2XQ7A

Pentameric ligand gated ion channel glic in complex with cadmium ion (cd2+)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein
molecule keywords GLR4197 PROTEIN
total genus 77
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq7A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq7A01
4ZRUA 2VL0A 5L4EA 2PH9A 2BG9A 4DBMA 1OEDE 2XQAA 2LKHA 2BJ0A 4TNVA 3C79A 5HCJA 5AFMB 2X00A 4IREA 5J5IA 2YOEA 2YMDA 2M6IA 1I9BA 2ZJVA 3WTHA 2XQ7A 4Z91A 4PIRA 2LKGA 2WN9A 4UM3S 4QH1A 3UU5A 3IGQA 3WTKA 4A98A 2XQ9A 4ZZCA 4TNWA 5AFJA 3WTIA 4XK9A 4XHEA 5AFNA 2XNTA 5HEOA 5CO5A 3RHWA 5LXBA 4UY2A 3T4MA 4UM3P 5KZUA 2XZ5A 3WTNA 3PMZA 4ALXA 3WTMA 3PEOA 5BRXA 2ZJUA 2M6BA 4HFHA 4ILAA 4COFA 3TLSA 5L47A 2LLYA 2KSRA 2BYPA 4ZR6A 3RIFA 4AFHA 3EI0A 5J0ZA 4HFEA 2PGZA 4TWFA 4WV9A 4B5DA 4HFCA 4A97A 3ZDHA 5HEGA 5J5HA 3LSVA 3UQ7A 3SQ9A 5AINA 4HQPA 2Y57A 5FJVA 3WTOA 3SIOA 3JAFA 1OEDA 3U8MA 5AFMA 5L4HA 2UZ6A 2BG9B 5TVCA 2X00D 3UU6A 3EHZA 5IUXA 3WIPA 5AFHA 1OEDB 3U8LA 2XYSA 3RI5A 2XQ8A 3P4WA 2Y7YA 2YMEA 2YN6A 4F8HA 3GUAA 4LMLA 4TWHA 4LMJA 3WTJA 4Z90A 5CFBA 3P50A 3UQ4A 2BR8A 4QABA 5AFKA 4ZK4A 2BYRA 3UUBA 2WNCA 4EZ1A 3JAEA 2BYSA 3ZDGA 4UM1A 4QH5A 4NZBA 4AFGA 5HEJA 1UV6A 3U8KA 4HFDA 2XNUA 4IL9A 3ZKRA 2WNJA 5HEUA 5LG3A 2BG9C 4ZJSA 3EAMA 2BYNA 5SYOA 3UU3A 4QH4A 3RQUA 4ZZBA 4AFTA 2MAWA 2Y58A 1OEDC 4ZK1A 2XQ6A 3TLUA 5JMEA 2YKSA 4LMKA 5BP0A 2WNLA 4NPPA 3U8JA 2XQ5A 3UU4A 2LM2A 4BFQA 5BW2A 2Y54A 2XQ3A 3UU8A 4IL4A 5AFLA 4X5TA 2W8GA 2XNVA 3TLWA 2W8FA 4ZJTA 3JADA 4UXUA 4ILBA 4TWDA 1UW6A 3U8NA 2XZ6A 3C84A 3SH1A 3SQ6A 1UX2A 2Y56A 5HCMA 5J5FA 5KE4A 4HFIA 5J5GA 4QACA 4D01A 2BG9E 4BQTA 4ILCA 5HEHA 4HFBA 2XQ4A 2C9TA 2XYTA 4QAAA 3WTLA 3TLTA 3TLVA 4UM3A 2BR7A 3RIAA 4FRRA 2WZYA 2QC1B 3RQWA 2BYQA
chains in the Genus database with same CATH superfamily
3UUMA 2V6YB 5JDFA 5LGTB 2Y48B 4PIRA 2WMNA 3AEDA 1HX8A 4QH1A 1BR0A 4XK9A 3MKDA 3N2GE 2XNTA 5KZUA 2ODUA 3FZLB 2V7KA 3TLSA 2WBLA 3EI0A 4MBQA 4A97A 2RP4A 5HEGA 1W09A 5HXCA 4BJNA 1ZKEA 5FJVA 5IHYA 3FZKB 4EZHA 4HWIB 1H7CA 3VKGA 5A1LA 3EDUA 1KK7A 1D1BA 4ZI3D 4JI3T 2JMHA 1MMGA 3CWZB 4LMJA 2KINB 1E1HB 1UCUA 5ABFA 2N9DA 4UM1A 2JQ9A 2LOPA 3LBXB 2FJDA 2BKPA 2UXNB 3QB5A 4EGWA 1T7SA 4HWDA 2E5VA 5FXVA 2VQFT 4KUMB 4QXBB 3K3NA 2IMLA 3MACA 3UU4A 4KP3C 4ZJTA 2HN1A 5FXXA 5FY7A 2N2NA 5KE4A 2JQKA 4JI7T 3AXJB 3GWHA 5E0OA 3KFWX 5KMGP 4P09A 2FJAA 2LSKA 5JTGA 4QHOA 3F57A 4PJMA 2L8KA 5FXZA 1IBLT 2V26A 5CB4E 5F8PA 1M7KA 1J5ET 4ASKA 3PEOA 4WZXA 2D5UA 3JC6C 2WP9A 3C64A 4MHCA 3RH3A 1HCIA 4GYSA 4JI6T 5J5HA 3IA3A 3FB2A 4N78D 2X0HA 4GK0E 3ABVA 5AQHB 5AFMA 2JJ9A 2CMRA 4Z8XA 2XYSA 2XQ8A 4DV6T 2CLYC 3KVBA 4AKLA 3ZDGA 2XAFB 3ZMZB 5JREA 2NP9A 3CX6B 5M4YA 2XAQB 1YKEB 5SYOA 4H9SE 2CLYB 2YINA 4AISA 1OEDC 3AAEB 5HXRA 3U78A 3UU8A 4OYJA 5JDMA 2IUBA 4GIWA 3PUZF 3ZYKA 3ZYLA 2ACZA 4L0RA 5AQJB 3M65A 2A3DA 4ANJA 2BR7A 4X66T 4YY3T 4HKAA 4I4TE 4YTPA 2I0MA 5CA1E 5J5IA 3AEFA 5LMNT 3QNUA 4U7IA 3WTKA 3UU5A 5FL1A 2E2AA 4PJJA 3L3PA 2C5KT 4CQIA 3RRWA 2BDEA 5HEOA 5H6QB 4UY2A 4TV9E 4WW0A 2NW9A 5AQSB 2YU1A 1FIOA 3AE4A 4X1YE 5LNKA 2UUBT 4HFEA 5CJ5A 2PGZA 3ZDHA 3RYFE 4DR1T 4ISTA 4LF4T 5JR9A 1MMNA 1US7B 5AQPB 4JEHB 2BKOA 1E2AA 4F8HA 4U2YA 3UQ4A 2VKDA 1J5WA 5JRCB 4DR2T 3NRYA 5GONE 4YSXA 4AQFC 4H9RC 2A2FX 4E7ZA 4ZZBA 5CA0E 4EEDA 3HI2A 4M1PA 5FVKA 2ZLYA 1VCSA 3IBPA 3B13A 2W8GA 4B3RT 3KV4A 2B76A 4K0UA 5C3JA 2IC6A 1XWMA 4MFRA 2H89A 4QX7B 4UM3A 3O1JA 2H7OA 3RIAA 2NTYA 4Q25A 2XUEA 1E7PA 2PH9A 1LRZA 2XAGB 4JI4T 2OV9A 2XPKA 4ZS3A 2DNXA 4ZS2A 5LP6E 3CIRA 4A56A 5BR8T 5AFNA 2I59A 2DL1A 3GA8A 1DU2A 3WTNA 2WU2A 2KLQA 2W62A 4EYUA 3AXJA 1HTJF 2WDVA 3FXEB 4JUYA 3VU7H 1T8BA 1MIWA 1QUUA 4CN4A 4YSYA 3SRZA 3P4QA 4AQYT 2CM0A 3V5SA 3GMIA 5FVLA 2IHR1 2W66A 5L4HA 5FL0A 2BG9B 4FI5A 4PK6A 1IAPA 3AAAB 2PBIA 1BR4A 5HYAA 3H37A 5HXHA 2Q9QC 4WNKA 2LSYA 