2XQ6A

Pentameric ligand gated ion channel glic in complex with cesium ion (cs+)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein
molecule keywords GLR4197 PROTEIN
total genus 73
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq6A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq6A01
5AFHA 2Y7YA 3EAMA 2PGZA 3JAEA 3SH1A 5TVCA 2XQ3A 2UZ6A 1OEDE 2M6IA 3UUBA 3GUAA 4ZR6A 2C9TA 4ZZBA 2MAWA 3UU4A 4AFTA 3WIPA 2BJ0A 2KSRA 5AFKA 4XHEA 2YN6A 2XYTA 5KE4A 3P4WA 2BYRA 4HFIA 2BR7A 2XQAA 1UX2A 5LXBA 3SQ9A 3TLWA 4BFQA 5JMEA 5SYOA 3TLVA 4IREA 5HEUA 2XZ5A 4QACA 2XNVA 4DBMA 4TWHA 2X00D 3WTNA 5BRXA 5J5HA 4IL4A 2XZ6A 4IL9A 3T4MA 5J5FA 3EHZA 4F8HA 2BYSA 2X00A 4Z90A 5AFNA 2QC1B 4LMJA 5KZUA 4LMKA 3SIOA 2M6BA 5AINA 4ILBA 2BG9B 2LM2A 4UM3S 4ILCA 5LG3A 4HFDA 3U8KA 3SQ6A 5HCMA 3RIFA 4D01A 1OEDA 4EZ1A 4ZRUA 4PIRA 5IUXA 3RI5A 5J5IA 2Y58A 3P50A 3UQ7A 2XQ9A 2VL0A 4HFEA 4UM3A 5AFJA 4X5TA 5HEOA 4UM1A 5FJVA 3WTMA 4AFHA 3U8JA 3UQ4A 1OEDB 3JAFA 2YKSA 4HFCA 2BG9C 3TLSA 4TWFA 4FRRA 2XQ5A 4QAAA 3PEOA 3ZKRA 2YMEA 4ZJSA 3WTHA 3WTJA 4QABA 3C84A 2LKHA 4AFGA 4LMLA 2BYNA 2YOEA 5HEJA 2Y57A 3U8MA 5CFBA 4HQPA 4BQTA 3WTIA 4ZK4A 4XK9A 2XQ7A 2WN9A 2BR8A 4Z91A 1OEDC 4QH1A 4A98A 4NPPA 2WNJA 4TWDA 3RQUA 2Y54A 2ZJUA 2XQ6A 2BG9E 5L47A 4HFHA 3UU8A 2WNCA 3IGQA 2BYQA 5CO5A 4ILAA 2BG9A 2LLYA 5HEHA 3JADA 3RQWA 4COFA 2XQ4A 3ZDHA 3EI0A 5L4EA 3RHWA 2XNTA 3WTLA 5BP0A 4UXUA 4UY2A 4ALXA 2ZJVA 3RIAA 2XNUA 4ZZCA 5J5GA 3WTKA 4ZK1A 1I9BA 1UV6A 3U8NA 2BYPA 3C79A 3ZDGA 5BW2A 2XQ8A 3PMZA 5AFMA 4HFBA 5HEGA 5HCJA 2XYSA 5AFLA 2W8GA 4UM3P 2YMDA 3TLTA 3TLUA 1UW6A 2PH9A 4ZJTA 2WNLA 4QH4A 3LSVA 2WZYA 4A97A 4TNVA 5AFMB 4WV9A 5J0ZA 5L4HA 3UU6A 3U8LA 4B5DA 2LKGA 4TNWA 4NZBA 2W8FA 3WTOA 4QH5A 3UU5A 3UU3A 2Y56A
chains in the Genus database with same CATH superfamily
2CWYA 2UXCT 3SH1A 4HN9A 3RRCA 2XUEA 3OJAA 2E9XA 2MPKA 3I0OA 4HFIA 2BKNA 4G63A 2VQFT 5AQGB 3TLVA 2PBIA 2V5CA 2WDRA 2AXDS 3OBVE 1VCTA 4JI7T 1T98A 5KXJA 4OK0A 2WDQA 1CHUA 2KZ7B 3K8PC 3A8YC 3CX8B 5LHHB 3C4WA 2ODVA 2JQKA 3P4RA 2WB5A 5HEOA 3NZPA 4ANJA 3C98B 2ZM8A 5FP3A 1Z8UA 5LGTB 3QNUA 3I0QA 3AE5A 3ESLA 2C5KT 2Y54A 4EZ4A 2XQ6A 4EYYR 3QC9A 3ZMTB 2JMHA 2AE9A 2QGSA 3IGQA 4EIWA 1S94A 3ZC0A 2B76A 2ZJVA 5J5GA 2KMFA 4DR2T 2RPAA 2WQYA 3RYHE 2XQ8A 3BQIA 5AFMA 3GN5A 4ZJTA 5J2UE 3U8LA 4AQFC 2LKGA 4GYRA 1HNWT 4HE8A 3LG7A 4QH5A 3GWHA 4NUVA 5A1LA 2C5IT 3UUBA 2C5JA 1IBKT 3RLFF 1UURA 2H3RA 3SQ9A 2M67A 5FXVA 4YFSA 3UUMA 2IIUA 3P7IA 5EZYE 5FY0A 3RKOA 4DBRA 4U31A 3J7Yq 3ZMUB 2EHOA 4I50E 5LBMA 4Z90A 4OX9T 3ZT7A 2LM2A 3UFGA 2X9YA 3U8KA 3H3MA 2LSIA 2KINB 3AEDA 3AVSA 3WTMA 4TUYE 2LRKA 3C4ZA 5ABFA 4P0BA 2Q9QB 1D1BA 4MALA 3LFMA 3B5MA 3U8MA 4JI5T 2XSBA 5JTGA 2BR8A 1KFYA 3P8CD 1IBLT 3RIUA 4H9NC 4BA9A 1HFAA 4G2AA 3QOFA 5LHGB 3WI3A 3ZDHA 2C0SA 1SHZC 5LHIB 1XDPA 2HHHT 3QUJA 1YQ4A 1WFDA 3NZQA 4IE4A 5FL1A 3K1SA 5AQPB 3DJBA 1WYCA 5KMGP 3CQCB 1E2AA 5DQVA 2Z6EA 1BR0A 3RYIE 5AQLB 2XM2A 4YTPA 3CK6A 2DWKA 2I59A 4E7ZA 1W0AA 3JAEA 3GMIA 2E5VA 4H9SE 2GK9A 1VCSA 4DV3T 2BS3A 3HKEE 5HXSA 5IWAT 3Q9DA 1R8IA 2DI4A 4QX7B 4LF7T 3ZMVB 1DU2A 5AQSB 4LFAT 3CKDA 3SIOA 5AINA 3D0TA 5JDGA 5C2TA 1YQ3A 3FBZA 1MMAA 2LOPA 5JDNA 2F4VT 2MBGA 4ZI7E 2XQ9A 3KV6A 2LSGA 3NRXA 3ETVA 3VR8A 2X9XA 3U8JA 2DLRA 4TWFA 2XQ5A 4LF8T 2V8SV 2XZEA 4CI1B 4WW0A 3CMLA 2J1DG 4WYVA 5HEJA 3AAEB 4BQTA 3P4SA 3SS1A 1VRBA 2RA1A 4Z91A 1XNQT 2WWVA 5C3JA 2D2SA 3KVBA 3M65A 3ZJ1A 2BG9A 3JADA 3JCFA 3RF1A 2OV9A 3PTRB 4PAGA 2CHNA 4CI2B 1I9BA 2CBJA 5AQMB 4KHPT 2IMLA 5HCJA 4C90A 3AE4A 3SOLA 4EZHA 3ZN0B 2W00A 3M3ZB 5LOVE 2CXFA 2D9DA 1OEDE 2M6IA 1XMQT 5HAXA 5KE4A 2D0TA 5LXBA 4UVAB 2JQHA 4B3TT 1HNZT 4IE5A 3IBPA 4MHCA 2X51A 4LMJA 1X79A 4LMKA 4EB6E 2IC9A 1KF6A 4EZ1A 3PJAA 2VASA 5HWYA 2V7JA 2BKPA 5J5IA 3V5SA 5IHYA 4O8SA 3AAIA 3AA0B 3AE7A 3U78A 1N33T 1W0BA 3PU8A 4JI3T 