2XQ6A

Pentameric ligand gated ion channel glic in complex with cesium ion (cs+)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
310
structure length
310
Chain Sequence
b'PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLR4197 PROTEIN
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein
total genus 73
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq6A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq6A01
4QH1A 4ZRUA 4LMLA 4ZR6A 4UM3S 4ZZCA 4AFTA 4QAAA 2UZ6A 4HFBA 1UW6A 2XQ8A 4ZJSA 4D01A 1OEDC 3WIPA 4ILCA 4BQTA 3TLSA 5HEHA 3WTMA 3EAMA 4Z90A 2YOEA 3C79A 2MAWA 4TNWA 3IGQA 5AFLA 3C84A 5AFMA 3UU3A 3LSVA 5J5FA 2XNTA 4UM3A 3T4MA 5HCJA 5HEOA 3RIFA 5L4EA 3U8NA 5AFHA 4ILAA 5AFJA 2W8FA 3WTJA 2LKHA 2XQ7A 4HFEA 2XYTA 4LMJA 4IREA 5L47A 2YMDA 2LLYA 4UY2A 4WV9A 5BW2A 3JADA 2LM2A 4HFDA 4B5DA 5HEJA 1OEDA 2XQ9A 5HEGA 4UM1A 2X00A 3WTHA 4HFHA 4UM3P 4X5TA 5J5IA 2Y57A 3PEOA 2BYSA 4TNVA 2BG9B 2WNJA 4TWHA 5L4HA 5HCMA 2PH9A 3WTLA 5J5HA 5KE4A 2VL0A 2BR8A 3U8MA 4HQPA 3P50A 4QACA 2XQAA 5SYOA 5KZUA 3SIOA 4ALXA 3JAEA 3TLUA 4IL9A 3ZDGA 2XQ4A 2BG9E 2WNCA 4LMKA 5FJVA 2YN6A 3RIAA 2XNVA 2YMEA 2X00D 4UXUA 5BRXA 3JAFA 2XQ6A 5J5GA 4QABA 2QC1B 4QH5A 4IL4A 2YKSA 4XK9A 3UUBA 4NPPA 3TLWA 3RI5A 2W8GA 3EHZA 4ZK1A 3RHWA 4DBMA 5CO5A 4Z91A 4ZJTA 2BYPA 4FRRA 4QH4A 5BP0A 2LKGA 2BG9C 3UQ4A 3SQ9A 3TLVA 2PGZA 5CFBA 4COFA 4F8HA 4ZK4A 5LG3A 2WN9A 2KSRA 2ZJVA 3WTOA 5AFMB 5AFNA 3ZDHA 3WTIA 4HFCA 4AFHA 3WTKA 5LXBA 2WZYA 5J0ZA 4XHEA 4A98A 2XZ6A 5IUXA 4A97A 4HFIA 2XQ3A 2Y54A 3U8JA 2Y56A 2BR7A 2XYSA 3TLTA 1UV6A 3UU6A 2ZJUA 1OEDB 2BJ0A 4ZZBA 3SQ6A 3P4WA 4ILBA 5HEUA 3RQWA 2BG9A 2BYQA 2C9TA 2WNLA 2XNUA 3GUAA 3PMZA 4TWFA 3UQ7A 3WTNA 4BFQA 4EZ1A 3UU8A 3UU5A 3SH1A 5AINA 5JMEA 2M6IA 2Y58A 2Y7YA 4NZBA 2XZ5A 2BYNA 2BYRA 1UX2A 1OEDE 3U8LA 4AFGA 4TWDA 3RQUA 1I9BA 4PIRA 3U8KA 5TVCA 5AFKA 2XQ5A 2M6BA 3UU4A 3EI0A 3ZKRA
chains in the Genus database with same CATH superfamily
4LF8T 4ZI3C 2K5BB 4QAAA 1UW6A 2EHOA 5AQIB 5JDNA 5LGNB 2HHHT 3AE9A 4PAGA 5ABEA 4X66T 3LG7A 3OKQA 3WI3A 2KWHA 5C8YE 3SRZA 4TN7B 5HWXA 5CJ5A 4X65T 1LVFA 4PJJA 4QXCB 3ETVA 5J2TE 3N9LA 2C5JA 2JPFA 5EZYE 5KZUA 1JNRA 5AQRB 3J9X1 2JIWA 3IHRA 5DJQC 3NRYA 4DR2T 1UX5A 4LMKA 3N9QA 4IDOA 2V7KA 4QABA 4XK9A 2CCQA 5FXZA 4HGAA 2WS3A 2W61A 5ABGA 2YK0A 5LG3A 2DWKA 5IHYA 3KVBA 2JMKA 2WDQA 4QWNB 2WZYA 1NWMX 3P7IA 2JJ9A 2X9WA 4YHJA 5JRCA 2JRKA 4WBOA 5EK2A 4JBWF 4IE5A 4KP3C 1JNZA 2R6GF 3FHNA 4AXPA 4GKJT 2XYSA 2BKOA 3CQGB 1E1HB 4ILBA 5HEUA 2XNUA 2WNLA 3GUAA 4TWFA 3ZLIA 2CHNA 2N9DA 2LSGA 2XPKA 2XZ5A 4L5GA 2WM9A 3K8PC 2HPJA 1UX2A 5JQGE 3CKDA 1WYBA 3F2EA 4DV0T 3L8RA 2WWUA 4ZJSA 3V5UA 4X1YE 2V6XA 4U7IA 3U8NA 4HEAA 3CWZB 3ZJ1A 2XTLA 2IAKA 2E9XD 4O4IE 2C0SA 4ERRA 2D0TA 4BJNA 2BS4A 3N9NA 3F57A 2YU2A 4I55E 3MK7C 2LJLA 5LGUB 4TX5A 5AQKB 3UFGA 4DUZT 2BYSA 4HFVA 2VKJA 3Q2MA 2WB5A 4B3RT 4HWHA 4QX8B 4QACA 3PURA 1U4QA 3OTOT 4KBMB 2WNCA 1CHUA 2H88A 2QYWA 2PJQA 2YMEA 2CRBA 3UUBA 3O4XE 3RI5A 2WU2A 4P1NA 1QLBA 2WDRA 2HN1A 2EHOB 4UEMA 2RPAA 3QK6A 3PU3A 2RA1A 2UUCT 3GWHA 4AIUA 3ANWB 4JUYA 4C91A 3CQXC 2L9QA 2UU9T 2CBIA 1HG5A 4ZS2A 4XBFB 2WCAA 4ZHQE 3AEDA 3CMLA 5FNVE 2GK9A 2L8KA 2C5KT 1OEDE 1ZP0A 3RX6A 4AFGA 4UVCB 3FZMB 4CI2B 2KT9A 2Q9QD 2MOZA 2XQ5A 4TZ4C 3KV5A 4ZRUA 3FZHB 4TV8E 4JI7T 2W66A 4DUYT 4ILCA 1T8BA 3PJAJ 1G73A 2HH7A 2MYSA 3LDQB 2XNTA 2CWYA 1J5ET 5AFJA 3KINB 2VKHA 2Z6EA 5JRCB 2MPKA 4DR4T 3C64A 3AEFA 2LM2A 3PJAA 2Y57A 5GONE 2V1DB 1E7PA 4AKIA 2WQYA 3OVUA 2FJAA 5LNKA 2XAFB 4V1Av 3ZN0B 1XDPA 4GYRA 4ZI2C 3ZC1A 2FJEA 2WMNA 2XQ6A 2ACZA 3L3PA 2KLQA 3C50A 4QH4A 5LHGB 2JMHA 3ZYKA 5AQOB 5FL0A 1M7KA 2N2NA 3AE6A 2DNXA 2D0UA 4PK5A 4YXDA 3B5MA 4XHEA 1L0VA 4TV9E 3ZCJA 4CXWA 4IE4A 1BR0A 2BR7A 3UU6A 2Y8DA 4JI4T 3AE1A 4F6RC 4QKNA 1S35A 5L3BB 5L3FB 2Y7YA 3WAJA 4TWDA 3NVOA 3UU4A 3RYHE 2E9XA 3LBXB 4ZEYA 