1MNEA 3TKLB 3B57A 5L3CB 1D1CA 2BG9C 2E9XB 4QH4A 2W67A 1HF8A 3AE2A 2YKSA 2V7IA 3PE0A 5KXJA 4BFQA 3ZMVB 3PUQA 4CXYA 4H63V 2XNVA 5LHGB 3N9QA 4ZI7E 5FKYA 2BG9E 4OHFA 3ZT6A 2PTFA 3G06A 2PG8A 1OWAA 1WYCA 4YHJA 3C79A 4IDNA 2M6IA 1XZYA 3C4XA 2FUPA 3N9PA 2LRLA 3AB3B 5JDNA 1WR6A 3PDYA 4MLKA 1X9BA 2K48A 4XBFB 2XHEB 4I55E 2EHOC 5AQNB 2DHRA 3ANWA 4O2AE 1HNXT 2A9UA 4O8SA 1M62A 2ZJUA 4OK0A 4HFHA 2X67A 4WBNE 2XY8B 3LSVA 3RKGA 5AINA 4PNIA 1Z8UA 2QGSA 3AE5A 5DQWA 4DV1T 3ZN0B 1N33T 4DIDB 4YJ3E 3Q9DA 3ZC0A 1I6ZA 5LXTE 4XZCA 3I1AA 2FJBA 2D0TA 4UIGA 2IW5B 3OPCA 4K0KT 4TX5A 3RYCE 2AXDS 5HEUA 3ONLC 3JC6D 4U3CA 4X1IE 4NUVA 3AE8A 2E9XA 1T98A 3OYZA 2V7JA 3PV0F 3ZSTA 4UXUA 3PU3A 4IE6A 4JYAT 5JVDE 5J5GA 2X9YA 1IJ6A 2EHOD 4IHJE 2X9HA 1FEWA 2YDQA 2XM2A 2BYQA 2BG9A 4IREA 3WTHA 5AFUL 2CHOA 1S35A 2K5BB 1L0VA 3ZYMA 5LBMA 4U74A 4DUYT 2VVNA 4UM3P 2JQHA 2XASB 5AQOB 4JBWF 1OXZA 2BVMA 4DR3T 4DBQA 2FBWA 3CQCB 1UGOA 3N9MA 2K24A 1J1JA 3ZC1A 5JR9C 2YDRA 4O4HE 4LF6T 4FJOA 4TV8E 5HXSA 3KDSE 3L39A 1WCRA 2WM9A 1KNRA 2KT9A 1MIYA 3P4WA 1VOMA 1V9DA 2VVSA 5JR9B 2VB6A 3AA6B 2BYSA 3QUJA 4WYVA 3RRCA 2HN2A 1HG5A 4GYRA 4KI0F 2IDOB 2LT3A 3NVOA 2CHNA 2HPJA 3AE3A 3NRXA 5BW2A 3QC9A 2WSSV 4ILBA 2UXBT 2KMFA 2MBGA 3KBUA 2V8SV 2VURA 5HEHA 3FBLA 5L3DB 3AEAA 3L09A 2X66A 3TLVA 5L3BB 1HX1B 5JH7E 2XQAA 3OKQA 3AVRA 5EK3A 2OA5A 3M3ZB 4EEBA 2XTLA 3IF8B 3V5UA 4TNWA 3N5LA 3ONXA 4I0UA 5AQQB 4JEUB 4UVCB 3IHRA 4G2AA 3JAFA 2JPFA 4I50E 4QX8B 4QWNB 1WRDA 5L3EB 4JI2T 5LG4A 5AFKA 3LK42 3N9LA 3W15B 2WNJA 3LK3B 2JRKA 4O2BE 3EAMA 4UV8B 4X20E 3UULA 3T1YT 3KVAA 3SFEA 1G8XA 1XNRT 3H3AA 2HPLA 5C8YE 1NAFA 4B3ST 3WI3A 4NXMT 2XZ6A 2DLRA 1UX2A 4PFOA 2MTQA 5ABHA 3Q5EA 5J2UE 4LF7T 1YXRA 3PUWF 1D1AA 4B3MT 3BQKA 2BJ0A 1UX4A 4TNVA 5AFMB 2YDSA 2V1DB 2CXLA 3RYIE 3IGQA 4IE0A 4HEAA 3WTIA 4H9PC 1XNQT 2V7MA 3AA0B 3MXZA 4YLHA 2XZ5A 5LMUT 1AJ3A 3PMZA 4YTMA 4EYYR 1LKXA 2WCAA 2LLYA 2W4XA 5LHHB 2BS2A 2LOSA 4U72A 3HKBE 1NEKA 5LB7B 3U8MA 3EVYA 3ZT7A 3NWIA 2XZEA 3RI5A 4UR9A 3RC8A 3Q2MA 4PFPA 4HGAA 4LFBT 1W0BA 4YJ2E 2L9QA 3C4ZA 2LHRA 2IIUA 3VR9A 2J4GA 2BKNA 2LM9A 1G73A 4DV0T 3I9WA 2XQ5A 2DWKA 4IE4A 1SE7A 3FZHB 3CVRA 5LJNA 3RGLA 3SH1A 4X65T 2WB5A 1HG2A 1MNDA 3X1DA 2VKJA 3MJXA 2XQ4A 2D2SA 5F3JA 2ES0A 3RQWA 3O1IA 4UVBB 3F2EA 2LKHA 4C91A 4DR7T 2VL8A 2YMDA 2ZM2A 1SHZC 4UELA 2XQ9A 2XAJB 3ETUA 4ZZCA 2MYSA 2X9XA 5CGMA 1KFYA 1BR2A 4UF0A 2LSIA 2CE7A 5AQIB 3O4XE 5LCYA 2UXDT 1JNRA 3PUYF 5FMNA 3B5MA 4X62T 4AFHA 4TWFA 4WBOA 1XMOT 3ESLA 2PJQA 3C4WA 2CXDA 3WTOA 3CPZA 3NBXX 2L3LA 5L2LA 2V6YA 3ETVA 1WLXA 3EHZA 5JDHA 4A5XA 3E0ZA 4JI8T 3P4PA 1B7TA 2XQYA 1HFAA 1KEYA 2YMEA 3P50A 2W2UA 1X79A 2ZM8A 5C2TA 1W9RA 4IL9A 1R8IA 5LHIB 3F31A 5AQUB 3AAIA 1UURA 3QOFA 2Q9QA 2V5CA 5AQGB 3MZKB 4O4JE 4DV4T 3O1HA 2MAWA 1IBKT 4ZK1A 3TLUA 2WMOA 2CRBA 1GQEA 5DQVA 2J1DG 2Y54A 3KV5A 2W8FA 1UW6A 4DO0A 2BBJA 3O9XA 2SPCA 2Y56A 5TAOA 3BK9A 4D01A 4PW8A 2NW7A 3WAKA 2XYTA 3TLTA 3Q5WA 2LRKA 4FRRA 4IT4A 5L3FB 2UUCT 3QB5K 4DBMA 2X0LB 4EB6E 4GKKT 4UF0B 4JV5T 2AE9A 2XQ7A 2KWHA 2LKGA 3DP7A 3MA9A 4A98A 3UT5E 3K3QC 2N1GA 4HWHA 3RHWA 5LXBA 4B6XA 2Q9QD 1WYBA 3WTMA 4P0BA 4E7SA 2C0SA 3N2KE 2XAHB 1YQ4A 4KMCA 1XDPA 3ZMTB 3UQ7A 5LGUB 3AEGA 1FMWA 1ZOYA 1ZHCA 4DVDA 5EZYE 2QA7A 2X00D 2WZHA 3UU6A 2Y7YA 4DNDA 2YN6A 3GUAA 5FYMA 4TWHA 3J9X1 2BR8A 3RLFF 2HH7A 3I0OA 3RC3A 3ZKRA 4CN6A 4EV6A 2UUAT 1QLBA 2C5JA 3RF1A 2Y58A 2D9DA 2WNLA 2LM2A 3LG7A 3UUNA 3RPUA 4IGUA 2ZMAA 1SA0E 5HCMA 5J5FA 1MMDA 5JDQA 3SWHA 3NZQA 1N32T 4QAAA 3U3IA 2LHNA 4HE8A 4AI6A 3EABA 4CI3B 4DV3T 3AE6A 4MALA 3VR8A 2X00A 1I9BA 2ZM0A 1EZ3A 3AEBA 1KF6A 4JI1T 2YK0A 3ZPOA 1LVKA 4YXDA 3C50A 3I0QA 4ALXA 3S4UA 3E22E 3FBZA 2M6BA 4U31A 2CEAA 5AQRB 3ZCIA 4CXXA 2DI4A 2XSAA 5J0ZA 1NWMX 1D0XA 3ZLIA 4IDQA 5LA6E 4OX9T 3PU8A 4HWCA 4UVAB 1ZEEA 2R6GF 3ZJ1A 3LDQB 2UZ6A 3AEEA 2V7LA 4U33A 3N2OA 