2XQ7A 3N2OA 1QSDA 5AQNB 5FVKA 5M4YA 2IC6A 3RQUA 4PJNA 4HFHA 3RRWA 2V6YA 1I94T 3U3IA 2XQ4A 4PFOA 5AQOB 3PUQA 3RHWA 1ZEEA 2YEVC 4U74A 4X1YE 4MBQA 3CWZB 3O4XE 4XAXB 2FJBA 2I6HA 4EEBA 2W8GA 3CQXC 4YHHT 3ZYLA 2D0UA 4B5DA 4EXTA 2WS3A 4HKAA 3VKGA 3ANWB 3P4PA 2XQ3A 3AE3A 2VKDA 3NBXX 4HEAA 4A5XA 2FBWA 4OHFA 4PFPA 2BJ0A 2KSRA 5KX5E 4YTMA 3R6NA 2VKOA 3RPUA 2VQET 4UR9A 2B1EA 4X64T 4UVBB 4IGUA 2DHRA 2BVMA 1Y64B 5JDLA 2H7OA 3AXJA 1N36T 1OXZA 2V7LA 4HFDA 4D01A 3PJAJ 5E0OA 3RI5A 4CN6A 3ZN1B 4DMWA 2CM0A 2NTYA 3K3QC 5HWXA 5JRCA 3V5UA 2XHEB 1XNRT 2A2FX 3PURA 4QX8B 4PK5A 4ISTA 3PE0A 5F8PA 2WN9A 1OEDC 4JI0T 2H7VC 2ZM6T 3ABVA 2LSYA 1HNXT 4ZHQE 3HKBE 3RKGA 4CZZB 4EEDA 2H89A 3QB5A 2LLYA 1MMDA 1WR0A 5EK4A 4U72A 5FMNA 1HX8A 4DR3T 3I9WA 3BQLA 4CN4A 2VKHA 3KV9A 4ZI3C 5LGUB 4E7SA 3PUGA 3TLTA 5FKYA 3ZT6A 3B57A 4IDPA 3UU3A 5AFHA 4GYSA 3HKDE 5FXWA 1I6ZA 5AQFB 2UUAT 4DO0A 2X67A 2MTQA 2QYWA 4GKJT 2UXDT 4K0KT 4DUZT 5IYZE 3IF8B 2VVSA 4YLHA 2WBLA 4DV0T 1M62A 2CWOA 3GA8A 4YSZA 4AXPA 2CE7A 5L3CB 3W15B 3AE9A 4IHJE 2E9XD 2J47A 4PJMA 4U2YA 2Y58A 4U3CA 4X65T 3OPCA 3PUYF 3CQGB 3HKCE 3FZLB 4DV4T 5LJNA 2Y57A 1UX5A 2LSJA 2XAFB 3EDVA 1YKHB 2W62A 3FZHB 5LGNB 4LF6T 2E9XC 2A9UA 3BK9A 2YINA 4A98A 2ZJUA 2BG9E 3SWHA 4JI4T 2E9XB 4YSYA 5JR9C 3L09A 5FL0A 1W09A 3ZYKA 1ZP0A 3EI0A 4DV5T 3OVUA 2X68A 2XNUA 2WP9A 3ZMSB 3MACA 1UW6A 3T8OA 3ZLIA 3BQKA 5J0ZA 5FY1A 3UU6A 3ZEFB 4TNWA 1NAFA 4M1PA 4WNKA 2XY8B 3AA6B 4NIQA 2WY2A 2JRKA 2WZHA 2LRLA 4L5GA 3RGLA 4MFRA 3OYXA 1UX2A 4UV8B 2L9QA 3FBLA 2NTXA 3MA9A 1VOMA 3WTNA 4HWCA 4I55E 4LF9T 2BYSA 4JV5T 3K3OA 2LOSA 2IHR1 1D1AA 2ACZA 3AEBA 5LMUT 2V7IA 4IT4A 1UCUA 2PJQA 4YY3T 2VL0A 1MNEA 5JQGE 2V7MA 2BKOA 3JAFA 4HTEA 3A7MA 2BG9C 3AA7B 4ZS2A 5JDHA 2EHOD 2X9WA 3C84A 2MOZA 4UVCB 2NR4A 1HS7A 2E2AA 4XK9A 2IW5B 1GQEA 4MLKA 3TKLB 2WNJA 4KHZF 1ZHCA 1S35A 2ZM2A 4ILAA 3N2KE 4Q25A 2XNTA 2XAQB 2UXXB 4JEHB 3KFWX 2QRXA 2OA5A 1UV6A 5BW2A 2BYPA 3C79A 3Q5XA 3F2EA 2P9BA 4QH4A 4TNVA 4ASKA 2KT9A 3K3NA 2VKJA 5EK2A 3ONXA 3EAMA 2BS4A 4GK0E 3AECA 2DL1A 4HGAA 3KV4A 3AEGA 1Z0PA 3ZSTA 4DR6T 3I1AA 3E08A 2YN6A 4ZI2C 4ZEYA 2XQAA 3ZT5A 5JMEA 1L0VA 2NW7A 3O1JA 5CA1E 4DR7T 3O9XA 3VKHA 5F3JA 5J5HA 1KNZA 2K24A 3EDUA 3ZPOA 4I0UA 3RIFA 1ZV4X 2XJ7A 2BDEA 4YJ3E 2RP4A 3N9NA 2CMRA 2XAHB 4JEUB 4KX6A 1WR6A 4P09A 1V9DA 5CB4E 3WAJA 4B3ST 4BJNA 3C51A 5L3DB 4AFGA 3KINB 2EHOB 2QA7A 3E22E 3VRAA 4Z8XA 2JQQA 1KEYA 3C64A 3L3PA 1D0YA 4OYKA 3B13A 2L8KA 2XQYA 2WDVA 2W61A 1UK5A 5JREA 3AXJB 2Y48B 1FMVA 3LBXB 5BP0A 3AB3B 1HG5A 2NP9A 4UY2A 3ANWA 3UFEA 3RIAA 4ZK1A 2K5BB 4P0AA 4HFVA 3TLUA 2UXBT 3GN5B 3UTKA 2KXPB 2LSKA 5H6RB 3GUAA 4ZZBA 5AFKA 2XPKA 3PUAA 4H9RC 1FMWA 2WMOA 3EUHA 4QACA 2XM1A 2HPLA 4KUMB 5EK3A 4TWHA 5BRXA 3T4MA 1LRZA 3O1HA 3S4UA 2VL8A 4GOUA 4DR4T 4AISA 1OEDA 5AQIB 1JNZA 4LFBT 2FJDA 2LM9A 4XBFB 2ZM0A 1BR2A 3ZCIA 5LB7B 3RIUC 3CX6B 3FHNA 4LMLA 2KNDA 2JMKA 3MJXA 5AQTB 5HXRA 5HXHA 2WU5A 2X66A 1WCRA 5CGMA 4KBMB 5AQHB 2N2NA 1HTJF 2NOXA 5L3GB 5L4EA 2VB6A 3PDYA 1SE7A 4X1KE 2Q9QD 4ERRA 4AQYT 2WU2A 2JPFA 1UUSA 4UM3P 4YSXA 2OLTA 1W9RA 4EV6A 4DBQA 4QXCB 4NZBA 3UU5A 3VHLA 4DV1T 4JI1T 2V6XA 5BMVE 3WIPA 3QK6A 3P4WA 4GIWA 2BR7A 4UV9B 3TLWA 1US7B 4PJLA 5H6QB 2CLYB 4DBMA 2YDSA 3X1DA 3EVYA 5AFNA 2VWAA 5LG3A 5JDQA 2LT3A 4H63H 3H37A 4AKHA 1B7TA 4X20E 4X5TA 5JH7E 3CVRA 5KDMC 2IDOB 4QABA 2SPCA 1KK7A 3PUVF 3N9OA 4IE0A 3WTIA 4ZK4A 2G0UA 3MZKB 3Q5WA 4DV2T 4QH1A 2ES0A 5JR9B 1T7SA 5AFUL 1IJ6A 1HF8A 5JR9A 5CO5A 4ADZA 1KNRA 5AQRB 3T1HT 4HWDA 1FJGT 1UGOA 2J62A 4UIGA 4EAHA 5ABGA 4HFBA 2K3WA 2X0LB 5LJMA 2BS2A 3MXZA 3SFEA 1HCIA 2E5LT 5JVDE 1LVFA 4AKIA 1IJ5A 2YDRA 2JIWA 3UU4A 3EABA 2Y8DA 5BR8T 1UX4A 2BYRA 5FVLA 4BFQA 2V5DA 2NWBA 2CPTA 4CXYA 1LKXA 4EOZB 1N32T 2X00A 2V1DB 3UT5E 4ILUA 4YJ2E 2HH7A 5FXZA 1G73A 2Q9QC 3MK7C 2LHRA 3NRYA 2J4GA 5AQVB 2KWHA 5LP6E 3UQ4A 3DP7A 