2LEHA 1HX1B 5L2LA 3CVRA 3RLFF 4GKKT 1IJ6A 2MAWA 3RYIE 3UUXB 1D1CA 2L3LA 3RIFA 5AFHA 4ILAA 5ABFA 2W8FA 2LKHA 2E5VA 2LOSA 5AQPB 5AFUL 1OEDA 4HFHA 3ZEFB 2J62A 3MZKB 3GN5A 2WNJA 4IT4A 4NUVA 3EUHA 1UUSA 4QXHB 4AKLA 3AEAA 2BG9E 2IUBA 3ZMSB 1BR4A 3K1SA 4AI6A 2W8GA 2XAHB 4GK0E 4CI1B 5CFBA 4COFA 5IWAT 1KK7A 3S4UA 3SFEA 5JR9A 1VRBA 1IZNB 3A5XA 3P4RA 2KSRA 5IUXA 4B3ST 4PK4A 2Y56A 1Z0PA 3ZT7A 4IE6A 1HNZT 5HXSA 3MA9A 3HA4A 2EHOC 2CE7A 4OFZA 4NZBA 4DNDA 3W15B 4H63H 3ZJ2A 4LFBT 3U8KA 3K3NA 5LHHB 4YTNA 3HR0A 3P4QA 3N9OA 4PK6A 2WBLA 3HL6A 2UZ6A 2DCFA 3SFDA 2UUBT 1IJ5A 1HFAA 3TLSA 3JCFA 3FB2A 5JTGA 4G63A 3C79A 4OYKA 2W00A 4CN6A 2H7VC 2VQET 3T4MA 3DTOA 5HCJA 3SS1A 2VVNA 5L47A 2YMDA 2A3DA 3QB5K 1WRDA 3EDUA 3LK2B 4M1PA 3N2GE 4Z8XA 1QUUA 4ALXA 3VRAA 3MKDA 3PTRB 3AEGA 3P4SA 2YN6A 3RIAA 5JDLA 4LFAT 5BRXA 5AQMB 2E9XB 1BR2A 3AAAB 4L9IA 3Q5WA 4C90A 3EHZA 1T98A 2NP9A 5LB7B 4DV1T 3AXJA 5FVLA 5AFNA 3WTOA 2NOXA 3WTIA 3KV6A 2WU5A 2LRLA 5FMNA 1LKXA 4HFIA 3O9XA 3TLTA 4EYUA 1OEDB 4H9NC 1IBLT 2BG9A 2VKDA 4X1IE 2M67A 2K9AA 3ZMVB 3GN5B 1HNXT 4JI0T 2E2AA 3AE7A 5JDQA 4HN9A 1KNPA 5AQSB 3C4WA 4ZZCA 3PUXF 3SOLA 3AECA 5IYZE 4IGUA 2QA7A 3ZSSA 4UM3A 3HI2A 5FKYA 5JR9B 5L4EA 4EEBA 3ZMUB 3M65A 5C3JA 3HKDE 4IHJE 3PUZF 1YKEB 2I59A 2Q9QB 2B1EA 4DBRA 3OJAA 3CQCB 2BZBA 2DHRA 2YDSA 1W09A 1W0AA 2Y48B 3ANWA 2X0YA 5FXVA 3H3AA 3N9MA 4CXXA 2XY8B 4PW8A 2YKSA 4ZI7E 5F8PA 2J1DG 3SQ9A 5H6QB 2PGZA 4XAXB 5LXBA 4P0AA 3CX6B 4JI3T 1KFYA 2V7JA 3ZT5A 2WZHA 3NZPA 2VL8A 4LF4T 2XAGB 4ZZBA 4EGWA 5LYJE 3PMZA 4KI0F 3SH1A 1HG2A 2BKPA 2M6IA 3F31A 4CN1A 4UV8B 2DL1A 4H9PC 3ZT6A 2SPCA 4HKAA 3RKGA 4ZS3A 4LF6T 3AE2A 3ONXA 2OA5A 2XASB 3UT5E 4PJNA 2HPLA 3CX7B 3JC6D 4MHCA 2Y6XA 2I6HA 5DQWA 5KXJA 3L39A 3AXJB 4AKGA 4JI2T 3AE3A 3PUYF 2PFVA 3H37A 3GA8A 4O2AE 3TKLB 1OXZA 2LLYA 3G06A 4KMCA 5BW2A 3JADA 2KZ7B 3FBZA 5L3EB 5DQVA 4U2ZA 2BG9B 3LJCA 3RIUA 2PH9A 3WTLA 5LCYA 1US7B 3PUAA 2MTQA 3B13A 2IIUA 2XNVA 3BQKA 3EVYA 4H9SE 2BS3A 3AEBA 4UVAB 2CEAA 4DBMA 3WAKA 3N5LA 4U74A 4KHPT 2DWGA 3Q9DA 4ANJA 2FUPA 4AQYT 4KX6A 4IE0A 1MIYA 3RH3A 3LBXA 1KF6A 5ABHA 1UCUA 4JI5T 2E9XC 3RC8A 3KV9A 3FZLB 5J5IA 2ZLYA 2XM2A 4WYVA 1WFDA 1YW0A 2UUAT 5J2UE 1H7CA 2XZEA 2YDQA 3AE8A 1MMGA 2AE9A 1YKHB 5CA0E 2XAQB 2XUEA 3ZKRA 4QH1A 2CMRA 2UXCT 4Q25A 4UM3S 1ZHCA 1OEDC 1VCSA 3WIPA 2ZM0A 2IW5B 3K3OA 4UF0A 3AVRA 5J1GA 1WR0A 4TNWA 4P09A 4IE7A 2WZIA 3N9PA 1Z8UA 2V8SV 5HAXA 2CWOA 4NXMT 2NW8A 3LFMA 2QVAA 3N2OA 4UM1A 1VOMA 5F5WA 3ONJA 3AEEA 4OX9T 2RP4A 1FEWA 1X9BA 1N36T 1IBKT 2VL0A 3VR9A 3U8MA 3I9WA 5JR9C 4CI3B 4ISTA 2UXXB 3E08A 2KXPB 3TLUA 2VQFT 4BAYB 3O1JA 4HE8A 3MACA 2KMFA 3ETUA 3O1HA 4UELA 4Z91A 2NR4A 1EZ3A 2JQKA 2CPTA 3KVAA 4YT0A 3LK42 2H7OA 3QB5A 5JVDE 3R84B 3KFWX 1FIOA 5AQHB 1UGOA 4U72A 1NEKA 5JH7E 3VR8A 4PFOA 3PUQA 4OK0A 3OYZA 3B57A 1IAPA 5HXRA 3GMIA 3NZQA 2WP9A 4O4JE 5L3GB 2G0UA 2A2FX 4YHHT 3RRWA 3U3IA 4X64T 2UXBT 2VK9A 4ZR6A 5FL1A 5HYAA 3PE0A 4YY3T 1I6ZA 4MLKA 4LF9T 3PDYA 5J5FA 5HEOA 4BA9A 2IMLA 3QNUA 2XAJB 3C98B 4LMJA 4B5DA 4NIQA 2J4GA 4UV9B 2IC9A 4DV6T 2ODUA 1MNDA 2PBIA 4YLHA 4ISSA 2BR8A 1LVKA 5SYOA 2BS2A 5AQFB 2P9BA 3P4PA 4H9QC 3ZSTA 4UXUA 2OLTA 5AQQB 4NPPA 4L0RA 2MBGA 2D2SA 4ZJTA 4DMVA 2BG9C 2NTYA 4UF0B 3FZFB 5DABA 4ZOLE 3ZDHA 4O4HE 5HXHA 2CHOA 1FJGT 5FXXA 4IDPA 3AE5A 3ZC0A 1SUMB 5KE4A 3M3ZB 2I0MA 1T72A 3UU8A 4DR5T 2WDVA 3BQLA 4HWIB 4JV5T 2V7MA 1XZYA 1GQEA 2BVLA 3VRBA 4DR1T 2CA5A 2Q9QA 3ZMZB 1KEYA 1W9RA 2WMOA 3QUJA 3C84A 4BJMA 5AFMA 3LSVA 4AQGA 1YXRA 4HFEA 2IDOB 2LSYA 4HFDA 2IHR1 5HEGA 3NWIA 4X5TA 5AQUB 2CBJA 2CM0A 1N33T 3PUWF 3KV4A 1MMNA 3AVSA 5J5HA 1U5PA 2V5CA 2DI4A 2ZM2A 1DU2A 4QHOA 5F3JA 1D1BA 4PFPA 5AQTB 2NW7A 3FXDB 1UURA 3PU8A 3ZCIA 5BR8T 3CK6A 2LSJA 2WN9A 4PNIA 2CXLA 1NENA 2VVSA 2LT3A 2K48A 2XQ3A 3DP7A 4K0UA 3RQWA 3VKGA 1J1JA 4CN4A 2C5IT 5LBQB 3UUNA 2BBHA 2HN2A 3PV0F 4KHZF 5HXEA 2YDRA 