 3P4QA 2BBHA 5AFKA 1VCSA 4YY3T 3RYIE 2XNUA 1H7CA 3PUAA 4JYAT 1SUMB 2E9XC 2W63A 5FP3A 5LXTE 4N78D 3N2OA 4NPPA 1HR0T 4QH5A 3LDQB 4YLHA 3D0TA 3C51A 3UT5E 4A97A 3JAEA 5ABFB 3WAKA 3C64A 4D01A 3QOFA 4QWNB 3MKDA 2I59A 4JI7T 3UTKA 2X68A 2QYWA 5LBQB 3FZMB 3SFEA 2G0UA 2M67A 3IEEA 4OHFA 2OA5A 3O1IA 2IAKA 4PK5A 3AEEA 3FZKB 4FRRA 4AFGA 5F3JA 2H7VC 4ZI2D 4GYSA 5FNVE 3ZPOA 2YMDA 4ZOLE 3FXDB 2CXLA 5IYZE 4BA9A 3A5XA 4IDOA 3I0OA 1NAFA 2VWAA 2WMNA 2FJAA 4YSYA 2KWHA 3V5UA 2NWBA 3Q5WA 4IL9A 4XZCA 4WNKA 1ZV4X 1QUUA 3M3ZB 5M4YA 3PUXF 4YSZA 3X1DA 3EHZA 2PFVA 2CCQA 1HNZT 3RYFE 2V5DA 2WDRA 4DO0A 4OX9T 4YTPA 5LHGB 2J47A 2JQHA 2V1DB 2PH9A 3HR0A 3FB2A 4G2AA 1SA0E 3RX6A 4U74A 2BKPA 2WU5A 5JR9C 4J2CA 2D9DA 2D0UA 5JDHA 2WZYA 4Q25A 2Y8DA 2ODUA 2YDQA 2QGSA 4H9PC 3TLVA 2ODVA 3U78A 3QC9A 3PUWF 3AAAB 1N32T 1WRDA 4YFSA 4AISA 5ABFA 3ZYLA 3M65A 5LXBA 5HEGA 3Q9DA 2X9YA 5J0ZA 3LG7A 2WNCA 2ACZA 4BFQA 4CI1B 4PAGA 4O4JE 2HH7A 2CHNA 5AFLA 2X00D 2XAHB 4I4TE 2N1GA 3LK2B 2XZ6A 2XYSA 2UUBT 1Y01A 2LSJA 4UY2A 4IE5A 5AFMB 1N33T 2J1DG 3CKDA 4P0AA 4ZS2A 4DV7T 4IE6A 2K5BB 3SQ9A 3AE4A 3N9QA 5HEOA 3UFGA 3Q5EA 1YW0A 4ILBA 4ZI7E 3UUBA 4C91A 5ABHA 4LF9T 2BG9C 2LJLA 3HKEE 3QK6A 4H9SE 3GWHA 2M6BA 3VKHA 4WBNE 3WTHA 1XNRT 3IHRA 2X0HA 2A9UA 2WCAA 3AE9A 3S4UA 2BYPA 5H6QB 3FZHB 3PURA 4IDPA 1E2AA 1XDOA 2CHOA 5JDFA 1I9BA 2Y57A 3U8LA 3UU4A 4LF8T 4CXYA 1DU2A 3ZJ1A 1LVKA 4EV6A 5FY0A 5DQWA 3LBXA 2XZ5A 3ZMUB 2VVSA 1HF8A 4ZRUA 4EYYR 4CXWA 2CA5A 3GMIA 4PJMA 2UXNB 3B13A 1OEDE 2YU1A 3ZCJA 2K9AA 4HFCA 3C79A 2PTFA 1HX1B 3F31A 1WYCA 1J5ET 3OBVE 4QH4A 3Q2MA 2HPJA 3LFMA 1WR6A 5FYMA 2I0MA 4UM3P 5AINA 2F4VT 3CIRA 3LK3B 2PG8A 4DR7T 2LSIA 5LYJE 3SWHA 4UF0B 5FXZA 4HWDA 4IDNA 2XQ6A 2H89A 4AKGA 4X62T 4WV9A 3NVOA 4H9QC 3FBZA 2Q9QB 4PW8A 3TLUA 3UQ7A 3U8NA 2ES0A 3MJXA 3P4PA 2IMLA 2NW8A 1FJGT 2YEVC 4B3MT 4U3CA 5AQQB 3N9MA 3OPCA 5FKYA 1X9BA
chains in the Genus database with same CATH topology
4A97A 3PMZA 3WTJA 5AFMA 5J5HA 3TLWA 2WZYA 1I9BA 3JAEA 2BR8A 5FJVA 4QH1A 2Y57A 2YKSA 3U8LA 3UU4A 2Y56A 3RHWA 4AFTA 3JADA 4UM1A 3RQWA 5L4HA 2M6IA 3TLVA 3PEOA 4IL4A 4ILCA 2WN9A 4D01A 2XQAA 2BYRA 2LM2A 2BG9E 3WTNA 1OEDA 5J5GA 2ZJVA 2XZ5A 2BR7A 5J5IA 4ZRUA 2XQ8A 4B5DA 5LXBA 2LKHA 5HEGA 5J0ZA 4AFHA 2BG9A 4QABA 4ZK1A 1UX2A 2BYSA 4LMKA 2C9TA 1OEDE 2XQ3A 2MAWA 3EAMA 4HFDA 4HFEA 4LMLA 3U8KA 4ZR6A 2KSRA 2Y58A 2XQ4A 4XHEA 4HQPA 3UQ4A 2VL0A 2WNCA 4BFQA 3WTLA 2BYNA 4TNWA 2Y7YA 4FRRA 2YOEA 4ZK4A 3UU3A 3P50A 5HEJA 2BYQA 2UZ6A 4AFGA 4Z91A 5BP0A 4LMJA 2X00A 3P4WA 4HFCA 5HEUA 3C79A 5AFJA 4ZJTA 3EI0A 3RI5A 2YMDA 3IGQA 2ZJUA 4UM3A 5AFLA 2Y54A 5HEHA 2X00D 4TWHA 3WTOA 4QH4A 4NZBA 3WTKA 5L47A 5TVCA 5BW2A 4ZZCA 3C84A 4HFHA 2XZ6A 2XYSA 