4FRRA 3CIRA 2WM9A 5F5WA 4QAAA 4ZI2D 2DCFA 3ZKRA 3WTHA 1D0ZA 5ABFB 5LCYA 4UF0A 4U7IA 1Y01A 2YOEA 4AIUA 1BR4A 3ZMZB 3NVOA 4ZS3A 3N9PA 4IE7A 4ZXLA 5HYAA 2UUBT 3AE2A 3ZYMA 4ZZCA 3LBXA 1QUUA 3E0ZA 4QXHB 2KWIB 1N34T 3ETUA 2W63A 4PK4A 5AFMB 3PUWF 5LA6E 2MYSA 3SFDA 5LMNT 3WTOA 5CJ5A 2HN1A 2PG8A 2Y56A 2PGZA 2XAGB 4TZ4C 4XZCA 5JRCB 3PV0F 3HI2A 4AKLA 3KBUA 3FZFB 5HEUA 5JDMA 2HN2A 5LBQB 1G8XA 3ONLC 1MIVA 2XZ6A 3ZCJA 4UF0B 5FY7A 4B3MT 4DUYT 3SQ6A 3NKZA 3P4QA 3F31A 2VVNA 1BR1A 5AQUB 4DMVA 3RC8A 2A72A 3H3AA 3PUXF 3UQ7A 1NEKA 4X62T 3KVAA 3UULA 2CCQA 4WBNE 2EHOC 3ZSSA 2K9AA 4ZOLE 4ZJSA 3WTJA 1MMNA 1CUNA 1EZ3A 4LF4T 4IDQA 4UEMA 2CA5A 5AQKB 1J5WA 1YD8G 3JC6C 1XZYA 3AA1B 3FZKB 4H9PC 3RYCE 5AQJB 2QVAA 3WTLA 2JJ9A 4O2BE 3A5XA 3OKQA 2NW9A 2NW8A 4JUYA 3I9YA 3AEEA 4UXNB 3R84B 2CXLA 2WZIA 2YU2A 5ABEA 1OWAA 3C50A 3LK3B 2WZYA 3OYZA 4I43B 4IE6A 3FXEB 4UM3S 3LK2B 4HWFA 2W4XA 4DVDA 3WAKA 4KMCA 4ZR6A 2W2UA 4IDZA 4ISSA 3C4XA 4AFTA 2LE8A 2XYTA 4DV7T 4GKKT 4LFCT 2XZ5A 2XASB 2BZBA 3NWIA 3RC3A 4IL9A 3EHZA 4F8HA 2QC1B 2PTFA 5KZUA 4ILBA 3FZMB 3CPZA 3ZJ2A 4H9QC 4AKGA 4PW8A 3PUSA 4B6XA 4CXWA 3HA4A 2N1GA 4YTNA 4GK5E 2LJLA 5AFJA 4UM1A 4DIDB 2DNXA 2WWUA 1M7KA 1ZKEA 2YKSA 4CXXA 3RH3A 2R6GF 2D5UA 3VR9A 4F6RC 2W67A 3ONJA 5CFBA 1YXRA 1LVKA 4DNDA 2V6YB 4AQFA 2BVLA 2XTLA 4WZXA 3MKDA 2BBJA 3N9LA 4A56A 1MNDA 5C8YE 3N9MA 1ZOYA 1O3XA 2UXNB 2ZMAA 3IA3A 4UELA 2FJEA 4K0UA 3PMZA 2YU1A 5HXCA 4QXBB 3KBTA 1WRDA 4O4JE 2XAJB 1QLBA 4NXMT 2Y7YA 1SA0E 2UZ6A 5TAOA 3AEFA 3HL6A 2FJAA 1WYBA 1MMGA 2H88A 5SYOA 4IREA 4CN1A 4JI8T 5L3BB 5FNVE 1HR0T 5FXXA 2CRBA 5J1GA 3ZC1A 3AEAA 5J5FA 5ETWA 2WAUA 3FB2A 3CX7B 1SUMB 4B3RT 5FYMA 1AJ3A 4ZRUA 4PIRA 4UM3A 4NXNT 1OEDB 4P1NA 4HFCA 5ABHA 2X9HA 4J2CA 2W0GA 2YMEA 3RX6A 4TX5A 2LKHA 4H63V 2Y6XA 2WCAA 4O4HE 2CBIA 5DABA 2IAKA 5AQQB 3T1YT 1T72A 4FI5A 4U33A 3VU7H 4QWNB 3J9X1 1XWMA 3O1IA 3KDSE 1FEWA 3UU8A 1MIYA 3RQWA 2DWGA 3UUNA 1HG2A 2W66A 1D1CA 4UXUA 4ALXA 2X0YA 3WTKA 1T8BA 1KNPA 2LHNA 1IAPA 5L2LA 5J2TE 4IDOA 4EGWA 4A97A 4KP3C 4X66T 1E1HB 1YKEB 4AQGA 3Q2MA 2VK9A 4U2ZA 4O4LE 5TVCA 2CLYC 2YDQA 3OTOT 5LG4A 2C9TA 2Q9QA 1D0XA 2A3DA 4JI2T 2K48A 4OYJA 5DQWA 2BBHA 2HPJA 4I4TE 4U7YA 2X00D 4PNIA 1MIWA 3FXDB 1H7CA 4YXDA 4DR5T 5LYJE 1J5ET 4ILCA 4HWHA 4TV8E 4BAYB 5HCMA 4TN7B 2UU9T 3RYFE 2CEAA 5IUXA 2E8IA 1X9BA 4TV9E 4ZI3D 3P50A 1WLXA 4HFEA 4QKNA 5FJVA 4N78D 1NWMX 3AE1A 4AFHA 3TLSA 1XDOA 3QB5K 2UUCT 1NENA 4JI6T 2PFVA 5JDFA 3SRZA 3PEOA 3AAAB 5LNKA 5GONE 4QHOA 4V1Av 4AI6A 3IEEA 3PU3A 4NPPA 4TWDA 1IBMT 2WSSV 3PUZF 1E7PA 2BYQA 5HEHA 2XSAA 3JC6D 4COFA 3UUXB 3Q5DA 2I0MA 3DTOA 2JQ9A 3LDQB 2XYSA 2ODUA 2YMDA 2X0HA 2ZLYA 3AVRA 3LSVA 4KI0F 3VRBA 5HXEA 3N5LA 5L4HA 2KLQA 3AE6A 2YK0A 2FUPA 2L3LA 4YT0A 2CHOA 1U4QA 4L9IA 2MAWA 5LXTE 4XHEA 3KV5A 2ACXA 5DJQC 2VURA 4IDNA 4FJOA 4H9OC 2XNVA 4BJMA 4IL4A 4X1IE 4C91A 1JNRA 2IUBA 1FIOA 2M6BA 2BG9B 4EYUA 3L39A 2V7KA 4YHJA 2N9DA 3LJCA 4JBWF 2CXDA 5L3FB 3LK42 4PJJA 1J1JA 4IIJE 4JLEA 4L0RA 4AKRB 1YW0A 4CQIA 3IHRA 1XMOT 4DR1T 3Q5EA 1U5PA 2BYNA 1IZNB 4HQPA 4HWIB 4CI3B 5ADXL 3F57A 4OFZA 2LEHA 3HR0A 2V26A 5L47A 2WNCA 3G06A 5CA0E 3AE8A 4NUUA 3L8RA 4LF5T 3N2GE 1HX1B 3U8NA 3ZDGA 4DV6T 2WMNA 5HEGA 4PK6A 5AFLA 4WBOA 2PH9A 4JYAT 4WV9A 5L3EB 4O2AE 3N9QA 2W8FA 2WNLA 4O4IE
chains in the Genus database with same CATH topology
