2XQ6A

Pentameric ligand gated ion channel glic in complex with cesium ion (cs+)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLR4197 PROTEIN
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein
total genus 73
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq6A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq6A01
4UM3S 3SIOA 4AFTA 5AFMB 5HEHA 2X00D 2LKGA 2XQ8A 2LM2A 5L4HA 2XQ3A 3ZKRA 4AFHA 4QACA 2Y54A 5BRXA 2XNTA 5HEOA 2YMEA 4F8HA 3WTHA 3RI5A 3JAFA 2XQ5A 2W8GA 2XZ5A 3U8JA 5AFHA 4ILAA 3RHWA 4ILBA 5KZUA 2XYSA 3T4MA 2YKSA 5AFNA 1OEDA 5J5HA 4HFDA 5JMEA 4XHEA 5IUXA 5AFKA 4ZJSA 3RQWA 4XK9A 2BYNA 4ZRUA 3RIFA 5L47A 4IL4A 5CFBA 2BR8A 3WTIA 2BJ0A 4TNVA 3TLUA 5KE4A 1OEDE 2XQ4A 4ALXA 5AINA 3SQ9A 4IL9A 2PGZA 2WN9A 2BG9C 4LMLA 2BYPA 4TWDA 4UY2A 2M6IA 4BQTA 3P4WA 3TLVA 3UU8A 3SH1A 4UM3A 4LMJA 3U8NA 3U8MA 1UX2A 2Y58A 4D01A 5BW2A 3TLTA 2XQAA 3PMZA 3EAMA 4UXUA 3ZDGA 5J5FA 4QH1A 4ZR6A 2PH9A 4IREA 4TWHA 4ZK4A 5AFMA 2BYQA 2VL0A 2XQ7A 4X5TA 3ZDHA 5HEJA 3WTLA 3JAEA 2WNJA 3TLSA 3TLWA 3UU5A 3UUBA 2BYRA 3P50A 2UZ6A 3EHZA 3WTMA 3U8KA 5J0ZA 3WTJA 2MAWA 2BG9B 4QH5A 2XZ6A 2ZJUA 2LKHA 4BFQA 2W8FA 4HFBA 2XNUA 5HCMA 5HEGA 4HQPA 2XQ6A 4ZK1A 2QC1B 4UM1A 3GUAA 4TWFA 3SQ6A 2XQ9A 4TNWA 2BYSA 2Y57A 4A97A 2YN6A 3WTKA 3WTOA 3UU3A 4B5DA 4A98A 5BP0A 5AFLA 4LMKA 4PIRA 4QAAA 5LXBA 2BG9A 5J5IA 4ILCA 2XNVA 3PEOA 4QABA 2XYTA 2X00A 2WZYA 3UQ4A 4UM3P 4NPPA 5HEUA 4FRRA 3RQUA 3EI0A 3JADA 2KSRA 1OEDB 1OEDC 2C9TA 5CO5A 2M6BA 4Z91A 2Y56A 1UV6A 5TVCA 5HCJA 5SYOA 3WIPA 5FJVA 2BG9E 4WV9A 3WTNA 4NZBA 4QH4A 4EZ1A 4COFA 5J5GA 2WNCA 4HFCA 2YOEA 3RIAA 4HFEA 1UW6A 3C79A 3LSVA 2YMDA 3UU6A 5L4EA 4AFGA 2Y7YA 2LLYA 3C84A 4ZZBA 5AFJA 4DBMA 3IGQA 5LG3A 3UU4A 4Z90A 3UQ7A 2ZJVA 4HFHA 3U8LA 4HFIA 2WNLA 1I9BA 2BR7A 4ZZCA 4ZJTA
chains in the Genus database with same CATH superfamily
3AVSA 3RH3A 2A3DA 3VU7H 4YSXA 3U8JA 4C91A 2ES0A 3CX8B 2BS3A 2VKOA 3K3QC 3KDSE 3E22E 2MYSA 1W09A 2IC9A 4IL9A 2PGZA 3AA6B 2CCQA 5J1GA 3ONJA 3CX6B 4BJNA 4NUUA 3U8NA 3O9XA 2B1EA 1HX8A 1J5WA 4JYAT 2DWKA 2WU5A 4U2YA 4FJOA 1W0BA 1G73A 1VCSA 3QNUA 4GKKT 3N9PA 3WTJA 2EHOD 3C51A 2DHRA 4L9IA 4IDOA 2X0YA 3AA7B 3SQ6A 2YN6A 4U7IA 3AE4A 3ZSTA 4K0UA 2QVAA 4UM3P 2X9YA 3EI0A 3E0ZA 2ZM8A 2C5JA 3WIPA 2WZIA 4Q25A 3HKDE 1HNWT 3HR0A 4HFCA 2YDQA 4ZHQE 4QX7B 3SS1A 2X68A 4AFGA 5ETWA 3SRZA 4ZZBA 1US7B 5LG3A 4WNKA 4BAYB 1B7TA 1G8XA 4QWNB 5LP6E 3BQIA 2XASB 3AXJB 2CPTA 2W00A 3N2OA 1HS7A 5AFHA 5KZUA 1IBMT 4G63A 3VR9A 5CA1E 1EZ3A 1XDOA 5JMEA 3RQWA 3I9WA 2WAUA 3H37A 5L3GB 5KE4A 3AE6A 3KBUA 1OEDE 3AVRA 4O2BE 2HPLA 1KF6A 2IDOB 4IDNA 5AQGB 3N2KE 5IHYA 2XQAA 3FZFB 5C8YE 2XM1A 5ADXL 5AFUL 3R6NA 1YQ3A 5LOVE 4TN7B 5LHHB 2LOSA 3GWHA 4DUZT 3AEAA 1ZKEA 3DTOA 5AQTB 4YY3T 4GK0E 1UX4A 4KI0F 1D1BA 3CQGB 3BQKA 3W15B 4A56A 2XQ6A 1HG2A 4TWFA 3LBXB 5EK4A 1XWMA 5AFLA 4UVBB 3PEOA 1YW0A 2C5IT 4PFOA 1XMOT 3FXEB 3O1HA 3RPUA 4XZCA 2NTXA 3C79A 2FJBA 2WU2A 2V6YA 4DV0T 3K8PC 3RX6A 4ASKA 4JLEA 3FZLB 4KP3C 4HFIA 2ZMAA 3P8CD 2X00D 3HL6A 4P09A 5BRXA 4YHHT 3KV4A 4CQIA 5C2TA 3UTKA 2YKSA 1ZHCA 3F2EA 4DMVA 4DV4T 2OA5A 3C64A 5FXWA 4JI5T 4AKRB 2WS3A 3P4WA 2KLQA 4IE7A 2D0TA 4UM3A 1NEKA 4LMJA 2NTYA 3VRBA 3ANWA 2HH7A 2PH9A 4IREA 4ZK4A 3PTRB 1D0XA 2N9DA 1WYBA 1SE7A 2WNJA 4HWFA 3UU5A 3L09A 3MK7C 3UUBA 2X67A 2UUCT 1BR4A 5AQFB 3N5LA 2V26A 4X66T 2B76A 2BVLA 4CZZB 2UXNB 2XQ9A 3VKHA 4EV6A 4LMKA 2ZLYA 2UU9T 3UT5E 3AE3A 5KDMC 3PU8A 4NPPA 4FRRA 2V7IA 4HWDA 5HCJA 2H88A 3AE7A 4I4TE 4EZ1A 4UVAB 2BKNA 1AJ3A 2UXBT 3RIAA 4UVCB 2JMKA 3EUHA 4X1YE 2LEHA 5H6QB 2ZJVA 1I94T 2W61A 1HCIA 1HTJF 4JEUB 1IZNB 2LT3A 2LM2A 2WB5A 4ZI2D 3OYZA 2H7VC 4DR6T 5HXCA 4B3MT 3EDVA 3V5UA 5FXVA 3QB5A 2K48A 5L3FB 3S4UA 1Y01A 4LF4T 3GA8A 5L47A 4YTMA 3CK6A 4B6XA 4PJNA 4YLHA 4LMLA 2F4VT 3OBVE 5ABEA 4U2ZA 2W4XA 3UU8A 2IW5B 2V6XA 3ZDGA 4TZ4C 2XSAA 