4TWDA 2YMEA 5BRXA 5JMEA 4UM3P 5HCMA 4UY2A 5AINA 2XQ5A 3ZKRA 2PGZA 4UM3S 3RQUA 4COFA 5SYOA 3U8JA 5L4EA 4DBMA 5CFBA 4F8HA 5AFMB 4IREA 3SQ6A 3TLSA 4TWFA 1UW6A 4X5TA 3UU5A 2YN6A 3ZDGA 3T4MA 3U8MA 2W8FA 5AFHA 2XQ6A 4IL9A 5HCJA 3SH1A 3WIPA 3LSVA 3UU8A 3SQ9A 3RIFA 4HFBA 2BJ0A 4PIRA 2WNLA 3WTMA 5HEOA 2XNVA 4WV9A 5KZUA 3UU6A 3WTIA 4A98A 4ILBA 3EHZA 4QAAA 3JAFA 3TLTA 3UUBA 4ZJSA 2BG9C 2QC1B 4ALXA 5AFKA 2WNJA 4HFIA 2XNUA 3TLUA 3UQ7A 2M6BA 4Z90A 3GUAA 3SIOA 3U8NA 2BG9B 5CO5A 2XNTA 4XK9A 1UV6A 2LKGA 2PH9A 2XYTA 5J5FA 4ILAA 3RIAA 4QACA 4BQTA 3WTHA 4ZZBA 2LLYA 2XQ9A 4EZ1A 4NPPA 4UXUA 5IUXA 3ZDHA 5KE4A 1OEDC 4QH5A 2BYPA 5AFNA 4TNVA 2XQ7A 5LG3A 2W8GA 1OEDB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A97 A;  3PMZ A;  3WTJ A;  5AFM A;  5J5H A;  3TLW A;  2WZY A;  1I9B A;  3JAE A;  2BR8 A;  5FJV A;  4QH1 A;  2Y57 A;  2YKS A;  3U8L A;  3UU4 A;  2Y56 A;  3RHW A;  4AFT A;  3JAD A;  4UM1 A;  3RQW A;  5L4H A;  2M6I A;  3TLV A;  3PEO A;  4IL4 A;  4ILC A;  2WN9 A;  4D01 A;  2XQA A;  2BYR A;  2LM2 A;  2BG9 E;  3WTN A;  1OED A;  5J5G A;  2ZJV A;  2XZ5 A;  2BR7 A;  5J5I A;  4ZRU A;  2XQ8 A;  4B5D A;  5LXB A;  2LKH A;  5HEG A;  5J0Z A;  4AFH A;  2BG9 A;  4QAB A;  4ZK1 A;  1UX2 A;  2BYS A;  4LMK A;  2C9T A;  1OED E;  2XQ3 A;  2MAW A;  3EAM A;  4HFD A;  4HFE A;  4LML A;  3U8K A;  4ZR6 A;  2KSR A;  2Y58 A;  2XQ4 A;  4XHE A;  4HQP A;  3UQ4 A;  2VL0 A;  2WNC A;  4BFQ A;  3WTL A;  2BYN A;  4TNW A;  2Y7Y A;  4FRR A;  2YOE A;  4ZK4 A;  3UU3 A;  3P50 A;  5HEJ A;  2BYQ A;  2UZ6 A;  4AFG A;  4Z91 A;  5BP0 A;  4LMJ A;  2X00 A;  3P4W A;  4HFC A;  5HEU A;  3C79 A;  5AFJ A;  4ZJT A;  3EI0 A;  3RI5 A;  2YMD A;  3IGQ A;  2ZJU A;  4UM3 A;  5AFL A;  2Y54 A;  5HEH A;  2X00 D;  4TWH A;  3WTO A;  4QH4 A;  4NZB A;  3WTK A;  5L47 A;  5TVC A;  5BW2 A;  4ZZC A;  3C84 A;  4HFH A;  2XZ6 A;  2XYS A;  4TWD A;  2YME A;  5BRX A;  5JME A;  4UM3 P;  5HCM A;  4UY2 A;  5AIN A;  2XQ5 A;  3ZKR A;  2PGZ A;  4UM3 S;  3RQU A;  4COF A;  5SYO A;  3U8J A;  5L4E A;  4DBM A;  5CFB A;  4F8H A;  5AFM B;  4IRE A;  3SQ6 A;  3TLS A;  4TWF A;  1UW6 A;  4X5T A;  3UU5 A;  2YN6 A;  3ZDG A;  3T4M A;  3U8M A;  2W8F A;  5AFH A;  2XQ6 A;  4IL9 A;  5HCJ A;  3SH1 A;  3WIP A;  3LSV A;  3UU8 A;  3SQ9 A;  3RIF A;  4HFB A;  2BJ0 A;  4PIR A;  2WNL A;  3WTM A;  5HEO A;  2XNV A;  4WV9 A;  5KZU A;  3UU6 A;  3WTI A;  4A98 A;  4ILB A;  3EHZ A;  4QAA A;  3JAF A;  3TLT A;  3UUB A;  4ZJS A;  2BG9 C;  2QC1 B;  4ALX A;  5AFK A;  2WNJ A;  4HFI A;  2XNU A;  3TLU A;  3UQ7 A;  2M6B A;  4Z90 A;  3GUA A;  3SIO A;  3U8N A;  2BG9 B;  5CO5 A;  2XNT A;  4XK9 A;  1UV6 A;  2LKG A;  2PH9 A;  2XYT A;  5J5F A;  4ILA A;  3RIA A;  4QAC A;  4BQT A;  3WTH A;  4ZZB A;  2LLY A;  2XQ9 A;  4EZ1 A;  4NPP A;  4UXU A;  5IUX A;  3ZDH A;  5KE4 A;  1OED C;  4QH5 A;  2BYP A;  5AFN A;  4TNV A;  2XQ7 A;  5LG3 A;  2W8G A;  1OED B; 