5AFHA 2Y7YA 3EAMA 2PGZA 3JAEA 3SH1A 5TVCA 2XQ3A 2UZ6A 1OEDE 2M6IA 3UUBA 3GUAA 4ZR6A 2C9TA 4ZZBA 2MAWA 3UU4A 4AFTA 3WIPA 2BJ0A 2KSRA 5AFKA 4XHEA 2YN6A 2XYTA 5KE4A 3P4WA 2BYRA 4HFIA 2BR7A 2XQAA 1UX2A 5LXBA 3SQ9A 3TLWA 4BFQA 5JMEA 5SYOA 3TLVA 4IREA 5HEUA 2XZ5A 4QACA 2XNVA 4DBMA 4TWHA 2X00D 3WTNA 5BRXA 5J5HA 4IL4A 2XZ6A 4IL9A 3T4MA 5J5FA 3EHZA 4F8HA 2BYSA 2X00A 4Z90A 5AFNA 2QC1B 4LMJA 5KZUA 4LMKA 3SIOA 2M6BA 5AINA 4ILBA 2BG9B 2LM2A 4UM3S 4ILCA 5LG3A 4HFDA 3U8KA 3SQ6A 5HCMA 3RIFA 4D01A 1OEDA 4EZ1A 4ZRUA 4PIRA 5IUXA 3RI5A 5J5IA 2Y58A 3P50A 3UQ7A 2XQ9A 2VL0A 4HFEA 4UM3A 5AFJA 4X5TA 5HEOA 4UM1A 5FJVA 3WTMA 4AFHA 3U8JA 3UQ4A 1OEDB 3JAFA 2YKSA 4HFCA 2BG9C 3TLSA 4TWFA 4FRRA 2XQ5A 4QAAA 3PEOA 3ZKRA 2YMEA 4ZJSA 3WTHA 3WTJA 4QABA 3C84A 2LKHA 4AFGA 4LMLA 2BYNA 2YOEA 5HEJA 2Y57A 3U8MA 5CFBA 4HQPA 4BQTA 3WTIA 4ZK4A 4XK9A 2XQ7A 2WN9A 2BR8A 4Z91A 1OEDC 4QH1A 4A98A 4NPPA 2WNJA 4TWDA 3RQUA 2Y54A 2ZJUA 2XQ6A 2BG9E 5L47A 4HFHA 3UU8A 2WNCA 3IGQA 2BYQA 5CO5A 4ILAA 2BG9A 2LLYA 5HEHA 3JADA 3RQWA 4COFA 2XQ4A 3ZDHA 3EI0A 5L4EA 3RHWA 2XNTA 3WTLA 5BP0A 4UXUA 4UY2A 4ALXA 2ZJVA 3RIAA 2XNUA 4ZZCA 5J5GA 3WTKA 4ZK1A 1I9BA 1UV6A 3U8NA 2BYPA 3C79A 3ZDGA 5BW2A 2XQ8A 3PMZA 5AFMA 4HFBA 5HEGA 5HCJA 2XYSA 5AFLA 2W8GA 4UM3P 2YMDA 3TLTA 3TLUA 1UW6A 2PH9A 4ZJTA 2WNLA 4QH4A 3LSVA 2WZYA 4A97A 4TNVA 5AFMB 4WV9A 5J0ZA 5L4HA 3UU6A 3U8LA 4B5DA 2LKGA 4TNWA 4NZBA 2W8FA 3WTOA 4QH5A 3UU5A 3UU3A 2Y56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AFH A;  2Y7Y A;  3EAM A;  2PGZ A;  3JAE A;  3SH1 A;  5TVC A;  2XQ3 A;  2UZ6 A;  1OED E;  2M6I A;  3UUB A;  3GUA A;  4ZR6 A;  2C9T A;  4ZZB A;  2MAW A;  3UU4 A;  4AFT A;  3WIP A;  2BJ0 A;  2KSR A;  5AFK A;  4XHE A;  2YN6 A;  2XYT A;  5KE4 A;  3P4W A;  2BYR A;  4HFI A;  2BR7 A;  2XQA A;  1UX2 A;  5LXB A;  3SQ9 A;  3TLW A;  4BFQ A;  5JME A;  5SYO A;  3TLV A;  4IRE A;  5HEU A;  2XZ5 A;  4QAC A;  2XNV A;  4DBM A;  4TWH A;  2X00 D;  3WTN A;  5BRX A;  5J5H A;  4IL4 A;  2XZ6 A;  4IL9 A;  3T4M A;  5J5F A;  3EHZ A;  4F8H A;  2BYS A;  2X00 A;  4Z90 A;  5AFN A;  2QC1 B;  4LMJ A;  5KZU A;  4LMK A;  3SIO A;  2M6B A;  5AIN A;  4ILB A;  2BG9 B;  2LM2 A;  4UM3 S;  4ILC A;  5LG3 A;  4HFD A;  3U8K A;  3SQ6 A;  5HCM A;  3RIF A;  4D01 A;  1OED A;  4EZ1 A;  4ZRU A;  4PIR A;  5IUX A;  3RI5 A;  5J5I A;  2Y58 A;  3P50 A;  3UQ7 A;  2XQ9 A;  2VL0 A;  4HFE A;  4UM3 A;  5AFJ A;  4X5T A;  5HEO A;  4UM1 A;  5FJV A;  3WTM A;  4AFH A;  3U8J A;  3UQ4 A;  1OED B;  3JAF A;  2YKS A;  4HFC A;  2BG9 C;  3TLS A;  4TWF A;  4FRR A;  2XQ5 A;  4QAA A;  3PEO A;  3ZKR A;  2YME A;  4ZJS A;  3WTH A;  3WTJ A;  4QAB A;  3C84 A;  2LKH A;  4AFG A;  4LML A;  2BYN A;  2YOE A;  5HEJ A;  2Y57 A;  3U8M A;  5CFB A;  4HQP A;  4BQT A;  3WTI A;  4ZK4 A;  4XK9 A;  2XQ7 A;  2WN9 A;  2BR8 A;  4Z91 A;  1OED C;  4QH1 A;  4A98 A;  4NPP A;  2WNJ A;  4TWD A;  3RQU A;  2Y54 A;  2ZJU A;  2XQ6 A;  2BG9 E;  5L47 A;  4HFH A;  3UU8 A;  2WNC A;  3IGQ A;  2BYQ A;  5CO5 A;  4ILA A;  2BG9 A;  2LLY A;  5HEH A;  3JAD A;  3RQW A;  4COF A;  2XQ4 A;  3ZDH A;  3EI0 A;  5L4E A;  3RHW A;  2XNT A;  3WTL A;  5BP0 A;  4UXU A;  4UY2 A;  4ALX A;  2ZJV A;  3RIA A;  2XNU A;  4ZZC A;  5J5G A;  3WTK A;  4ZK1 A;  1I9B A;  1UV6 A;  3U8N A;  2BYP A;  3C79 A;  3ZDG A;  5BW2 A;  2XQ8 A;  3PMZ A;  5AFM A;  4HFB A;  5HEG A;  5HCJ A;  2XYS A;  5AFL A;  2W8G A;  4UM3 P;  2YMD A;  3TLT A;  3TLU A;  1UW6 A;  2PH9 A;  4ZJT A;  2WNL A;  4QH4 A;  3LSV A;  2WZY A;  4A97 A;  4TNV A;  5AFM B;  4WV9 A;  5J0Z A;  5L4H A;  3UU6 A;  3U8L A;  4B5D A;  2LKG A;  4TNW A;  4NZB A;  2W8F A;  3WTO A;  4QH5 A;  3UU5 A;  3UU3 A;  2Y56 A; 
#chains in the Genus database with same CATH topology
 2CWY A;  2UXC T;  3SH1 A;  4HN9 A;  3RRC A;  2XUE A;  3OJA A;  2E9X A;  2MPK A;  3I0O A;  4HFI A;  2BKN A;  4G63 A;  2VQF T;  5AQG B;  3TLV A;  2PBI A;  2V5C A;  2WDR A;  2AXD S;  3OBV E;  1VCT A;  4JI7 T;  1T98 A;  5KXJ A;  4OK0 A;  2WDQ A;  1CHU A;  2KZ7 B;  3K8P C;  3A8Y C;  3CX8 B;  5LHH B;  3C4W A;  2ODV A;  2JQK A;  3P4R A;  2WB5 A;  5HEO A;  3NZP A;  4ANJ A;  3C98 B;  2ZM8 A;  5FP3 A;  1Z8U A;  5LGT B;  3QNU A;  3I0Q A;  3AE5 A;  3ESL A;  2C5K T;  2Y54 A;  4EZ4 A;  2XQ6 A;  4EYY R;  3QC9 A;  3ZMT B;  2JMH A;  2AE9 A;  2QGS A;  3IGQ A;  4EIW A;  1S94 A;  3ZC0 A;  