3BQLA 4KHPT 4TV9E 2Q9QB 2W66A 4PFPA 2CXLA 2LM9A 2VVNA 4U31A 5JDNA 3NRYA 2XZEA 4JBWF 4ZS3A 5HEGA 3ZJ1A 2ZM0A 4WW0A 3K3OA 3RRCA 1FMVA 3ZLIA 3KV9A 5JDLA 2X0HA 3KFWX 2H7OA 4ILCA 5JTGA 2K9AA 2PJQA 3UQ4A 1UGOA 1E1HB 2RP4A 2WMOA 5TVCA 5J2TE 1VCTA 3AE1A 4GKJT 5EZYE 1V9DA 4OYJA 2JQ9A 4ZI3D 4CN6A 1MIYA 4KMCA 5DQVA 2E9XD 2KWHA 1IJ6A 4CI3B 2CE7A 2QA7A 4H9NC 4LF8T 3WAKA 5L4EA 2XQYA 4AKHA 1SUMB 3HA4A 1QLBA 2XPKA 4JI8T 5CJ5A 2XAGB 3PUZF 1D0YA 2E2AA 3F31A 5LMUT 3RRWA 3KV6A 1OXZA 4DV2T 3KVBA 1WLXA 5A1LA 3Q9DA 4LF7T 5EK2A 3ZN1B 4DV1T 4QX8B 2BJ0A 2GK9A 2PG8A 3PUVF 5CB4E 2FJAA 2XJ7A 4O4HE 2BG9C 2K24A 5HXEA 1NAFA 5LCYA 3B5MA 3P4RA 3AXJA 2JJ9A 4H63H 2A9UA 4NUVA 3CPZA 3HKEE 5L3EB 5FY0A 2L8KA 1SHZC 2WWUA 4YTNA 3ZMZB 3Q2MA 4ZK1A 2QC1B 4A97A 4CXWA 3Q5EA 2X9WA 3CKDA 4QAAA 5FXXA 2CBJA 3LDQB 4IGUA 1UK5A 4WBOA 2KMFA 5DABA 3RQUA 2JQHA 5JDMA 2D5UA 1S94A 4Z91A 5C3JA 2YU1A 4QKNA 4EB6E 3ZEFB 2IUBA 1XZYA 3AE9A 2NW8A 3RIUC 3LFMA 4AXPA 3SIOA 3LBXA 5AFMB 2I6HA 2BKPA 4B3RT 5FNVE 2XYSA 2WY2A 4TUYE 3B13A 1X9BA 2FJDA 2OV9A 1YKHB 3L8RA 3MACA 3FBZA 5LHIB 3C4ZA 3AEBA 2LSKA 2WN9A 4ERRA 3TKLB 3OYXA 4O4IE 5BW2A 2VB6A 4CN4A 4X5TA 3C98B 2JIWA 1YD8G 1IAPA 3ZYKA 4YJ3E 4QH5A 2XZ6A 3D0TA 3NBXX 4UF0B 2WM9A 4U74A 4TNWA 4D01A 4B5DA 1KK7A 1VOMA 5JDHA 4JUYA 5FKYA 4YJ2E 2E5LT 3L39A 3DP7A 3Q5WA 3UFGA 5HEUA 4C90A 2UUAT 2J47A 2C9TA 3EDUA 1MIWA 3ZMUB 3ETVA 2V5DA 3OPCA 2VKHA 2AXDS 4HFEA 1CUNA 4EOZB 5FL1A 4PNIA 5JRCA 4ZOLE 5FYMA 2XHEB 4PJJA 3U8LA 3LG7A 2Y48B 5L3DB 2IHR1 1IJ5A 4U7YA 2XM2A 4CXXA 3RLFF 3ZMVB 2Y54A 2YMEA 4AIUA 3RI5A 4HFVA 3ZCJA 4P1NA 3QC9A 1Z0PA 2JQQA 5L3CB 1IBKT 3PJAJ 1WR6A 2BS4A 1E2AA 3FHNA 3OKQA 3O1IA 2LSGA 4DV3T 4E7ZA 1W0AA 3CMLA 3ZT5A 3HI2A 5M4YA 4G2AA 1T7SA 5LBQB 2NW9A 5J2UE 2G0UA 4HN9A 2DNXA 4ILUA 4DR1T 3EAMA 4UXUA 5LJMA 4IHJE 1J1JA 1BR1A 2N2NA 4DO0A 2XQ7A 2X51A 5HEJA 2Y8DA 3A8YC 3TLSA 3HKCE 2UUBT 3RYIE 3X1DA 3WTMA 4YSYA 4DIDB 2LHNA 2LKHA 4QXCB 4HFBA 4LFAT 3K1SA 3B57A 4PAGA 3L3PA 5AQVB 3FZHB 2MBGA 2Z6EA 5LXBA 5KXJA 4XAXB 5AQUB 4BA9A 1T98A 2LE8A 4UV9B 4NXNT 2C0SA 2Q9QA 4ADZA 4ZXLA 4X1KE 3OVUA 2E9XC 3LSVA 5ABGA 2NR4A 5AFJA 5JR9C 3IGQA 2CMRA 2NP9A 1KNZA 2W62A 1N34T 2DI4A 2J62A 2WCAA 3AE2A 4GK5E 5FL0A 5HEHA 2XQ3A 4QACA 2SPCA 3NZQA 3KINB 3JC6C 4AKIA 3LK42 4HFDA 3PUSA 2LRLA 4XK9A 4X62T 4O8SA 4LF9T 2BR8A 2VASA 4UIGA 3SQ9A 3AA0B 3E08A 3GN5B 3ZPOA 4TWDA 3IHRA 1UURA 2HN2A 4H9PC 5LXTE 4DR7T 2Y58A 2WZHA 1I6ZA 4FI5A 3I0QA 2VKDA 1MIVA 2WBLA 1T8BA 4QHOA 3RF1A 2YU2A 3HKBE 4DV5T 3P50A 5AQOB 3U8KA 2K3WA 2V7JA 2WQYA 2A72A 2FBWA 5HXHA 5LGTB 4Z8XA 2VK9A 3ZMSB 1N33T 2BYSA 4H9QC 3ONLC 2BG9A 2DLRA 4EXTA 2FJEA 3N9QA 1XNQT 1MMAA 2XAFB 5JRCB 4HGAA 5FJVA 4YHJA 5HWXA 1M7KA 3WAJA 3T1HT 2OLTA 1YQ4A 2XUEA 4I55E 4IDQA 5FXZA 5AQKB 2XAQB 2LLYA 4PK6A 3T1YT 5E0OA 1NENA 2ODVA 4X1IE 2XQ8A 4ANJA 3VHLA 1OWAA 2JRKA 2KWIB 1LVKA 4ILBA 4X65T 4YT0A 1LRZA 5IUXA 4AKGA 2BYNA 3IF8B 3NVOA 2RA1A 4I50E 1UX5A 2IC6A 1QUUA 2ZM2A 4UY2A 1S35A 1HFAA 4IE5A 2W2UA 3RIUA 3TLVA 2ZM6T 1BR2A 3RKOA 2D9DA 2BKOA 4IE6A 1WYCA 5AFMA 1FIOA 4XBFB 3JAEA 2H3RA 1R8IA 5J0ZA 3N9LA 4H63V 4H9RC 3ZJ2A 2IMLA 5JH7E 5FVLA 3P4SA 4JI0T 2WP9A 4HKAA 2Y57A 2V7KA 3P4QA 2E8IA 4E7SA 1SA0E 2XYTA 4HWHA 2WZYA 1UCUA 2KSRA 3NKZA 3LK3B 4QH4A 2E5VA 2EHOB 2EHOC 4LF6T 2WNCA 5FMNA 5GONE 2WSSV 5AQQB 2ACZA 2CHNA 5F5WA 1D1CA 2A2FX 4L5GA 1N32T 4H9SE 3UUMA 4UF0A 4EZHA 2VQFT 4AQFC 3U3IA 3ZKRA 2V5CA 4YFSA 2W8GA 2WMNA 2XZ5A 1HR0T 3RHWA 5EK3A 4OYKA 4DR5T 4PK4A 3VR8A 4KX6A 4I43B 4JI6T 4ZI7E 1YXRA 4ZR6A 2BYQA 5ABFA 1XNRT 2CWOA 4DBQA 2CEAA 2N1GA 3TLWA 3H3MA 2MOZA 2ACXA 2ODUA 2BG9B 4QXHB 2D2SA 4HQPA 4H9OC 2V7MA 2NWBA 3FXDB 4LFCT 4U3CA 4LFBT 2CXDA 2XNVA 3N2GE 2UXXB 3JADA 5LYJE 2W67A 5CO5A 1HX1B 4DR2T 5J5GA 4NXMT 2V8SV 5HWYA 1U4QA 2YMDA 2NW7A 4DR4T 1HF8A 4DR3T 2Y7YA 3VKGA 4IIJE 2YINA 2NOXA 1I9BA 2PBIA 4O4JE 3SWHA 4AFTA 