2XQ6A

Pentameric ligand gated ion channel glic in complex with cesium ion (cs+)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
310
structure length
310
Chain Sequence
b'PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
molecule keywords GLR4197 PROTEIN
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein
total genus 73
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq6A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq6A01
5LG3A 2LKHA 3EAMA 2VL0A 3TLUA 3WTKA 5CO5A 3TLVA 4B5DA 4D01A 4ZZCA 3UU8A 3WTIA 4HFBA 3WTMA 3RIAA 2W8GA 3P4WA 2XQ9A 2LM2A 4TNWA 2W8FA 2XQ8A 2Y54A 3JAEA 5SYOA 5KZUA 4UM1A 4TWHA 2XZ6A 4WV9A 4TWFA 5J5HA 2BYRA 3WIPA 2XQ3A 3SQ9A 2XQ5A 2ZJVA 2YN6A 5J5IA 4AFTA 3PMZA 4DBMA 4ZK1A 2WZYA 5HEGA 3C79A 5AFHA 2YMEA 3T4MA 3UU4A 2BJ0A 2XZ5A 4TWDA 3UUBA 4F8HA 3U8LA 5HEJA 2WNLA 2PH9A 3U8JA 3TLSA 2XNVA 4QH1A 2XNTA 5FJVA 4HFEA 2M6IA 4XHEA 5TVCA 2LKGA 3WTHA 2XQ6A 5L4HA 3TLWA 1UW6A 2UZ6A 4ZRUA 2ZJUA 2YMDA 3ZDHA 1UX2A 2Y58A 3UU6A 5HCJA 4X5TA 4ILCA 3JAFA 4PIRA 2XNUA 4HFIA 3PEOA 4UY2A 4HFHA 4ZJTA 3SH1A 3ZKRA 5AFJA 5KE4A 4QH4A 3WTJA 4BQTA 3UQ4A 4AFHA 3RI5A 4QACA 4UXUA 2M6BA 2BG9E 5L4EA 3U8MA 4UM3S 4ZR6A 2BG9B 3RQUA 4NPPA 2PGZA 4HFCA 5HEHA 3EHZA 4ILAA 4LMJA 2BYNA 5J5FA 2BG9A 5HCMA 4UM3A 1UV6A 4QABA 2X00A 4ALXA 3LSVA 5AFNA 3WTLA 1OEDE 4A97A 2MAWA 5J0ZA 1OEDB 5JMEA 2XYSA 2BYPA 5BW2A 3WTOA 2X00D 4EZ1A 2BYSA 4Z91A 5BRXA 2BG9C 4HQPA 2XQ4A 2YOEA 2Y56A 4QH5A 5CFBA 2QC1B 3ZDGA 1OEDA 3GUAA 3UQ7A 5BP0A 4IL4A 4AFGA 5LXBA 4ZZBA 2XYTA 5IUXA 3IGQA 4ZJSA 3U8KA 3RQWA 2Y57A 4UM3P 3P50A 1OEDC 4NZBA 3UU5A 5J5GA 4IL9A 2BR7A 5AFLA 3U8NA 3WTNA 2BR8A 4HFDA 4BFQA 2XQAA 5L47A 4LMLA 5HEOA 4ZK4A 2LLYA 3SQ6A 5AFMB 4QAAA 3SIOA 3RIFA 2WN9A 5HEUA 4Z90A 4A98A 3EI0A 3TLTA 3RHWA 2XQ7A 3UU3A 5AFMA 2Y7YA 2KSRA 5AINA 4LMKA 4IREA 4FRRA 2YKSA 3JADA 3C84A 4TNVA 2WNCA 1I9BA 2C9TA 4COFA 4ILBA 4XK9A 2WNJA 5AFKA 2BYQA
chains in the Genus database with same CATH superfamily
2L8KA 2PJQA 3EAMA 3TLUA 4AQFC 4LF8T 2JJ9A 4V1Av 2ACXA 4YXDA 4EAHA 3JC6C 1HFAA 4ISTA 2LM9A 3TLSA 3P8CD 2ZLYA 3QB5A 2C5JA 2DL1A 3ONXA 5L4HA 3DTOA 3UU6A 2D9DA 1XDOA 5FVKA 3AEFA 3E08A 5LGNB 4IE5A 2WB5A 3V5SA 2N9DA 5HAXA 4ZI3D 2VKDA 3LJCA 4L5GA 4BJMA 4HQPA 5CFBA 1MMNA 3BQLA 4TX5A 4P0BA 3EVYA 2LSGA 3I1AA 1ZV4X 1MIWA 3U3IA 1I94T 3VU7H 4BFQA 5HYAA 5HEOA 5LMNT 3SWHA 1YQ3A 3ZCIA 2X0HA 3UTKA 1MIVA 5HEUA 5CB4E 4G2AA 5AQJB 3K1SA 3EI0A 5LCYA 2WZHA 2XQ7A 2V7LA 3JADA 5JVDE 4GIWA 5LGTB 2ZM0A 3ZC0A 3Q2MA 4EOZB 2LSIA 2UXBT 3WTMA 3CIRA 5H6RB 4PNIA 2BVLA 2X67A 3QUJA 4O8SA 3RYIE 3QK6A 4QX8B 2PG8A 3KV5A 3T4MA 4HWIB 2E8IA 2J1DG 4DR1T 1KEYA 2UU9T 4QH1A 3W15B 4C91A 2BKNA 2P9BA 3QOFA 1UUSA 3LFMA 2IC9A 3HA4A 3RQUA 3H3MA 3N9OA 3P4SA 2K3WA 4H9PC 4CI2B 2C5IT 5AQRB 4U72A 2FJAA 4ZI3C 4IDZA 4ANJA 4ZHQE 4P1NA 4GYSA 4UV9B 4CN6A 3C98B 1D0ZA 1UGOA 5BW2A 4EZ1A 2Y56A 3GUAA 3VKGA 3FZFB 4DR2T 3FBZA 4GKKT 2UXCT 3L3PA 1L0VA 2BR7A 5AFLA 4IDNA 3FZKB 4PK4A 4UF0B 3KV6A 1D0XA 5FXWA 4U31A 3LK2B 2JMHA 4GK5E 3C51A 4PK6A 1XZYA 2JQHA 4IE6A 1BR4A 3PUWF 4TNVA 4COFA 5LG3A 4DNDA 3MKDA 3KV4A 3WAKA 2LM2A 4PJLA 2Y54A 4HE8A 4I4TE 3PMZA 4U7IA 2XZ5A 2NR4A 5LA6E 3VRBA 3U8JA 4ASKA 2XNVA 2XTLA 1UX2A 2XAFB 5C8YE 3SOLA 2CA5A 2WMOA 3K3NA 3ZKRA 1T8BA 5KE4A 4P09A 5BR8T 5DJQC 5J2TE 2YU1A 2JRKA 4B3TT 2D0TA 3I9YA 2LHNA 4HWHA 2CCQA 2QVAA 4JV5T 4HWDA 2CBIA 3RPUA 3I0QA 4Z91A 3RRWA 4MALA 3KV9A 2BS3A 1WCRA 4HGAA 3ZEFB 2A2FX 4YSXA 3IGQA 3U8KA 4AKRB 5LOVE 3ZMTB 3ZT5A 1SUMB 1N34T 2H89A 2M67A 4CI3B 3O1HA 2D2SA 1U4QA 2MBGA 3PU3A 4CN1A 5LHGB 2WNJA 3OPCA 1KF6A 3UUXB 3WTKA 4JI6T 2OLTA 2XAHB 3P4WA 5J1GA 2CXLA 3IA3A 4PJNA 2XQ3A 4GYRA 2VQET 5HEGA 2WY2A 3E22E 1FIOA 4XAXB 1MMGA 3D0TA 5AQHB 1HX8A 4UVBB 2C0SA 5CJ5A 1XDPA 3AAEB 2ZM6T 2ACZA 2L3LA 5EK2A 4UY2A 3HKCE 5AQVB 1X79A 2UUBT 2BBHA 4JI8T 3UQ4A 4UM3S 3ZT6A 4EV6A 3PURA 