3AE7A 3BQIA 2NR4A 2CWOA 3R84B 4LMLA 4JI0T 5CFBA 3P4SA 2EHOA 3JAEA 5LYJE 2PFVA 1XDOA 3U8KA 1YD8G 4O4IE 5AQFB 4LFCT 3LJCA 5ADXL 5AQTB 3KBTA 1U4QA 3AA7B 2E5LT 3PUXF 5AFLA 1N34T 4G63A 3JADA 3U8NA 3T1HT 4BQTA 3PUAA 4DV5T 4UV9B 4O4LE 3OYXA 4ZEYA 2UU9T 1UUSA 3J7Yq 3VRAA 2KXPB 4ZOLE 2X51A 5AFJA 5ABEA 3KINB 3ONJA 3GN5A 3NKZA 1LVFA 4H63H 2BBHA 5FP3A 3H3MA 2RPAA 4ZR6A 5DJQC 4WV9A 4H9OC 4HFCA 3LK2B 2WAUA 4YHHT 3PTRB 4TN7B 1CUNA 3N9OA 4ZI2C 3SIOA 5IYZE 5LJMA 1VCTA 4ILUA 1KNZA 1HNZT 4YSZA 4UEMA 2CPTA 3ZSSA 4EZ4A 1O3XA 4Z90A 2IAKA 3ZMSB 2EHOB 2WNCA 3UUBA 1IBMT 2D0UA 5HEJA 2LEHA 3C51A 2M67A 4X64T 4GK5E 1D0ZA 2QYWA 3P4RA 3CX8B 4NXNT 2KWIB 5FXWA 4TUYE 3C98B 4AFTA 4B3TT 3PUVF 4NPPA 2H88A 4L5GA 4U2ZA 4CZZB 2XQ3A 3PUSA 2H3RA 4YT0A 4AKRB 3HR0A 3P7IA 4GKJT 4HFIA 4EIWA 3ZEFB 2KZ7B 4ILCA 2ACXA 1N36T 4IIJE 1HNWT 2E8IA 1Y01A 2V6XA 2B1EA 4XAXB 5H6RB 3R6NA 4LFAT 2X9WA 2VL0A 1OEDE 4EAHA 2YOEA 2UXCT 3MK7C 3VRBA 1YKHB 2Z6EA 4XHEA 2NTXA 1BR1A 3OVUA 5HAXA 2LSJA 5LOVE 3I9YA 2W61A 2NW8A 2G0UA 1WR0A 4ILAA 2MOZA 2FJEA 2BYPA 3RIFA 4B5DA 3CMLA 4AQFA 4HQPA 2QVAA 2Y57A 4AKGA 3ZT5A 1WFDA 1VRBA 1I94T 5TVCA 5HXEA 5JDLA 5KDMC 5FNVE 3WIPA 1UX5A 2WDQA 1ZP0A 5IWAT 1CHUA 4OFZA 4J2CA 3E08A 3WTJA 3ZJ2A 2BYRA 4AQGA 3LFMA 5LBQB 3N9NA 1UV6A 4KX6A 5L3GB 5JRCA 5LG3A 1U5PA 1D0YA 5JDGA 3T8OA 5HWYA 2CBIA 3IEEA 4I43B 4DV7T 3GN5B 3RYHE 2IC9A 1JNZA 2BVLA 2DWGA 3TLWA 3CKDA 2X0YA 2W63A 2QRXA 5HWXA 1XMQT 1KNPA 2F4VT 5KX5E 3WTLA 2VK9A 3KV6A 3P8CD 4QXHB 2QC1B 3JCFA 3KV9A 4ZRUA 5L4EA 3A7MA 5HCJA 2GK9A 2H7VC 3PURA 4UM3S 4KBMB 3AVSA 4CN1A 1UK5A 5JQGE 4YTNA 5CO5A 2JIWA 4OYKA 3T4MA 3Q5XA 4P0AA 5FY0A 5J2TE 3PJAA 3HKEE 2K3WA 3BQLA 5BRXA 4HTEA 3EDVA 2KSRA 2ODVA 4EXTA 2WY2A 3SOLA 4HFVA 5EK2A 4DMWA 4NIQA 4CI1B 3FHNA 3OTOT 4HWFA 4DR6T 1OEDB 2WWVA 3U8LA 3K1SA 3HKCE 2VQET 4DR5T 4ZK4A 4QH5A 4U7YA 3RIUA 3ZN1B 4AFGA 4P1NA 3HKDE 3FZFB 4ISSA 4ZJSA 4H9QC 1FMVA 4DR4T 4ERRA 2V5DA 3OBVE 5BMVE 4F6RC 5JMEA 5AQMB 3UFGA 4BA9A 3SS1A 2W00A 4X5TA 1MMAA 1S94A 3SQ6A 4BAYB 1HR0T 3ZCJA 5AQLB 4QACA 1FJGT 4PJNA 2RA1A 2C9TA 4HN9A 3K3OA 4PAGA 1ZV4X 3L8RA 3UUXB 2YU2A 2ZJVA 3CX7B 4JLEA 4Z91A 3NZPA 2K9AA 4X1KE 2WN9A 2XSBA 4GOUA 2NOXA 3CK6A 4ZI3C 2HHHT 3A5XA 3AE1A 4AIUA 4JI5T 2VKOA 5AQVB 3CQXC 4IDPA 2UXXB 2XJ7A 3QK6A 4H9NC 1Z0PA 2J47A 2WS3A 4COFA 1QSDA 3FXDB 2CA5A 2JMKA 4ZI2D 4CXWA 5FY1A 2Y6XA 3AA1B 2YEVC 3ZMUB 5DABA 5AFHA 4NUUA 2WDRA 1YW0A 4QABA 2CWYA 2VWAA 2JQQA 3DTOA 4YFSA 4NZBA 4ADZA 3LBXA 4BJMA 5ABFB 4EOZB 2X68A 3RQUA 2E9XD 2J62A 4PK5A 3UFEA 2XQ6A 4AKIA 3Q5DA 4KHZF 5BP0A 3U8JA 1MIVA 4AXPA 3K8PC 4TWDA 2A72A 1Y64B 5LGNB 3C84A 4AKHA 2XM1A 4LF5T 4UXNB 3PUGA 3OJAA 4LF8T 3VHLA 3RIUC 3AECA 3A8YC 5ABGA 5EK4A 3SFDA 4DV2T 1SUMB 4V1Av 2MPKA 2I6HA 2WZIA 3VKHA 4L9IA 1W0AA 2ZM6T 1IJ5A 3DJBA 2VASA 5J1GA 3PJAJ 3FZMB 3HA4A 4C90A 5F5WA 4IDOA 2WU5A 5L47A 4KHPT 2Q9QB 2BS4A 2NWBA 2BS3A 2LE8A 2LSGA 3AE9A 3SQ9A 2DCFA 1NENA 1OEDA 4QKNA 4IDZA 2E9XC 2VKHA 2WWUA 3EUHA 5IUXA 5AQKB 3RX6A 1YQ3A 4DBRA 2WQYA 2CXFA 1IZNB 2OLTA 4DUZT 1T72A 2BZBA 4TZ4C 4EZ1A 3HL6A 2CBJA 4HFDA 2XNUA 3D0TA 2BYNA 2LJLA 4IE5A 3UU3A 1HS7A 3UTKA 4PJLA 4IE7A 3RKOA 4CI2B 2KNDA 5ETWA 4LMKA 4ZXLA 4PK4A 4IL4A 2W0GA 2P9BA 4DMVA 3CQGB 3WAJA 4LF9T 2Y8DA 4HFBA 3ANWB 4QXCB 4ZHQE 2C5IT 2WZYA 2CCQA
chains in the Genus database with same CATH topology