#chains in the Genus database with same CATH topology
 3PMZ A;  1HNW T;  4DV0 T;  5L4H A;  2CXF A;  2VUR A;  4EAH A;  3ANW A;  3AAE B;  2ZLY A;  1CHU A;  4TV9 E;  3KDS E;  3CML A;  2KWI B;  4JI2 T;  5J5I A;  3ZCI A;  4CN6 A;  3OTO T;  4PJN A;  4B3S T;  3G06 A;  4AFH A;  5HXS A;  2IDO B;  3EAM A;  2LSK A;  4XBF B;  2KSR A;  4XHE A;  2D0T A;  4GIW A;  2HPL A;  4U7I A;  4E7Z A;  2X9X A;  5CGM A;  1SE7 A;  3HKB E;  5HXH A;  3EI0 A;  2VKH A;  3ZT5 A;  1HG5 A;  2C0S A;  4P09 A;  2RPA A;  5AQS B;  5CJ5 A;  5ETW A;  4YHH T;  3GA8 A;  2H3R A;  3RC3 A;  1XWM A;  1KEY A;  5AQU B;  4FJO A;  2UXD T;  4IT4 A;  3EDU A;  4B3T T;  3VR9 A;  2LRL A;  2DCF A;  3LSV A;  4MAL A;  4JUY A;  4BJM A;  2BJ0 A;  5AQF B;  4YT0 A;  4L5G A;  2ZM8 A;  3AEC A;  3ZST A;  2K24 A;  3R6N A;  4ZS3 A;  2H7O A;  2Y48 B;  1N34 T;  4CN4 A;  3ESL A;  1L0V A;  1BR4 A;  3QNU A;  4EZ1 A;  5KE4 A;  3UUN A;  2E2A A;  3ZYM A;  1ZOY A;  5AFN A;  3CK6 A;  2KXP B;  2W8G A;  2ACX A;  3NKZ A;  2KLQ A;  4DV4 T;  3AE2 A;  4NXM T;  1D1A A;  1ZKE A;  3FHN A;  3RKO A;  3O4X E;  4IL4 A;  5HWX A;  2BYR A;  3OYZ A;  1MMN A;  3PU8 A;  3ZMV B;  2V7M A;  5JDN A;  3KIN B;  2D2S A;  4X1Y E;  5HWY A;  2ZJV A;  3HA4 A;  4ZHQ E;  1UGO A;  2W2U A;  3MA9 A;  2XAF B;  1LKX A;  3RGL A;  2FJE A;  3PUV F;  2LOS A;  2CEA A;  2JMK A;  5FMN A;  2LRK A;  1YKE B;  2BYN A;  1WCR A;  4U33 A;  3P50 A;  5BP0 A;  3ONJ A;  3CX8 B;  4DBQ A;  4X64 T;  2VKO A;  3AXJ B;  3ONL C;  5JQG E;  3ZT6 A;  2B1E A;  1MMD A;  4MLK A;  4IST A;  5AQP B;  3TLS A;  2NTY A;  4TWF A;  2V6Y A;  2CE7 A;  4UV9 B;  3RKG A;  4AQY T;  4QXC B;  2XHE B;  2XAJ B;  5HXE A;  3JAF A;  1WFD A;  4KHP T;  1VCT A;  2V7K A;  2K48 A;  1BR2 A;  2A2F X;  5AQM B;  2EHO C;  1KK7 A;  4BQT A;  4KX6 A;  2W0G A;  4C90 A;  1OED C;  1D0X A;  4H63 V;  3O9X A;  5AQG B;  2GK9 A;  4GKK T;  4L9I A;  2NW9 A;  3ZEF B;  5DJQ C;  3LK4 2;  4UM1 A;  4KP3 C;  4TN7 B;  4ILC A;  4LF6 T;  5KX5 E;  4O4L E;  2LEH A;  2DI4 A;  5LGT B;  2CBJ A;  3MK7 C;  2E8I A;  1IZN B;  4HKA A;  4JI6 T;  4H9R C;  3E22 E;  3PU3 A;  4OFZ A;  2MAW A;  4ILU A;  4ISS A;  2Y7Y A;  1V9D A;  1KF6 A;  2E9X D;  4DR2 T;  5L3C B;  3QUJ A;  5JDG A;  3NRX A;  1FIO A;  3N2K E;  3IGQ A;  5C8Y E;  3C4W A;  2X51 A;  4AKR B;  2UU9 T;  3RC8 A;  3ZYK A;  4ZZC A;  2X0L B;  2AE9 A;  4LFA T;  3I9Y A;  3OKQ A;  2IUB A;  4UM3 S;  2E5L T;  3ETV A;  3OVU A;  1FEW A;  4JI0 T;  2WWU A;  2IC6 A;  4ZI2 C;  