4HEAA 3T1YT 3ZSSA 2PGZA 1W0BA 2K9AA 3KBUA 5HCMA 4ALXA 5AFNA 4A97A 2JQQA 4PAGA 5JMEA 1WYBA 3FXEB 2J4GA 2QRXA 5J2UE 4KX6A 3ZDGA 2JQ9A 4P0AA 1NAFA 5FXXA 4XBFB 3O4XE 2WS3A 5JDQA 4EYYR 1D1BA 4QX7B 1MIYA 2XSBA 2X51A 3ZYMA 3MA9A 3N2GE 4WZXA 2R6GF 3N9MA 4QKNA 4AKIA 2MOZA 3BQKA 1FMWA 5LG4A 5HWYA 3ANWA 4DUZT 1WR0A 3ONJA 1UURA 3Q5DA 4CXXA 3AA0B 3C4WA 3NBXX 5KZUA 4PJJA 4DV4T 4AQYT 2BVMA 3E0ZA 5FNVE 3S4UA 4ZK1A 3I0OA 2HHHT 3UUBA 4DV2T 4JUYA 4B6XA 2CRBA 2KWIB 2KMFA 3ZJ1A 4HFEA 3AE7A 4DMWA 4E7ZA 1KNRA 3JC6D 5FMNA 1J1JA 2NW7A 3PUYF 2BS2A 2CXFA 3LDQB 3MK7C 4L0RA 2WDQA 4GOUA 3J9X1 3EHZA 3JCFA 2MAWA 3SFEA 4H9RC 2BZBA 2NP9A 5LNKA 2IUBA 4YLHA 4IL4A 1LVKA 4AFGA 3IBPA 4PFPA 4OK0A 4EZHA 5J5GA 2UUCT 5E0OA 2XUEA 4ZK4A 2KZ7B 4H9NC 3VR8A 4LFAT 4H63V 2SPCA 2YKSA 5JDGA 4CXYA 3GWHA 3LK3B 4O2BE 3CVRA 2ZJVA 5J5IA 3HKDE 2V7JA 2BJ0A 4IIJE 1ZEEA 2CLYB 4BAYB 2LJLA 4ZI7E 4BA9A 2LHRA 3OJAA 1YKHB 2CLYC 3CPZA 3QC9A 1HG5A 1XWMA 4H9QC 2FJEA 5HXRA 5L3BB 5AQGB 1HNWT 2V5DA 5FY1A 2XAGB 3RX6A 3LK42 2IAKA 3N9LA 2NOXA 2LT3A 2Z6EA 4MLKA 2XZEA 2XHEB 1JNZA 2XQ4A 3SFDA 5BP0A 4YJ3E 1UCUA 2A9UA 4C90A 2WZIA 2CWYA 4O4JE 1SA0E 2VKJA 5JDLA 2N1GA 2V6YA 2BR8A 2W0GA 5JDNA 5C2TA 4DR5T 4DV7T 3ANWB 5BMVE 1S35A 3PUZF 5IYZE 4UV8B 5KDMC 2Y7YA 2V6XA 3OKQA 2A72A 2MTQA 2CPTA 1I9BA 1HTJF 5ABEA 5CO5A 3NKZA 3KDSE 4B3ST 1ZHCA 2CWOA 4IDPA 2XQ9A 3FXDB 3UT5E 5SYOA 2YINA 2NW8A 3B57A 3AE2A 3LBXA 3KINB 3ZJ2A 4MFRA 4ISSA 3AECA 2ZJUA 3H37A 2FJBA 2YU2A 3CWZB 4I0UA 5LHIB 2XNUA 2KWHA 3ESLA 3WTJA 3RI5A 4UVAB 3ZMSB 4NPPA 4PK5A 2ODVA 2WU2A 1HNXT 1IZNB 5AQIB 1VCSA 1IBKT 3FB2A 3A7MA 2W66A 1T98A 4LFBT 2H7VC 2BYSA 4X66T 2ZM2A 2B1EA 2YOEA 4LF7T 4IDQA 1E2AA 4DR7T 2E2AA 4AQGA 4YFSA 5IUXA 2YEVC 1KK7A 4NXMT 1G8XA 3PUAA 5ABGA 3UFEA 4HWFA 3ETVA 1HS7A 4GK0E 2I6HA 3VKHA 2VURA 3PV0F 3RHWA 4OYJA 4YT0A 4H9OC 4QXCB 4L9IA 2LRKA 4O4IE 5DQWA 2V7IA 3FHNA 2LKHA 1VCTA 2QA7A 2LRLA 2XAJB 2JIWA 5FL0A 3JAEA 3KVBA 5J5HA 4KMCA 4UR9A 1WYCA 2VKOA 3C79A 2WCAA 4X1YE 4KI0F 5HEJA 2X9HA 3ZPOA 2FUPA 1NEKA 1WLXA 2XASB 5L3DB 4X5TA 2PFVA 2DHRA 3FBLA 3MJXA 4YSZA 3OVUA 1IBMT 4U74A 4AFHA 5L4EA 5HXHA 3RKGA 4ILAA 2BG9A 3AE6A 4U7YA 2FBWA 4YHHT 3RF1A 4EGWA 2VVNA 1D1CA 1OXZA 3N9NA 2E5VA 3UQ7A 5AQOB 4CN4A 2GK9A 4DV0T 2HN2A 4X65T 2V6YB 4PW8A 2DLRA 2HPLA 4QHOA 4DO0A 4QXBB 3CMLA 1D1AA 4GKJT 5LJNA 3B5MA 2RA1A 3ZMVB 1IAPA 2ZM8A 2V7KA 4LF5T 2BYQA 5FXZA 2IHR1 1VRBA 5FY0A 1QUUA 2KLQA 4HFBA 3H3AA 2W8FA 3KBTA 3LBXB 4X20E 3WIPA 3MZKB 2Q9QA 2WSSV 1O3XA 3C4XA 5AQLB 2WNLA 3T8OA 2XNTA 5TVCA 3TLWA 2X66A 4ZRUA 2YMDA 4DIDB 2DNXA 5KMGP 4DR6T 1T72A 4QH4A 5L3EB 1Y64B 4M1PA 2H3RA 4CZZB 1UV6A 4NXNT 2LOPA 3ZYLA 2YDRA 1E1HB 4LFCT 5JREA 2F4VT 4ZZBA 1YQ4A 1M7KA 3AE9A 5DQVA 4ADZA 2W62A 4LF6T 2CMRA 5FYMA 4HFDA 3O1IA 1LVFA 1R8IA 2BKOA 4NUVA 2VKHA 3LG7A 4KHZF 4X1IE 2KSRA 2FJDA 1D0YA 2XM2A 3FZLB 1WFDA 1FJGT 4DV3T 3RC8A 1QSDA 3TLVA 3UU8A 4YTMA 4FJOA 2CEAA 4Q25A 2KXPB 2WZYA 3P4PA 3PUXF 1US7B 2LSJA 2KINB 3MXZA 2OV9A 4JYAT 4IHJE 2K24A 4OFZA 4WW0A 2W2UA 3A8YC 4A5XA 2XAQB 3OYZA 2WAUA 3UUMA 4HFIA 2WWVA 1FMVA 4JI2T 2HPJA 2JMKA 1YKEB 4U2YA 2BG9B 2QYWA 2PBIA 5LB7B 3GMIA 4G63A 2W4XA 2H88A 1X9BA 3TKLB 1IJ5A 1CUNA 5J0ZA 5HXCA 3HR0A 3AEBA 3ZYKA 2BG9C 3PTRB 2HN1A 1OEDA 2V7MA 1YXRA 5LXTE 3ZMUB 4AISA 4B3MT 2V5CA 5FKYA 4ZEYA 4DUYT 2KT9A 3RLFF 3RQWA 2X9WA 3AAAB 1J5ET 4IL9A 2DWGA 2VASA 2ODUA 5C3JA 1W9RA 3PUGA 2I59A 3NRXA 1B7TA 5AQQB 2ZMAA 3SQ6A 3QB5K 3RIFA 4X1KE 4DV6T 2LSKA 1LRZA 3AXJA 3O1JA 3Q5WA 4EZ4A 3UU3A 5AFMA 4X64T 4IREA 1HR0T 4YHJA 3NRYA 4XK9A 4ILBA 5ETWA 3AE3A 3Q5EA 1CHUA 2Q9QB 2XPKA 5ABFA 2W8GA 5LBQB 4JI5T 2WU5A 4TWHA 2BS4A 3KVAA 1UX5A 2AE9A 2CM0A 2XQ5A 2W63A 1M62A 1U5PA 3I9WA 2BKPA 4JLEA 3U8LA 3ZLIA 2Q9QC 1E7PA 2EHOA 2M6IA 3F2EA 4AKGA 2V1DB 5M4YA 1Z0PA 4HN9A 3QNUA 4YTNA 3IHRA 4NUUA 3NZPA 1I6ZA 3RYFE 5AFJA 1AJ3A 4JBWF 1XMQT 2VL8A 3OYXA 3ETUA 3CKDA 