2XAJB 4P0BA 2CLYC 2LSIA 4DBRA 2XNTA 3WTHA 4ILAA 4GYRA 3T4MA 5AFKA 4N78D 2AE9A 5JREA 5JVDE 3PURA 5TAOA 4TNVA 4OK0A 5KX5E 2XQ4A 2LSJA 4CI2B 3UUNA 3O4XE 2JPFA 2BZBA 3CWZB 2XY8B 4V1Av 1UX2A 2MPKA 3PMZA 2BVMA 5LG4A 1IBLT 1MMDA 1X79A 2VL0A 4IDPA 1KEYA 3C4XA 5LHGB 2CHOA 2W63A 4DVDA 4UR9A 2L3LA 3UFEA 4BFQA 1WFDA 4ISTA 3H3AA 2XNUA 5AQJB 2QGSA 5JQGE 2VVSA 3IEEA 3PU3A 2K5BB 5FVKA 2V7LA 3VRAA 2QRXA 3BK9A 2VURA 3GN5A 3MJXA 4QABA 5FP3A 1OEDB 1OEDC 4K0KT 3RYHE 2Y56A 1UV6A 2LJLA 2BG9E 4KUMB 3WTNA 2XTLA 1WR0A 3ZMTB 3ZYLA 1KNPA 5DJQC 3M65A 4KHZF 3RYFE 2JMHA 4ISSA 5CGMA 5JDQA 2QYWA 4JI4T 4OX9T 2DL1A 2BR7A 5F8PA 1Z8UA 4UM3S 3IA3A 2LKGA 4AFHA 5JDFA 2YK0A 4F8HA 2W0GA 2KZ7B 2WDVA 1MNDA 1CHUA 1HG5A 2X0LB 2Q9QD 4EZ4A 2XAHB 4I0UA 1FJGT 5AINA 4EYUA 4ZEYA 4X64T 5ABFB 3F57A 4ZI2C 3SH1A 3PUAA 5F3JA 1H7CA 2BDEA 2YDRA 3UULA 4HTEA 2I0MA 1ZEEA 2MAWA 3P7IA 3I1AA 1D0ZA 1U5PA 5IWAT 5LA6E 3MZKB 5HCMA 3IBPA 3QK6A 2HN1A 3KV5A 4O4LE 4JV5T 5BP0A 1VRBA 3RC8A 3QOFA 1HNXT 4AQYT 5IYZE 3K3NA 2RPAA 3ZSSA 4NZBA 4WBNE 3CIRA 3ZYMA 2VQET 4IE0A 1UW6A 3KVAA 4YXDA 3RGLA 2HHHT 5LB7B 3OTOT 1Y64B 2LHRA 3PUWF 4JI1T 2VL8A 3RC3A 2LOPA 3RKGA 2WDRA 4AQGA 4IT4A 5L4HA 4IDZA 4A5XA 2L9QA 3QB5K 1M62A 3MKDA 5FY7A 4ZI3C 2E9XB 5AQLB 5AFNA 1KNRA 3T8OA 3CQXC 4ZJSA 5JR9B 2WDQA 2EHOA 4YSZA 5HXRA 3TLUA 5LNKA 4BQTA 1QSDA 2JQKA 3AEFA 4DNDA 3AAIA 4L0RA 2J1DG 4QH1A 5ABHA 3I0OA 4PJLA 4TWHA 4AQFA 1UUSA 2VWAA 2XSBA 2H89A 3ZDHA 2PTFA 3PDYA 2X9XA 3R84B 3AEEA 2P9BA 4IE4A 1ZOYA 1JNRA 3FB2A 2DCFA 3UUXB 3UU3A 4A98A 4PIRA 2KT9A 2V1DB 5LGNB 5LBMA 2I59A 3AE8A 4CI1B 3FBLA 5SYOA 3ZT6A 4WV9A 3AAEB 3AECA 4CXYA 4DV7T 3ABVA 5AQHB 5HAXA 3A7MA 4JI3T 3UU6A 4HFHA 4KBMB 3FZKB 1XDPA 2UXDT 4UV8B 4PW8A 1WCRA 4HEAA 3AEDA 3SFEA 3PE0A 2CXFA 3SFDA 3AA1B 4X20E 4XHEA 3C50A 4IL4A 4U33A 2HPJA 4ALXA 2BYPA 2KINB 4F6RC 2M6IA 4J2CA 4TX5A 3ETUA 2CRBA 3GMIA 3PV0F 3EABA 5AQIB 3CVRA 4GIWA 4DUYT 5LMNT 1ZP0A 3JCFA 3O1JA 4BJMA 4EEDA 3ZC0A 2UZ6A 4JEHB 1WRDA 2WWVA 2IAKA 3M3ZB 3FZMB 4HWCA 5FY1A 4MHCA 4EIWA 3ZCIA 1T72A 5J5IA 5AQSB 3J9X1 4WYVA 2DWGA 2X00A 2C5KT 3CX7B 4GOUA 4PJMA 1JNZA 1MNEA 1HNZT 4JI2T 4B3ST 3LJCA 1FMWA 3ESLA 5AQNB 3N9NA 3AAAB 5BR8T 4MALA 4EAHA 4NIQA 3C84A 3PUGA 3UU4A 3QUJA 2CA5A 3ZN0B 2LSYA 4LF5T 4MLKA 3P4PA 4ZS2A 2MTQA 2M67A 1ZV4X 5HEOA 3JAFA 2XQ5A 3I9YA 4AI6A 5AQPB 2Q9QC 1OEDA 5J5HA 3AEGA 1XMQT 4WZXA 3KBTA 2KXPB 5CA0E 4U72A 3OJAA 2R6GF 5H6RB 2YEVC 4EYYR 3SOLA 3G06A 4OFZA 4P0AA 3MXZA 2J4GA 3U8MA 3TLTA 5J5FA 1LKXA 2X9HA 3AE5A 1DU2A 4O2AE 2V6YB 2BBJA 3WI3A 4CN1A 2BYRA 3EHZA 2IIUA 4UELA 3CQCB 2ZJUA 5DQWA 4DV6T 4UM1A 1E7PA 4DMWA 3WTOA 1W9RA 2YDSA 1GQEA 2CWYA 4COFA 3J7Yq 3Q5DA 3JC6D 3PUQA 2BS2A 2BBHA 1N36T 3N9MA 2VKJA 4B3TT 1O3XA 3ANWB 3Q5XA 1J5ET 2X66A 3V5SA 5LJNA 4HE8A 5LGUB 4OHFA 4AISA 4JI7T 5AQMB 3U78A 2D0UA 2KNDA 3NZPA 3A5XA 4ZRUA 3RIFA 5CFBA 2PFVA 5BMVE 3LK2B 3WTIA 5JDGA 4UXNB 1MMGA 2CLYB 4EGWA 5AQRB 1LVFA 4GYSA 3C4WA 4QXBB 4EEBA 2FUPA 5HXSA 3AB3B 1KFYA 3EVYA 3WTLA 3PUXF 5L2LA 3N9OA 3ZT7A 3ONXA 2E9XA 2W8FA 4PK5A 2LRKA 3DJBA 5JR9A 3PUYF 2CM0A 3ZC1A 3GUAA 1D1AA 2CBIA 4HWIB 3WTKA 1NWMX 3RYCE 3MA9A 4UEMA 4AKLA 4YTPA 2M6BA 4MFRA 2Y6XA 1BR0A 4M1PA 1MMNA 3NRXA 2YOEA 3PJAA 4TV8E 1FEWA 4MBQA 1YKEB 5L3BB 1L0VA 4DBMA 3UQ7A 4Z90A 5HYAA 3NWIA 5KMGP 2WNLA 2UXCT 4ZZCA 4ZJTA
chains in the Genus database with same CATH topology