2B76 A;  2ZJV A;  5J5G A;  2KMF A;  4DR2 T;  2RPA A;  2WQY A;  3RYH E;  2XQ8 A;  3BQI A;  5AFM A;  3GN5 A;  4ZJT A;  5J2U E;  3U8L A;  4AQF C;  2LKG A;  4GYR A;  1HNW T;  4HE8 A;  3LG7 A;  4QH5 A;  3GWH A;  4NUV A;  5A1L A;  2C5I T;  3UUB A;  2C5J A;  1IBK T;  3RLF F;  1UUR A;  2H3R A;  3SQ9 A;  2M67 A;  5FXV A;  4YFS A;  3UUM A;  2IIU A;  3P7I A;  5EZY E;  5FY0 A;  3RKO A;  4DBR A;  4U31 A;  3J7Y q;  3ZMU B;  2EHO A;  4I50 E;  5LBM A;  4Z90 A;  4OX9 T;  3ZT7 A;  2LM2 A;  3UFG A;  2X9Y A;  3U8K A;  3H3M A;  2LSI A;  2KIN B;  3AED A;  3AVS A;  3WTM A;  4TUY E;  2LRK A;  3C4Z A;  5ABF A;  4P0B A;  2Q9Q B;  1D1B A;  4MAL A;  3LFM A;  3B5M A;  3U8M A;  4JI5 T;  2XSB A;  5JTG A;  2BR8 A;  1KFY A;  3P8C D;  1IBL T;  3RIU A;  4H9N C;  4BA9 A;  1HFA A;  4G2A A;  3QOF A;  5LHG B;  3WI3 A;  3ZDH A;  2C0S A;  1SHZ C;  5LHI B;  1XDP A;  2HHH T;  3QUJ A;  1YQ4 A;  1WFD A;  3NZQ A;  4IE4 A;  5FL1 A;  3K1S A;  5AQP B;  3DJB A;  1WYC A;  5KMG P;  3CQC B;  1E2A A;  5DQV A;  2Z6E A;  1BR0 A;  3RYI E;  5AQL B;  2XM2 A;  4YTP A;  3CK6 A;  2DWK A;  2I59 A;  4E7Z A;  1W0A A;  3JAE A;  3GMI A;  2E5V A;  4H9S E;  2GK9 A;  1VCS A;  4DV3 T;  2BS3 A;  3HKE E;  5HXS A;  5IWA T;  3Q9D A;  1R8I A;  2DI4 A;  4QX7 B;  4LF7 T;  3ZMV B;  1DU2 A;  5AQS B;  4LFA T;  3CKD A;  3SIO A;  5AIN A;  3D0T A;  5JDG A;  5C2T A;  1YQ3 A;  3FBZ A;  1MMA A;  2LOP A;  5JDN A;  2F4V T;  2MBG A;  4ZI7 E;  2XQ9 A;  3KV6 A;  2LSG A;  3NRX A;  3ETV A;  3VR8 A;  2X9X A;  3U8J A;  2DLR A;  4TWF A;  2XQ5 A;  4LF8 T;  2V8S V;  2XZE A;  4CI1 B;  4WW0 A;  3CML A;  2J1D G;  4WYV A;  5HEJ A;  3AAE B;  4BQT A;  3P4S A;  3SS1 A;  1VRB A;  2RA1 A;  4Z91 A;  1XNQ T;  2WWV A;  5C3J A;  2D2S A;  3KVB A;  3M65 A;  3ZJ1 A;  2BG9 A;  3JAD A;  3JCF A;  3RF1 A;  2OV9 A;  3PTR B;  4PAG A;  2CHN A;  4CI2 B;  1I9B A;  2CBJ A;  5AQM B;  4KHP T;  2IML A;  5HCJ A;  4C90 A;  3AE4 A;  3SOL A;  4EZH A;  3ZN0 B;  2W00 A;  3M3Z B;  5LOV E;  2CXF A;  2D9D A;  1OED E;  2M6I A;  1XMQ T;  5HAX A;  5KE4 A;  2D0T A;  5LXB A;  4UVA B;  2JQH A;  4B3T T;  1HNZ T;  4IE5 A;  3IBP A;  4MHC A;  2X51 A;  4LMJ A;  1X79 A;  4LMK A;  4EB6 E;  2IC9 A;  1KF6 A;  4EZ1 A;  3PJA A;  2VAS A;  5HWY A;  2V7J A;  2BKP A;  5J5I A;  3V5S A;  5IHY A;  4O8S A;  3AAI A;  3AA0 B;  3AE7 A;  3U78 A;  1N33 T;  1W0B A;  3PU8 A;  4JI3 T;  2XQ7 A;  3N2O A;  1QSD A;  5AQN B;  5FVK A;  5M4Y A;  2IC6 A;  3RQU A;  4PJN A;  4HFH A;  3RRW A;  2V6Y A;  1I94 T;  3U3I A;  2XQ4 A;  4PFO A;  5AQO B;  3PUQ A;  3RHW A;  1ZEE A;  2YEV C;  4U74 A;  4X1Y E;  4MBQ A;  3CWZ B;  3O4X E;  4XAX B;  2FJB A;  2I6H A;  4EEB A;  2W8G A;  3CQX C;  4YHH T;  3ZYL A;  2D0U A;  4B5D A;  4EXT A;  2WS3 A;  4HKA A;  3VKG A;  3ANW B;  3P4P A;  2XQ3 A;  3AE3 A;  2VKD A;  3NBX X;  4HEA A;  4A5X A;  2FBW A;  4OHF A;  4PFP A;  2BJ0 A;  2KSR A;  5KX5 E;  4YTM A;  3R6N A;  2VKO A;  3RPU A;  2VQE T;  4UR9 A;  2B1E A;  4X64 T;  4UVB B;  4IGU A;  2DHR A;  2BVM A;  1Y64 B;  5JDL A;  2H7O A;  3AXJ A;  1N36 T;  1OXZ A;  2V7L A;  4HFD A;  4D01 A;  3PJA J;  5E0O A;  3RI5 A;  4CN6 A;  3ZN1 B;  4DMW A;  2CM0 A;  2NTY A;  3K3Q C;  5HWX A;  5JRC A;  3V5U A;  2XHE B;  1XNR T;  2A2F X;  3PUR A;  4QX8 B;  4PK5 A;  4IST A;  3PE0 A;  5F8P A;  2WN9 A;  1OED C;  4JI0 T;  2H7V C;  2ZM6 T;  3ABV A;  2LSY A;  1HNX T;  4ZHQ E;  3HKB E;  3RKG A;  4CZZ B;  4EED A;  2H89 A;  3QB5 A;  2LLY A;  1MMD A;  1WR0 A;  5EK4 A;  4U72 A;  5FMN A;  1HX8 A;  4DR3 T;  3I9W A;  3BQL A;  4CN4 A;  2VKH A;  3KV9 A;  4ZI3 C;  5LGU B;  4E7S A;  3PUG A;  3TLT A;  5FKY A;  3ZT6 A;  3B57 A;  4IDP A;  3UU3 A;  5AFH A;  4GYS A;  3HKD E;  5FXW A;  1I6Z A;  5AQF B;  2UUA T;  4DO0 A;  2X67 A;  2MTQ A;  2QYW A;  4GKJ T;  2UXD T;  4K0K T;  4DUZ T;  5IYZ E;  3IF8 B;  