2LSY A;  3H3A A;  2EHO B;  3N9P A;  4DND A;  2KT9 A;  4MFR A;  2WNL A;  4IIJ E;  3UUX B;  5C3J A;  2X9W A;  4H9N C;  4X66 T;  4O4H E;  5TAO A;  4A98 A;  2BS4 A;  4QAA A;  2X66 A;  4U7Y A;  2IHR 1;  2QRX A;  4DMV A;  3AEA A;  2IIU A;  1KNZ A;  1OXZ A;  4GK5 E;  4YSX A;  5J5F A;  2UUC T;  2E9X B;  3N9O A;  5L2L A;  4MBQ A;  4JBW F;  3KFW X;  1R8I A;  3TLW A;  2BR8 A;  1M7K A;  4EEB A;  2YKS A;  4QXB B;  3Q5D A;  1U5P A;  2WM9 A;  2L8K A;  2VVN A;  3PEO A;  2CBI A;  5HAX A;  5JVD E;  1NEN A;  3WTN A;  4HFV A;  3EDV A;  2LHN A;  5JRE A;  1UX4 A;  4O2B E;  4EIW A;  5LJN A;  2HN1 A;  4LML A;  5IWA T;  3ZLI A;  3ZMZ B;  4ZXL A;  3FZL B;  2BYQ A;  3ZN0 B;  4KMC A;  3F57 A;  3BQK A;  2LT3 A;  4UM3 A;  1B7T A;  3P4S A;  2CPT A;  4PFP A;  4KBM B;  3I1A A;  4IE0 A;  2BKN A;  4YJ2 E;  4DID B;  3KV5 A;  2KIN B;  1YKH B;  2C5I T;  3EUH A;  4H63 H;  2C5J A;  3ZKR A;  4U2Z A;  2W8F A;  3AA0 B;  2UXX B;  4TUY E;  4PIR A;  3P8C D;  3UU6 A;  4AQF A;  2RP4 A;  2XJ7 A;  3AE8 A;  4ZJS A;  2E5V A;  2WB5 A;  4HFI A;  4UVA B;  3GUA A;  1KNP A;  2W62 A;  4XK9 A;  2LKG A;  4E7S A;  4QAC A;  4P1N A;  5AQK B;  3KVB A;  5BR8 T;  2WP9 A;  5LG3 A;  2MPK A;  5LP6 E;  5JR9 B;  5J5H A;  2DLR A;  5C2T A;  1HCI A;  2E9X A;  5HYA A;  5FXW A;  2N9D A;  3B5M A;  2MOZ A;  1HX8 A;  2CRB A;  1VRB A;  2WBL A;  2LE8 A;  1T98 A;  2XQ8 A;  2P9B A;  2WDQ A;  3KV9 A;  5BMV E;  3JCF A;  2QA7 A;  2XQ3 A;  4YJ3 E;  1YXR A;  3PTR B;  4YXD A;  4JEU B;  4U2Y A;  4F6R C;  4CN1 A;  5FXX A;  3UQ4 A;  1UK5 A;  3L8R A;  1XMO T;  4ANJ A;  4KUM B;  1S35 A;  5AQL B;  3P4W A;  3N9L A;  3N9N A;  4UV8 B;  2CM0 A;  2Q9Q D;  1QSD A;  1W9R A;  4LFC T;  3AAI A;  2R6G F;  1MND A;  3U8J A;  2AXD S;  3PUZ F;  3AB3 B;  3AE5 A;  5JDL A;  3N5L A;  1UX5 A;  4WW0 A;  3PDY A;  5ADX L;  2CLY C;  3ZC1 A;  4DUZ T;  2DL1 A;  4DVD A;  4AKL A;  4MHC A;  4HWF A;  2X9H A;  1BR1 A;  4K0U A;  3HI2 A;  2BG9 B;  2W4X A;  2K3W A;  3AEG A;  4X20 E;  4CZZ B;  5HXC A;  5LGU B;  3P7I A;  4AKI A;  3OYX A;  3AE3 A;  1HTJ F;  5AFM A;  2ZM2 A;  3L3P A;  3EAB A;  4HN9 A;  3EVY A;  2LM2 A;  5LJM A;  4KI0 F;  1G73 A;  1IBL T;  3MZK B;  5LB7 B;  2JQK A;  2C9T A;  3A7M A;  3AEF A;  3ABV A;  5L3G B;  5ABE A;  4X65 T;  2X00 A;  5HXR A;  2JPF A;  1FMW A;  3IBP A;  5CA0 E;  4UVC B;  4BAY B;  2ZJU A;  3VR8 A;  3ZT7 A;  3NBX X;  2WS3 A;  4HWC A;  4JI1 T;  1HNX T;  3NRY A;  3H37 A;  3HKC E;  3J7Y q;  1JNR A;  2XQ5 A;  5KXJ A;  2PGZ A;  3ZMT B;  5CFB A;  1MIW A;  4F8H A;  4K0K T;  4ASK A;  3VRA A;  2YN6 A;  3ZDG A;  1US7 B;  3WIP A;  3SH1 A;  3UU8 A;  5JTG A;  5LG4 A;  2CWO A;  5L3D B;  5AQN B;  1Z8U A;  3BK9 A;  2QC1 