2A3DA 2WDVA 3AE1A 4HFCA 5L3FB 5J5FA 4UM3A 2IW5B 3AB3B 4ZS3A 5F8PA 4K0UA 3ZSTA 2XM1A 3CX7B 5BRXA 4UIGA 4IE0A 2UXDT 3AE4A 4QH5A 3RGLA 5JTGA 5LXBA 2LOSA 5AQUB 1HNZT 3RKOA 2J47A 3C64A 1MNDA 4UVCB 4HKAA 5JDFA 4HTEA 3BQIA 2KNDA 1MMDA 4LMLA 5L47A 3EABA 3Q5XA 4IT4A 3SIOA 4HWCA 4U2ZA 3AE8A 2N2NA 4NIQA 4A98A 1NWMX 2WP9A 1HX1B 3G06A 4LF4T 3A5XA 4IGUA 1WR6A 2C9TA 3Q9DA 5AFKA 2VL0A 4D01A 2WMNA 3WTIA 3ZC1A 1UX4A 2IDOB 4UM1A 4TWFA 1LKXA 4DV5T 4DR3T 2K5BB 3SQ9A 4DBMA 1YW0A 2OA5A 2X0LB 1MNEA 4DVDA 1XNRT 3C4ZA 3PUSA 3AEEA 4WNKA 3AE5A 5CGMA 2IC6A 2L9QA 5AQMB 3P4QA 2NTYA 2X0YA 4UEMA 3UUNA 4LF9T 4EYUA 1T7SA 2UZ6A 1N32T 5HCJA 5FVLA 2EHOD 3IEEA 3K3OA 3HL6A 2Y48B 5JR9A 5HWXA 2BG9E 4I43B 3R84B 3NVOA 1NENA 2WWUA 3UULA 2VWAA 4TZ4C 1HF8A 2XQYA 3RYCE 3WTLA 1OEDB 4WBNE 4TV8E 5FXVA 3GN5A 5AFUL 2LSYA 5L2LA 1KNZA 3CQGB 5EZYE 5H6QB 4JI1T 3HKEE 2WM9A 3X1DA 5ABHA 1JNRA 2QC1B 3RIUA 2NW9A 1OEDC 3WAJA 3WTNA 2I0MA 3P4RA 3M65A 3AXJB 4EIWA 5AFMB 1BR2A 1XNQT 3VRAA 2HH7A 3L09A 2CHNA 3CX6B 1H7CA 3IF8B 4H9SE 5ABFB 2WNCA 4HFVA 5KXJA 4X62T 4JI3T 4OYKA 4B5DA 2YDSA 1SHZC 3AEGA 4EB6E 2XSAA 5FP3A 2YN6A 3PUQA 1FEWA 5AFHA 3AA6B 4AI6A 5HXEA 2EHOB 4JI4T 4TUYE 3PJAJ 2JPFA 2YK0A 5LGUB 4XHEA 2LKGA 1UW6A 1ZKEA 3CQXC 1KNPA 3K8PC 1KFYA 4TN7B 2VK9A 2EHOC 2MPKA 3ZMZB 3FZMB 4WYVA 4ZR6A 5F5WA 1GQEA 5IWAT 4ZXLA 5IHYA 4KHPT 3PE0A 5HXSA 3L39A 2XY8B 3EDUA 2V26A 5LYJE 1ZOYA 2WBLA 3B13A 5AQNB 3CQCB 4YY3T 5LP6E 2XYTA 4ZJSA 5CA0E 4UM3P 3UU5A 1V9DA 3N9PA 2X9XA 5KX5E 5LJMA 3OBVE 5JDMA 2QGSA 5AQSB 4Z90A 3NWIA 3N2OA 2V8SV 4JI7T 5AINA 2J62A 4LMKA 2ES0A 4BJNA 4TV9E 2K48A 2CXDA 2Y6XA 3M3ZB 2H7OA 4ZZCA 1EZ3A 4TNWA 1Z8UA 4QWNB 2DWKA 5AQKB 2XJ7A 4KP3C 4XZCA 4Z8XA 3VR9A 3BK9A 2D0UA 5JH7E 1YD8G 3UU4A 4TWDA 3O9XA 1VOMA 4AXPA 3UFGA 2X9YA 4ZOLE 2B76A 4PJMA 3P7IA 5JRCA 3SRZA 5JDHA 2UUAT 5JR9B 2D5UA 3JAFA 4EEDA 5L3CB 4HFHA 3SH1A 3V5UA 5LMUT 3U8MA 4EXTA 2W61A 1S94A 3T1HT 1MMAA 3GN5B 5JR9C 4QABA 2X00A 3LSVA 1OEDE 2G0UA 3PUVF 3N5LA 2UXXB 2XYSA 2C5KT 3ABVA 2LE8A 4ZI2D 5EK4A 4ERRA 3ZT7A 2LEHA 4N78D 4DR4T 4CI1B 4JI0T 3AA7B 3HKBE 3P50A 1IJ6A 2RP4A 4A56A 4NZBA 3AVRA 3NZQA 2W67A 4AKLA 3EUHA 3RIUC 3MACA 2E9XA 4YJ2E 3C50A 4K0KT 3F31A 2LLYA 5JQGE 4QAAA 2WN9A 4O4HE 3F57A 3AVSA 1BR0A 4AQFA 4FRRA 3C84A 5CA1E 4IDOA 2VVSA 3WI3A 3PJAA 4FI5A 4OX9T 2NTXA 4J2CA 2XQ8A 5A1LA 1DU2A 1N33T 4QXHB 4O2AE 4F8HA 4ILUA 5AQPB 2PH9A 4IE7A 4AKHA 2W00A 2X68A 4JEUB 3ZDHA 5FY7A 4ZS2A 3PEOA 2DCFA 2BDEA 5TAOA 3AA1B 3VHLA 4JEHB 4BQTA 1OWAA 4UXNB 2Q9QD 4EEBA 3RRCA 5ADXL 5HEHA 1IBLT 4LMJA 4KBMB 2BYNA 3HI2A 5AQFB 2WDRA 4H63H 4OHFA 5LHHB 5AQTB 2BYPA 3N9QA 2X00D 3WTOA 2CBJA 1QLBA 4ZI2C 2VB6A 2YDQA 2IMLA 3PDYA 5EK3A 3CK6A 3N2KE 2BBJA 4CQIA 3U8NA 4I55E 1HCIA 5L3GB 2E9XD 2WQYA 2Y8DA 4KUMB 5FL1A 4PFOA 3L8RA 3SS1A 4YTPA 1UK5A 3FZHB 1J5WA 4DV1T 3RIAA 1XMOT 3KFWX 2E5LT 2XZ6A 4WV9A 1ZP0A 2DI4A 2BYRA 5DABA 1G73A 4AFTA 1Y01A 4DBRA 3RYHE 3U78A 3ZCJA 2UXNB 2YMEA 3DP7A 5GONE 5JRCB 4DMVA 3ZN0B 1HG2A 2IIUA 5FJVA 4IE4A 3WTHA 2XQ6A 1W09A 2Y58A 4ILCA 2CE7A 4PIRA 3ZN1B 4U3CA 4O4LE 4ZJTA 3RC3A 4E7SA 4QACA 4UXUA 2M6BA 3AEAA 5LBMA 3CX8B 1W0AA 4WBOA 3PU8A 4UELA 4B3RT 3EDVA 4AIUA 4MHCA 4DBQA 2PTFA 3ONLC 3RH3A 1SE7A 4F6RC 1WRDA 3DJBA 2E9XB 2Y57A 1BR1A 2AXDS 4YSYA 4MBQA 2XQAA 4CXWA 2CHOA 2MYSA 3AEDA 3OTOT 2VQFT 2RPAA 2E9XC 3K3QC 3AAIA 3TLTA 4I50E 4UF0A 2NWBA 3J7Yq 3R6NA 1N36T 2JQKA 4U33A 5F3JA 3GA8A
chains in the Genus database with same CATH topology