4UM3S 3SIOA 4AFTA 5AFMB 5HEHA 2X00D 2LKGA 2XQ8A 2LM2A 5L4HA 2XQ3A 3ZKRA 4AFHA 4QACA 2Y54A 5BRXA 2XNTA 5HEOA 2YMEA 4F8HA 3WTHA 3RI5A 3JAFA 2XQ5A 2W8GA 2XZ5A 3U8JA 5AFHA 4ILAA 3RHWA 4ILBA 5KZUA 2XYSA 3T4MA 2YKSA 5AFNA 1OEDA 5J5HA 4HFDA 5JMEA 4XHEA 5IUXA 5AFKA 4ZJSA 3RQWA 4XK9A 2BYNA 4ZRUA 3RIFA 5L47A 4IL4A 5CFBA 2BR8A 3WTIA 2BJ0A 4TNVA 3TLUA 5KE4A 1OEDE 2XQ4A 4ALXA 5AINA 3SQ9A 4IL9A 2PGZA 2WN9A 2BG9C 4LMLA 2BYPA 4TWDA 4UY2A 2M6IA 4BQTA 3P4WA 3TLVA 3UU8A 3SH1A 4UM3A 4LMJA 3U8NA 3U8MA 1UX2A 2Y58A 4D01A 5BW2A 3TLTA 2XQAA 3PMZA 3EAMA 4UXUA 3ZDGA 5J5FA 4QH1A 4ZR6A 2PH9A 4IREA 4TWHA 4ZK4A 5AFMA 2BYQA 2VL0A 2XQ7A 4X5TA 3ZDHA 5HEJA 3WTLA 3JAEA 2WNJA 3TLSA 3TLWA 3UU5A 3UUBA 2BYRA 3P50A 2UZ6A 3EHZA 3WTMA 3U8KA 5J0ZA 3WTJA 2MAWA 2BG9B 4QH5A 2XZ6A 2ZJUA 2LKHA 4BFQA 2W8FA 4HFBA 2XNUA 5HCMA 5HEGA 4HQPA 2XQ6A 4ZK1A 2QC1B 4UM1A 3GUAA 4TWFA 3SQ6A 2XQ9A 4TNWA 2BYSA 2Y57A 4A97A 2YN6A 3WTKA 3WTOA 3UU3A 4B5DA 4A98A 5BP0A 5AFLA 4LMKA 4PIRA 4QAAA 5LXBA 2BG9A 5J5IA 4ILCA 2XNVA 3PEOA 4QABA 2XYTA 2X00A 2WZYA 3UQ4A 4UM3P 4NPPA 5HEUA 4FRRA 3RQUA 3EI0A 3JADA 2KSRA 1OEDB 1OEDC 2C9TA 5CO5A 2M6BA 4Z91A 2Y56A 1UV6A 5TVCA 5HCJA 5SYOA 3WIPA 5FJVA 2BG9E 4WV9A 3WTNA 4NZBA 4QH4A 4EZ1A 4COFA 5J5GA 2WNCA 4HFCA 2YOEA 3RIAA 4HFEA 1UW6A 3C79A 3LSVA 2YMDA 3UU6A 5L4EA 4AFGA 2Y7YA 2LLYA 3C84A 4ZZBA 5AFJA 4DBMA 3IGQA 5LG3A 3UU4A 4Z90A 3UQ7A 2ZJVA 4HFHA 3U8LA 4HFIA 2WNLA 1I9BA 2BR7A 4ZZCA 4ZJTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UM3 S;  3SIO A;  4AFT A;  5AFM B;  5HEH A;  2X00 D;  2LKG A;  2XQ8 A;  2LM2 A;  5L4H A;  2XQ3 A;  3ZKR A;  4AFH A;  4QAC A;  2Y54 A;  5BRX A;  2XNT A;  5HEO A;  2YME A;  4F8H A;  3WTH A;  3RI5 A;  3JAF A;  2XQ5 A;  2W8G A;  2XZ5 A;  3U8J A;  5AFH A;  4ILA A;  3RHW A;  4ILB A;  5KZU A;  2XYS A;  3T4M A;  2YKS A;  5AFN A;  1OED A;  5J5H A;  4HFD A;  5JME A;  4XHE A;  5IUX A;  5AFK A;  4ZJS A;  3RQW A;  4XK9 A;  2BYN A;  4ZRU A;  3RIF A;  5L47 A;  4IL4 A;  5CFB A;  2BR8 A;  3WTI A;  2BJ0 A;  4TNV A;  3TLU A;  5KE4 A;  1OED E;  2XQ4 A;  4ALX A;  5AIN A;  3SQ9 A;  4IL9 A;  2PGZ A;  2WN9 A;  2BG9 C;  4LML A;  2BYP A;  4TWD A;  4UY2 A;  2M6I A;  4BQT A;  3P4W A;  3TLV A;  3UU8 A;  3SH1 A;  4UM3 A;  4LMJ A;  3U8N A;  3U8M A;  1UX2 A;  2Y58 A;  4D01 A;  5BW2 A;  3TLT A;  2XQA A;  3PMZ A;  3EAM A;  4UXU A;  3ZDG A;  5J5F A;  4QH1 A;  4ZR6 A;  2PH9 A;  4IRE A;  4TWH A;  4ZK4 A;  5AFM A;  2BYQ A;  2VL0 A;  2XQ7 A;  4X5T A;  3ZDH A;  5HEJ A;  3WTL A;  3JAE A;  2WNJ A;  3TLS A;  3TLW A;  3UU5 A;  3UUB A;  2BYR A;  3P50 A;  2UZ6 A;  3EHZ A;  3WTM A;  3U8K A;  5J0Z A;  3WTJ A;  2MAW A;  2BG9 B;  4QH5 A;  2XZ6 A;  2ZJU A;  2LKH A;  4BFQ A;  2W8F A;  4HFB A;  2XNU A;  5HCM A;  5HEG A;  4HQP A;  2XQ6 A;  4ZK1 A;  2QC1 B;  4UM1 A;  3GUA A;  4TWF A;  3SQ6 A;  2XQ9 A;  4TNW A;  2BYS A;  2Y57 A;  4A97 A;  2YN6 A;  3WTK A;  3WTO A;  3UU3 A;  4B5D A;  4A98 A;  5BP0 A;  5AFL A;  4LMK A;  4PIR A;  4QAA A;  5LXB A;  2BG9 A;  5J5I A;  4ILC A;  2XNV A;  3PEO A;  4QAB A;  2XYT A;  2X00 A;  2WZY A;  3UQ4 A;  4UM3 P;  4NPP A;  5HEU A;  4FRR A;  3RQU A;  3EI0 A;  3JAD A;  2KSR A;  1OED B;  1OED C;  2C9T A;  5CO5 A;  2M6B A;  4Z91 A;  2Y56 A;  1UV6 A;  5TVC A;  5HCJ A;  5SYO A;  3WIP A;  5FJV A;  2BG9 E;  4WV9 A;  3WTN A;  4NZB A;  4QH4 A;  4EZ1 A;  4COF A;  5J5G A;  2WNC A;  4HFC A;  2YOE A;  3RIA A;  4HFE A;  1UW6 A;  3C79 A;  3LSV A;  2YMD A;  3UU6 A;  5L4E A;  4AFG A;  2Y7Y A;  2LLY A;  3C84 A;  4ZZB A;  5AFJ A;  4DBM A;  3IGQ A;  5LG3 A;  3UU4 A;  4Z90 A;  3UQ7 A;  2ZJV A;  4HFH A;  3U8L A;  4HFI A;  2WNL A;  1I9B A;  2BR7 A;  4ZZC A;  4ZJT A; 
#chains in the Genus database with same CATH topology
 3AVS A;  3RH3 A;  2A3D A;  3VU7 H;  4YSX A;  3U8J A;  4C91 A;  2ES0 A;  3CX8 B;  2BS3 A;  2VKO A;  3K3Q C;  3KDS E;  3E22 E;  2MYS A;  1W09 A;  2IC9 A;  4IL9 A;  2PGZ A;  3AA6 B;  2CCQ A;  5J1G A;  3ONJ A;  3CX6 B;  4BJN A;  4NUU A;  3U8N A;  3O9X A;  2B1E A;  1HX8 A;  1J5W A;  4JYA T;  2DWK A;  2WU5 A;  4U2Y A;  4FJO A;  1W0B A;  1G73 A;  1VCS A;  3QNU A;  4GKK T;  3N9P A;  3WTJ A;  2EHO D;  3C51 A;  2DHR A;  4L9I A;  4IDO A;  2X0Y A;  3AA7 B;  3SQ6 A;  2YN6 A;  4U7I A;  3AE4 A;  3ZST A;  4K0U A;  2QVA A;  4UM3 P;  2X9Y A;  3EI0 A;  3E0Z A;  2ZM8 A;  