2ES0A 3Q5DA 3R6NA 5FY7A 2AXDS 2M6BA 3OPCA 2QGSA 5LBMA 2V5DA 1I94T 3VU7H 2UXDT 3RF1A 2VASA 4Z90A 1O3XA 3X1DA 4I50E 4GK5E 3RIUC 4EZ4A 5AQNB 4YJ2E 3UFEA 2KNDA 4OYJA 4ZXLA 4IREA 4PJMA 3Q5EA 4WV9A 4DO0A 5JREA 4AKRB 2YU1A 4UM3P 4PJLA 1MIWA 2OV9A 3BQIA 1D0YA 5BMVE 5LP6E 2LHNA 4YTPA 3E0ZA 4HQPA 3P8CD 2LSKA 3RPUA 4DV2T 4ZI3D 3JAEA 4IDZA 3PUSA 4AQFA 4WBNE 5LG4A 5LMUT 5FP3A 2F4VT 2ODVA 4JI6T 4LFCT 3UQ4A 1ZKEA 4IDQA 3AA0B 1HR0T 1D1AA 4DV4T 5AFMB 3PUVF 4EV6A 4JI1T 2BBJA 1X79A 3SQ6A 1B7TA 1AJ3A 3UULA 2CLYB 4O4LE 4YSXA 3J7Yq 5C2TA 1XWMA 3LK3B 3EI0A 4LMLA 4B6XA 3HKEE 2A9UA 4WW0A 4EEDA 3WTMA 1MMDA 2E8IA 4B3MT 2YOEA 5H6RB 4X20E 3L09A 3UU3A 5JDGA 3CIRA 4CZZB 3A8YC 3WTJA 3AA7B 3IF8B 2W63A 1CUNA 4YFSA 2XHEB 4I43B 3WTHA 1BR1A 2A72A 5KX5E 3ESLA 4UXNB 4HWDA 3ZN1B 3V5SA 4U2YA 2LOPA 5EK3A 2JQHA 2DLRA 3AAIA 1D0ZA 4JI8T 2D5UA 3AA6B 2FBWA 2LSIA 3SWHA 3FZKB 2JQ9A 3NRXA 2WAUA 5J5GA 2QC1B 1ZOYA 3CX8B 3TLWA 4FJOA 4ZK1A 4ILUA 2BYPA 3UTKA 4JEUB 2XM1A 1UX4A 5KMGP 5CB4E 3JC6C 4DR3T 4GYSA 4HFCA 4U7YA 3H3MA 4HTEA 4H9OC 2X9HA 5EK4A 3I0OA 4WNKA 1MMAA 5LOVE 3U8JA 2CXFA 2X68A 2ZJUA 4K0KT 2BYQA 4EZ1A 5LJNA 2PTFA 3Q5XA 3E22E 2NWBA 5ETWA 2YEVC 1HS7A 3NBXX 3ZPOA 1SA0E 4HFBA 2E5LT 4UIGA 2KINB 3OYXA 4HWCA 4YJ3E 5AFLA 4YSZA 4DBQA 2V6YA 4TUYE 5HEJA 5FVKA 1MNEA 4EAHA 3RC3A 3A7MA 4TWHA 4QXBB 4ASKA 1W0BA 4WZXA 2V7IA 3OBVE 5AQGB 4MALA 1ZEEA 5FJVA 2VWAA 2X00D 1YQ4A 3EDVA 4OHFA 4IL4A 1SHZC 1WCRA 3VKHA 5LGTB 4EXTA 5CO5A 3FXEB 4I4TE 2JQQA 1T7SA 1MIVA 3KBTA 4E7SA 5J0ZA 4A98A 4DV7T 2XZ6A 2YINA 3I9YA 4A97A 2Y54A 5JDHA 4H63V 3I1AA 2Q9QC 3WTNA 4BFQA 4E7ZA 3UQ7A 2X51A 4JLEA 4JYAT 2J47A 3RYFE 3AE4A 4O2BE 3ONLC 1FMVA 4ZI2D 4UVBB 2BVMA 2N1GA 5FY0A 2FJBA 1I9BA 4HWFA 5TVCA 2ZMAA 4AKHA 5JDMA 1M62A 3PEOA 1N32T 4B3TT 1XDOA 1E2AA 4DIDB 4IDNA 2PG8A 4AFTA 2FJDA 2XQ8A 3I0QA 1WLXA 2K24A 1HCIA 2X9XA 3RYCE 1XNQT 3IGQA 2CLYC 2LM9A 4X62T 2XQ7A 2LHRA 5ADXL 2XYTA 1Y64B 5E0OA 1WYCA 2QRXA 4YSYA 1HNWT 4DR6T 3IBPA 5HCMA 4CXYA 2XQAA 3SIOA 2X0LB 4AISA 4MFRA 3ZDGA 4EZHA 5M4YA 4FI5A 4QH5A 1ZV4X 4ADZA 3RHWA 4NUUA 3TLVA 3C4ZA 4F8HA 5CGMA 4DVDA 3T1YT 4KUMB 2D9DA 3IEEA 5LA6E 2V6YB 1WR6A 2LE8A 2NW9A 2BJ0A 5LJMA 1VCTA 3AA1B 4IIJE 3MJXA 4U33A 5AQJB 2Y58A 3N2KE 2X67A 3DJBA 4NXNT 1HF8A 3KBUA 3U8LA 3AB3B 2W0GA 1KNZA 4J2CA 1QSDA 4N78D 5AQVB 3T8OA 3K3QC 4X1KE 2IC6A 3NKZA 3VHLA 2H89A 1V9DA 1J5WA 3ZMTB 3ZYLA 4AQFC 3FBLA 3HKBE 2EHOD 2X00A 1FMWA 4YTMA 4TNVA 4O8SA 5L4HA 2WSSV 1Y01A 1NAFA 3P50A 3ABVA 1SE7A 3EABA 4IL9A 2KWIB 2XQ4A 3RGLA 2V26A 2B76A 1S94A 3KDSE 3UUMA 1YQ3A 5LXTE 5TAOA 2X66A 5HWYA 2W67A 3MXZA 5BP0A 4ZK4A 5FY1A 2ZJVA 2K3WA 5CA1E 4G2AA 4A5XA 4U3CA 2WWVA 2NTXA 2UXNB 3P4WA 3UU5A 3O1IA 3RRCA 5JMEA 3BK9A 4DV5T 3HKCE 2ZM6T 2BYNA 2VURA 1HTJF 2BYRA 5L3DB 2XSAA 1R8IA 4EIWA 1HX8A 1IBMT 4EOZB 4PIRA 4DV3T 1D0XA 1G8XA 4D01A 4BQTA 3ZYMA 5HEHA 2VKOA 3IA3A 3EAMA 2BDEA 4A56A 5AQLB 4GOUA 2CXDA 5LHIB 2W62A 4JEHB 3C4XA 3QC9A 2H3RA 5HXCA 4LF5T 2ZM8A 4UY2A 5LMNT 4I0UA 2XQ9A 2XQYA 1XNRT 2BKNA 1YD8G 3T1HT 5JDFA 4XZCA 2X0HA 5FXWA 4U31A 1N34T 2LRKA 2WY2A 5ABFB 3RKOA 1KNRA 1XMQT 3JAFA 4QX7B 2VB6A 1XMOT 4FRRA 4UR9A 2LKGA 2XSBA 4LF7T 4DMWA 2V7LA 5KDMC 3QOFA 3WTKA 4AFHA 2W2UA 4H9RC 2XJ7A 4CQIA 5FYMA 3C51A 2ACXA 1UV6A 3AAEB 4GIWA 2W4XA 2C9TA 5L3CB 4DR7T 5AINA 3U78A 4P0BA 4MBQA 1LRZA 3CPZA 3PUGA 5A1LA 3D0TA 1OWAA 3RQUA 4EB6E 1UK5A 5AFKA 2X9YA 4EYYR
chains in the Genus database with same CATH topology