B;  2BZB A;  4O8S A;  4X1I E;  2XQY A;  4AI6 A;  4ILA A;  5J2U E;  2NTX A;  4DV5 T;  5JRC B;  3C4X A;  1ZEE A;  5L3B B;  5FY7 A;  2FUP A;  4ZI3 C;  1XDP A;  2W00 A;  2N2N A;  4UF0 A;  1IBM T;  1I94 T;  3RHW A;  4AFT A;  4JI5 T;  4FI5 A;  3U3I A;  4P0B A;  2XQA A;  2Q9Q A;  3AA7 B;  5LOV E;  3T8O A;  4GYR A;  4B5D A;  5LMU T;  3K1S A;  4AIU A;  2L3L A;  4EXT A;  4ZK1 A;  2IC9 A;  2V5C A;  2FJB A;  4ZR6 A;  1FMV A;  3WTL A;  2DNX A;  3RH3 A;  3BQI A;  4ADZ A;  5FL1 A;  4CI3 B;  4EB6 E;  2CMR A;  2JIW A;  2HHH T;  3K8P C;  3R84 B;  4TWD A;  5HCM A;  2DWG A;  4I55 E;  3RQU A;  2W67 A;  5CA1 E;  4DBM A;  2WY2 A;  5EK3 A;  4AXP A;  3RRC A;  4IRE A;  2WZH A;  2V7L A;  1UW6 A;  1WR0 A;  4X5T A;  2UUA T;  5L3E B;  3A8Y C;  1YQ3 A;  3RYC E;  4IE7 A;  3F2E A;  4PFO A;  3N2G E;  2BDE A;  2XAS B;  3PUS A;  4LF4 T;  2NR4 A;  3ZC0 A;  2BKO A;  3SIO A;  5E0O A;  2PJQ A;  4QX7 B;  3AED A;  2OV9 A;  1W0A A;  4I0U A;  4ZZB A;  2LLY A;  3RYH E;  5IUX A;  2XY8 B;  4NXN T;  3MAC A;  3NWI A;  3JC6 C;  5KDM C;  2MYS A;  3K3Q C;  4V1A v;  4HWH A;  3ZSS A;  3RF1 A;  5DQV A;  4EOZ B;  3PJA J;  5JH7 E;  3J9X 1;  1MNE A;  3NZQ A;  3K3N A;  3RIU A;  3AE6 A;  1Z0P A;  2ZM0 A;  5EK4 A;  4AQF C;  1WYB A;  2XAG B;  1NWM X;  1T72 A;  1U4Q A;  4UEL A;  1GQE A;  2YDR A;  2XQ4 A;  2HN2 A;  3RLF F;  2WDV A;  3UU3 A;  1M62 A;  4X1K E;  2EHO D;  3SRZ A;  2Y54 A;  4JI4 T;  3CWZ B;  3WTO A;  3WTK A;  5BW2 A;  4EYU A;  5AQI B;  2V6X A;  5JME A;  5AQH B;  1NEK A;  2V8S V;  5LGN B;  3U8M A;  2Z6E A;  4CQI A;  4UIG A;  4U72 A;  2SPC A;  2LOP A;  4QHO A;  3ONX A;  4WYV A;  1O3X A;  1YQ4 A;  2V7I A;  4TZ4 C;  1UV6 A;  3AXJ A;  5F8P A;  1JNZ A;  2WMO A;  4IE4 A;  2VQE T;  4L0R A;  2JQ9 A;  2NP9 A;  2NOX A;  1E1H B;  1OED B;  1IJ6 A;  3UUM A;  3P4R A;  1HG2 A;  2WQY A;  3JAD A;  2VK9 A;  4A56 A;  2WN9 A;  3O1J A;  3CX6 B;  1MMG A;  3KBU A;  4KHZ F;  1KNR A;  4EZ4 A;  3VU7 H;  2BR7 A;  3GN5 B;  1J5W A;  4LF5 T;  3SS1 A;  2VL8 A;  2JMH A;  4QAB A;  2XAQ B;  2BYS A;  4HFD A;  2YDS A;  4TV8 E;  4TNW A;  1OWA A;  4ZK4 A;  1AJ3 A;  2UZ6 A;  4PK6 A;  3IF8 B;  4LMJ A;  1N36 T;  3SOL A;  5LBM A;  3L09 A;  4TWH A;  4GK0 E;  3C84 A;  2YME A;  5IHY A;  5LHH B;  3KV4 A;  5H6R B;  3PUG A;  4NUV A;  4Z8X A;  4BJN A;  4TX5 A;  5AFH A;  2BS2 A;  3VRB A;  2XNV A;  2YK0 A;  3OJA A;  2J4G A;  4ALX A;  5FY1 A;  3LBX B;  1SHZ C;  1CUN A;  5J1G A;  3BQL A;  5CO5 A;  3RIA A;  1D1B A;  3NZP A;  5FVK A;  1XZY A;  5JDM A;  4QH1 A;  2A72 A;  3VKG A;  1E7P A;  2EHO A;  2ZM6 T;  5AQO B;  3DP7 A;  3CQC B;  2X67 A;  1LVF A;  1OED A;  2YU2 A;  5J5G A;  5AQT B;  2I6H A;  3PUQ A;  5LMN T;  