2C5J A;  3WIP A;  2WZI A;  4Q25 A;  3HKD E;  1HNW T;  3HR0 A;  4HFC A;  2YDQ A;  4ZHQ E;  4QX7 B;  3SS1 A;  2X68 A;  4AFG A;  5ETW A;  3SRZ A;  4ZZB A;  1US7 B;  5LG3 A;  4WNK A;  4BAY B;  1B7T A;  1G8X A;  4QWN B;  5LP6 E;  3BQI A;  2XAS B;  3AXJ B;  2CPT A;  2W00 A;  3N2O A;  1HS7 A;  5AFH A;  5KZU A;  1IBM T;  4G63 A;  3VR9 A;  5CA1 E;  1EZ3 A;  1XDO A;  5JME A;  3RQW A;  3I9W A;  2WAU A;  3H37 A;  5L3G B;  5KE4 A;  3AE6 A;  3KBU A;  1OED E;  3AVR A;  4O2B E;  2HPL A;  1KF6 A;  2IDO B;  4IDN A;  5AQG B;  3N2K E;  5IHY A;  2XQA A;  3FZF B;  5C8Y E;  2XM1 A;  5ADX L;  5AFU L;  3R6N A;  1YQ3 A;  5LOV E;  4TN7 B;  5LHH B;  2LOS A;  3GWH A;  4DUZ T;  3AEA A;  1ZKE A;  3DTO A;  5AQT B;  4YY3 T;  4GK0 E;  1UX4 A;  4KI0 F;  1D1B A;  3CQG B;  3BQK A;  3W15 B;  4A56 A;  2XQ6 A;  1HG2 A;  4TWF A;  3LBX B;  5EK4 A;  1XWM A;  5AFL A;  4UVB B;  3PEO A;  1YW0 A;  2C5I T;  4PFO A;  1XMO T;  3FXE B;  3O1H A;  3RPU A;  4XZC A;  2NTX A;  3C79 A;  2FJB A;  2WU2 A;  2V6Y A;  4DV0 T;  3K8P C;  3RX6 A;  4ASK A;  4JLE A;  3FZL B;  4KP3 C;  4HFI A;  2ZMA A;  3P8C D;  2X00 D;  3HL6 A;  4P09 A;  5BRX A;  4YHH T;  3KV4 A;  4CQI A;  5C2T A;  3UTK A;  2YKS A;  1ZHC A;  3F2E A;  4DMV A;  4DV4 T;  2OA5 A;  3C64 A;  5FXW A;  4JI5 T;  4AKR B;  2WS3 A;  3P4W A;  2KLQ A;  4IE7 A;  2D0T A;  4UM3 A;  1NEK A;  4LMJ A;  2NTY A;  3VRB A;  3ANW A;  2HH7 A;  2PH9 A;  4IRE A;  4ZK4 A;  3PTR B;  1D0X A;  2N9D A;  1WYB A;  1SE7 A;  2WNJ A;  4HWF A;  3UU5 A;  3L09 A;  3MK7 C;  3UUB A;  2X67 A;  2UUC T;  1BR4 A;  5AQF B;  3N5L A;  2V26 A;  4X66 T;  2B76 A;  2BVL A;  4CZZ B;  2UXN B;  2XQ9 A;  3VKH A;  4EV6 A;  4LMK A;  2ZLY A;  2UU9 T;  3UT5 E;  3AE3 A;  5KDM C;  3PU8 A;  4NPP A;  4FRR A;  2V7I A;  4HWD A;  5HCJ A;  2H88 A;  3AE7 A;  4I4T E;  4EZ1 A;  4UVA B;  2BKN A;  1AJ3 A;  2UXB T;  3RIA A;  4UVC B;  2JMK A;  3EUH A;  4X1Y E;  2LEH A;  5H6Q B;  2ZJV A;  1I94 T;  2W61 A;  1HCI A;  1HTJ F;  4JEU B;  1IZN B;  2LT3 A;  2LM2 A;  2WB5 A;  4ZI2 D;  3OYZ A;  2H7V C;  4DR6 T;  5HXC A;  4B3M T;  3EDV A;  3V5U A;  5FXV A;  3QB5 A;  2K48 A;  5L3F B;  3S4U A;  1Y01 A;  4LF4 T;  3GA8 A;  5L47 A;  4YTM A;  3CK6 A;  4B6X A;  4PJN A;  4YLH A;  4LML A;  2F4V T;  3OBV E;  5ABE A;  4U2Z A;  2W4X A;  3UU8 A;  2IW5 B;  2V6X A;  3ZDG A;  4TZ4 C;  2XSA A;  3BQL A;  4KHP T;  4TV9 E;  2Q9Q B;  2W66 A;  4PFP A;  2CXL A;  2LM9 A;  2VVN A;  4U31 A;  5JDN A;  3NRY A;  2XZE A;  4JBW F;  4ZS3 A;  5HEG A;  3ZJ1 A;  2ZM0 A;  4WW0 A;  3K3O A;  3RRC A;  1FMV A;  3ZLI A;  3KV9 A;  5JDL A;  2X0H A;  3KFW X;  2H7O A;  4ILC A;  5JTG A;  2K9A A;  2PJQ A;  3UQ4 A;  1UGO A;  1E1H B;  2RP4 A;  2WMO A;  5TVC A;  5J2T E;  1VCT A;  3AE1 A;  4GKJ T;  5EZY E;  1V9D A;  4OYJ A;  2JQ9 A;  4ZI3 D;  4CN6 A;  1MIY A;  4KMC A;  5DQV A;  2E9X D;  2KWH A;  1IJ6 A;  4CI3 B;  2CE7 A;  2QA7 A;  4H9N C;  4LF8 T;  3WAK A;  5L4E A;  2XQY A;  4AKH A;  1SUM B;  3HA4 A;  1QLB A;  2XPK A;  4JI8 T;  5CJ5 A;  2XAG B;  3PUZ F;  1D0Y A;  2E2A A;  3F31 A;  5LMU T;  3RRW A;  3KV6 A;  1OXZ A;  4DV2 T;  3KVB A;  1WLX A;  5A1L A;  3Q9D A;  4LF7 T;  5EK2 A;  3ZN1 B;  4DV1 T;  4QX8 B;  2BJ0 A;  2GK9 A;  2PG8 A;  3PUV F;  5CB4 E;  2FJA A;  2XJ7 A;  4O4H E;  2BG9 C;  2K24 A;  5HXE A;  1NAF A;  5LCY A;  3B5M A;  3P4R A;  3AXJ A;  2JJ9 A;  4H63 H;  2A9U A;  4NUV A;  3CPZ A;  3HKE E;  5L3E B;  5FY0 A;  2L8K A;  1SHZ C;  2WWU A;  4YTN A;  3ZMZ B;  3Q2M A;  4ZK1 A;  2QC1 B;  4A97 A;  4CXW A;  3Q5E A;  2X9W A;  3CKD A;  4QAA A;  5FXX A;  2CBJ A;  3LDQ B;  4IGU A;  1UK5 A;  4WBO A;  2KMF A;  5DAB A;  3RQU A;  2JQH A;  5JDM A;  2D5U A;  1S94 A;  4Z91 A;  5C3J A;  2YU1 A;  4QKN A;  4EB6 E;  3ZEF B;  2IUB A;  1XZY A;  3AE9 A;  2NW8 A;  3RIU C;  3LFM A;  4AXP A;  3SIO A;  3LBX A;  5AFM