2VVS A;  4YLH A;  2WBL A;  4DV0 T;  1M62 A;  2CWO A;  3GA8 A;  4YSZ A;  4AXP A;  2CE7 A;  5L3C B;  3W15 B;  3AE9 A;  4IHJ E;  2E9X D;  2J47 A;  4PJM A;  4U2Y A;  2Y58 A;  4U3C A;  4X65 T;  3OPC A;  3PUY F;  3CQG B;  3HKC E;  3FZL B;  4DV4 T;  5LJN A;  2Y57 A;  1UX5 A;  2LSJ A;  2XAF B;  3EDV A;  1YKH B;  2W62 A;  3FZH B;  5LGN B;  4LF6 T;  2E9X C;  2A9U A;  3BK9 A;  2YIN A;  4A98 A;  2ZJU A;  2BG9 E;  3SWH A;  4JI4 T;  2E9X B;  4YSY A;  5JR9 C;  3L09 A;  5FL0 A;  1W09 A;  3ZYK A;  1ZP0 A;  3EI0 A;  4DV5 T;  3OVU A;  2X68 A;  2XNU A;  2WP9 A;  3ZMS B;  3MAC A;  1UW6 A;  3T8O A;  3ZLI A;  3BQK A;  5J0Z A;  5FY1 A;  3UU6 A;  3ZEF B;  4TNW A;  1NAF A;  4M1P A;  4WNK A;  2XY8 B;  3AA6 B;  4NIQ A;  2WY2 A;  2JRK A;  2WZH A;  2LRL A;  4L5G A;  3RGL A;  4MFR A;  3OYX A;  1UX2 A;  4UV8 B;  2L9Q A;  3FBL A;  2NTX A;  3MA9 A;  1VOM A;  3WTN A;  4HWC A;  4I55 E;  4LF9 T;  2BYS A;  4JV5 T;  3K3O A;  2LOS A;  2IHR 1;  1D1A A;  2ACZ A;  3AEB A;  5LMU T;  2V7I A;  4IT4 A;  1UCU A;  2PJQ A;  4YY3 T;  2VL0 A;  1MNE A;  5JQG E;  2V7M A;  2BKO A;  3JAF A;  4HTE A;  3A7M A;  2BG9 C;  3AA7 B;  4ZS2 A;  5JDH A;  2EHO D;  2X9W A;  3C84 A;  2MOZ A;  4UVC B;  2NR4 A;  1HS7 A;  2E2A A;  4XK9 A;  2IW5 B;  1GQE A;  4MLK A;  3TKL B;  2WNJ A;  4KHZ F;  1ZHC A;  1S35 A;  2ZM2 A;  4ILA A;  3N2K E;  4Q25 A;  2XNT A;  2XAQ B;  2UXX B;  4JEH B;  3KFW X;  2QRX A;  2OA5 A;  1UV6 A;  5BW2 A;  2BYP A;  3C79 A;  3Q5X A;  3F2E A;  2P9B A;  4QH4 A;  4TNV A;  4ASK A;  2KT9 A;  3K3N A;  2VKJ A;  5EK2 A;  3ONX A;  3EAM A;  2BS4 A;  4GK0 E;  3AEC A;  2DL1 A;  4HGA A;  3KV4 A;  3AEG A;  1Z0P A;  3ZST A;  4DR6 T;  3I1A A;  3E08 A;  2YN6 A;  4ZI2 C;  4ZEY A;  2XQA A;  3ZT5 A;  5JME A;  1L0V A;  2NW7 A;  3O1J A;  5CA1 E;  4DR7 T;  3O9X A;  3VKH A;  5F3J A;  5J5H A;  1KNZ A;  2K24 A;  3EDU A;  3ZPO A;  4I0U A;  3RIF A;  1ZV4 X;  2XJ7 A;  2BDE A;  4YJ3 E;  2RP4 A;  3N9N A;  2CMR A;  2XAH B;  4JEU B;  4KX6 A;  1WR6 A;  4P09 A;  1V9D A;  5CB4 E;  3WAJ A;  4B3S T;  4BJN A;  3C51 A;  5L3D B;  4AFG A;  3KIN B;  2EHO B;  2QA7 A;  3E22 E;  3VRA A;  4Z8X A;  2JQQ A;  1KEY A;  3C64 A;  3L3P A;  1D0Y A;  4OYK A;  3B13 A;  2L8K A;  2XQY A;  2WDV A;  2W61 A;  1UK5 A;  5JRE A;  3AXJ B;  2Y48 B;  1FMV A;  3LBX B;  5BP0 A;  3AB3 B;  1HG5 A;  2NP9 A;  4UY2 A;  3ANW A;  3UFE A;  3RIA A;  4ZK1 A;  2K5B B;  4P0A A;  4HFV A;  3TLU A;  2UXB T;  3GN5 B;  3UTK A;  2KXP B;  2LSK A;  5H6R B;  3GUA A;  4ZZB A;  5AFK A;  2XPK A;  3PUA A;  4H9R C;  1FMW A;  2WMO A;  3EUH A;  4QAC A;  2XM1 A;  2HPL A;  4KUM B;  5EK3 A;  4TWH A;  5BRX A;  3T4M A;  1LRZ A;  3O1H A;  3S4U A;  2VL8 A;  4GOU A;  4DR4 T;  4AIS A;  1OED A;  5AQI B;  1JNZ A;  4LFB T;  2FJD A;  2LM9 A;  4XBF B;  2ZM0 A;  1BR2 A;  3ZCI A;  5LB7 B;  3RIU C;  3CX6 B;  3FHN A;  4LML A;  2KND A;  2JMK A;  3MJX A;  5AQT B;  5HXR A;  5HXH A;  2WU5 A;  2X66 A;  1WCR A;  5CGM A;  4KBM B;  5AQH B;  2N2N A;  1HTJ F;  2NOX A;  5L3G B;  5L4E A;  2VB6 A;  3PDY A;  1SE7 A;  4X1K E;  2Q9Q D;  4ERR A;  4AQY T;  2WU2 A;  2JPF A;  1UUS A;  4UM3 P;  4YSX A;  2OLT A;  1W9R A;  4EV6 A;  4DBQ A;  4QXC B;  4NZB A;  3UU5 A;  3VHL A;  4DV1 T;  4JI1 T;  2V6X A;  5BMV E;  3WIP A;  3QK6 A;  3P4W A;  4GIW A;  2BR7 A;  4UV9 B;  3TLW A;  1US7 B;  4PJL A;  5H6Q B;  2CLY B;  4DBM A;  2YDS A;  3X1D A;  3EVY A;  5AFN A;  2VWA A;  5LG3 A;  5JDQ A;  2LT3 A;  4H63 H;  3H37 A;  4AKH A;  1B7T A;  4X20 E;  4X5T A;  5JH7 E;  3CVR A;  5KDM C;  2IDO B;  4QAB A;  2SPC A;  1KK7 A;  3PUV F;  3N9O A;  4IE0 A;  3WTI A;  4ZK4 A;  2G0U A;  3MZK B;  3Q5W A;  4DV2 T;  4QH1 A;  2ES0 A;  5JR9 B;  1T7S A;  5AFU L;  1IJ6 A;  1HF8 A;  5JR9 A;  5CO5 A;  4ADZ A;  1KNR A;  5AQR B;  3T1H T;  4HWD A;  1FJG T;  1UGO A;  2J62 A;  4UIG A;  