4ZRUA 2VL0A 5L4EA 2PH9A 2BG9A 4DBMA 1OEDE 2XQAA 2LKHA 2BJ0A 4TNVA 3C79A 5HCJA 5AFMB 2X00A 4IREA 5J5IA 2YOEA 2YMDA 2M6IA 1I9BA 2ZJVA 3WTHA 2XQ7A 4Z91A 4PIRA 2LKGA 2WN9A 4UM3S 4QH1A 3UU5A 3IGQA 3WTKA 4A98A 2XQ9A 4ZZCA 4TNWA 5AFJA 3WTIA 4XK9A 4XHEA 5AFNA 2XNTA 5HEOA 5CO5A 3RHWA 5LXBA 4UY2A 3T4MA 4UM3P 5KZUA 2XZ5A 3WTNA 3PMZA 4ALXA 3WTMA 3PEOA 5BRXA 2ZJUA 2M6BA 4HFHA 4ILAA 4COFA 3TLSA 5L47A 2LLYA 2KSRA 2BYPA 4ZR6A 3RIFA 4AFHA 3EI0A 5J0ZA 4HFEA 2PGZA 4TWFA 4WV9A 4B5DA 4HFCA 4A97A 3ZDHA 5HEGA 5J5HA 3LSVA 3UQ7A 3SQ9A 5AINA 4HQPA 2Y57A 5FJVA 3WTOA 3SIOA 3JAFA 1OEDA 3U8MA 5AFMA 5L4HA 2UZ6A 2BG9B 5TVCA 2X00D 3UU6A 3EHZA 5IUXA 3WIPA 5AFHA 1OEDB 3U8LA 2XYSA 3RI5A 2XQ8A 3P4WA 2Y7YA 2YMEA 2YN6A 4F8HA 3GUAA 4LMLA 4TWHA 4LMJA 3WTJA 4Z90A 5CFBA 3P50A 3UQ4A 2BR8A 4QABA 5AFKA 4ZK4A 2BYRA 3UUBA 2WNCA 4EZ1A 3JAEA 2BYSA 3ZDGA 4UM1A 4QH5A 4NZBA 4AFGA 5HEJA 1UV6A 3U8KA 4HFDA 2XNUA 4IL9A 3ZKRA 2WNJA 5HEUA 5LG3A 2BG9C 4ZJSA 3EAMA 2BYNA 5SYOA 3UU3A 4QH4A 3RQUA 4ZZBA 4AFTA 2MAWA 2Y58A 1OEDC 4ZK1A 2XQ6A 3TLUA 5JMEA 2YKSA 4LMKA 5BP0A 2WNLA 4NPPA 3U8JA 2XQ5A 3UU4A 2LM2A 4BFQA 5BW2A 2Y54A 2XQ3A 3UU8A 4IL4A 5AFLA 4X5TA 2W8GA 2XNVA 3TLWA 2W8FA 4ZJTA 3JADA 4UXUA 4ILBA 4TWDA 1UW6A 3U8NA 2XZ6A 3C84A 3SH1A 3SQ6A 1UX2A 2Y56A 5HCMA 5J5FA 5KE4A 4HFIA 5J5GA 4QACA 4D01A 2BG9E 4BQTA 4ILCA 5HEHA 4HFBA 2XQ4A 2C9TA 2XYTA 4QAAA 3WTLA 3TLTA 3TLVA 4UM3A 2BR7A 3RIAA 4FRRA 2WZYA 2QC1B 3RQWA 2BYQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZRU A;  2VL0 A;  5L4E A;  2PH9 A;  2BG9 A;  4DBM A;  1OED E;  2XQA A;  2LKH A;  2BJ0 A;  4TNV A;  3C79 A;  5HCJ A;  5AFM B;  2X00 A;  4IRE A;  5J5I A;  2YOE A;  2YMD A;  2M6I A;  1I9B A;  2ZJV A;  3WTH A;  2XQ7 A;  4Z91 A;  4PIR A;  2LKG A;  2WN9 A;  4UM3 S;  4QH1 A;  3UU5 A;  3IGQ A;  3WTK A;  4A98 A;  2XQ9 A;  4ZZC A;  4TNW A;  5AFJ A;  3WTI A;  4XK9 A;  4XHE A;  5AFN A;  2XNT A;  5HEO A;  5CO5 A;  3RHW A;  5LXB A;  4UY2 A;  3T4M A;  4UM3 P;  5KZU A;  2XZ5 A;  3WTN A;  3PMZ A;  4ALX A;  3WTM A;  3PEO A;  5BRX A;  2ZJU A;  2M6B A;  4HFH A;  4ILA A;  4COF A;  3TLS A;  5L47 A;  2LLY A;  2KSR A;  2BYP A;  4ZR6 A;  3RIF A;  4AFH A;  3EI0 A;  5J0Z A;  4HFE A;  2PGZ A;  4TWF A;  4WV9 A;  4B5D A;  4HFC A;  4A97 A;  3ZDH A;  5HEG A;  5J5H A;  3LSV A;  3UQ7 A;  3SQ9 A;  5AIN A;  4HQP A;  2Y57 A;  5FJV A;  3WTO A;  3SIO A;  3JAF A;  1OED A;  3U8M A;  5AFM A;  5L4H A;  2UZ6 A;  2BG9 B;  5TVC A;  2X00 D;  3UU6 A;  3EHZ A;  5IUX A;  3WIP A;  5AFH A;  1OED B;  3U8L A;  2XYS A;  3RI5 A;  2XQ8 A;  3P4W A;  2Y7Y A;  2YME A;  2YN6 A;  4F8H A;  3GUA A;  4LML A;  4TWH A;  4LMJ A;  3WTJ A;  4Z90 A;  5CFB A;  3P50 A;  3UQ4 A;  2BR8 A;  4QAB A;  5AFK A;  4ZK4 A;  2BYR A;  3UUB A;  2WNC A;  4EZ1 A;  3JAE A;  2BYS A;  3ZDG A;  4UM1 A;  4QH5 A;  4NZB A;  4AFG A;  5HEJ A;  1UV6 A;  3U8K A;  4HFD A;  2XNU A;  4IL9 A;  3ZKR A;  2WNJ A;  5HEU A;  5LG3 A;  2BG9 C;  4ZJS A;  3EAM A;  2BYN A;  5SYO A;  3UU3 A;  4QH4 A;  3RQU A;  4ZZB A;  4AFT A;  2MAW A;  2Y58 A;  1OED C;  4ZK1 A;  2XQ6 A;  3TLU A;  5JME A;  2YKS A;  4LMK A;  5BP0 A;  2WNL A;  4NPP A;  3U8J A;  2XQ5 A;  3UU4 A;  2LM2 A;  4BFQ A;  5BW2 A;  2Y54 A;  2XQ3 A;  3UU8 A;  4IL4 A;  5AFL A;  4X5T A;  2W8G A;  2XNV A;  3TLW A;  2W8F A;  4ZJT A;  3JAD A;  4UXU A;  4ILB A;  4TWD A;  1UW6 A;  3U8N A;  2XZ6 A;  3C84 A;  3SH1 A;  3SQ6 A;  1UX2 A;  2Y56 A;  5HCM A;  5J5F A;  5KE4 A;  4HFI A;  5J5G A;  4QAC A;  4D01 A;  2BG9 E;  4BQT A;  4ILC A;  5HEH A;  4HFB A;  2XQ4 A;  2C9T A;  2XYT A;  4QAA A;  3WTL A;  3TLT A;  3TLV A;  4UM3 A;  2BR7 A;  3RIA A;  4FRR A;  2WZY A;  2QC1 B;  3RQW A;  2BYQ A; 
#chains in the Genus database with same CATH topology
 3UUM A;  2V6Y B;  5JDF A;  5LGT B;  2Y48 B;  4PIR A;  2WMN A;  3AED A;  1HX8 A;  4QH1 A;  1BR0 A;  4XK9 A;  3MKD A;  3N2G E;  2XNT A;  5KZU A;  2ODU A;  3FZL B;  2V7K A;  3TLS A;  2WBL A;  3EI0 A;  4MBQ A;  4A97 A;  2RP4 A;  5HEG A;  1W09 A;  5HXC A;  4BJN A;  1ZKE A;  5FJV A;  5IHY A;  3FZK B;  4EZH A;  4HWI B;  1H7C A;  3VKG A;  5A1L A;  3EDU A;  1KK7 A;  1D1B A;  4ZI3 D;  4JI3 T;  2JMH A;  1MMG A;  3CWZ B;  4LMJ A;  2KIN B;  1E1H B;  1UCU A;  5ABF A;  2N9D A;  4UM1 A;  2JQ9 A;  2LOP A;  3LBX B;  2FJD A;  2BKP A;  2UXN B;  3QB5 A;  4EGW A;  1T7S A;  4HWD A;  2E5V A;  