1D0Y A;  4JLE A;  4DR3 T;  1J1J A;  4LMK A;  2VKD A;  3TKL B;  3AE7 A;  3MXZ A;  2YOE A;  3KVA A;  3VHL A;  5HEJ A;  3GN5 A;  3PV0 F;  1I6Z A;  4Z91 A;  4HTE A;  1UCU A;  4ZJT A;  2XUE A;  4A5X A;  5FL0 A;  5LCY A;  4XAX B;  2FBW A;  3I0Q A;  3DJB A;  4NZB A;  4JEH B;  3DTO A;  2LHR A;  4HFH A;  3C50 A;  5BRX A;  4DV3 T;  3CPZ A;  4B6X A;  4GKJ T;  3ZJ2 A;  3T4M A;  3CX7 B;  4NIQ A;  4DR1 T;  3AA6 B;  3ANW B;  4DR4 T;  2Q9Q C;  5FVL A;  4YHJ A;  5KZU A;  4QKN A;  1T7S A;  3UFE A;  3QB5 K;  2XSB A;  4Z90 A;  2BS3 A;  4DR6 T;  2XNT A;  3C98 B;  3W15 B;  2XYT A;  1WLX A;  5AQR B;  5LA6 E;  2VQF T;  3WI3 A;  1QLB A;  4TNV A;  3WAJ A;  2BVL A;  4ZEY A;  3RPU A;  4O2A E;  1YD8 G;  5GON E;  3KBT A;  2M6I A;  4OK0 A;  4DV2 T;  2JJ9 A;  1MIY A;  5AFU L;  2W61 A;  3PE0 A;  3L39 A;  3SFD A;  4QXH B;  2CWY A;  4OYJ A;  1IAP A;  1IJ5 A;  1UX2 A;  3ZMS B;  4EED A;  2XTL A;  3H3M A;  2XSA A;  3PUY F;  2Y58 A;  2VL0 A;  4OYK A;  2J62 A;  3E0Z A;  2MTQ A;  3UUL A;  2LSG A;  3AEB A;  4IDQ A;  4I50 E;  5HEU A;  5AFJ A;  5JR9 A;  3RI5 A;  2MBG A;  4CI2 B;  3Q5X A;  2WWV A;  3CQG B;  5DAB A;  5L47 A;  5TVC A;  2XPK A;  1XMQ T;  1MIV A;  1D1C A;  2JRK A;  3FBL A;  4COF A;  3B57 A;  2BBJ A;  4LFB T;  2NW7 A;  4DR5 T;  4DMW A;  5AQJ B;  2UXB T;  2V26 A;  3HKD E;  2IW5 B;  2H88 A;  3O1H A;  5L3F B;  3RIF A;  3PJA A;  3WTM A;  2C5K T;  3WTI A;  4DV6 T;  4O4I E;  2CLY B;  3RIU C;  3C4Z A;  2B76 A;  1LRZ A;  2RA1 A;  4IDZ A;  2XQ9 A;  3ZDH A;  4CXX A;  2KMF A;  5AQV B;  2OLT A;  2XQ7 A;  3WTJ A;  4LF7 T;  1MMA A;  5FJV A;  2Y56 A;  3RQW A;  2VKJ A;  3QB5 A;  5CB4 E;  2A3D A;  3I9W A;  2D5U A;  4G63 A;  5EZY E;  4EGW A;  2LM9 A;  2LKH A;  2V6Y B;  1UUR A;  2BG9 A;  4JV5 T;  2L9Q A;  3KV6 A;  2UXC T;  1ZHC A;  3T1Y T;  4DV1 T;  3AA1 B;  3ETU A;  4HQP A;  2YIN A;  1HS7 A;  4YTM A;  2WU2 A;  4PK4 A;  5JDQ A;  3AE1 A;  4ERR A;  4ZI3 D;  4DBR A;  3FXE B;  5L4E A;  3ZN1 B;  1W09 A;  1HFA A;  4HEA A;  2KZ7 B;  1VOM A;  4HE8 A;  4UEM A;  4HGA A;  2BVM A;  3E08 A;  4HFB A;  1Y64 B;  4JI8 T;  4YTN A;  1UUS A;  3TLT A;  2WNJ A;  3K3O A;  4EZH A;  2WZI A;  4PJL A;  2WAU A;  2V7J A;  4B3R T;  2CXD A;  1XNQ T;  3AVR A;  4UXU A;  1EZ3 A;  2DHR A;  2JQQ A;  5J2T E;  4UVB B;  4H9O C;  1IBK T;  3RRW A;  2XM1 A;  3V5S A;  4I43 B;  2VAS A;  4PNI A;  1BR0 A;  2BG9 E;  3CVR A;  4AQG A;  2DWK A;  4NUU A;  3FZF B;  1G8X A;  4WBO A;  5KMG P;  5LNK A;  4HFE A;  2XZE A;  4IHJ E;  5F5W A;  3U8K A;  5JRC A;  2VB6 A;  1S94 A;  4PJJ A;  1X79 A;  2Y6X A;  2ZMA A;  2X0Y A;  3LJC A;  4WZX A;  4AKH A;  4UXN B;  5LHI B;  5HEH A;  2XM2 A;  5EK2 A;  4QX8 B;  5FXV A;  