4QH1A 4ZRUA 4LMLA 4ZR6A 4UM3S 4ZZCA 4AFTA 4QAAA 2UZ6A 4HFBA 1UW6A 2XQ8A 4ZJSA 4D01A 1OEDC 3WIPA 4ILCA 4BQTA 3TLSA 5HEHA 3WTMA 3EAMA 4Z90A 2YOEA 3C79A 2MAWA 4TNWA 3IGQA 5AFLA 3C84A 5AFMA 3UU3A 3LSVA 5J5FA 2XNTA 4UM3A 3T4MA 5HCJA 5HEOA 3RIFA 5L4EA 3U8NA 5AFHA 4ILAA 5AFJA 2W8FA 3WTJA 2LKHA 2XQ7A 4HFEA 2XYTA 4LMJA 4IREA 5L47A 2YMDA 2LLYA 4UY2A 4WV9A 5BW2A 3JADA 2LM2A 4HFDA 4B5DA 5HEJA 1OEDA 2XQ9A 5HEGA 4UM1A 2X00A 3WTHA 4HFHA 4UM3P 4X5TA 5J5IA 2Y57A 3PEOA 2BYSA 4TNVA 2BG9B 2WNJA 4TWHA 5L4HA 5HCMA 2PH9A 3WTLA 5J5HA 5KE4A 2VL0A 2BR8A 3U8MA 4HQPA 3P50A 4QACA 2XQAA 5SYOA 5KZUA 3SIOA 4ALXA 3JAEA 3TLUA 4IL9A 3ZDGA 2XQ4A 2BG9E 2WNCA 4LMKA 5FJVA 2YN6A 3RIAA 2XNVA 2YMEA 2X00D 4UXUA 5BRXA 3JAFA 2XQ6A 5J5GA 4QABA 2QC1B 4QH5A 4IL4A 2YKSA 4XK9A 3UUBA 4NPPA 3TLWA 3RI5A 2W8GA 3EHZA 4ZK1A 3RHWA 4DBMA 5CO5A 4Z91A 4ZJTA 2BYPA 4FRRA 4QH4A 5BP0A 2LKGA 2BG9C 3UQ4A 3SQ9A 3TLVA 2PGZA 5CFBA 4COFA 4F8HA 4ZK4A 5LG3A 2WN9A 2KSRA 2ZJVA 3WTOA 5AFMB 5AFNA 3ZDHA 3WTIA 4HFCA 4AFHA 3WTKA 5LXBA 2WZYA 5J0ZA 4XHEA 4A98A 2XZ6A 5IUXA 4A97A 4HFIA 2XQ3A 2Y54A 3U8JA 2Y56A 2BR7A 2XYSA 3TLTA 1UV6A 3UU6A 2ZJUA 1OEDB 2BJ0A 4ZZBA 3SQ6A 3P4WA 4ILBA 5HEUA 3RQWA 2BG9A 2BYQA 2C9TA 2WNLA 2XNUA 3GUAA 3PMZA 4TWFA 3UQ7A 3WTNA 4BFQA 4EZ1A 3UU8A 3UU5A 3SH1A 5AINA 5JMEA 2M6IA 2Y58A 2Y7YA 4NZBA 2XZ5A 2BYNA 2BYRA 1UX2A 1OEDE 3U8LA 4AFGA 4TWDA 3RQUA 1I9BA 4PIRA 3U8KA 5TVCA 5AFKA 2XQ5A 2M6BA 3UU4A 3EI0A 3ZKRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QH1 A;  4ZRU A;  4LML A;  4ZR6 A;  4UM3 S;  4ZZC A;  4AFT A;  4QAA A;  2UZ6 A;  4HFB A;  1UW6 A;  2XQ8 A;  4ZJS A;  4D01 A;  1OED C;  3WIP A;  4ILC A;  4BQT A;  3TLS A;  5HEH A;  3WTM A;  3EAM A;  4Z90 A;  2YOE A;  3C79 A;  2MAW A;  4TNW A;  3IGQ A;  5AFL A;  3C84 A;  5AFM A;  3UU3 A;  3LSV A;  5J5F A;  2XNT A;  4UM3 A;  3T4M A;  5HCJ A;  5HEO A;  3RIF A;  5L4E A;  3U8N A;  5AFH A;  4ILA A;  5AFJ A;  2W8F A;  3WTJ A;  2LKH A;  2XQ7 A;  4HFE A;  2XYT A;  4LMJ A;  4IRE A;  5L47 A;  2YMD A;  2LLY A;  4UY2 A;  4WV9 A;  5BW2 A;  3JAD A;  2LM2 A;  4HFD A;  4B5D A;  5HEJ A;  1OED A;  2XQ9 A;  5HEG A;  4UM1 A;  2X00 A;  3WTH A;  4HFH A;  4UM3 P;  4X5T A;  5J5I A;  2Y57 A;  3PEO A;  2BYS A;  4TNV A;  2BG9 B;  2WNJ A;  4TWH A;  5L4H A;  5HCM A;  2PH9 A;  3WTL A;  5J5H A;  5KE4 A;  2VL0 A;  2BR8 A;  3U8M A;  4HQP A;  3P50 A;  4QAC A;  2XQA A;  5SYO A;  5KZU A;  3SIO A;  4ALX A;  3JAE A;  3TLU A;  4IL9 A;  3ZDG A;  2XQ4 A;  2BG9 E;  2WNC A;  4LMK A;  5FJV A;  2YN6 A;  3RIA A;  2XNV A;  2YME A;  2X00 D;  4UXU A;  5BRX A;  3JAF A;  2XQ6 A;  5J5G A;  4QAB A;  2QC1 B;  4QH5 A;  4IL4 A;  2YKS A;  4XK9 A;  3UUB A;  4NPP A;  3TLW A;  3RI5 A;  2W8G A;  3EHZ A;  4ZK1 A;  3RHW A;  4DBM A;  5CO5 A;  4Z91 A;  4ZJT A;  2BYP A;  4FRR A;  4QH4 A;  5BP0 A;  2LKG A;  2BG9 C;  3UQ4 A;  3SQ9 A;  3TLV A;  2PGZ A;  5CFB A;  4COF A;  4F8H A;  4ZK4 A;  5LG3 A;  2WN9 A;  2KSR A;  2ZJV A;  3WTO A;  5AFM B;  5AFN A;  3ZDH A;  3WTI A;  4HFC A;  4AFH A;  3WTK A;  5LXB A;  2WZY A;  5J0Z A;  4XHE A;  4A98 A;  2XZ6 A;  5IUX A;  4A97 A;  4HFI A;  2XQ3 A;  2Y54 A;  3U8J A;  2Y56 A;  2BR7 A;  2XYS A;  3TLT A;  1UV6 A;  3UU6 A;  2ZJU A;  1OED B;  2BJ0 A;  4ZZB A;  3SQ6 A;  3P4W A;  4ILB A;  5HEU A;  3RQW A;  2BG9 A;  2BYQ A;  2C9T A;  2WNL A;  2XNU A;  3GUA A;  3PMZ A;  4TWF A;  3UQ7 A;  3WTN A;  4BFQ A;  4EZ1 A;  3UU8 A;  3UU5 A;  3SH1 A;  5AIN A;  5JME A;  2M6I A;  2Y58 A;  2Y7Y A;  4NZB A;  2XZ5 A;  2BYN A;  2BYR A;  1UX2 A;  1OED E;  3U8L A;  4AFG A;  4TWD A;  3RQU A;  1I9B A;  4PIR A;  3U8K A;  5TVC A;  5AFK A;  2XQ5 A;  2M6B A;  3UU4 A;  3EI0 A;  3ZKR A; 
#chains in the Genus database with same CATH topology