5FXV A;  2VQF T;  4KUM B;  4QXB B;  3K3N A;  2IML A;  3MAC A;  3UU4 A;  4KP3 C;  4ZJT A;  2HN1 A;  5FXX A;  5FY7 A;  2N2N A;  5KE4 A;  2JQK A;  4JI7 T;  3AXJ B;  3GWH A;  5E0O A;  3KFW X;  5KMG P;  4P09 A;  2FJA A;  2LSK A;  5JTG A;  4QHO A;  3F57 A;  4PJM A;  2L8K A;  5FXZ A;  1IBL T;  2V26 A;  5CB4 E;  5F8P A;  1M7K A;  1J5E T;  4ASK A;  3PEO A;  4WZX A;  2D5U A;  3JC6 C;  2WP9 A;  3C64 A;  4MHC A;  3RH3 A;  1HCI A;  4GYS A;  4JI6 T;  5J5H A;  3IA3 A;  3FB2 A;  4N78 D;  2X0H A;  4GK0 E;  3ABV A;  5AQH B;  5AFM A;  2JJ9 A;  2CMR A;  4Z8X A;  2XYS A;  2XQ8 A;  4DV6 T;  2CLY C;  3KVB A;  4AKL A;  3ZDG A;  2XAF B;  3ZMZ B;  5JRE A;  2NP9 A;  3CX6 B;  5M4Y A;  2XAQ B;  1YKE B;  5SYO A;  4H9S E;  2CLY B;  2YIN A;  4AIS A;  1OED C;  3AAE B;  5HXR A;  3U78 A;  3UU8 A;  4OYJ A;  5JDM A;  2IUB A;  4GIW A;  3PUZ F;  3ZYK A;  3ZYL A;  2ACZ A;  4L0R A;  5AQJ B;  3M65 A;  2A3D A;  4ANJ A;  2BR7 A;  4X66 T;  4YY3 T;  4HKA A;  4I4T E;  4YTP A;  2I0M A;  5CA1 E;  5J5I A;  3AEF A;  5LMN T;  3QNU A;  4U7I A;  3WTK A;  3UU5 A;  5FL1 A;  2E2A A;  4PJJ A;  3L3P A;  2C5K T;  4CQI A;  3RRW A;  2BDE A;  5HEO A;  5H6Q B;  4UY2 A;  4TV9 E;  4WW0 A;  2NW9 A;  5AQS B;  2YU1 A;  1FIO A;  3AE4 A;  4X1Y E;  5LNK A;  2UUB T;  4HFE A;  5CJ5 A;  2PGZ A;  3ZDH A;  3RYF E;  4DR1 T;  4IST A;  4LF4 T;  5JR9 A;  1MMN A;  1US7 B;  5AQP B;  4JEH B;  2BKO A;  1E2A A;  4F8H A;  4U2Y A;  3UQ4 A;  2VKD A;  1J5W A;  5JRC B;  4DR2 T;  3NRY A;  5GON E;  4YSX A;  4AQF C;  4H9R C;  2A2F X;  4E7Z A;  4ZZB A;  5CA0 E;  4EED A;  3HI2 A;  4M1P A;  5FVK A;  2ZLY A;  1VCS A;  3IBP A;  3B13 A;  2W8G A;  4B3R T;  3KV4 A;  2B76 A;  4K0U A;  5C3J A;  2IC6 A;  1XWM A;  4MFR A;  2H89 A;  4QX7 B;  4UM3 A;  3O1J A;  2H7O A;  3RIA A;  2NTY A;  4Q25 A;  2XUE A;  1E7P A;  2PH9 A;  1LRZ A;  2XAG B;  4JI4 T;  2OV9 A;  2XPK A;  4ZS3 A;  2DNX A;  4ZS2 A;  5LP6 E;  3CIR A;  4A56 A;  5BR8 T;  5AFN A;  2I59 A;  2DL1 A;  3GA8 A;  1DU2 A;  3WTN A;  2WU2 A;  2KLQ A;  2W62 A;  4EYU A;  3AXJ A;  1HTJ F;  2WDV A;  3FXE B;  4JUY A;  3VU7 H;  1T8B A;  1MIW A;  1QUU A;  4CN4 A;  4YSY A;  3SRZ A;  3P4Q A;  4AQY T;  2CM0 A;  3V5S A;  3GMI A;  5FVL A;  2IHR 1;  2W66 A;  5L4H A;  5FL0 A;  2BG9 B;  4FI5 A;  4PK6 A;  1IAP A;  3AAA B;  2PBI A;  1BR4 A;  5HYA A;  3H37 A;  5HXH A;  2Q9Q C;  4WNK A;  2LSY A;  1MNE A;  3TKL B;  3B57 A;  5L3C B;  1D1C A;  2BG9 C;  2E9X B;  4QH4 A;  2W67 A;  1HF8 A;  3AE2 A;  2YKS A;  2V7I A;  3PE0 A;  5KXJ A;  4BFQ A;  3ZMV B;  3PUQ A;  4CXY A;  4H63 V;  2XNV A;  5LHG B;  3N9Q A;  4ZI7 E;  5FKY A;  2BG9 E;  4OHF A;  3ZT6 A;  2PTF A;  3G06 A;  2PG8 A;  1OWA A;  1WYC A;  4YHJ A;  3C79 A;  4IDN A;  2M6I A;  1XZY A;  3C4X A;  2FUP A;  3N9P A;  2LRL A;  3AB3 B;  5JDN A;  1WR6 A;  3PDY A;  4MLK A;  1X9B A;  2K48 A;  4XBF B;  2XHE B;  4I55 E;  2EHO C;  5AQN B;  2DHR A;  3ANW A;  4O2A E;  1HNX T;  2A9U A;  4O8S A;  1M62 A;  2ZJU A;  4OK0 A;  4HFH A;  2X67 A;  4WBN E;  2XY8 B;  3LSV A;  3RKG A;  5AIN A;  4PNI A;  1Z8U A;  2QGS A;  3AE5 A;  5DQW A;  4DV1 T;  3ZN0 B;  1N33 T;  4DID B;  4YJ3 E;  3Q9D A;  3ZC0 A;  1I6Z A;  5LXT E;  4XZC A;  3I1A A;  2FJB A;  2D0T A;  4UIG A;  2IW5 B;  3OPC A;  4K0K T;  4TX5 A;  3RYC E;  2AXD S;  5HEU A;  3ONL C;  3JC6 D;  4U3C A;  4X1I E;  4NUV A;  3AE8 A;  2E9X A;  1T98 A;  3OYZ A;  2V7J A;  3PV0 F;  3ZST A;  4UXU A;  3PU3 A;  4IE6 A;  4JYA T;  5JVD E;  5J5G A;  2X9Y A;  1IJ6 A;  2EHO D;  4IHJ E;  2X9H A;  1FEW A;  2YDQ A;  2XM2 A;  2BYQ A;  2BG9 A;  4IRE A;  3WTH A;  5AFU L;  2CHO A;  1S35 A;  2K5B B;  1L0V A;  3ZYM A;  5LBM A;  4U74 A;  4DUY T;  2VVN A;  4UM3 P;  2JQH A;  2XAS B;  5AQO B;  4JBW F;  1OXZ A;  2BVM A;  4DR3 T;  4DBQ A;  2FBW A;  3CQC B;  1UGO A;  3N9M A;  2K24 A;  1J1J A;  