4EAH A;  5ABG A;  4HFB A;  2K3W A;  2X0L B;  5LJM A;  2BS2 A;  3MXZ A;  3SFE A;  1HCI A;  2E5L T;  5JVD E;  1LVF A;  4AKI A;  1IJ5 A;  2YDR A;  2JIW A;  3UU4 A;  3EAB A;  2Y8D A;  5BR8 T;  1UX4 A;  2BYR A;  5FVL A;  4BFQ A;  2V5D A;  2NWB A;  2CPT A;  4CXY A;  1LKX A;  4EOZ B;  1N32 T;  2X00 A;  2V1D B;  3UT5 E;  4ILU A;  4YJ2 E;  2HH7 A;  5FXZ A;  1G73 A;  2Q9Q C;  3MK7 C;  2LHR A;  3NRY A;  2J4G A;  5AQV B;  2KWH A;  5LP6 E;  3UQ4 A;  3DP7 A;  4FRR A;  3CIR A;  2WM9 A;  5F5W A;  4QAA A;  4ZI2 D;  2DCF A;  3ZKR A;  3WTH A;  1D0Z A;  5ABF B;  5LCY A;  4UF0 A;  4U7I A;  1Y01 A;  2YOE A;  4AIU A;  1BR4 A;  3ZMZ B;  3NVO A;  4ZS3 A;  3N9P A;  4IE7 A;  4ZXL A;  5HYA A;  2UUB T;  3AE2 A;  3ZYM A;  4ZZC A;  3LBX A;  1QUU A;  3E0Z A;  4QXH B;  2KWI B;  1N34 T;  3ETU A;  2W63 A;  4PK4 A;  5AFM B;  3PUW F;  5LA6 E;  2MYS A;  3SFD A;  5LMN T;  3WTO A;  5CJ5 A;  2HN1 A;  2PG8 A;  2Y56 A;  2PGZ A;  2XAG B;  4TZ4 C;  4XZC A;  5JRC B;  3PV0 F;  3HI2 A;  4AKL A;  3KBU A;  3FZF B;  5HEU A;  5JDM A;  2HN2 A;  5LBQ B;  1G8X A;  3ONL C;  1MIV A;  2XZ6 A;  3ZCJ A;  4UF0 B;  5FY7 A;  4B3M T;  4DUY T;  3SQ6 A;  3NKZ A;  3P4Q A;  3F31 A;  2VVN A;  1BR1 A;  5AQU B;  4DMV A;  3RC8 A;  2A72 A;  3H3A A;  3PUX F;  3UQ7 A;  1NEK A;  4X62 T;  3KVA A;  3UUL A;  2CCQ A;  4WBN E;  2EHO C;  3ZSS A;  2K9A A;  4ZOL E;  4ZJS A;  3WTJ A;  1MMN A;  1CUN A;  1EZ3 A;  4LF4 T;  4IDQ A;  4UEM A;  2CA5 A;  5AQK B;  1J5W A;  1YD8 G;  3JC6 C;  1XZY A;  3AA1 B;  3FZK B;  4H9P C;  3RYC E;  5AQJ B;  2QVA A;  3WTL A;  2JJ9 A;  4O2B E;  3A5X A;  3OKQ A;  2NW9 A;  2NW8 A;  4JUY A;  3I9Y A;  3AEE A;  4UXN B;  3R84 B;  2CXL A;  2WZI A;  2YU2 A;  5ABE A;  1OWA A;  3C50 A;  3LK3 B;  2WZY A;  3OYZ A;  4I43 B;  4IE6 A;  3FXE B;  4UM3 S;  3LK2 B;  4HWF A;  2W4X A;  4DVD A;  3WAK A;  4KMC A;  4ZR6 A;  2W2U A;  4IDZ A;  4ISS A;  3C4X A;  4AFT A;  2LE8 A;  2XYT A;  4DV7 T;  4GKK T;  4LFC T;  2XZ5 A;  2XAS B;  2BZB A;  3NWI A;  3RC3 A;  4IL9 A;  3EHZ A;  4F8H A;  2QC1 B;  2PTF A;  5KZU A;  4ILB A;  3FZM B;  3CPZ A;  3ZJ2 A;  4H9Q C;  4AKG A;  4PW8 A;  3PUS A;  4B6X A;  4CXW A;  3HA4 A;  2N1G A;  4YTN A;  4GK5 E;  2LJL A;  5AFJ A;  4UM1 A;  4DID B;  2DNX A;  2WWU A;  1M7K A;  1ZKE A;  2YKS A;  4CXX A;  3RH3 A;  2R6G F;  2D5U A;  3VR9 A;  4F6R C;  2W67 A;  3ONJ A;  5CFB A;  1YXR A;  1LVK A;  4DND A;  2V6Y B;  4AQF A;  2BVL A;  2XTL A;  4WZX A;  3MKD A;  2BBJ A;  3N9L A;  4A56 A;  1MND A;  5C8Y E;  3N9M A;  1ZOY A;  1O3X A;  2UXN B;  2ZMA A;  3IA3 A;  4UEL A;  2FJE A;  4K0U A;  3PMZ A;  2YU1 A;  5HXC A;  4QXB B;  3KBT A;  1WRD A;  4O4J E;  2XAJ B;  1QLB A;  4NXM T;  2Y7Y A;  1SA0 E;  2UZ6 A;  5TAO A;  3AEF A;  3HL6 A;  2FJA A;  1WYB A;  1MMG A;  2H88 A;  5SYO A;  4IRE A;  4CN1 A;  4JI8 T;  5L3B B;  5FNV E;  1HR0 T;  5FXX A;  2CRB A;  5J1G A;  3ZC1 A;  3AEA A;  5J5F A;  5ETW A;  2WAU A;  3FB2 A;  3CX7 B;  1SUM B;  4B3R T;  5FYM A;  1AJ3 A;  4ZRU A;  4PIR A;  4UM3 A;  4NXN T;  1OED B;  4P1N A;  4HFC A;  5ABH A;  2X9H A;  4J2C A;  2W0G A;  2YME A;  3RX6 A;  4TX5 A;  2LKH A;  4H63 V;  2Y6X A;  2WCA A;  4O4H E;  2CBI A;  5DAB A;  2IAK A;  5AQQ B;  3T1Y T;  1T72 A;  4FI5 A;  4U33 A;  3VU7 H;  4QWN B;  3J9X 1;  1XWM A;  3O1I A;  3KDS E;  1FEW A;  3UU8 A;  1MIY A;  3RQW A;  2DWG A;  3UUN A;  1HG2 A;  2W66 A;  1D1C A;  4UXU A;  4ALX A;  2X0Y A;  3WTK A;  1T8B A;  1KNP A;  2LHN A;  1IAP A;  5L2L A;  5J2T E;  4IDO A;  4EGW A;  4A97 A;  4KP3 C;  4X66 T;  1E1H B;  1YKE B;  4AQG A;  3Q2M A;  2VK9 A;  4U2Z A;  4O4L E;  5TVC A;  2CLY C;  2YDQ A;  3OTO T;  5LG4 A;  2C9T A;  2Q9Q A;  1D0X A;  2A3D A;  4JI2 T;  2K48 A;  4OYJ A;  5DQW A;  2BBH A;  2HPJ A;  4I4T E;  4U7Y A;  2X00 D;  4PNI A;  1MIW A;  3FXD B;  1H7C A;  4YXD A;  4DR5 T;  