2FJD A;  2W66 A;  3CQX C;  4IGU A;  4GOU A;  3IA3 A;  5ABG A;  3JC6 D;  4JI3 T;  1KFY A;  4UR9 A;  5SYO A;  2QVA A;  1D0Z A;  3AVS A;  3SQ6 A;  5A1L A;  2KND A;  4HWI B;  3UU5 A;  5HCJ A;  4M1P A;  1ZP0 A;  2PBI A;  3T1H T;  3HL6 A;  1W0B A;  4DUY T;  2WSS V;  1T8B A;  4U31 A;  3P4Q A;  2BBH A;  5AFK A;  1VCS A;  4YY3 T;  3RYI E;  2XNU A;  1H7C A;  3PUA A;  4JYA T;  1SUM B;  2E9X C;  2W63 A;  5FP3 A;  5LXT E;  4N78 D;  3N2O A;  4NPP A;  1HR0 T;  4QH5 A;  3LDQ B;  4YLH A;  3D0T A;  3C51 A;  3UT5 E;  4A97 A;  3JAE A;  5ABF B;  3WAK A;  3C64 A;  4D01 A;  3QOF A;  4QWN B;  3MKD A;  2I59 A;  4JI7 T;  3UTK A;  2X68 A;  2QYW A;  5LBQ B;  3FZM B;  3SFE A;  2G0U A;  2M67 A;  3IEE A;  4OHF A;  2OA5 A;  3O1I A;  2IAK A;  4PK5 A;  3AEE A;  3FZK B;  4FRR A;  4AFG A;  5F3J A;  2H7V C;  4ZI2 D;  4GYS A;  5FNV E;  3ZPO A;  2YMD A;  4ZOL E;  3FXD B;  2CXL A;  5IYZ E;  4BA9 A;  3A5X A;  4IDO A;  3I0O A;  1NAF A;  2VWA A;  2WMN A;  2FJA A;  4YSY A;  2KWH A;  3V5U A;  2NWB A;  3Q5W A;  4IL9 A;  4XZC A;  4WNK A;  1ZV4 X;  1QUU A;  3M3Z B;  5M4Y A;  3PUX F;  4YSZ A;  3X1D A;  3EHZ A;  2PFV A;  2CCQ A;  1HNZ T;  3RYF E;  2V5D A;  2WDR A;  4DO0 A;  4OX9 T;  4YTP A;  5LHG B;  2J47 A;  2JQH A;  2V1D B;  2PH9 A;  3HR0 A;  3FB2 A;  4G2A A;  1SA0 E;  3RX6 A;  4U74 A;  2BKP A;  2WU5 A;  5JR9 C;  4J2C A;  2D9D A;  2D0U A;  5JDH A;  2WZY A;  4Q25 A;  2Y8D A;  2ODU A;  2YDQ A;  2QGS A;  4H9P C;  3TLV A;  2ODV A;  3U78 A;  3QC9 A;  3PUW F;  3AAA B;  1N32 T;  1WRD A;  4YFS A;  4AIS A;  5ABF A;  3ZYL A;  3M65 A;  5LXB A;  5HEG A;  3Q9D A;  2X9Y A;  5J0Z A;  3LG7 A;  2WNC A;  2ACZ A;  4BFQ A;  4CI1 B;  4PAG A;  4O4J E;  2HH7 A;  2CHN A;  5AFL A;  2X00 D;  2XAH B;  4I4T E;  2N1G A;  3LK2 B;  2XZ6 A;  2XYS A;  2UUB T;  1Y01 A;  2LSJ A;  4UY2 A;  4IE5 A;  5AFM B;  1N33 T;  2J1D G;  3CKD A;  4P0A A;  4ZS2 A;  4DV7 T;  4IE6 A;  2K5B B;  3SQ9 A;  3AE4 A;  3N9Q A;  5HEO A;  3UFG A;  3Q5E A;  1YW0 A;  4ILB A;  4ZI7 E;  3UUB A;  4C91 A;  5ABH A;  4LF9 T;  2BG9 C;  2LJL A;  3HKE E;  3QK6 A;  4H9S E;  3GWH A;  2M6B A;  3VKH A;  4WBN E;  3WTH A;  1XNR T;  3IHR A;  2X0H A;  2A9U A;  2WCA A;  3AE9 A;  3S4U A;  2BYP A;  5H6Q B;  3FZH B;  3PUR A;  4IDP A;  1E2A A;  1XDO A;  2CHO A;  5JDF A;  1I9B A;  2Y57 A;  3U8L A;  3UU4 A;  4LF8 T;  4CXY A;  1DU2 A;  3ZJ1 A;  1LVK A;  4EV6 A;  5FY0 A;  5DQW A;  3LBX A;  2XZ5 A;  3ZMU B;  2VVS A;  1HF8 A;  4ZRU A;  4EYY R;  4CXW A;  2CA5 A;  3GMI A;  4PJM A;  2UXN B;  3B13 A;  1OED E;  2YU1 A;  3ZCJ A;  2K9A A;  4HFC A;  3C79 A;  2PTF A;  1HX1 B;  3F31 A;  1WYC A;  1J5E T;  3OBV E;  4QH4 A;  3Q2M A;  2HPJ A;  3LFM A;  1WR6 