3ZC1 A;  5JR9 C;  2YDR A;  4O4H E;  4LF6 T;  4FJO A;  4TV8 E;  5HXS A;  3KDS E;  3L39 A;  1WCR A;  2WM9 A;  1KNR A;  2KT9 A;  1MIY A;  3P4W A;  1VOM A;  1V9D A;  2VVS A;  5JR9 B;  2VB6 A;  3AA6 B;  2BYS A;  3QUJ A;  4WYV A;  3RRC A;  2HN2 A;  1HG5 A;  4GYR A;  4KI0 F;  2IDO B;  2LT3 A;  3NVO A;  2CHN A;  2HPJ A;  3AE3 A;  3NRX A;  5BW2 A;  3QC9 A;  2WSS V;  4ILB A;  2UXB T;  2KMF A;  2MBG A;  3KBU A;  2V8S V;  2VUR A;  5HEH A;  3FBL A;  5L3D B;  3AEA A;  3L09 A;  2X66 A;  3TLV A;  5L3B B;  1HX1 B;  5JH7 E;  2XQA A;  3OKQ A;  3AVR A;  5EK3 A;  2OA5 A;  3M3Z B;  4EEB A;  2XTL A;  3IF8 B;  3V5U A;  4TNW A;  3N5L A;  3ONX A;  4I0U A;  5AQQ B;  4JEU B;  4UVC B;  3IHR A;  4G2A A;  3JAF A;  2JPF A;  4I50 E;  4QX8 B;  4QWN B;  1WRD A;  5L3E B;  4JI2 T;  5LG4 A;  5AFK A;  3LK4 2;  3N9L A;  3W15 B;  2WNJ A;  3LK3 B;  2JRK A;  4O2B E;  3EAM A;  4UV8 B;  4X20 E;  3UUL A;  3T1Y T;  3KVA A;  3SFE A;  1G8X A;  1XNR T;  3H3A A;  2HPL A;  5C8Y E;  1NAF A;  4B3S T;  3WI3 A;  4NXM T;  2XZ6 A;  2DLR A;  1UX2 A;  4PFO A;  2MTQ A;  5ABH A;  3Q5E A;  5J2U E;  4LF7 T;  1YXR A;  3PUW F;  1D1A A;  4B3M T;  3BQK A;  2BJ0 A;  1UX4 A;  4TNV A;  5AFM B;  2YDS A;  2V1D B;  2CXL A;  3RYI E;  3IGQ A;  4IE0 A;  4HEA A;  3WTI A;  4H9P C;  1XNQ T;  2V7M A;  3AA0 B;  3MXZ A;  4YLH A;  2XZ5 A;  5LMU T;  1AJ3 A;  3PMZ A;  4YTM A;  4EYY R;  1LKX A;  2WCA A;  2LLY A;  2W4X A;  5LHH B;  2BS2 A;  2LOS A;  4U72 A;  3HKB E;  1NEK A;  5LB7 B;  3U8M A;  3EVY A;  3ZT7 A;  3NWI A;  2XZE A;  3RI5 A;  4UR9 A;  3RC8 A;  3Q2M A;  4PFP A;  4HGA A;  4LFB T;  1W0B A;  4YJ2 E;  2L9Q A;  3C4Z A;  2LHR A;  2IIU A;  3VR9 A;  2J4G A;  2BKN A;  2LM9 A;  1G73 A;  4DV0 T;  3I9W A;  2XQ5 A;  2DWK A;  4IE4 A;  1SE7 A;  3FZH B;  3CVR A;  5LJN A;  3RGL A;  3SH1 A;  4X65 T;  2WB5 A;  1HG2 A;  1MND A;  3X1D A;  2VKJ A;  3MJX A;  2XQ4 A;  2D2S A;  5F3J A;  2ES0 A;  3RQW A;  3O1I A;  4UVB B;  3F2E A;  2LKH A;  4C91 A;  4DR7 T;  2VL8 A;  2YMD A;  2ZM2 A;  1SHZ C;  4UEL A;  2XQ9 A;  2XAJ B;  3ETU A;  4ZZC A;  2MYS A;  2X9X A;  5CGM A;  1KFY A;  1BR2 A;  4UF0 A;  2LSI A;  2CE7 A;  5AQI B;  3O4X E;  5LCY A;  2UXD T;  1JNR A;  3PUY F;  5FMN A;  3B5M A;  4X62 T;  4AFH A;  4TWF A;  4WBO A;  1XMO T;  3ESL A;  2PJQ A;  3C4W A;  2CXD A;  3WTO A;  3CPZ A;  3NBX X;  2L3L A;  5L2L A;  2V6Y A;  3ETV A;  1WLX A;  3EHZ A;  5JDH A;  4A5X A;  3E0Z A;  4JI8 T;  3P4P A;  1B7T A;  2XQY A;  1HFA A;  1KEY A;  2YME A;  3P50 A;  2W2U A;  1X79 A;  2ZM8 A;  5C2T A;  1W9R A;  4IL9 A;  1R8I A;  5LHI B;  3F31 A;  5AQU B;  3AAI A;  1UUR A;  3QOF A;  2Q9Q A;  2V5C A;  5AQG B;  3MZK B;  4O4J E;  4DV4 T;  3O1H A;  2MAW A;  1IBK T;  4ZK1 A;  3TLU A;  2WMO A;  2CRB A;  1GQE A;  5DQV A;  2J1D G;  2Y54 A;  3KV5 A;  2W8F A;  1UW6 A;  4DO0 A;  2BBJ A;  3O9X A;  2SPC A;  2Y56 A;  5TAO A;  3BK9 A;  4D01 A;  4PW8 A;  2NW7 A;  3WAK A;  2XYT A;  3TLT A;  3Q5W A;  2LRK A;  4FRR A;  4IT4 A;  5L3F B;  2UUC T;  3QB5 K;  4DBM A;  2X0L B;  4EB6 E;  4GKK T;  4UF0 B;  4JV5 T;  2AE9 A;  2XQ7 A;  2KWH A;  2LKG A;  3DP7 A;  3MA9 A;  4A98 A;  3UT5 E;  3K3Q C;  2N1G A;  4HWH A;  3RHW A;  5LXB A;  4B6X A;  2Q9Q D;  1WYB A;  3WTM A;  4P0B A;  4E7S A;  2C0S A;  3N2K E;  2XAH B;  1YQ4 A;  4KMC A;  1XDP A;  3ZMT B;  3UQ7 A;  5LGU B;  3AEG A;  1FMW A;  1ZOY A;  1ZHC A;  4DVD A;  5EZY E;  2QA7 A;  2X00 D;  2WZH A;  3UU6 A;  2Y7Y A;  4DND A;  2YN6 A;  3GUA A;  5FYM A;  4TWH A;  3J9X 1;  2BR8 A;  3RLF F;  2HH7 A;  3I0O A;  3RC3 A;  3ZKR A;  4CN6 A;  4EV6 A;  2UUA T;  1QLB A;  2C5J A;  3RF1 A;  2Y58 A;  2D9D A;  2WNL A;  2LM2 A;  3LG7 A;  3UUN A;  3RPU A;  4IGU A;  2ZMA A;  1SA0 E;  5HCM A;  5J5F A;  1MMD A;  5JDQ A;  3SWH A;  3NZQ A;  1N32 T;  4QAA A;  3U3I A;  2LHN A;  4HE8 A;  4AI6 A;  