5LG3A 2LKHA 3EAMA 2VL0A 3TLUA 3WTKA 5CO5A 3TLVA 4B5DA 4D01A 4ZZCA 3UU8A 3WTIA 4HFBA 3WTMA 3RIAA 2W8GA 3P4WA 2XQ9A 2LM2A 4TNWA 2W8FA 2XQ8A 2Y54A 3JAEA 5SYOA 5KZUA 4UM1A 4TWHA 2XZ6A 4WV9A 4TWFA 5J5HA 2BYRA 3WIPA 2XQ3A 3SQ9A 2XQ5A 2ZJVA 2YN6A 5J5IA 4AFTA 3PMZA 4DBMA 4ZK1A 2WZYA 5HEGA 3C79A 5AFHA 2YMEA 3T4MA 3UU4A 2BJ0A 2XZ5A 4TWDA 3UUBA 4F8HA 3U8LA 5HEJA 2WNLA 2PH9A 3U8JA 3TLSA 2XNVA 4QH1A 2XNTA 5FJVA 4HFEA 2M6IA 4XHEA 5TVCA 2LKGA 3WTHA 2XQ6A 5L4HA 3TLWA 1UW6A 2UZ6A 4ZRUA 2ZJUA 2YMDA 3ZDHA 1UX2A 2Y58A 3UU6A 5HCJA 4X5TA 4ILCA 3JAFA 4PIRA 2XNUA 4HFIA 3PEOA 4UY2A 4HFHA 4ZJTA 3SH1A 3ZKRA 5AFJA 5KE4A 4QH4A 3WTJA 4BQTA 3UQ4A 4AFHA 3RI5A 4QACA 4UXUA 2M6BA 2BG9E 5L4EA 3U8MA 4UM3S 4ZR6A 2BG9B 3RQUA 4NPPA 2PGZA 4HFCA 5HEHA 3EHZA 4ILAA 4LMJA 2BYNA 5J5FA 2BG9A 5HCMA 4UM3A 1UV6A 4QABA 2X00A 4ALXA 3LSVA 5AFNA 3WTLA 1OEDE 4A97A 2MAWA 5J0ZA 1OEDB 5JMEA 2XYSA 2BYPA 5BW2A 3WTOA 2X00D 4EZ1A 2BYSA 4Z91A 5BRXA 2BG9C 4HQPA 2XQ4A 2YOEA 2Y56A 4QH5A 5CFBA 2QC1B 3ZDGA 1OEDA 3GUAA 3UQ7A 5BP0A 4IL4A 4AFGA 5LXBA 4ZZBA 2XYTA 5IUXA 3IGQA 4ZJSA 3U8KA 3RQWA 2Y57A 4UM3P 3P50A 1OEDC 4NZBA 3UU5A 5J5GA 4IL9A 2BR7A 5AFLA 3U8NA 3WTNA 2BR8A 4HFDA 4BFQA 2XQAA 5L47A 4LMLA 5HEOA 4ZK4A 2LLYA 3SQ6A 5AFMB 4QAAA 3SIOA 3RIFA 2WN9A 5HEUA 4Z90A 4A98A 3EI0A 3TLTA 3RHWA 2XQ7A 3UU3A 5AFMA 2Y7YA 2KSRA 5AINA 4LMKA 4IREA 4FRRA 2YKSA 3JADA 3C84A 4TNVA 2WNCA 1I9BA 2C9TA 4COFA 4ILBA 4XK9A 2WNJA 5AFKA 2BYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LG3 A;  2LKH A;  3EAM A;  2VL0 A;  3TLU A;  3WTK A;  5CO5 A;  3TLV A;  4B5D A;  4D01 A;  4ZZC A;  3UU8 A;  3WTI A;  4HFB A;  3WTM A;  3RIA A;  2W8G A;  3P4W A;  2XQ9 A;  2LM2 A;  4TNW A;  2W8F A;  2XQ8 A;  2Y54 A;  3JAE A;  5SYO A;  5KZU A;  4UM1 A;  4TWH A;  2XZ6 A;  4WV9 A;  4TWF A;  5J5H A;  2BYR A;  3WIP A;  2XQ3 A;  3SQ9 A;  2XQ5 A;  2ZJV A;  2YN6 A;  5J5I A;  4AFT A;  3PMZ A;  4DBM A;  4ZK1 A;  2WZY A;  5HEG A;  3C79 A;  5AFH A;  2YME A;  3T4M A;  3UU4 A;  2BJ0 A;  2XZ5 A;  4TWD A;  3UUB A;  4F8H A;  3U8L A;  5HEJ A;  2WNL A;  2PH9 A;  3U8J A;  3TLS A;  2XNV A;  4QH1 A;  2XNT A;  5FJV A;  4HFE A;  2M6I A;  4XHE A;  5TVC A;  2LKG A;  3WTH A;  2XQ6 A;  5L4H A;  3TLW A;  1UW6 A;  2UZ6 A;  4ZRU A;  2ZJU A;  2YMD A;  3ZDH A;  1UX2 A;  2Y58 A;  3UU6 A;  5HCJ A;  4X5T A;  4ILC A;  3JAF A;  4PIR A;  2XNU A;  4HFI A;  3PEO A;  4UY2 A;  4HFH A;  4ZJT A;  3SH1 A;  3ZKR A;  5AFJ A;  5KE4 A;  4QH4 A;  3WTJ A;  4BQT A;  3UQ4 A;  4AFH A;  3RI5 A;  4QAC A;  4UXU A;  2M6B A;  2BG9 E;  5L4E A;  3U8M A;  4UM3 S;  4ZR6 A;  2BG9 B;  3RQU A;  4NPP A;  2PGZ A;  4HFC A;  5HEH A;  3EHZ A;  4ILA A;  4LMJ A;  2BYN A;  5J5F A;  2BG9 A;  5HCM A;  4UM3 A;  1UV6 A;  4QAB A;  2X00 A;  4ALX A;  3LSV A;  5AFN A;  3WTL A;  1OED E;  4A97 A;  2MAW A;  5J0Z A;  1OED B;  5JME A;  2XYS A;  2BYP A;  5BW2 A;  3WTO A;  2X00 D;  4EZ1 A;  2BYS A;  4Z91 A;  5BRX A;  2BG9 C;  4HQP A;  2XQ4 A;  2YOE A;  2Y56 A;  4QH5 A;  5CFB A;  2QC1 B;  3ZDG A;  1OED A;  3GUA A;  3UQ7 A;  5BP0 A;  4IL4 A;  4AFG A;  5LXB A;  4ZZB A;  2XYT A;  5IUX A;  3IGQ A;  4ZJS A;  3U8K A;  3RQW A;  2Y57 A;  4UM3 P;  3P50 A;  1OED C;  4NZB A;  3UU5 A;  5J5G A;  4IL9 A;  2BR7 A;  5AFL A;  3U8N A;  3WTN A;  2BR8 A;  4HFD A;  4BFQ A;  2XQA A;  5L47 A;  4LML A;  5HEO A;  4ZK4 A;  2LLY A;  3SQ6 A;  5AFM B;  4QAA A;  3SIO A;  3RIF A;  2WN9 A;  5HEU A;  4Z90 A;  4A98 A;  3EI0 A;  3TLT A;  3RHW A;  2XQ7 A;  3UU3 A;  5AFM A;  2Y7Y A;  2KSR A;  5AIN A;  4LMK A;  4IRE A;  4FRR A;  2YKS A;  3JAD A;  3C84 A;  4TNV A;  2WNC A;  1I9B A;  2C9T A;  4COF A;  4ILB A;  4XK9 A;  2WNJ A;  5AFK A;  2BYQ A; 
#chains in the Genus database with same CATH topology