 4LF8 T;  4ZI3 C;  2K5B B;  4QAA A;  1UW6 A;  2EHO A;  5AQI B;  5JDN A;  5LGN B;  2HHH T;  3AE9 A;  4PAG A;  5ABE A;  4X66 T;  3LG7 A;  3OKQ A;  3WI3 A;  2KWH A;  5C8Y E;  3SRZ A;  4TN7 B;  5HWX A;  5CJ5 A;  4X65 T;  1LVF A;  4PJJ A;  4QXC B;  3ETV A;  5J2T E;  3N9L A;  2C5J A;  2JPF A;  5EZY E;  5KZU A;  1JNR A;  5AQR B;  3J9X 1;  2JIW A;  3IHR A;  5DJQ C;  3NRY A;  4DR2 T;  1UX5 A;  4LMK A;  3N9Q A;  4IDO A;  2V7K A;  4QAB A;  4XK9 A;  2CCQ A;  5FXZ A;  4HGA A;  2WS3 A;  2W61 A;  5ABG A;  2YK0 A;  5LG3 A;  2DWK A;  5IHY A;  3KVB A;  2JMK A;  2WDQ A;  4QWN B;  2WZY A;  1NWM X;  3P7I A;  2JJ9 A;  2X9W A;  4YHJ A;  5JRC A;  2JRK A;  4WBO A;  5EK2 A;  4JBW F;  4IE5 A;  4KP3 C;  1JNZ A;  2R6G F;  3FHN A;  4AXP A;  4GKJ T;  2XYS A;  2BKO A;  3CQG B;  1E1H B;  4ILB A;  5HEU A;  2XNU A;  2WNL A;  3GUA A;  4TWF A;  3ZLI A;  2CHN A;  2N9D A;  2LSG A;  2XPK A;  2XZ5 A;  4L5G A;  2WM9 A;  3K8P C;  2HPJ A;  1UX2 A;  5JQG E;  3CKD A;  1WYB A;  3F2E A;  4DV0 T;  3L8R A;  2WWU A;  4ZJS A;  3V5U A;  4X1Y E;  2V6X A;  4U7I A;  3U8N A;  4HEA A;  3CWZ B;  3ZJ1 A;  2XTL A;  2IAK A;  2E9X D;  4O4I E;  2C0S A;  4ERR A;  2D0T A;  4BJN A;  2BS4 A;  3N9N A;  3F57 A;  2YU2 A;  4I55 E;  3MK7 C;  2LJL A;  5LGU B;  4TX5 A;  5AQK B;  3UFG A;  4DUZ T;  2BYS A;  4HFV A;  2VKJ A;  3Q2M A;  2WB5 A;  4B3R T;  4HWH A;  4QX8 B;  4QAC A;  3PUR A;  1U4Q A;  3OTO T;  4KBM B;  2WNC A;  1CHU A;  2H88 A;  2QYW A;  2PJQ A;  2YME A;  2CRB A;  3UUB A;  3O4X E;  3RI5 A;  2WU2 A;  4P1N A;  1QLB A;  2WDR A;  2HN1 A;  2EHO B;  4UEM A;  2RPA A;  3QK6 A;  3PU3 A;  2RA1 A;  2UUC T;  3GWH A;  4AIU A;  3ANW B;  4JUY A;  4C91 A;  3CQX C;  2L9Q A;  2UU9 T;  2CBI A;  1HG5 A;  4ZS2 A;  4XBF B;  2WCA A;  4ZHQ E;  3AED A;  3CML A;  5FNV E;  2GK9 A;  2L8K A;  2C5K T;  1OED E;  1ZP0 A;  3RX6 A;  4AFG A;  4UVC B;  3FZM B;  4CI2 B;  2KT9 A;  2Q9Q D;  2MOZ A;  2XQ5 A;  4TZ4 C;  3KV5 A;  4ZRU A;  3FZH B;  4TV8 E;  4JI7 T;  2W66 A;  4DUY T;  4ILC A;  1T8B A;  3PJA J;  1G73 A;  2HH7 A;  2MYS A;  3LDQ B;  2XNT A;  2CWY A;  1J5E T;  5AFJ A;  3KIN B;  2VKH A;  2Z6E A;  5JRC B;  2MPK A;  4DR4 T;  3C64 A;  3AEF A;  2LM2 A;  3PJA A;  2Y57 A;  5GON E;  2V1D B;  1E7P A;  4AKI A;  2WQY A;  3OVU A;  2FJA A;  5LNK A;  2XAF B;  4V1A v;  3ZN0 B;  1XDP A;  4GYR A;  4ZI2 C;  3ZC1 A;  2FJE A;  2WMN A;  2XQ6 A;  2ACZ A;  3L3P A;  2KLQ A;  3C50 A;  4QH4 A;  5LHG B;  2JMH A;  3ZYK A;  5AQO B;  5FL0 A;  1M7K A;  2N2N A;  3AE6 A;  2DNX A;  2D0U A;  4PK5 A;  4YXD A;  3B5M A;  4XHE A;  1L0V A;  4TV9 E;  3ZCJ A;  4CXW A;  4IE4 A;  1BR0 A;  2BR7 A;  3UU6 A;  2Y8D A;  4JI4 T;  3AE1 A;  4F6R C;  4QKN A;  1S35 A;  5L3B B;  5L3F B;  2Y7Y A;  3WAJ A;  4TWD A;  3NVO A;  3UU4 A;  3RYH E;  2E9X A;  3LBX B;  4ZEY A;  2LEH A;  1HX1 B;  5L2L A;  3CVR A;  3RLF F;  4GKK T;  1IJ6 A;  2MAW A;  3RYI E;  3UUX B;  1D1C A;  2L3L A;  3RIF A;  5AFH A;  4ILA A;  5ABF A;  2W8F A;  2LKH A;  2E5V A;  2LOS A;  5AQP B;  5AFU L;  1OED A;  4HFH A;  3ZEF B;  2J62 A;  3MZK B;  3GN5 A;  2WNJ A;  4IT4 A;  4NUV A;  3EUH A;  1UUS A;  4QXH B;  4AKL A;  3AEA A;  2BG9 E;  2IUB A;  3ZMS B;  1BR4 A;  3K1S A;  4AI6 A;  2W8G A;  2XAH B;  4GK0 E;  4CI1 B;  5CFB A;  4COF A;  5IWA T;  1KK7 A;  3S4U A;  3SFE A;  5JR9 A;  1VRB A;  1IZN B;  3A5X A;  3P4R A;  2KSR A;  5IUX A;  4B3S T;  4PK4 A;  2Y56 A;  1Z0P A;  3ZT7 A;  4IE6 A;  1HNZ T;  5HXS A;  3MA9 A;  3HA4 A;  2EHO C;  2CE7 A;  4OFZ A;  4NZB A;  4DND A;  3W15 B;  4H63 H;  3ZJ2 A;  4LFB T;  3U8K A;  3K3N A;  5LHH B;  4YTN A;  3HR0 A;  3P4Q A;  3N9O A;  4PK6 A;  2WBL A;  3HL6 A;  2UZ6 A;  2DCF A;  3SFD A;  2UUB T;  1IJ5 A;  1HFA A;  3TLS A;  3JCF A;  3FB2 A;  5JTG A;  4G63 A;  3C79 A;  4OYK A;  2W00 A;  4CN6 A;  2H7V C;  2VQE T;  3T4M A;  3DTO A;  5HCJ A;  3SS1 A;  2VVN A;  5L47 A;  2YMD A;  2A3D A;  3QB5 K;  1WRD A;  3EDU A;  3LK2 B;  4M1P A;  3N2G E;  4Z8X A;  1QUU A;  4ALX A;  3VRA A;  3MKD A;  3PTR B;  3AEG A;  3P4S A;  2YN6 A;  3RIA A;  5JDL A;  4LFA T;  5BRX A;  5AQM B;  2E9X B;  1BR2 A;  3AAA B;  4L9I A;  3Q5W A;  4C90 A;  3EHZ A;  1T98 A;  2NP9 A;  5LB7 B;  4DV1 T;  3AXJ A;  5FVL A;  5AFN A;  3WTO A;  2NOX A;  3WTI A;  3KV6 A;  2WU5 A;  2LRL A;  5FMN A;  1LKX A;  4HFI A;  3O9X A;  3TLT A;  4EYU A;  1OED B;  4H9N C;  1IBL T;  2BG9 A;  2VKD A;  4X1I