5LYJ E;  1J5E T;  4ILC A;  4HWH A;  4TV8 E;  4BAY B;  5HCM A;  4TN7 B;  2UU9 T;  3RYF E;  2CEA A;  5IUX A;  2E8I A;  1X9B A;  4TV9 E;  4ZI3 D;  3P50 A;  1WLX A;  4HFE A;  4QKN A;  5FJV A;  4N78 D;  1NWM X;  3AE1 A;  4AFH A;  3TLS A;  1XDO A;  3QB5 K;  2UUC T;  1NEN A;  4JI6 T;  2PFV A;  5JDF A;  3SRZ A;  3PEO A;  3AAA B;  5LNK A;  5GON E;  4QHO A;  4V1A v;  4AI6 A;  3IEE A;  3PU3 A;  4NPP A;  4TWD A;  1IBM T;  2WSS V;  3PUZ F;  1E7P A;  2BYQ A;  5HEH A;  2XSA A;  3JC6 D;  4COF A;  3UUX B;  3Q5D A;  2I0M A;  3DTO A;  2JQ9 A;  3LDQ B;  2XYS A;  2ODU A;  2YMD A;  2X0H A;  2ZLY A;  3AVR A;  3LSV A;  4KI0 F;  3VRB A;  5HXE A;  3N5L A;  5L4H A;  2KLQ A;  3AE6 A;  2YK0 A;  2FUP A;  2L3L A;  4YT0 A;  2CHO A;  1U4Q A;  4L9I A;  2MAW A;  5LXT E;  4XHE A;  3KV5 A;  2ACX A;  5DJQ C;  2VUR A;  4IDN A;  4FJO A;  4H9O C;  2XNV A;  4BJM A;  4IL4 A;  4X1I E;  4C91 A;  1JNR A;  2IUB A;  1FIO A;  2M6B A;  2BG9 B;  4EYU A;  3L39 A;  2V7K A;  4YHJ A;  2N9D A;  3LJC A;  4JBW F;  2CXD A;  5L3F B;  3LK4 2;  4PJJ A;  1J1J A;  4IIJ E;  4JLE A;  4L0R A;  4AKR B;  1YW0 A;  4CQI A;  3IHR A;  1XMO T;  4DR1 T;  3Q5E A;  1U5P A;  2BYN A;  1IZN B;  4HQP A;  4HWI B;  4CI3 B;  5ADX L;  3F57 A;  4OFZ A;  2LEH A;  3HR0 A;  2V26 A;  5L47 A;  2WNC A;  3G06 A;  5CA0 E;  3AE8 A;  4NUU A;  3L8R A;  4LF5 T;  3N2G E;  1HX1 B;  3U8N A;  3ZDG A;  4DV6 T;  2WMN A;  5HEG A;  4PK6 A;  5AFL A;  4WBO A;  2PH9 A;  4JYA T;  4WV9 A;  5L3E B;  4O2A E;  3N9Q A;  2W8F A;  2WNL A;  4O4I E; 
#chains in the Genus database with same CATH homology
 5AFH A;  2Y7Y A;  3EAM A;  2PGZ A;  3JAE A;  3SH1 A;  5TVC A;  2XQ3 A;  2UZ6 A;  1OED E;  2M6I A;  3UUB A;  3GUA A;  4ZR6 A;  2C9T A;  4ZZB A;  2MAW A;  3UU4 A;  4AFT A;  3WIP A;  2BJ0 A;  2KSR A;  5AFK A;  4XHE A;  2YN6 A;  2XYT A;  5KE4 A;  3P4W A;  2BYR A;  4HFI A;  2BR7 A;  2XQA A;  1UX2 A;  5LXB A;  3SQ9 A;  3TLW A;  4BFQ A;  5JME A;  5SYO A;  3TLV A;  4IRE A;  5HEU A;  2XZ5 A;  4QAC A;  2XNV A;  4DBM A;  4TWH A;  2X00 D;  3WTN A;  5BRX A;  5J5H A;  4IL4 A;  2XZ6 A;  4IL9 A;  3T4M A;  5J5F A;  3EHZ A;  4F8H A;  2BYS A;  2X00 A;  4Z90 A;  5AFN A;  2QC1 B;  4LMJ A;  5KZU A;  4LMK A;  3SIO A;  2M6B A;  5AIN A;  4ILB A;  2BG9 B;  2LM2 A;  4UM3 S;  4ILC A;  5LG3 A;  4HFD A;  3U8K A;  3SQ6 A;  5HCM A;  3RIF A;  4D01 A;  1OED A;  4EZ1 A;  4ZRU A;  4PIR A;  5IUX A;  3RI5 A;  5J5I A;  2Y58 A;  3P50 A;  3UQ7 A;  2XQ9 A;  2VL0 A;  4HFE A;  4UM3 A;  5AFJ A;  4X5T A;  5HEO A;  4UM1 A;  5FJV A;  3WTM A;  4AFH A;  3U8J A;  3UQ4 A;  1OED B;  3JAF A;  2YKS A;  4HFC A;  2BG9 C;  3TLS A;  4TWF A;  4FRR A;  2XQ5 A;  4QAA A;  3PEO A;  3ZKR A;  2YME A;  4ZJS A;  3WTH A;  3WTJ A;  4QAB A;  3C84 A;  2LKH A;  4AFG A;  4LML A;  2BYN A;  2YOE A;  5HEJ A;  2Y57 A;  3U8M A;  5CFB A;  4HQP A;  4BQT A;  3WTI A;  4ZK4 A;  4XK9 A;  2XQ7 A;  2WN9 A;  2BR8 A;  4Z91 A;  1OED C;  4QH1 A;  4A98 A;  4NPP A;  2WNJ A;  4TWD A;  3RQU A;  2Y54 A;  2ZJU A;  2XQ6 A;  2BG9 E;  5L47 A;  4HFH A;  3UU8 A;  2WNC A;  3IGQ A;  2BYQ A;  5CO5 A;  4ILA A;  2BG9 A;  2LLY A;  5HEH A;  3JAD A;  3RQW A;  4COF A;  2XQ4 A;  3ZDH A;  3EI0 A;  5L4E A;  3RHW A;  2XNT A;  3WTL A;  5BP0 A;  4UXU A;  4UY2 A;  4ALX A;  2ZJV A;  3RIA A;  2XNU A;  4ZZC A;  5J5G A;  3WTK A;  4ZK1 A;  1I9B A;  1UV6 A;  3U8N A;  2BYP A;  3C79 A;  3ZDG A;  5BW2 A;  2XQ8 A;  3PMZ A;  5AFM A;  4HFB A;  5HEG A;  5HCJ A;  2XYS A;  5AFL A;  2W8G A;  4UM3 P;  2YMD A;  3TLT A;  3TLU A;  1UW6 A;  2PH9 A;  4ZJT A;  2WNL A;  4QH4 A;  3LSV A;  2WZY A;  4A97 A;  4TNV A;  5AFM B;  4WV9 A;  5J0Z A;  5L4H A;  3UU6 A;  3U8L A;  4B5D A;  2LKG A;  4TNW A;  4NZB A;  2W8F A;  3WTO A;  4QH5 A;  3UU5 A;  3UU3 A;  2Y56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...