A;  5FYM A;  2I0M A;  4UM3 P;  5AIN A;  2F4V T;  3CIR A;  3LK3 B;  2PG8 A;  4DR7 T;  2LSI A;  5LYJ E;  3SWH A;  4UF0 B;  5FXZ A;  4HWD A;  4IDN A;  2XQ6 A;  2H89 A;  4AKG A;  4X62 T;  4WV9 A;  3NVO A;  4H9Q C;  3FBZ A;  2Q9Q B;  4PW8 A;  3TLU A;  3UQ7 A;  3U8N A;  2ES0 A;  3MJX A;  3P4P A;  2IML A;  2NW8 A;  1FJG T;  2YEV C;  4B3M T;  4U3C A;  5AQQ B;  3N9M A;  3OPC A;  5FKY A;  1X9B A; 
#chains in the Genus database with same CATH homology
 4A97 A;  3PMZ A;  3WTJ A;  5AFM A;  5J5H A;  3TLW A;  2WZY A;  1I9B A;  3JAE A;  2BR8 A;  5FJV A;  4QH1 A;  2Y57 A;  2YKS A;  3U8L A;  3UU4 A;  2Y56 A;  3RHW A;  4AFT A;  3JAD A;  4UM1 A;  3RQW A;  5L4H A;  2M6I A;  3TLV A;  3PEO A;  4IL4 A;  4ILC A;  2WN9 A;  4D01 A;  2XQA A;  2BYR A;  2LM2 A;  2BG9 E;  3WTN A;  1OED A;  5J5G A;  2ZJV A;  2XZ5 A;  2BR7 A;  5J5I A;  4ZRU A;  2XQ8 A;  4B5D A;  5LXB A;  2LKH A;  5HEG A;  5J0Z A;  4AFH A;  2BG9 A;  4QAB A;  4ZK1 A;  1UX2 A;  2BYS A;  4LMK A;  2C9T A;  1OED E;  2XQ3 A;  2MAW A;  3EAM A;  4HFD A;  4HFE A;  4LML A;  3U8K A;  4ZR6 A;  2KSR A;  2Y58 A;  2XQ4 A;  4XHE A;  4HQP A;  3UQ4 A;  2VL0 A;  2WNC A;  4BFQ A;  3WTL A;  2BYN A;  4TNW A;  2Y7Y A;  4FRR A;  2YOE A;  4ZK4 A;  3UU3 A;  3P50 A;  5HEJ A;  2BYQ A;  2UZ6 A;  4AFG A;  4Z91 A;  5BP0 A;  4LMJ A;  2X00 A;  3P4W A;  4HFC A;  5HEU A;  3C79 A;  5AFJ A;  4ZJT A;  3EI0 A;  3RI5 A;  2YMD A;  3IGQ A;  2ZJU A;  4UM3 A;  5AFL A;  2Y54 A;  5HEH A;  2X00 D;  4TWH A;  3WTO A;  4QH4 A;  4NZB A;  3WTK A;  5L47 A;  5TVC A;  5BW2 A;  4ZZC A;  3C84 A;  4HFH A;  2XZ6 A;  2XYS A;  4TWD A;  2YME A;  5BRX A;  5JME A;  4UM3 P;  5HCM A;  4UY2 A;  5AIN A;  2XQ5 A;  3ZKR A;  2PGZ A;  4UM3 S;  3RQU A;  4COF A;  5SYO A;  3U8J A;  5L4E A;  4DBM A;  5CFB A;  4F8H A;  5AFM B;  4IRE A;  3SQ6 A;  3TLS A;  4TWF A;  1UW6 A;  4X5T A;  3UU5 A;  2YN6 A;  3ZDG A;  3T4M A;  3U8M A;  2W8F A;  5AFH A;  2XQ6 A;  4IL9 A;  5HCJ A;  3SH1 A;  3WIP A;  3LSV A;  3UU8 A;  3SQ9 A;  3RIF A;  4HFB A;  2BJ0 A;  4PIR A;  2WNL A;  3WTM A;  5HEO A;  2XNV A;  4WV9 A;  5KZU A;  3UU6 A;  3WTI A;  4A98 A;  4ILB A;  3EHZ A;  4QAA A;  3JAF A;  3TLT A;  3UUB A;  4ZJS A;  2BG9 C;  2QC1 B;  4ALX A;  5AFK A;  2WNJ A;  4HFI A;  2XNU A;  3TLU A;  3UQ7 A;  2M6B A;  4Z90 A;  3GUA A;  3SIO A;  3U8N A;  2BG9 B;  5CO5 A;  2XNT A;  4XK9 A;  1UV6 A;  2LKG A;  2PH9 A;  2XYT A;  5J5F A;  4ILA A;  3RIA A;  4QAC A;  4BQT A;  3WTH A;  4ZZB A;  2LLY A;  2XQ9 A;  4EZ1 A;  4NPP A;  4UXU A;  5IUX A;  3ZDH A;  5KE4 A;  1OED C;  4QH5 A;  2BYP A;  5AFN A;  4TNV A;  2XQ7 A;  5LG3 A;  2W8G A;  1OED B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...