B;  2I6H A;  2BKP A;  4B3R T;  5FNV E;  2XYS A;  2WY2 A;  4TUY E;  3B13 A;  1X9B A;  2FJD A;  2OV9 A;  1YKH B;  3L8R A;  3MAC A;  3FBZ A;  5LHI B;  3C4Z A;  3AEB A;  2LSK A;  2WN9 A;  4ERR A;  3TKL B;  3OYX A;  4O4I E;  5BW2 A;  2VB6 A;  4CN4 A;  4X5T A;  3C98 B;  2JIW A;  1YD8 G;  1IAP A;  3ZYK A;  4YJ3 E;  4QH5 A;  2XZ6 A;  3D0T A;  3NBX X;  4UF0 B;  2WM9 A;  4U74 A;  4TNW A;  4D01 A;  4B5D A;  1KK7 A;  1VOM A;  5JDH A;  4JUY A;  5FKY A;  4YJ2 E;  2E5L T;  3L39 A;  3DP7 A;  3Q5W A;  3UFG A;  5HEU A;  4C90 A;  2UUA T;  2J47 A;  2C9T A;  3EDU A;  1MIW A;  3ZMU B;  3ETV A;  2V5D A;  3OPC A;  2VKH A;  2AXD S;  4HFE A;  1CUN A;  4EOZ B;  5FL1 A;  4PNI A;  5JRC A;  4ZOL E;  5FYM A;  2XHE B;  4PJJ A;  3U8L A;  3LG7 A;  2Y48 B;  5L3D B;  2IHR 1;  1IJ5 A;  4U7Y A;  2XM2 A;  4CXX A;  3RLF F;  3ZMV B;  2Y54 A;  2YME A;  4AIU A;  3RI5 A;  4HFV A;  3ZCJ A;  4P1N A;  3QC9 A;  1Z0P A;  2JQQ A;  5L3C B;  1IBK T;  3PJA J;  1WR6 A;  2BS4 A;  1E2A A;  3FHN A;  3OKQ A;  3O1I A;  2LSG A;  4DV3 T;  4E7Z A;  1W0A A;  3CML A;  3ZT5 A;  3HI2 A;  5M4Y A;  4G2A A;  1T7S A;  5LBQ B;  2NW9 A;  5J2U E;  2G0U A;  4HN9 A;  2DNX A;  4ILU A;  4DR1 T;  3EAM A;  4UXU A;  5LJM A;  4IHJ E;  1J1J A;  1BR1 A;  2N2N A;  4DO0 A;  2XQ7 A;  2X51 A;  5HEJ A;  2Y8D A;  3A8Y C;  3TLS A;  3HKC E;  2UUB T;  3RYI E;  3X1D A;  3WTM A;  4YSY A;  4DID B;  2LHN A;  2LKH A;  4QXC B;  4HFB A;  4LFA T;  3K1S A;  3B57 A;  4PAG A;  3L3P A;  5AQV B;  3FZH B;  2MBG A;  2Z6E A;  5LXB A;  5KXJ A;  4XAX B;  5AQU B;  4BA9 A;  1T98 A;  2LE8 A;  4UV9 B;  4NXN T;  2C0S A;  2Q9Q A;  4ADZ A;  4ZXL A;  4X1K E;  3OVU A;  2E9X C;  3LSV A;  5ABG A;  2NR4 A;  5AFJ A;  5JR9 C;  3IGQ A;  2CMR A;  2NP9 A;  1KNZ A;  2W62 A;  1N34 T;  2DI4 A;  2J62 A;  2WCA A;  3AE2 A;  4GK5 E;  5FL0 A;  5HEH A;  2XQ3 A;  4QAC A;  2SPC A;  3NZQ A;  3KIN B;  3JC6 C;  4AKI A;  3LK4 2;  4HFD A;  3PUS A;  2LRL A;  4XK9 A;  4X62 T;  4O8S A;  4LF9 T;  2BR8 A;  2VAS A;  4UIG A;  3SQ9 A;  3AA0 B;  3E08 A;  3GN5 B;  3ZPO A;  4TWD A;  3IHR A;  1UUR A;  2HN2 A;  4H9P C;  5LXT E;  4DR7 T;  2Y58 A;  2WZH A;  1I6Z A;  4FI5 A;  3I0Q A;  2VKD A;  1MIV A;  2WBL A;  1T8B A;  4QHO A;  3RF1 A;  2YU2 A;  3HKB E;  4DV5 T;  3P50 A;  5AQO B;  3U8K A;  2K3W A;  2V7J A;  2WQY A;  2A72 A;  2FBW A;  5HXH A;  5LGT B;  4Z8X A;  2VK9 A;  3ZMS B;  1N33 T;  2BYS A;  4H9Q C;  3ONL C;  2BG9 A;  2DLR A;  4EXT A;  2FJE A;  3N9Q A;  1XNQ T;  1MMA A;  2XAF B;  5JRC B;  4HGA A;  5FJV A;  4YHJ A;  5HWX A;  1M7K A;  3WAJ A;  3T1H T;  2OLT A;  1YQ4 A;  2XUE A;  4I55 E;  4IDQ A;  5FXZ A;  5AQK B;  2XAQ B;  2LLY A;  4PK6 A;  3T1Y T;  5E0O A;  1NEN A;  2ODV A;  4X1I E;  2XQ8 A;  4ANJ A;  3VHL A;  1OWA A;  2JRK A;  2KWI B;  1LVK A;  4ILB A;  4X65 T;  4YT0 A;  1LRZ A;  5IUX A;  4AKG A;  2BYN A;  3IF8 B;  3NVO A;  2RA1 A;  4I50 E;  1UX5 A;  2IC6 A;  1QUU A;  2ZM2 A;  4UY2 A;  1S35 A;  1HFA A;  4IE5 A;  2W2U A;  3RIU A;  3TLV A;  2ZM6 T;  1BR2 A;  3RKO A;  2D9D A;  2BKO A;  4IE6 A;  1WYC A;  5AFM A;  1FIO A;  4XBF B;  3JAE A;  2H3R A;  1R8I A;  5J0Z A;  3N9L A;  4H63 V;  4H9R C;  3ZJ2 A;  2IML A;  5JH7 E;  5FVL A;  3P4S A;  4JI0 T;  2WP9 A;  4HKA A;  2Y57 A;  2V7K A;  3P4Q A;  2E8I A;  4E7S A;  1SA0 E;  2XYT A;  4HWH A;  2WZY A;  1UCU A;  2KSR A;  3NKZ A;  3LK3 B;  4QH4 A;  2E5V A;  2EHO B;  2EHO C;  4LF6 T;  2WNC A;  5FMN A;  5GON E;  2WSS V;  5AQQ B;  2ACZ A;  2CHN A;  5F5W A;  1D1C A;  2A2F X;  4L5G A;  1N32 T;  4H9S E;  3UUM A;  4UF0 A;  4EZH A;  2VQF T;  4AQF C;  3U3I A;  3ZKR A;  2V5C A;  4YFS A;  2W8G A;  2WMN A;  2XZ5 A;  1HR0 T;  3RHW A;  5EK3 A;  4OYK A;  4DR5 T;  4PK4 A;  3VR8 A;  4KX6 A;  4I43 B;  4JI6 T;  4ZI7 E;  1YXR A;  4ZR6 A;  2BYQ A;  5ABF A;  1XNR T;  2CWO A;  4DBQ A;  2CEA A;  