E;  2M67 A;  2K9A A;  3ZMV B;  3GN5 B;  1HNX T;  4JI0 T;  2E2A A;  3AE7 A;  5JDQ A;  4HN9 A;  1KNP A;  5AQS B;  3C4W A;  4ZZC A;  3PUX F;  3SOL A;  3AEC A;  5IYZ E;  4IGU A;  2QA7 A;  3ZSS A;  4UM3 A;  3HI2 A;  5FKY A;  5JR9 B;  5L4E A;  4EEB A;  3ZMU B;  3M65 A;  5C3J A;  3HKD E;  4IHJ E;  3PUZ F;  1YKE B;  2I59 A;  2Q9Q B;  2B1E A;  4DBR A;  3OJA A;  3CQC B;  2BZB A;  2DHR A;  2YDS A;  1W09 A;  1W0A A;  2Y48 B;  3ANW A;  2X0Y A;  5FXV A;  3H3A A;  3N9M A;  4CXX A;  2XY8 B;  4PW8 A;  2YKS A;  4ZI7 E;  5F8P A;  2J1D G;  3SQ9 A;  5H6Q B;  2PGZ A;  4XAX B;  5LXB A;  4P0A A;  3CX6 B;  4JI3 T;  1KFY A;  2V7J A;  3ZT5 A;  2WZH A;  3NZP A;  2VL8 A;  4LF4 T;  2XAG B;  4ZZB A;  4EGW A;  5LYJ E;  3PMZ A;  4KI0 F;  3SH1 A;  1HG2 A;  2BKP A;  2M6I A;  3F31 A;  4CN1 A;  4UV8 B;  2DL1 A;  4H9P C;  3ZT6 A;  2SPC A;  4HKA A;  3RKG A;  4ZS3 A;  4LF6 T;  3AE2 A;  3ONX A;  2OA5 A;  2XAS B;  3UT5 E;  4PJN A;  2HPL A;  3CX7 B;  3JC6 D;  4MHC A;  2Y6X A;  2I6H A;  5DQW A;  5KXJ A;  3L39 A;  3AXJ B;  4AKG A;  4JI2 T;  3AE3 A;  3PUY F;  2PFV A;  3H37 A;  3GA8 A;  4O2A E;  3TKL B;  1OXZ A;  2LLY A;  3G06 A;  4KMC A;  5BW2 A;  3JAD A;  2KZ7 B;  3FBZ A;  5L3E B;  5DQV A;  4U2Z A;  2BG9 B;  3LJC A;  3RIU A;  2PH9 A;  3WTL A;  5LCY A;  1US7 B;  3PUA A;  2MTQ A;  3B13 A;  2IIU A;  2XNV A;  3BQK A;  3EVY A;  4H9S E;  2BS3 A;  3AEB A;  4UVA B;  2CEA A;  4DBM A;  3WAK A;  3N5L A;  4U74 A;  4KHP T;  2DWG A;  3Q9D A;  4ANJ A;  2FUP A;  4AQY T;  4KX6 A;  4IE0 A;  1MIY A;  3RH3 A;  3LBX A;  1KF6 A;  5ABH A;  1UCU A;  4JI5 T;  2E9X C;  3RC8 A;  3KV9 A;  3FZL B;  5J5I A;  2ZLY A;  2XM2 A;  4WYV A;  1WFD A;  1YW0 A;  2UUA T;  5J2U E;  1H7C A;  2XZE A;  2YDQ A;  3AE8 A;  1MMG A;  2AE9 A;  1YKH B;  5CA0 E;  2XAQ B;  2XUE A;  3ZKR A;  4QH1 A;  2CMR A;  2UXC T;  4Q25 A;  4UM3 S;  1ZHC A;  1OED C;  1VCS A;  3WIP A;  2ZM0 A;  2IW5 B;  3K3O A;  4UF0 A;  3AVR A;  5J1G A;  1WR0 A;  4TNW A;  4P09 A;  4IE7 A;  2WZI A;  3N9P A;  1Z8U A;  2V8S V;  5HAX A;  2CWO A;  4NXM T;  2NW8 A;  3LFM A;  2QVA A;  3N2O A;  4UM1 A;  1VOM A;  5F5W A;  3ONJ A;  3AEE A;  4OX9 T;  2RP4 A;  1FEW A;  1X9B A;  1N36 T;  1IBK T;  2VL0 A;  3VR9 A;  3U8M A;  3I9W A;  5JR9 C;  4CI3 B;  4IST A;  2UXX B;  3E08 A;  2KXP B;  3TLU A;  2VQF T;  4BAY B;  3O1J A;  4HE8 A;  3MAC A;  2KMF A;  3ETU A;  3O1H A;  4UEL A;  4Z91 A;  2NR4 A;  1EZ3 A;  2JQK A;  2CPT A;  3KVA A;  4YT0 A;  3LK4 2;  2H7O A;  3QB5 A;  5JVD E;  3R84 B;  3KFW X;  1FIO A;  5AQH B;  1UGO A;  4U72 A;  1NEK A;  5JH7 E;  3VR8 A;  4PFO A;  3PUQ A;  4OK0 A;  3OYZ A;  3B57 A;  1IAP A;  5HXR A;  3GMI A;  3NZQ A;  2WP9 A;  4O4J E;  5L3G B;  2G0U A;  2A2F X;  4YHH T;  3RRW A;  3U3I A;  4X64 T;  2UXB T;  2VK9 A;  4ZR6 A;  5FL1 A;  5HYA A;  3PE0 A;  4YY3 T;  1I6Z A;  4MLK A;  4LF9 T;  3PDY A;  5J5F A;  5HEO A;  4BA9 A;  2IML A;  3QNU A;  2XAJ B;  3C98 B;  4LMJ A;  4B5D A;  4NIQ A;  2J4G A;  4UV9 B;  2IC9 A;  4DV6 T;  2ODU A;  1MND A;  2PBI A;  4YLH A;  4ISS A;  2BR8 A;  1LVK A;  5SYO A;  2BS2 A;  5AQF B;  2P9B A;  3P4P A;  4H9Q C;  3ZST A;  4UXU A;  2OLT A;  5AQQ B;  4NPP A;  4L0R A;  2MBG A;  2D2S A;  4ZJT A;  4DMV A;  2BG9 C;  2NTY A;  4UF0 B;  3FZF B;  5DAB A;  4ZOL E;  3ZDH A;  4O4H E;  5HXH A;  2CHO A;  1FJG T;  5FXX A;  4IDP A;  3AE5 A;  3ZC0 A;  1SUM B;  5KE4 A;  3M3Z B;  2I0M A;  1T72 A;  3UU8 A;  4DR5 T;  2WDV A;  3BQL A;  4HWI B;  4JV5 T;  2V7M A;  1XZY A;  1GQE A;  2BVL A;  3VRB A;  4DR1 T;  2CA5 A;  2Q9Q A;  3ZMZ B;  1KEY A;  1W9R A;  2WMO A;  3QUJ A;  3C84 A;  4BJM A;  5AFM A;  3LSV A;  4AQG A;  1YXR A;  4HFE A;  2IDO B;  2LSY A;  4HFD A;  2IHR 1;  5HEG A;  3NWI A;  4X5T A;  5AQU B;  2CBJ A;  2CM0 A;  1N33 T;  3PUW F;  3KV4 A;  1MMN A;  3AVS A;  5J5H A;  1U5P A;  2V5C A;  2DI4 A;  