 2L8K A;  2PJQ A;  3EAM A;  3TLU A;  4AQF C;  4LF8 T;  2JJ9 A;  4V1A v;  2ACX A;  4YXD A;  4EAH A;  3JC6 C;  1HFA A;  4IST A;  2LM9 A;  3TLS A;  3P8C D;  2ZLY A;  3QB5 A;  2C5J A;  2DL1 A;  3ONX A;  5L4H A;  3DTO A;  3UU6 A;  2D9D A;  1XDO A;  5FVK A;  3AEF A;  3E08 A;  5LGN B;  4IE5 A;  2WB5 A;  3V5S A;  2N9D A;  5HAX A;  4ZI3 D;  2VKD A;  3LJC A;  4L5G A;  4BJM A;  4HQP A;  5CFB A;  1MMN A;  3BQL A;  4TX5 A;  4P0B A;  3EVY A;  2LSG A;  3I1A A;  1ZV4 X;  1MIW A;  3U3I A;  1I94 T;  3VU7 H;  4BFQ A;  5HYA A;  5HEO A;  5LMN T;  3SWH A;  1YQ3 A;  3ZCI A;  2X0H A;  3UTK A;  1MIV A;  5HEU A;  5CB4 E;  4G2A A;  5AQJ B;  3K1S A;  3EI0 A;  5LCY A;  2WZH A;  2XQ7 A;  2V7L A;  3JAD A;  5JVD E;  4GIW A;  5LGT B;  2ZM0 A;  3ZC0 A;  3Q2M A;  4EOZ B;  2LSI A;  2UXB T;  3WTM A;  3CIR A;  5H6R B;  4PNI A;  2BVL A;  2X67 A;  3QUJ A;  4O8S A;  3RYI E;  3QK6 A;  4QX8 B;  2PG8 A;  3KV5 A;  3T4M A;  4HWI B;  2E8I A;  2J1D G;  4DR1 T;  1KEY A;  2UU9 T;  4QH1 A;  3W15 B;  4C91 A;  2BKN A;  2P9B A;  3QOF A;  1UUS A;  3LFM A;  2IC9 A;  3HA4 A;  3RQU A;  3H3M A;  3N9O A;  3P4S A;  2K3W A;  4H9P C;  4CI2 B;  2C5I T;  5AQR B;  4U72 A;  2FJA A;  4ZI3 C;  4IDZ A;  4ANJ A;  4ZHQ E;  4P1N A;  4GYS A;  4UV9 B;  4CN6 A;  3C98 B;  1D0Z A;  1UGO A;  5BW2 A;  4EZ1 A;  2Y56 A;  3GUA A;  3VKG A;  3FZF B;  4DR2 T;  3FBZ A;  4GKK T;  2UXC T;  3L3P A;  1L0V A;  2BR7 A;  5AFL A;  4IDN A;  3FZK B;  4PK4 A;  4UF0 B;  3KV6 A;  1D0X A;  5FXW A;  4U31 A;  3LK2 B;  2JMH A;  4GK5 E;  3C51 A;  4PK6 A;  1XZY A;  2JQH A;  4IE6 A;  1BR4 A;  3PUW F;  4TNV A;  4COF A;  5LG3 A;  4DND A;  3MKD A;  3KV4 A;  3WAK A;  2LM2 A;  4PJL A;  2Y54 A;  4HE8 A;  4I4T E;  3PMZ A;  4U7I A;  2XZ5 A;  2NR4 A;  5LA6 E;  3VRB A;  3U8J A;  4ASK A;  2XNV A;  2XTL A;  1UX2 A;  2XAF B;  5C8Y E;  3SOL A;  2CA5 A;  2WMO A;  3K3N A;  3ZKR A;  1T8B A;  5KE4 A;  4P09 A;  5BR8 T;  5DJQ C;  5J2T E;  2YU1 A;  2JRK A;  4B3T T;  2D0T A;  3I9Y A;  2LHN A;  4HWH A;  2CCQ A;  2QVA A;  4JV5 T;  4HWD A;  2CBI A;  3RPU A;  3I0Q A;  4Z91 A;  3RRW A;  4MAL A;  3KV9 A;  2BS3 A;  1WCR A;  4HGA A;  3ZEF B;  2A2F X;  4YSX A;  3IGQ A;  3U8K A;  4AKR B;  5LOV E;  3ZMT B;  3ZT5 A;  1SUM B;  1N34 T;  2H89 A;  2M67 A;  4CI3 B;  3O1H A;  2D2S A;  1U4Q A;  2MBG A;  3PU3 A;  4CN1 A;  5LHG B;  2WNJ A;  3OPC A;  1KF6 A;  3UUX B;  3WTK A;  4JI6 T;  2OLT A;  2XAH B;  3P4W A;  5J1G A;  2CXL A;  3IA3 A;  4PJN A;  2XQ3 A;  4GYR A;  2VQE T;  5HEG A;  2WY2 A;  3E22 E;  1FIO A;  4XAX B;  1MMG A;  3D0T A;  5AQH B;  1HX8 A;  4UVB B;  2C0S A;  5CJ5 A;  1XDP A;  3AAE B;  2ZM6 T;  2ACZ A;  2L3L A;  5EK2 A;  4UY2 A;  3HKC E;  5AQV B;  1X79 A;  2UUB T;  2BBH A;  4JI8 T;  3UQ4 A;  4UM3 S;  3ZT6 A;  4EV6 A;  3PUR A;  4HEA A;  3T1Y T;  3ZSS A;  2PGZ A;  1W0B A;  2K9A A;  3KBU A;  5HCM A;  4ALX A;  5AFN A;  4A97 A;  2JQQ A;  4PAG A;  5JME A;  1WYB A;  3FXE B;  2J4G A;  2QRX A;  5J2U E;  4KX6 A;  3ZDG A;  2JQ9 A;  4P0A A;  1NAF A;  5FXX A;  4XBF B;  3O4X E;  2WS3 A;  5JDQ A;  4EYY R;  1D1B A;  4QX7 B;  1MIY A;  2XSB A;  2X51 A;  3ZYM A;  3MA9 A;  3N2G E;  4WZX A;  2R6G F;  3N9M A;  4QKN A;  4AKI A;  2MOZ A;  3BQK A;  1FMW A;  5LG4 A;  5HWY A;  3ANW A;  4DUZ T;  1WR0 A;  3ONJ A;  1UUR A;  3Q5D A;  4CXX A;  3AA0 B;  3C4W A;  3NBX X;  5KZU A;  4PJJ A;  4DV4 T;  4AQY T;  2BVM A;  3E0Z A;  5FNV E;  3S4U A;  4ZK1 A;  3I0O A;  2HHH T;  3UUB A;  4DV2 T;  4JUY A;  4B6X A;  2CRB A;  2KWI B;  2KMF A;  3ZJ1 A;  4HFE A;  3AE7 A;  4DMW A;  4E7Z A;  1KNR A;  3JC6 D;  5FMN A;  1J1J A;  2NW7 A;  3PUY F;  2BS2 A;  2CXF A;  3LDQ B;  3MK7 C;  4L0R A;  2WDQ A;  4GOU A;  3J9X 1;  3EHZ A;  3JCF A;  2MAW A;  3SFE A;  4H9R C;  2BZB A;  2NP9 A;  5LNK A;  2IUB A;  4YLH A;  4IL4 A;  1LVK A;  4AFG A;  3IBP A;  4PFP A;  4OK0 A;  4EZH A;  5J5G A;  2UUC T;  5E0O A;  2XUE A;  4ZK4 A;  2KZ7 B;  4H9N C;  3VR8 A;  4LFA T;  4H63 V;  2SPC A;  2YKS A;  5JDG A;  4CXY A;  3GWH A;  3LK3 B;  4O2B E;  3CVR A;  2ZJV A;  5J5I A;  3HKD E;  2V7J A;  2BJ0 A;  4IIJ E;  1ZEE A;  2CLY B;  4BAY B;  2LJL A;  4ZI7 E;  4BA9 A;  2LHR A;  3OJA A;  1YKH B;  2CLY C;  3CPZ A;  3QC9 A;  1HG5 A;  1XWM A;  4H9Q C;  2FJE A;  5HXR A;  5L3B B;  5AQG B;  1HNW T;  2V5D A;  5FY1 A;  2XAG B;  3RX6 A;  3LK4 2;  2IAK A;  3N9L A;  2NOX A;  2LT3 A;  2Z6E A;  4MLK