3EAB A;  4CI3 B;  4DV3 T;  3AE6 A;  4MAL A;  3VR8 A;  2X00 A;  1I9B A;  2ZM0 A;  1EZ3 A;  3AEB A;  1KF6 A;  4JI1 T;  2YK0 A;  3ZPO A;  1LVK A;  4YXD A;  3C50 A;  3I0Q A;  4ALX A;  3S4U A;  3E22 E;  3FBZ A;  2M6B A;  4U31 A;  2CEA A;  5AQR B;  3ZCI A;  4CXX A;  2DI4 A;  2XSA A;  5J0Z A;  1NWM X;  1D0X A;  3ZLI A;  4IDQ A;  5LA6 E;  4OX9 T;  3PU8 A;  4HWC A;  4UVA B;  1ZEE A;  2R6G F;  3ZJ1 A;  3LDQ B;  2UZ6 A;  3AEE A;  2V7L A;  4U33 A;  3N2O A;  3AE7 A;  3BQI A;  2NR4 A;  2CWO A;  3R84 B;  4LML A;  4JI0 T;  5CFB A;  3P4S A;  2EHO A;  3JAE A;  5LYJ E;  2PFV A;  1XDO A;  3U8K A;  1YD8 G;  4O4I E;  5AQF B;  4LFC T;  3LJC A;  5ADX L;  5AQT B;  3KBT A;  1U4Q A;  3AA7 B;  2E5L T;  3PUX F;  5AFL A;  1N34 T;  4G63 A;  3JAD A;  3U8N A;  3T1H T;  4BQT A;  3PUA A;  4DV5 T;  4UV9 B;  4O4L E;  3OYX A;  4ZEY A;  2UU9 T;  1UUS A;  3J7Y q;  3VRA A;  2KXP B;  4ZOL E;  2X51 A;  5AFJ A;  5ABE A;  3KIN B;  3ONJ A;  3GN5 A;  3NKZ A;  1LVF A;  4H63 H;  2BBH A;  5FP3 A;  3H3M A;  2RPA A;  4ZR6 A;  5DJQ C;  4WV9 A;  4H9O C;  4HFC A;  3LK2 B;  2WAU A;  4YHH T;  3PTR B;  4TN7 B;  1CUN A;  3N9O A;  4ZI2 C;  3SIO A;  5IYZ E;  5LJM A;  1VCT A;  4ILU A;  1KNZ A;  1HNZ T;  4YSZ A;  4UEM A;  2CPT A;  3ZSS A;  4EZ4 A;  1O3X A;  4Z90 A;  2IAK A;  3ZMS B;  2EHO B;  2WNC A;  3UUB A;  1IBM T;  2D0U A;  5HEJ A;  2LEH A;  3C51 A;  2M67 A;  4X64 T;  4GK5 E;  1D0Z A;  2QYW A;  3P4R A;  3CX8 B;  4NXN T;  2KWI B;  5FXW A;  4TUY E;  3C98 B;  4AFT A;  4B3T T;  3PUV F;  4NPP A;  2H88 A;  4L5G A;  4U2Z A;  4CZZ B;  2XQ3 A;  3PUS A;  2H3R A;  4YT0 A;  4AKR B;  3HR0 A;  3P7I A;  4GKJ T;  4HFI A;  4EIW A;  3ZEF B;  2KZ7 B;  4ILC A;  2ACX A;  1N36 T;  4IIJ E;  1HNW T;  2E8I A;  1Y01 A;  2V6X A;  2B1E A;  4XAX B;  5H6R B;  3R6N A;  4LFA T;  2X9W A;  2VL0 A;  1OED E;  4EAH A;  2YOE A;  2UXC T;  3MK7 C;  3VRB A;  1YKH B;  2Z6E A;  4XHE A;  2NTX A;  1BR1 A;  3OVU A;  5HAX A;  2LSJ A;  5LOV E;  3I9Y A;  2W61 A;  2NW8 A;  2G0U A;  1WR0 A;  4ILA A;  2MOZ A;  2FJE A;  2BYP A;  3RIF A;  4B5D A;  3CML A;  4AQF A;  4HQP A;  2QVA A;  2Y57 A;  4AKG A;  3ZT5 A;  1WFD A;  1VRB A;  1I94 T;  5TVC A;  5HXE A;  5JDL A;  5KDM C;  5FNV E;  3WIP A;  1UX5 A;  2WDQ A;  1ZP0 A;  5IWA T;  1CHU A;  4OFZ A;  4J2C A;  3E08 A;  3WTJ A;  3ZJ2 A;  2BYR A;  4AQG A;  3LFM A;  5LBQ B;  3N9N A;  1UV6 A;  4KX6 A;  5L3G B;  5JRC A;  5LG3 A;  1U5P A;  1D0Y A;  5JDG A;  3T8O A;  5HWY A;  2CBI A;  3IEE A;  4I43 B;  4DV7 T;  3GN5 B;  3RYH E;  2IC9 A;  1JNZ A;  2BVL A;  2DWG A;  3TLW A;  3CKD A;  2X0Y A;  2W63 A;  2QRX A;  5HWX A;  1XMQ T;  1KNP A;  2F4V T;  5KX5 E;  3WTL A;  2VK9 A;  3KV6 A;  3P8C D;  4QXH B;  2QC1 B;  3JCF A;  3KV9 A;  4ZRU A;  5L4E A;  3A7M A;  5HCJ A;  2GK9 A;  2H7V C;  3PUR A;  4UM3 S;  4KBM B;  3AVS A;  4CN1 A;  1UK5 A;  5JQG E;  4YTN A;  5CO5 A;  2JIW A;  4OYK A;  3T4M A;  3Q5X A;  4P0A A;  5FY0 A;  5J2T E;  3PJA A;  3HKE E;  2K3W A;  3BQL A;  5BRX A;  4HTE A;  3EDV A;  2KSR A;  2ODV A;  4EXT A;  2WY2 A;  3SOL A;  4HFV A;  5EK2 A;  4DMW A;  4NIQ A;  4CI1 B;  3FHN A;  3OTO T;  4HWF A;  4DR6 T;  1OED B;  2WWV A;  3U8L A;  3K1S A;  3HKC E;  2VQE T;  4DR5 T;  4ZK4 A;  4QH5 A;  4U7Y A;  3RIU A;  3ZN1 B;  4AFG A;  4P1N A;  3HKD E;  3FZF B;  4ISS A;  4ZJS A;  4H9Q C;  1FMV A;  4DR4 T;  4ERR A;  2V5D A;  3OBV E;  5BMV E;  4F6R C;  5JME A;  5AQM B;  3UFG A;  4BA9 A;  3SS1 A;  2W00 A;  4X5T A;  1MMA A;  1S94 A;  3SQ6 A;  4BAY B;  1HR0 T;  3ZCJ A;  5AQL B;  4QAC A;  1FJG T;  4PJN A;  2RA1 A;  2C9T A;  4HN9 A;  3K3O A;  4PAG A;  1ZV4 X;  3L8R A;  3UUX B;  2YU2 A;  2ZJV A;  3CX7 B;  4JLE A;  4Z91 A;  3NZP A;  2K9A A;  4X1K E;  2WN9 A;  2XSB A;  4GOU A;  2NOX A;  3CK6 A;  4ZI3 C;  2HHH T;  3A5X A;  3AE1 A;  4AIU A;  4JI5 T;  2VKO A;  