2XQ7A

Pentameric ligand gated ion channel glic in complex with cadmium ion (cd2+)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
310
structure length
310
Chain Sequence
b'PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLR4197 PROTEIN
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein
total genus 77
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq7A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq7A01
4ALXA 3RI5A 5CFBA 4NPPA 2BG9E 2MAWA 2BYPA 3UU6A 3WTNA 3C79A 2XNUA 5TVCA 4AFGA 5HEGA 5HEJA 2WNCA 4EZ1A 2XQ6A 4UM1A 3PEOA 2XQAA 4TWDA 1UX2A 2BYSA 4LMKA 3WTJA 4DBMA 4ZK1A 5HCMA 3UUBA 3C84A 2Y58A 1UV6A 2LKGA 4TWHA 4HQPA 4UY2A 3RIAA 4ILAA 5AFMB 4HFHA 2YN6A 5LG3A 4IREA 2X00D 4B5DA 3P4WA 4Z90A 2XNVA 5AFJA 3WTMA 4AFHA 2Y54A 5HEOA 4ZJSA 3WTOA 5AINA 5KE4A 3P50A 2ZJUA 2BG9C 3JAFA 4HFEA 3GUAA 3WTIA 5AFLA 4NZBA 4ZK4A 2YKSA 4A97A 2XZ5A 3UU4A 3TLTA 4ZJTA 4Z91A 4HFBA 4X5TA 4F8HA 3SQ9A 3WIPA 2XQ8A 5KZUA 2UZ6A 4COFA 3IGQA 2XQ3A 3RIFA 3WTKA 3WTLA 4HFCA 4QH1A 5HEUA 4BQTA 2PGZA 2M6BA 4ILBA 3U8JA 5FJVA 4UM3P 3EHZA 3U8MA 4IL4A 5J5FA 4TNWA 2M6IA 4XHEA 4FRRA 5J5GA 2YOEA 2WNLA 5J0ZA 2LKHA 2WNJA 2YMDA 5HCJA 4TNVA 4WV9A 3JAEA 2BYQA 5BRXA 2Y7YA 2YMEA 1I9BA 5AFHA 2LM2A 3UQ7A 4PIRA 3WTHA 2XNTA 5L4EA 4QAAA 5JMEA 2WZYA 4ILCA 4UXUA 5SYOA 2ZJVA 4D01A 4BFQA 5BW2A 3ZDHA 1OEDA 5HEHA 4HFDA 1UW6A 2BYNA 4ZR6A 3RQWA 3SH1A 2LLYA 2W8GA 2QC1B 3SIOA 2BYRA 3U8NA 5AFKA 2Y57A 3UU5A 5J5HA 3ZKRA 4LMLA 2BR7A 4TWFA 3JADA 5LXBA 3T4MA 2XQ9A 3TLSA 3UQ4A 4XK9A 1OEDE 3TLUA 2W8FA 4ZZBA 2VL0A 3TLVA 3TLWA 4UM3A 4HFIA 4QH5A 3PMZA 4IL9A 3RQUA 4QABA 4LMJA 3UU8A 2XYSA 3SQ6A 3RHWA 2Y56A 3U8KA 2XQ4A 2X00A 5CO5A 2BJ0A 2XQ5A 5BP0A 2BR8A 4QH4A 3EI0A 2WN9A 3U8LA 5L47A 5L4HA 5AFMA 4ZZCA 1OEDB 2BG9A 3UU3A 4ZRUA 2XQ7A 2PH9A 3EAMA 5AFNA 2BG9B 5J5IA 2XYTA 2KSRA 5IUXA 4A98A 4QACA 1OEDC 4UM3S 3LSVA 3ZDGA 2XZ6A 4AFTA 2C9TA
chains in the Genus database with same CATH superfamily