A;  2XZE A;  2XHE B;  1JNZ A;  2XQ4 A;  3SFD A;  5BP0 A;  4YJ3 E;  1UCU A;  2A9U A;  4C90 A;  2WZI A;  2CWY A;  4O4J E;  1SA0 E;  2VKJ A;  5JDL A;  2N1G A;  2V6Y A;  2BR8 A;  2W0G A;  5JDN A;  5C2T A;  4DR5 T;  4DV7 T;  3ANW B;  5BMV E;  1S35 A;  3PUZ F;  5IYZ E;  4UV8 B;  5KDM C;  2Y7Y A;  2V6X A;  3OKQ A;  2A72 A;  2MTQ A;  2CPT A;  1I9B A;  1HTJ F;  5ABE A;  5CO5 A;  3NKZ A;  3KDS E;  4B3S T;  1ZHC A;  2CWO A;  4IDP A;  2XQ9 A;  3FXD B;  3UT5 E;  5SYO A;  2YIN A;  2NW8 A;  3B57 A;  3AE2 A;  3LBX A;  3KIN B;  3ZJ2 A;  4MFR A;  4ISS A;  3AEC A;  2ZJU A;  3H37 A;  2FJB A;  2YU2 A;  3CWZ B;  4I0U A;  5LHI B;  2XNU A;  2KWH A;  3ESL A;  3WTJ A;  3RI5 A;  4UVA B;  3ZMS B;  4NPP A;  4PK5 A;  2ODV A;  2WU2 A;  1HNX T;  1IZN B;  5AQI B;  1VCS A;  1IBK T;  3FB2 A;  3A7M A;  2W66 A;  1T98 A;  4LFB T;  2H7V C;  2BYS A;  4X66 T;  2ZM2 A;  2B1E A;  2YOE A;  4LF7 T;  4IDQ A;  1E2A A;  4DR7 T;  2E2A A;  4AQG A;  4YFS A;  5IUX A;  2YEV C;  1KK7 A;  4NXM T;  1G8X A;  3PUA A;  5ABG A;  3UFE A;  4HWF A;  3ETV A;  1HS7 A;  4GK0 E;  2I6H A;  3VKH A;  2VUR A;  3PV0 F;  3RHW A;  4OYJ A;  4YT0 A;  4H9O C;  4QXC B;  4L9I A;  2LRK A;  4O4I E;  5DQW A;  2V7I A;  3FHN A;  2LKH A;  1VCT A;  2QA7 A;  2LRL A;  2XAJ B;  2JIW A;  5FL0 A;  3JAE A;  3KVB A;  5J5H A;  4KMC A;  4UR9 A;  1WYC A;  2VKO A;  3C79 A;  2WCA A;  4X1Y E;  4KI0 F;  5HEJ A;  2X9H A;  3ZPO A;  2FUP A;  1NEK A;  1WLX A;  2XAS B;  5L3D B;  4X5T A;  2PFV A;  2DHR A;  3FBL A;  3MJX A;  4YSZ A;  3OVU A;  1IBM T;  4U74 A;  4AFH A;  5L4E A;  5HXH A;  3RKG A;  4ILA A;  2BG9 A;  3AE6 A;  4U7Y A;  2FBW A;  4YHH T;  3RF1 A;  4EGW A;  2VVN A;  1D1C A;  1OXZ A;  3N9N A;  2E5V A;  3UQ7 A;  5AQO B;  4CN4 A;  2GK9 A;  4DV0 T;  2HN2 A;  4X65 T;  2V6Y B;  4PW8 A;  2DLR A;  2HPL A;  4QHO A;  4DO0 A;  4QXB B;  3CML A;  1D1A A;  4GKJ T;  5LJN A;  3B5M A;  2RA1 A;  3ZMV B;  1IAP A;  2ZM8 A;  2V7K A;  4LF5 T;  2BYQ A;  5FXZ A;  2IHR 1;  1VRB A;  5FY0 A;  1QUU A;  2KLQ A;  4HFB A;  3H3A A;  2W8F A;  3KBT A;  3LBX B;  4X20 E;  3WIP A;  3MZK B;  2Q9Q A;  2WSS V;  1O3X A;  3C4X A;  5AQL B;  2WNL A;  3T8O A;  2XNT A;  5TVC A;  3TLW A;  2X66 A;  4ZRU A;  2YMD A;  4DID B;  2DNX A;  5KMG P;  4DR6 T;  1T72 A;  4QH4 A;  5L3E B;  1Y64 B;  4M1P A;  2H3R A;  4CZZ B;  1UV6 A;  4NXN T;  2LOP A;  3ZYL A;  2YDR A;  1E1H B;  4LFC T;  5JRE A;  2F4V T;  4ZZB A;  1YQ4 A;  1M7K A;  3AE9 A;  5DQV A;  4ADZ A;  2W62 A;  4LF6 T;  2CMR A;  5FYM A;  4HFD A;  3O1I A;  1LVF A;  1R8I A;  2BKO A;  4NUV A;  2VKH A;  3LG7 A;  4KHZ F;  4X1I E;  2KSR A;  2FJD A;  1D0Y A;  2XM2 A;  3FZL B;  1WFD A;  1FJG T;  4DV3 T;  3RC8 A;  1QSD A;  3TLV A;  3UU8 A;  4YTM A;  4FJO A;  2CEA A;  4Q25 A;  2KXP B;  2WZY A;  3P4P A;  3PUX F;  1US7 B;  2LSJ A;  2KIN B;  3MXZ A;  2OV9 A;  4JYA T;  4IHJ E;  2K24 A;  4OFZ A;  4WW0 A;  2W2U A;  3A8Y C;  4A5X A;  2XAQ B;  3OYZ A;  2WAU A;  3UUM A;  4HFI A;  2WWV A;  1FMV A;  4JI2 T;  2HPJ A;  2JMK A;  1YKE B;  4U2Y A;  2BG9 B;  2QYW A;  2PBI A;  5LB7 B;  3GMI A;  4G63 A;  2W4X A;  2H88 A;  1X9B A;  3TKL B;  1IJ5 A;  1CUN A;  5J0Z A;  5HXC A;  3HR0 A;  3AEB A;  3ZYK A;  2BG9 C;  3PTR B;  2HN1 A;  1OED A;  2V7M A;  1YXR A;  5LXT E;  3ZMU B;  4AIS A;  4B3M T;  2V5C A;  5FKY A;  4ZEY A;  4DUY T;  2KT9 A;  3RLF F;  3RQW A;  2X9W A;  3AAA B;  1J5E T;  4IL9 A;  2DWG A;  2VAS A;  2ODU A;  5C3J A;  1W9R A;  3PUG A;  2I59 A;  3NRX A;  1B7T A;  5AQQ B;  2ZMA A;  3SQ6 A;  3QB5 K;  3RIF A;  4X1K E;  4DV6 T;  2LSK A;  1LRZ A;  3AXJ A;  3O1J A;  3Q5W A;  4EZ4 A;  3UU3 A;  5AFM A;  4X64 T;  4IRE A;  1HR0 T;  4YHJ A;  3NRY A;  4XK9 A;  4ILB A;  5ETW A;  3AE3 A;  3Q5E A;  1CHU A;  2Q9Q B;  2XPK A;  5ABF A;  2W8G A;  5LBQ B;  4JI5 T;  2WU5 A;  4TWH A;  2BS4 A;  3KVA A;  1UX5 A;  2AE9 