2N1G A;  3TLW A;  3H3M A;  2MOZ A;  2ACX A;  2ODU A;  2BG9 B;  4QXH B;  2D2S A;  4HQP A;  4H9O C;  2V7M A;  2NWB A;  3FXD B;  4LFC T;  4U3C A;  4LFB T;  2CXD A;  2XNV A;  3N2G E;  2UXX B;  3JAD A;  5LYJ E;  2W67 A;  5CO5 A;  1HX1 B;  4DR2 T;  5J5G A;  4NXM T;  2V8S V;  5HWY A;  1U4Q A;  2YMD A;  2NW7 A;  4DR4 T;  1HF8 A;  4DR3 T;  2Y7Y A;  3VKG A;  4IIJ E;  2YIN A;  2NOX A;  1I9B A;  2PBI A;  4O4J E;  3SWH A;  4AFT A;  2XAJ B;  4P0B A;  2CLY C;  2LSI A;  4DBR A;  2XNT A;  3WTH A;  4ILA A;  4GYR A;  3T4M A;  5AFK A;  4N78 D;  2AE9 A;  5JRE A;  5JVD E;  3PUR A;  5TAO A;  4TNV A;  4OK0 A;  5KX5 E;  2XQ4 A;  2LSJ A;  4CI2 B;  3UUN A;  3O4X E;  2JPF A;  2BZB A;  3CWZ B;  2XY8 B;  4V1A v;  1UX2 A;  2MPK A;  3PMZ A;  2BVM A;  5LG4 A;  1IBL T;  1MMD A;  1X79 A;  2VL0 A;  4IDP A;  1KEY A;  3C4X A;  5LHG B;  2CHO A;  2W63 A;  4DVD A;  4UR9 A;  2L3L A;  3UFE A;  4BFQ A;  1WFD A;  4IST A;  3H3A A;  2XNU A;  5AQJ B;  2QGS A;  5JQG E;  2VVS A;  3IEE A;  3PU3 A;  2K5B B;  5FVK A;  2V7L A;  3VRA A;  2QRX A;  3BK9 A;  2VUR A;  3GN5 A;  3MJX A;  4QAB A;  5FP3 A;  1OED B;  1OED C;  4K0K T;  3RYH E;  2Y56 A;  1UV6 A;  2LJL A;  2BG9 E;  4KUM B;  3WTN A;  2XTL A;  1WR0 A;  3ZMT B;  3ZYL A;  1KNP A;  5DJQ C;  3M65 A;  4KHZ F;  3RYF E;  2JMH A;  4ISS A;  5CGM A;  5JDQ A;  2QYW A;  4JI4 T;  4OX9 T;  2DL1 A;  2BR7 A;  5F8P A;  1Z8U A;  4UM3 S;  3IA3 A;  2LKG A;  4AFH A;  5JDF A;  2YK0 A;  4F8H A;  2W0G A;  2KZ7 B;  2WDV A;  1MND A;  1CHU A;  1HG5 A;  2X0L B;  2Q9Q D;  4EZ4 A;  2XAH B;  4I0U A;  1FJG T;  5AIN A;  4EYU A;  4ZEY A;  4X64 T;  5ABF B;  3F57 A;  4ZI2 C;  3SH1 A;  3PUA A;  5F3J A;  1H7C A;  2BDE A;  2YDR A;  3UUL A;  4HTE A;  2I0M A;  1ZEE A;  2MAW A;  3P7I A;  3I1A A;  1D0Z A;  1U5P A;  5IWA T;  5LA6 E;  3MZK B;  5HCM A;  3IBP A;  3QK6 A;  2HN1 A;  3KV5 A;  4O4L E;  4JV5 T;  5BP0 A;  1VRB A;  3RC8 A;  3QOF A;  1HNX T;  4AQY T;  5IYZ E;  3K3N A;  2RPA A;  3ZSS A;  4NZB A;  4WBN E;  3CIR A;  3ZYM A;  2VQE T;  4IE0 A;  1UW6 A;  3KVA A;  4YXD A;  3RGL A;  2HHH T;  5LB7 B;  3OTO T;  1Y64 B;  2LHR A;  3PUW F;  4JI1 T;  2VL8 A;  3RC3 A;  2LOP A;  3RKG A;  2WDR A;  4AQG A;  4IT4 A;  5L4H A;  4IDZ A;  4A5X A;  2L9Q A;  3QB5 K;  1M62 A;  3MKD A;  5FY7 A;  4ZI3 C;  2E9X B;  5AQL B;  5AFN A;  1KNR A;  3T8O A;  3CQX C;  4ZJS A;  5JR9 B;  2WDQ A;  2EHO A;  4YSZ A;  5HXR A;  3TLU A;  5LNK A;  4BQT A;  1QSD A;  2JQK A;  3AEF A;  4DND A;  3AAI A;  4L0R A;  2J1D G;  4QH1 A;  5ABH A;  3I0O A;  4PJL A;  4TWH A;  4AQF A;  1UUS A;  2VWA A;  2XSB A;  2H89 A;  3ZDH A;  2PTF A;  3PDY A;  2X9X A;  3R84 B;  3AEE A;  2P9B A;  4IE4 A;  1ZOY A;  1JNR A;  3FB2 A;  2DCF A;  3UUX B;  3UU3 A;  4A98 A;  4PIR A;  2KT9 A;  2V1D B;  5LGN B;  5LBM A;  2I59 A;  3AE8 A;  4CI1 B;  3FBL A;  5SYO A;  3ZT6 A;  4WV9 A;  3AAE B;  3AEC A;  4CXY A;  4DV7 T;  3ABV A;  5AQH B;  5HAX A;  3A7M A;  4JI3 T;  3UU6 A;  4HFH A;  4KBM B;  3FZK B;  1XDP A;  2UXD T;  4UV8 B;  4PW8 A;  1WCR A;  4HEA A;  3AED A;  3SFE A;  3PE0 A;  2CXF A;  3SFD A;  3AA1 B;  4X20 E;  4XHE A;  3C50 A;  4IL4 A;  4U33 A;  2HPJ A;  4ALX A;  2BYP A;  2KIN B;  4F6R C;  2M6I A;  4J2C A;  4TX5 A;  3ETU A;  2CRB A;  3GMI A;  3PV0 F;  3EAB A;  5AQI B;  3CVR A;  4GIW A;  4DUY T;  5LMN T;  1ZP0 A;  3JCF A;  3O1J A;  4BJM A;  4EED A;  3ZC0 A;  2UZ6 A;  4JEH B;  1WRD A;  2WWV A;  2IAK A;  3M3Z B;  3FZM B;  4HWC A;  5FY1 A;  4MHC A;  4EIW A;  3ZCI A;  1T72 A;  5J5I A;  5AQS B;  3J9X 1;  4WYV A;  2DWG A;  2X00 A;  2C5K T;  3CX7 B;  4GOU A;  4PJM A;  1JNZ A;  1MNE A;  1HNZ T;  4JI2 T;  4B3S T;  3LJC A;  1FMW A;  3ESL A;  5AQN B;  3N9N A;  3AAA B;  5BR8 T;  4MAL A;  4EAH A;  4NIQ A;  3C84 A;  3PUG A;  3UU4 A;  3QUJ A;  2CA5 A;  3ZN0 B;  2LSY A;  4LF5 T;  4MLK A;  3P4P