2ZM2 A;  1DU2 A;  4QHO A;  5F3J A;  1D1B A;  4PFP A;  5AQT B;  2NW7 A;  3FXD B;  1UUR A;  3PU8 A;  3ZCI A;  5BR8 T;  3CK6 A;  2LSJ A;  2WN9 A;  4PNI A;  2CXL A;  1NEN A;  2VVS A;  2LT3 A;  2K48 A;  2XQ3 A;  3DP7 A;  4K0U A;  3RQW A;  3VKG A;  1J1J A;  4CN4 A;  2C5I T;  5LBQ B;  3UUN A;  2BBH A;  2HN2 A;  3PV0 F;  4KHZ F;  5HXE A;  2YDR A;  2ES0 A;  3Q5D A;  3R6N A;  5FY7 A;  2AXD S;  2M6B A;  3OPC A;  2QGS A;  5LBM A;  2V5D A;  1I94 T;  3VU7 H;  2UXD T;  3RF1 A;  2VAS A;  4Z90 A;  1O3X A;  3X1D A;  4I50 E;  4GK5 E;  3RIU C;  4EZ4 A;  5AQN B;  4YJ2 E;  3UFE A;  2KND A;  4OYJ A;  4ZXL A;  4IRE A;  4PJM A;  3Q5E A;  4WV9 A;  4DO0 A;  5JRE A;  4AKR B;  2YU1 A;  4UM3 P;  4PJL A;  1MIW A;  2OV9 A;  3BQI A;  1D0Y A;  5BMV E;  5LP6 E;  2LHN A;  4YTP A;  3E0Z A;  4HQP A;  3P8C D;  2LSK A;  3RPU A;  4DV2 T;  4ZI3 D;  3JAE A;  4IDZ A;  3PUS A;  4AQF A;  4WBN E;  5LG4 A;  5LMU T;  5FP3 A;  2F4V T;  2ODV A;  4JI6 T;  4LFC T;  3UQ4 A;  1ZKE A;  4IDQ A;  3AA0 B;  1HR0 T;  1D1A A;  4DV4 T;  5AFM B;  3PUV F;  4EV6 A;  4JI1 T;  2BBJ A;  1X79 A;  3SQ6 A;  1B7T A;  1AJ3 A;  3UUL A;  2CLY B;  4O4L E;  4YSX A;  3J7Y q;  5C2T A;  1XWM A;  3LK3 B;  3EI0 A;  4LML A;  4B6X A;  3HKE E;  2A9U A;  4WW0 A;  4EED A;  3WTM A;  1MMD A;  2E8I A;  4B3M T;  2YOE A;  5H6R B;  4X20 E;  3L09 A;  3UU3 A;  5JDG A;  3CIR A;  4CZZ B;  3A8Y C;  3WTJ A;  3AA7 B;  3IF8 B;  2W63 A;  1CUN A;  4YFS A;  2XHE B;  4I43 B;  3WTH A;  1BR1 A;  2A72 A;  5KX5 E;  3ESL A;  4UXN B;  4HWD A;  3ZN1 B;  3V5S A;  4U2Y A;  2LOP A;  5EK3 A;  2JQH A;  2DLR A;  3AAI A;  1D0Z A;  4JI8 T;  2D5U A;  3AA6 B;  2FBW A;  2LSI A;  3SWH A;  3FZK B;  2JQ9 A;  3NRX A;  2WAU A;  5J5G A;  2QC1 B;  1ZOY A;  3CX8 B;  3TLW A;  4FJO A;  4ZK1 A;  4ILU A;  2BYP A;  3UTK A;  4JEU B;  2XM1 A;  1UX4 A;  5KMG P;  5CB4 E;  3JC6 C;  4DR3 T;  4GYS A;  4HFC A;  4U7Y A;  3H3M A;  4HTE A;  4H9O C;  2X9H A;  5EK4 A;  3I0O A;  4WNK A;  1MMA A;  5LOV E;  3U8J A;  2CXF A;  2X68 A;  2ZJU A;  4K0K T;  2BYQ A;  4EZ1 A;  5LJN A;  2PTF A;  3Q5X A;  3E22 E;  2NWB A;  5ETW A;  2YEV C;  1HS7 A;  3NBX X;  3ZPO A;  1SA0 E;  4HFB A;  2E5L T;  4UIG A;  2KIN B;  3OYX A;  4HWC A;  4YJ3 E;  5AFL A;  4YSZ A;  4DBQ A;  2V6Y A;  4TUY E;  5HEJ A;  5FVK A;  1MNE A;  4EAH A;  3RC3 A;  3A7M A;  4TWH A;  4QXB B;  4ASK A;  1W0B A;  4WZX A;  2V7I A;  3OBV E;  5AQG B;  4MAL A;  1ZEE A;  5FJV A;  2VWA A;  2X00 D;  1YQ4 A;  3EDV A;  4OHF A;  4IL4 A;  1SHZ C;  1WCR A;  3VKH A;  5LGT B;  4EXT A;  5CO5 A;  3FXE B;  4I4T E;  2JQQ A;  1T7S A;  1MIV A;  3KBT A;  4E7S A;  5J0Z A;  4A98 A;  4DV7 T;  2XZ6 A;  2YIN A;  3I9Y A;  4A97 A;  2Y54 A;  5JDH A;  4H63 V;  3I1A A;  2Q9Q C;  3WTN A;  4BFQ A;  4E7Z A;  3UQ7 A;  2X51 A;  4JLE A;  4JYA T;  2J47 A;  3RYF E;  3AE4 A;  4O2B E;  3ONL C;  1FMV A;  4ZI2 D;  4UVB B;  2BVM A;  2N1G A;  5FY0 A;  2FJB A;  1I9B A;  4HWF A;  5TVC A;  2ZMA A;  4AKH A;  5JDM A;  1M62 A;  3PEO A;  1N32 T;  4B3T T;  1XDO A;  1E2A A;  4DID B;  4IDN A;  2PG8 A;  4AFT A;  2FJD A;  2XQ8 A;  3I0Q A;  1WLX A;  2K24 A;  1HCI A;  2X9X A;  3RYC E;  1XNQ T;  3IGQ A;  2CLY C;  2LM9 A;  4X62 T;  2XQ7 A;  2LHR A;  5ADX L;  2XYT A;  1Y64 B;  5E0O A;  1WYC A;  2QRX A;  4YSY A;  1HNW T;  4DR6 T;  3IBP A;  5HCM A;  4CXY A;  2XQA A;  3SIO A;  2X0L B;  4AIS A;  4MFR A;  3ZDG A;  4EZH A;  5M4Y A;  4FI5 A;  4QH5 A;  1ZV4 X;  4ADZ A;  3RHW A;  4NUU A;  3TLV A;  3C4Z A;  4F8H A;  5CGM A;  4DVD A;  3T1Y T;  4KUM B;  2D9D A;  3IEE A;  5LA6 E;  2V6Y B;  1WR6 A;  2LE8 A;  2NW9 A;  2BJ0 A;  5LJM A;  1VCT A;  3AA1 B;  4IIJ E;  3MJX A;  4U33 A;  5AQJ B;  2Y58 A;  3N2K E;  2X67 A;  3DJB A;  4NXN T;  1HF8 A;  3KBU A;  3U8L A;  3AB3 B;  2W0G A;  1KNZ A;  4J2C A;  1QSD A;  4N78 D;  5AQV B;  3T8O A;  3K3Q C;  4X1K E;  