A;  2CM0 A;  2XQ5 A;  2W63 A;  1M62 A;  1U5P A;  3I9W A;  2BKP A;  4JLE A;  3U8L A;  3ZLI A;  2Q9Q C;  1E7P A;  2EHO A;  2M6I A;  3F2E A;  4AKG A;  2V1D B;  5M4Y A;  1Z0P A;  4HN9 A;  3QNU A;  4YTN A;  3IHR A;  4NUU A;  3NZP A;  1I6Z A;  3RYF E;  5AFJ A;  1AJ3 A;  4JBW F;  1XMQ T;  2VL8 A;  3OYX A;  3ETU A;  3CKD A;  2A3D A;  2WDV A;  3AE1 A;  4HFC A;  5L3F B;  5J5F A;  4UM3 A;  2IW5 B;  3AB3 B;  4ZS3 A;  5F8P A;  4K0U A;  3ZST A;  2XM1 A;  3CX7 B;  5BRX A;  4UIG A;  4IE0 A;  2UXD T;  3AE4 A;  4QH5 A;  3RGL A;  5JTG A;  5LXB A;  2LOS A;  5AQU B;  1HNZ T;  3RKO A;  2J47 A;  3C64 A;  1MND A;  4UVC B;  4HKA A;  5JDF A;  4HTE A;  3BQI A;  2KND A;  1MMD A;  4LML A;  5L47 A;  3EAB A;  3Q5X A;  4IT4 A;  3SIO A;  4HWC A;  4U2Z A;  3AE8 A;  2N2N A;  4NIQ A;  4A98 A;  1NWM X;  2WP9 A;  1HX1 B;  3G06 A;  4LF4 T;  3A5X A;  4IGU A;  1WR6 A;  2C9T A;  3Q9D A;  5AFK A;  2VL0 A;  4D01 A;  2WMN A;  3WTI A;  3ZC1 A;  1UX4 A;  2IDO B;  4UM1 A;  4TWF A;  1LKX A;  4DV5 T;  4DR3 T;  2K5B B;  3SQ9 A;  4DBM A;  1YW0 A;  2OA5 A;  2X0L B;  1MNE A;  4DVD A;  1XNR T;  3C4Z A;  3PUS A;  3AEE A;  4WNK A;  3AE5 A;  5CGM A;  2IC6 A;  2L9Q A;  5AQM B;  3P4Q A;  2NTY A;  2X0Y A;  4UEM A;  3UUN A;  4LF9 T;  4EYU A;  1T7S A;  2UZ6 A;  1N32 T;  5HCJ A;  5FVL A;  2EHO D;  3IEE A;  3K3O A;  3HL6 A;  2Y48 B;  5JR9 A;  5HWX A;  2BG9 E;  4I43 B;  3R84 B;  3NVO A;  1NEN A;  2WWU A;  3UUL A;  2VWA A;  4TZ4 C;  1HF8 A;  2XQY A;  3RYC E;  3WTL A;  1OED B;  4WBN E;  4TV8 E;  5FXV A;  3GN5 A;  5AFU L;  2LSY A;  5L2L A;  1KNZ A;  3CQG B;  5EZY E;  5H6Q B;  4JI1 T;  3HKE E;  2WM9 A;  3X1D A;  5ABH A;  1JNR A;  2QC1 B;  3RIU A;  2NW9 A;  1OED C;  3WAJ A;  3WTN A;  2I0M A;  3P4R A;  3M65 A;  3AXJ B;  4EIW A;  5AFM B;  1BR2 A;  1XNQ T;  3VRA A;  2HH7 A;  3L09 A;  2CHN A;  3CX6 B;  1H7C A;  3IF8 B;  4H9S E;  5ABF B;  2WNC A;  4HFV A;  5KXJ A;  4X62 T;  4JI3 T;  4OYK A;  4B5D A;  2YDS A;  1SHZ C;  3AEG A;  4EB6 E;  2XSA A;  5FP3 A;  2YN6 A;  3PUQ A;  1FEW A;  5AFH A;  3AA6 B;  4AI6 A;  5HXE A;  2EHO B;  4JI4 T;  4TUY E;  3PJA J;  2JPF A;  2YK0 A;  5LGU B;  4XHE A;  2LKG A;  1UW6 A;  1ZKE A;  3CQX C;  1KNP A;  3K8P C;  1KFY A;  4TN7 B;  2VK9 A;  2EHO C;  2MPK A;  3ZMZ B;  3FZM B;  4WYV A;  4ZR6 A;  5F5W A;  1GQE A;  5IWA T;  4ZXL A;  5IHY A;  4KHP T;  3PE0 A;  5HXS A;  3L39 A;  2XY8 B;  3EDU A;  2V26 A;  5LYJ E;  1ZOY A;  2WBL A;  3B13 A;  5AQN B;  3CQC B;  4YY3 T;  5LP6 E;  2XYT A;  4ZJS A;  5CA0 E;  4UM3 P;  3UU5 A;  1V9D A;  3N9P A;  2X9X A;  5KX5 E;  5LJM A;  3OBV E;  5JDM A;  2QGS A;  5AQS B;  4Z90 A;  3NWI A;  3N2O A;  2V8S V;  4JI7 T;  5AIN A;  2J62 A;  4LMK A;  2ES0 A;  4BJN A;  4TV9 E;  2K48 A;  2CXD A;  2Y6X A;  3M3Z B;  2H7O A;  4ZZC A;  1EZ3 A;  4TNW A;  1Z8U A;  4QWN B;  2DWK A;  5AQK B;  2XJ7 A;  4KP3 C;  4XZC A;  4Z8X A;  3VR9 A;  3BK9 A;  2D0U A;  5JH7 E;  1YD8 G;  3UU4 A;  4TWD A;  3O9X A;  1VOM A;  4AXP A;  3UFG A;  2X9Y A;  4ZOL E;  2B76 A;  4PJM A;  3P7I A;  5JRC A;  3SRZ A;  5JDH A;  2UUA T;  5JR9 B;  2D5U A;  3JAF A;  4EED A;  5L3C B;  4HFH A;  3SH1 A;  3V5U A;  5LMU T;  3U8M A;  4EXT A;  2W61 A;  1S94 A;  3T1H T;  1MMA A;  3GN5 B;  5JR9 C;  4QAB A;  2X00 A;  3LSV A;  1OED E;  2G0U A;  3PUV F;  3N5L A;  2UXX B;  2XYS A;  2C5K T;  3ABV A;  2LE8 A;  4ZI2 D;  5EK4 A;  4ERR A;  3ZT7 A;  2LEH A;  4N78 D;  4DR4 T;  4CI1 B;  4JI0 T;  3AA7 B;  3HKB E;  3P50 A;  1IJ6 A;  2RP4 A;  4A56 A;  4NZB A;  3AVR A;  3NZQ A;  2W67 A;  4AKL A;  3EUH A;  3RIU C;  3MAC A;  2E9X A;  4YJ2 E;  3C50 A;  4K0K T;  3F31 A;  2LLY A;  5JQG E;  4QAA A;  2WN9 A;  4O4H E;  3F57 A;  3AVS A;  1BR0 A;  4AQF A;  4FRR A;  3C84 A;  5CA1 E;  4IDO A;  2VVS A;  3WI3 A;  3PJA A;  4FI5 A;  4OX9 T;  2NTX A;  4J2C A;  2XQ8 A;  5A1L A;  1DU2 A;  1N33 