A;  4ZS2 A;  2MTQ A;  2M67 A;  1ZV4 X;  5HEO A;  3JAF A;  2XQ5 A;  3I9Y A;  4AI6 A;  5AQP B;  2Q9Q C;  1OED A;  5J5H A;  3AEG A;  1XMQ T;  4WZX A;  3KBT A;  2KXP B;  5CA0 E;  4U72 A;  3OJA A;  2R6G F;  5H6R B;  2YEV C;  4EYY R;  3SOL A;  3G06 A;  4OFZ A;  4P0A A;  3MXZ A;  2J4G A;  3U8M A;  3TLT A;  5J5F A;  1LKX A;  2X9H A;  3AE5 A;  1DU2 A;  4O2A E;  2V6Y B;  2BBJ A;  3WI3 A;  4CN1 A;  2BYR A;  3EHZ A;  2IIU A;  4UEL A;  3CQC B;  2ZJU A;  5DQW A;  4DV6 T;  4UM1 A;  1E7P A;  4DMW A;  3WTO A;  1W9R A;  2YDS A;  1GQE A;  2CWY A;  4COF A;  3J7Y q;  3Q5D A;  3JC6 D;  3PUQ A;  2BS2 A;  2BBH A;  1N36 T;  3N9M A;  2VKJ A;  4B3T T;  1O3X A;  3ANW B;  3Q5X A;  1J5E T;  2X66 A;  3V5S A;  5LJN A;  4HE8 A;  5LGU B;  4OHF A;  4AIS A;  4JI7 T;  5AQM B;  3U78 A;  2D0U A;  2KND A;  3NZP A;  3A5X A;  4ZRU A;  3RIF A;  5CFB A;  2PFV A;  5BMV E;  3LK2 B;  3WTI A;  5JDG A;  4UXN B;  1MMG A;  2CLY B;  4EGW A;  5AQR B;  1LVF A;  4GYS A;  3C4W A;  4QXB B;  4EEB A;  2FUP A;  5HXS A;  3AB3 B;  1KFY A;  3EVY A;  3WTL A;  3PUX F;  5L2L A;  3N9O A;  3ZT7 A;  3ONX A;  2E9X A;  2W8F A;  4PK5 A;  2LRK A;  3DJB A;  5JR9 A;  3PUY F;  2CM0 A;  3ZC1 A;  3GUA A;  1D1A A;  2CBI A;  4HWI B;  3WTK A;  1NWM X;  3RYC E;  3MA9 A;  4UEM A;  4AKL A;  4YTP A;  2M6B A;  4MFR A;  2Y6X A;  1BR0 A;  4M1P A;  1MMN A;  3NRX A;  2YOE A;  3PJA A;  4TV8 E;  1FEW A;  4MBQ A;  1YKE B;  5L3B B;  1L0V A;  4DBM A;  3UQ7 A;  4Z90 A;  5HYA A;  3NWI A;  5KMG P;  2WNL A;  2UXC T;  4ZZC A;  4ZJT A; 
#chains in the Genus database with same CATH homology
 4UM3 S;  3SIO A;  4AFT A;  5AFM B;  5HEH A;  2X00 D;  2LKG A;  2XQ8 A;  2LM2 A;  5L4H A;  2XQ3 A;  3ZKR A;  4AFH A;  4QAC A;  2Y54 A;  5BRX A;  2XNT A;  5HEO A;  2YME A;  4F8H A;  3WTH A;  3RI5 A;  3JAF A;  2XQ5 A;  2W8G A;  2XZ5 A;  3U8J A;  5AFH A;  4ILA A;  3RHW A;  4ILB A;  5KZU A;  2XYS A;  3T4M A;  2YKS A;  5AFN A;  1OED A;  5J5H A;  4HFD A;  5JME A;  4XHE A;  5IUX A;  5AFK A;  4ZJS A;  3RQW A;  4XK9 A;  2BYN A;  4ZRU A;  3RIF A;  5L47 A;  4IL4 A;  5CFB A;  2BR8 A;  3WTI A;  2BJ0 A;  4TNV A;  3TLU A;  5KE4 A;  1OED E;  2XQ4 A;  4ALX A;  5AIN A;  3SQ9 A;  4IL9 A;  2PGZ A;  2WN9 A;  2BG9 C;  4LML A;  2BYP A;  4TWD A;  4UY2 A;  2M6I A;  4BQT A;  3P4W A;  3TLV A;  3UU8 A;  3SH1 A;  4UM3 A;  4LMJ A;  3U8N A;  3U8M A;  1UX2 A;  2Y58 A;  4D01 A;  5BW2 A;  3TLT A;  2XQA A;  3PMZ A;  3EAM A;  4UXU A;  3ZDG A;  5J5F A;  4QH1 A;  4ZR6 A;  2PH9 A;  4IRE A;  4TWH A;  4ZK4 A;  5AFM A;  2BYQ A;  2VL0 A;  2XQ7 A;  4X5T A;  3ZDH A;  5HEJ A;  3WTL A;  3JAE A;  2WNJ A;  3TLS A;  3TLW A;  3UU5 A;  3UUB A;  2BYR A;  3P50 A;  2UZ6 A;  3EHZ A;  3WTM A;  3U8K A;  5J0Z A;  3WTJ A;  2MAW A;  2BG9 B;  4QH5 A;  2XZ6 A;  2ZJU A;  2LKH A;  4BFQ A;  2W8F A;  4HFB A;  2XNU A;  5HCM A;  5HEG A;  4HQP A;  2XQ6 A;  4ZK1 A;  2QC1 B;  4UM1 A;  3GUA A;  4TWF A;  3SQ6 A;  2XQ9 A;  4TNW A;  2BYS A;  2Y57 A;  4A97 A;  2YN6 A;  3WTK A;  3WTO A;  3UU3 A;  4B5D A;  4A98 A;  5BP0 A;  5AFL A;  4LMK A;  4PIR A;  4QAA A;  5LXB A;  2BG9 A;  5J5I A;  4ILC A;  2XNV A;  3PEO A;  4QAB A;  2XYT A;  2X00 A;  2WZY A;  3UQ4 A;  4UM3 P;  4NPP A;  5HEU A;  4FRR A;  3RQU A;  3EI0 A;  3JAD A;  2KSR A;  1OED B;  1OED C;  2C9T A;  5CO5 A;  2M6B A;  4Z91 A;  2Y56 A;  1UV6 A;  5TVC A;  5HCJ A;  5SYO A;  3WIP A;  5FJV A;  2BG9 E;  4WV9 A;  3WTN A;  4NZB A;  4QH4 A;  4EZ1 A;  4COF A;  5J5G A;  2WNC A;  4HFC A;  2YOE A;  3RIA A;  4HFE A;  1UW6 A;  3C79 A;  3LSV A;  2YMD A;  3UU6 A;  5L4E A;  4AFG A;  2Y7Y A;  2LLY A;  3C84 A;  4ZZB A;  5AFJ A;  4DBM A;  3IGQ A;  5LG3 A;  3UU4 A;  4Z90 A;  3UQ7 A;  2ZJV A;  4HFH A;  3U8L A;  4HFI A;  2WNL A;  1I9B A;  2BR7 A;  4ZZC A;  4ZJT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...