5AQV B;  3CQX C;  4IDP A;  2UXX B;  2XJ7 A;  3QK6 A;  4H9N C;  1Z0P A;  2J47 A;  2WS3 A;  4COF A;  1QSD A;  3FXD B;  2CA5 A;  2JMK A;  4ZI2 D;  4CXW A;  5FY1 A;  2Y6X A;  3AA1 B;  2YEV C;  3ZMU B;  5DAB A;  5AFH A;  4NUU A;  2WDR A;  1YW0 A;  4QAB A;  2CWY A;  2VWA A;  2JQQ A;  3DTO A;  4YFS A;  4NZB A;  4ADZ A;  3LBX A;  4BJM A;  5ABF B;  4EOZ B;  2X68 A;  3RQU A;  2E9X D;  2J62 A;  4PK5 A;  3UFE A;  2XQ6 A;  4AKI A;  3Q5D A;  4KHZ F;  5BP0 A;  3U8J A;  1MIV A;  4AXP A;  3K8P C;  4TWD A;  2A72 A;  1Y64 B;  5LGN B;  3C84 A;  4AKH A;  2XM1 A;  4LF5 T;  4UXN B;  3PUG A;  3OJA A;  4LF8 T;  3VHL A;  3RIU C;  3AEC A;  3A8Y C;  5ABG A;  5EK4 A;  3SFD A;  4DV2 T;  1SUM B;  4V1A v;  2MPK A;  2I6H A;  2WZI A;  3VKH A;  4L9I A;  1W0A A;  2ZM6 T;  1IJ5 A;  3DJB A;  2VAS A;  5J1G A;  3PJA J;  3FZM B;  3HA4 A;  4C90 A;  5F5W A;  4IDO A;  2WU5 A;  5L47 A;  4KHP T;  2Q9Q B;  2BS4 A;  2NWB A;  2BS3 A;  2LE8 A;  2LSG A;  3AE9 A;  3SQ9 A;  2DCF A;  1NEN A;  1OED A;  4QKN A;  4IDZ A;  2E9X C;  2VKH A;  2WWU A;  3EUH A;  5IUX A;  5AQK B;  3RX6 A;  1YQ3 A;  4DBR A;  2WQY A;  2CXF A;  1IZN B;  2OLT A;  4DUZ T;  1T72 A;  2BZB A;  4TZ4 C;  4EZ1 A;  3HL6 A;  2CBJ A;  4HFD A;  2XNU A;  3D0T A;  2BYN A;  2LJL A;  4IE5 A;  3UU3 A;  1HS7 A;  3UTK A;  4PJL A;  4IE7 A;  3RKO A;  4CI2 B;  2KND A;  5ETW A;  4LMK A;  4ZXL A;  4PK4 A;  4IL4 A;  2W0G A;  2P9B A;  4DMV A;  3CQG B;  3WAJ A;  4LF9 T;  2Y8D A;  4HFB A;  3ANW B;  4QXC B;  4ZHQ E;  2C5I T;  2WZY A;  2CCQ A; 
#chains in the Genus database with same CATH homology
 4ZRU A;  2VL0 A;  5L4E A;  2PH9 A;  2BG9 A;  4DBM A;  1OED E;  2XQA A;  2LKH A;  2BJ0 A;  4TNV A;  3C79 A;  5HCJ A;  5AFM B;  2X00 A;  4IRE A;  5J5I A;  2YOE A;  2YMD A;  2M6I A;  1I9B A;  2ZJV A;  3WTH A;  2XQ7 A;  4Z91 A;  4PIR A;  2LKG A;  2WN9 A;  4UM3 S;  4QH1 A;  3UU5 A;  3IGQ A;  3WTK A;  4A98 A;  2XQ9 A;  4ZZC A;  4TNW A;  5AFJ A;  3WTI A;  4XK9 A;  4XHE A;  5AFN A;  2XNT A;  5HEO A;  5CO5 A;  3RHW A;  5LXB A;  4UY2 A;  3T4M A;  4UM3 P;  5KZU A;  2XZ5 A;  3WTN A;  3PMZ A;  4ALX A;  3WTM A;  3PEO A;  5BRX A;  2ZJU A;  2M6B A;  4HFH A;  4ILA A;  4COF A;  3TLS A;  5L47 A;  2LLY A;  2KSR A;  2BYP A;  4ZR6 A;  3RIF A;  4AFH A;  3EI0 A;  5J0Z A;  4HFE A;  2PGZ A;  4TWF A;  4WV9 A;  4B5D A;  4HFC A;  4A97 A;  3ZDH A;  5HEG A;  5J5H A;  3LSV A;  3UQ7 A;  3SQ9 A;  5AIN A;  4HQP A;  2Y57 A;  5FJV A;  3WTO A;  3SIO A;  3JAF A;  1OED A;  3U8M A;  5AFM A;  5L4H A;  2UZ6 A;  2BG9 B;  5TVC A;  2X00 D;  3UU6 A;  3EHZ A;  5IUX A;  3WIP A;  5AFH A;  1OED B;  3U8L A;  2XYS A;  3RI5 A;  2XQ8 A;  3P4W A;  2Y7Y A;  2YME A;  2YN6 A;  4F8H A;  3GUA A;  4LML A;  4TWH A;  4LMJ A;  3WTJ A;  4Z90 A;  5CFB A;  3P50 A;  3UQ4 A;  2BR8 A;  4QAB A;  5AFK A;  4ZK4 A;  2BYR A;  3UUB A;  2WNC A;  4EZ1 A;  3JAE A;  2BYS A;  3ZDG A;  4UM1 A;  4QH5 A;  4NZB A;  4AFG A;  5HEJ A;  1UV6 A;  3U8K A;  4HFD A;  2XNU A;  4IL9 A;  3ZKR A;  2WNJ A;  5HEU A;  5LG3 A;  2BG9 C;  4ZJS A;  3EAM A;  2BYN A;  5SYO A;  3UU3 A;  4QH4 A;  3RQU A;  4ZZB A;  4AFT A;  2MAW A;  2Y58 A;  1OED C;  4ZK1 A;  2XQ6 A;  3TLU A;  5JME A;  2YKS A;  4LMK A;  5BP0 A;  2WNL A;  4NPP A;  3U8J A;  2XQ5 A;  3UU4 A;  2LM2 A;  4BFQ A;  5BW2 A;  2Y54 A;  2XQ3 A;  3UU8 A;  4IL4 A;  5AFL A;  4X5T A;  2W8G A;  2XNV A;  3TLW A;  2W8F A;  4ZJT A;  3JAD A;  4UXU A;  4ILB A;  4TWD A;  1UW6 A;  3U8N A;  2XZ6 A;  3C84 A;  3SH1 A;  3SQ6 A;  1UX2 A;  2Y56 A;  5HCM A;  5J5F A;  5KE4 A;  4HFI A;  5J5G A;  4QAC A;  4D01 A;  2BG9 E;  4BQT A;  4ILC A;  5HEH A;  4HFB A;  2XQ4 A;  2C9T A;  2XYT A;  4QAA A;  3WTL A;  3TLT A;  3TLV A;  4UM3 A;  2BR7 A;  3RIA A;  4FRR A;  2WZY A;  2QC1 B;  3RQW A;  2BYQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...