T;  4QXH B;  4O2A E;  4F8H A;  4ILU A;  5AQP B;  2PH9 A;  4IE7 A;  4AKH A;  2W00 A;  2X68 A;  4JEU B;  3ZDH A;  5FY7 A;  4ZS2 A;  3PEO A;  2DCF A;  2BDE A;  5TAO A;  3AA1 B;  3VHL A;  4JEH B;  4BQT A;  1OWA A;  4UXN B;  2Q9Q D;  4EEB A;  3RRC A;  5ADX L;  5HEH A;  1IBL T;  4LMJ A;  4KBM B;  2BYN A;  3HI2 A;  5AQF B;  2WDR A;  4H63 H;  4OHF A;  5LHH B;  5AQT B;  2BYP A;  3N9Q A;  2X00 D;  3WTO A;  2CBJ A;  1QLB A;  4ZI2 C;  2VB6 A;  2YDQ A;  2IML A;  3PDY A;  5EK3 A;  3CK6 A;  3N2K E;  2BBJ A;  4CQI A;  3U8N A;  4I55 E;  1HCI A;  5L3G B;  2E9X D;  2WQY A;  2Y8D A;  4KUM B;  5FL1 A;  4PFO A;  3L8R A;  3SS1 A;  4YTP A;  1UK5 A;  3FZH B;  1J5W A;  4DV1 T;  3RIA A;  1XMO T;  3KFW X;  2E5L T;  2XZ6 A;  4WV9 A;  1ZP0 A;  2DI4 A;  2BYR A;  5DAB A;  1G73 A;  4AFT A;  1Y01 A;  4DBR A;  3RYH E;  3U78 A;  3ZCJ A;  2UXN B;  2YME A;  3DP7 A;  5GON E;  5JRC B;  4DMV A;  3ZN0 B;  1HG2 A;  2IIU A;  5FJV A;  4IE4 A;  3WTH A;  2XQ6 A;  1W09 A;  2Y58 A;  4ILC A;  2CE7 A;  4PIR A;  3ZN1 B;  4U3C A;  4O4L E;  4ZJT A;  3RC3 A;  4E7S A;  4QAC A;  4UXU A;  2M6B A;  3AEA A;  5LBM A;  3CX8 B;  1W0A A;  4WBO A;  3PU8 A;  4UEL A;  4B3R T;  3EDV A;  4AIU A;  4MHC A;  4DBQ A;  2PTF A;  3ONL C;  3RH3 A;  1SE7 A;  4F6R C;  1WRD A;  3DJB A;  2E9X B;  2Y57 A;  1BR1 A;  2AXD S;  4YSY A;  4MBQ A;  2XQA A;  4CXW A;  2CHO A;  2MYS A;  3AED A;  3OTO T;  2VQF T;  2RPA A;  2E9X C;  3K3Q C;  3AAI A;  3TLT A;  4I50 E;  4UF0 A;  2NWB A;  3J7Y q;  3R6N A;  1N36 T;  2JQK A;  4U33 A;  5F3J A;  3GA8 A; 
#chains in the Genus database with same CATH homology
 5LG3 A;  2LKH A;  3EAM A;  2VL0 A;  3TLU A;  3WTK A;  5CO5 A;  3TLV A;  4B5D A;  4D01 A;  4ZZC A;  3UU8 A;  3WTI A;  4HFB A;  3WTM A;  3RIA A;  2W8G A;  3P4W A;  2XQ9 A;  2LM2 A;  4TNW A;  2W8F A;  2XQ8 A;  2Y54 A;  3JAE A;  5SYO A;  5KZU A;  4UM1 A;  4TWH A;  2XZ6 A;  4WV9 A;  4TWF A;  5J5H A;  2BYR A;  3WIP A;  2XQ3 A;  3SQ9 A;  2XQ5 A;  2ZJV A;  2YN6 A;  5J5I A;  4AFT A;  3PMZ A;  4DBM A;  4ZK1 A;  2WZY A;  5HEG A;  3C79 A;  5AFH A;  2YME A;  3T4M A;  3UU4 A;  2BJ0 A;  2XZ5 A;  4TWD A;  3UUB A;  4F8H A;  3U8L A;  5HEJ A;  2WNL A;  2PH9 A;  3U8J A;  3TLS A;  2XNV A;  4QH1 A;  2XNT A;  5FJV A;  4HFE A;  2M6I A;  4XHE A;  5TVC A;  2LKG A;  3WTH A;  2XQ6 A;  5L4H A;  3TLW A;  1UW6 A;  2UZ6 A;  4ZRU A;  2ZJU A;  2YMD A;  3ZDH A;  1UX2 A;  2Y58 A;  3UU6 A;  5HCJ A;  4X5T A;  4ILC A;  3JAF A;  4PIR A;  2XNU A;  4HFI A;  3PEO A;  4UY2 A;  4HFH A;  4ZJT A;  3SH1 A;  3ZKR A;  5AFJ A;  5KE4 A;  4QH4 A;  3WTJ A;  4BQT A;  3UQ4 A;  4AFH A;  3RI5 A;  4QAC A;  4UXU A;  2M6B A;  2BG9 E;  5L4E A;  3U8M A;  4UM3 S;  4ZR6 A;  2BG9 B;  3RQU A;  4NPP A;  2PGZ A;  4HFC A;  5HEH A;  3EHZ A;  4ILA A;  4LMJ A;  2BYN A;  5J5F A;  2BG9 A;  5HCM A;  4UM3 A;  1UV6 A;  4QAB A;  2X00 A;  4ALX A;  3LSV A;  5AFN A;  3WTL A;  1OED E;  4A97 A;  2MAW A;  5J0Z A;  1OED B;  5JME A;  2XYS A;  2BYP A;  5BW2 A;  3WTO A;  2X00 D;  4EZ1 A;  2BYS A;  4Z91 A;  5BRX A;  2BG9 C;  4HQP A;  2XQ4 A;  2YOE A;  2Y56 A;  4QH5 A;  5CFB A;  2QC1 B;  3ZDG A;  1OED A;  3GUA A;  3UQ7 A;  5BP0 A;  4IL4 A;  4AFG A;  5LXB A;  4ZZB A;  2XYT A;  5IUX A;  3IGQ A;  4ZJS A;  3U8K A;  3RQW A;  2Y57 A;  4UM3 P;  3P50 A;  1OED C;  4NZB A;  3UU5 A;  5J5G A;  4IL9 A;  2BR7 A;  5AFL A;  3U8N A;  3WTN A;  2BR8 A;  4HFD A;  4BFQ A;  2XQA A;  5L47 A;  4LML A;  5HEO A;  4ZK4 A;  2LLY A;  3SQ6 A;  5AFM B;  4QAA A;  3SIO A;  3RIF A;  2WN9 A;  5HEU A;  4Z90 A;  4A98 A;  3EI0 A;  3TLT A;  3RHW A;  2XQ7 A;  3UU3 A;  5AFM A;  2Y7Y A;  2KSR A;  5AIN A;  4LMK A;  4IRE A;  4FRR A;  2YKS A;  3JAD A;  3C84 A;  4TNV A;  2WNC A;  1I9B A;  2C9T A;  4COF A;  4ILB A;  4XK9 A;  2WNJ A;  5AFK A;  2BYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...