2IC6 A;  3NKZ A;  3VHL A;  2H89 A;  1V9D A;  1J5W A;  3ZMT B;  3ZYL A;  4AQF C;  3FBL A;  3HKB E;  2EHO D;  2X00 A;  1FMW A;  4YTM A;  4TNV A;  4O8S A;  5L4H A;  2WSS V;  1Y01 A;  1NAF A;  3P50 A;  3ABV A;  1SE7 A;  3EAB A;  4IL9 A;  2KWI B;  2XQ4 A;  3RGL A;  2V26 A;  2B76 A;  1S94 A;  3KDS E;  3UUM A;  1YQ3 A;  5LXT E;  5TAO A;  2X66 A;  5HWY A;  2W67 A;  3MXZ A;  5BP0 A;  4ZK4 A;  5FY1 A;  2ZJV A;  2K3W A;  5CA1 E;  4G2A A;  4A5X A;  4U3C A;  2WWV A;  2NTX A;  2UXN B;  3P4W A;  3UU5 A;  3O1I A;  3RRC A;  5JME A;  3BK9 A;  4DV5 T;  3HKC E;  2ZM6 T;  2BYN A;  2VUR A;  1HTJ F;  2BYR A;  5L3D B;  2XSA A;  1R8I A;  4EIW A;  1HX8 A;  1IBM T;  4EOZ B;  4PIR A;  4DV3 T;  1D0X A;  1G8X A;  4D01 A;  4BQT A;  3ZYM A;  5HEH A;  2VKO A;  3IA3 A;  3EAM A;  2BDE A;  4A56 A;  5AQL B;  4GOU A;  2CXD A;  5LHI B;  2W62 A;  4JEH B;  3C4X A;  3QC9 A;  2H3R A;  5HXC A;  4LF5 T;  2ZM8 A;  4UY2 A;  5LMN T;  4I0U A;  2XQ9 A;  2XQY A;  1XNR T;  2BKN A;  1YD8 G;  3T1H T;  5JDF A;  4XZC A;  2X0H A;  5FXW A;  4U31 A;  1N34 T;  2LRK A;  2WY2 A;  5ABF B;  3RKO A;  1KNR A;  1XMQ T;  3JAF A;  4QX7 B;  2VB6 A;  1XMO T;  4FRR A;  4UR9 A;  2LKG A;  2XSB A;  4LF7 T;  4DMW A;  2V7L A;  5KDM C;  3QOF A;  3WTK A;  4AFH A;  2W2U A;  4H9R C;  2XJ7 A;  4CQI A;  5FYM A;  3C51 A;  2ACX A;  1UV6 A;  3AAE B;  4GIW A;  2W4X A;  2C9T A;  5L3C B;  4DR7 T;  5AIN A;  3U78 A;  4P0B A;  4MBQ A;  1LRZ A;  3CPZ A;  3PUG A;  5A1L A;  3D0T A;  1OWA A;  3RQU A;  4EB6 E;  1UK5 A;  5AFK A;  2X9Y A;  4EYY R; 
#chains in the Genus database with same CATH homology
 4QH1 A;  4ZRU A;  4LML A;  4ZR6 A;  4UM3 S;  4ZZC A;  4AFT A;  4QAA A;  2UZ6 A;  4HFB A;  1UW6 A;  2XQ8 A;  4ZJS A;  4D01 A;  1OED C;  3WIP A;  4ILC A;  4BQT A;  3TLS A;  5HEH A;  3WTM A;  3EAM A;  4Z90 A;  2YOE A;  3C79 A;  2MAW A;  4TNW A;  3IGQ A;  5AFL A;  3C84 A;  5AFM A;  3UU3 A;  3LSV A;  5J5F A;  2XNT A;  4UM3 A;  3T4M A;  5HCJ A;  5HEO A;  3RIF A;  5L4E A;  3U8N A;  5AFH A;  4ILA A;  5AFJ A;  2W8F A;  3WTJ A;  2LKH A;  2XQ7 A;  4HFE A;  2XYT A;  4LMJ A;  4IRE A;  5L47 A;  2YMD A;  2LLY A;  4UY2 A;  4WV9 A;  5BW2 A;  3JAD A;  2LM2 A;  4HFD A;  4B5D A;  5HEJ A;  1OED A;  2XQ9 A;  5HEG A;  4UM1 A;  2X00 A;  3WTH A;  4HFH A;  4UM3 P;  4X5T A;  5J5I A;  2Y57 A;  3PEO A;  2BYS A;  4TNV A;  2BG9 B;  2WNJ A;  4TWH A;  5L4H A;  5HCM A;  2PH9 A;  3WTL A;  5J5H A;  5KE4 A;  2VL0 A;  2BR8 A;  3U8M A;  4HQP A;  3P50 A;  4QAC A;  2XQA A;  5SYO A;  5KZU A;  3SIO A;  4ALX A;  3JAE A;  3TLU A;  4IL9 A;  3ZDG A;  2XQ4 A;  2BG9 E;  2WNC A;  4LMK A;  5FJV A;  2YN6 A;  3RIA A;  2XNV A;  2YME A;  2X00 D;  4UXU A;  5BRX A;  3JAF A;  2XQ6 A;  5J5G A;  4QAB A;  2QC1 B;  4QH5 A;  4IL4 A;  2YKS A;  4XK9 A;  3UUB A;  4NPP A;  3TLW A;  3RI5 A;  2W8G A;  3EHZ A;  4ZK1 A;  3RHW A;  4DBM A;  5CO5 A;  4Z91 A;  4ZJT A;  2BYP A;  4FRR A;  4QH4 A;  5BP0 A;  2LKG A;  2BG9 C;  3UQ4 A;  3SQ9 A;  3TLV A;  2PGZ A;  5CFB A;  4COF A;  4F8H A;  4ZK4 A;  5LG3 A;  2WN9 A;  2KSR A;  2ZJV A;  3WTO A;  5AFM B;  5AFN A;  3ZDH A;  3WTI A;  4HFC A;  4AFH A;  3WTK A;  5LXB A;  2WZY A;  5J0Z A;  4XHE A;  4A98 A;  2XZ6 A;  5IUX A;  4A97 A;  4HFI A;  2XQ3 A;  2Y54 A;  3U8J A;  2Y56 A;  2BR7 A;  2XYS A;  3TLT A;  1UV6 A;  3UU6 A;  2ZJU A;  1OED B;  2BJ0 A;  4ZZB A;  3SQ6 A;  3P4W A;  4ILB A;  5HEU A;  3RQW A;  2BG9 A;  2BYQ A;  2C9T A;  2WNL A;  2XNU A;  3GUA A;  3PMZ A;  4TWF A;  3UQ7 A;  3WTN A;  4BFQ A;  4EZ1 A;  3UU8 A;  3UU5 A;  3SH1 A;  5AIN A;  5JME A;  2M6I A;  2Y58 A;  2Y7Y A;  4NZB A;  2XZ5 A;  2BYN A;  2BYR A;  1UX2 A;  1OED E;  3U8L A;  4AFG A;  4TWD A;  3RQU A;  1I9B A;  4PIR A;  3U8K A;  5TVC A;  5AFK A;  2XQ5 A;  2M6B A;  3UU4 A;  3EI0 A;  3ZKR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...