5ABHA 3PTRB 3OTOT 4U2YA 3ZLIA 1LKXA 2V6XA 4KMCA 3BK9A 4AFGA 1UX4A 2BS4A 4UM1A 4TX5A 4ZK1A 3AXJB 4JI4T 5JR9A 3OBVE 4YJ2E 1YXRA 4AI6A 5AFJA 4JI7T 3MA9A 3ZN0B 5HXCA 4GK0E 2WS3A 2CHOA 1O3XA 4GYRA 2DWKA 1HG2A 2V7IA 3ZT6A 2W63A 1HNXT 3RYCE 5LHGB 4CI1B 2FBWA 4CN1A 3V5UA 4JV5T 2IDOB 1IBKT 4CI3B 4KUMB 4ZI3D 2UXCT 2WZYA 3UFEA 4H9NC 5AQFB 1HNWT 3ZEFB 3J7Yq 4ASKA 3FB2A 4EYUA 5J2TE 4IGUA 2BS2A 5HXEA 4JEHB 4DR3T 3PMZA 3NRYA 1NEKA 3N9NA 5EK2A 4O2AE 3ZPOA 1QUUA 4X65T 3U8LA 5L47A 3AEAA 2WU2A 2BG9B 2CM0A 3N9QA 2XSAA 3LBXB 4PNIA 5J2UE 5IUXA 2D0TA 4NPPA 5IWAT 3U3IA 1L0VA 2MBGA 1N36T 4DBMA 4DBRA 5HCMA 3ETUA 5CJ5A 2HPLA 1W0BA 4HFHA 3PJAA 2J4GA 4OFZA 5F8PA 1CUNA 3RYIE 2W67A 4NZBA 2N2NA 4HWFA 4A97A 3ONXA 2XZ5A 2CWYA 2WBLA 3R84B 4IE6A 4DR7T 3NZQA 5JDLA 2LOPA 1W09A 5M4YA 3T8OA 4B3RT 2V7MA 4PFPA 2X0YA 2A3DA 1NAFA 4WV9A 5AQPB 3QUJA 4JLEA 5BMVE 1YQ4A 4UXUA 3ZCIA 2PTFA 2LLYA 1T8BA 1UK5A 5LXTE 3SIOA 4UVAB 5HAXA 3N2OA 3I1AA 2JRKA 5LXBA 5FXXA 5LNKA 5LA6E 1KEYA 4IIJE 2CXDA 4CXXA 2XHEB 4AXPA 3CQGB 1OEDB 3UU3A 4UELA 5L3DB 2VKHA 4QACA 5LOVE 2J1DG 1V9DA 2BG9E 5AQLB 5LJNA 3ZT7A 3AXJA 2Y8DA 2VURA 4LMKA 4WYVA 5DQWA 3RIAA 3O4XE 1VCTA 4Z90A 5JREA 3ZC0A 4JYAT 1LRZA 4ZI2C 4BJMA 4EAHA 3WTIA 1OWAA 1KFYA 3EUHA 5FVKA 4COFA 3P4SA 5EK3A 2WB5A 5ETWA 4FRRA 5CA0E 2KZ7B 2YDRA 4YSXA 4QAAA 4C90A 2ODVA 4X62T 2X67A 5AQRB 4P1NA 5JDNA 3MK7C 2LRLA 2QA7A 1IAPA 1UCUA 2NOXA 1X79A 4L0RA 2LSJA 1HCIA 4GK5E 1US7B 3ZMZB 4OYKA 4ANJA 2JPFA 2LHRA 4O8SA 2XQ5A 4EV6A 2ZLYA 1T72A 1WR0A 3UTKA 1Y64B 3O1HA 2BG9A 3LK2B 3O1IA 4DMWA 3KDSE 2FUPA 2YK0A 2IUBA 5LBMA 4ZXLA 2HN1A 4A98A 4X66T 4EEDA 2W4XA 4NXNT 2WSSV 4UEMA 4I43B 2IC6A 3ONLC 3RGLA 3UUBA 3UUXB 3AA7B 4JI8T 2YDSA 4HQPA 3CQXC 2CRBA 2Y6XA 5FVLA 3RYFE 3CKDA 4TV8E 4ZI2D 3FZMB 1MMNA 3KINB 2EHOA 4KBMB 3UU4A 4Z91A 4X5TA 3KVAA 2CHNA 2B1EA 2HHHT 3E22E 2CEAA 1IBMT 4ILBA 2V6YA 4TNWA 5AFUL 5JR9B 3J9X1 5J0ZA 3PU8A 3GWHA 5HCJA 2IMLA 5BRXA 3B5MA 2Y7YA 3PUAA 2BKOA 2IHR1 2HN2A 3C4WA 2GK9A 4HKAA 4ILUA 4AISA 3GA8A 3UU5A 3ZKRA 1HTJF 3ANWA 1MIWA 5C3JA 5JDGA 4HWIB 5LHHB 4X1KE 4ZHQE 4IL9A 2KT9A 4PFOA 2A72A 1FMWA 3SQ6A 3N9PA 3L3PA 2XY8B 3EI0A 3VKHA 2WU5A 2WDRA 2I0MA 4IHJE 4IE4A 2PH9A 3X1DA 1FJGT 3BQIA 1Y01A 2RA1A 2W0GA 3ZSTA 1HF8A 4XZCA 4ZR6A 3CVRA 2RPAA 2WM9A 4V1Av 4EZ1A 4DUYT 4X64T 4G2AA 3RC3A 1QLBA 4QXHB 4PW8A 3FZHB 1HFAA 5H6QB 5FNVE 2FJEA 3RRCA 5KXJA 1XNQT 2FJDA 3ZMVB 5AQIB 3AEFA 3LK3B 4U7YA 5JVDE 3WAKA 1Z8UA 4UVCB 4JI0T 3SS1A 4ZJTA 3RPUA 3RYHE 4NUUA 3H37A 3NWIA 4UM3P 2E9XD 3AA6B 2YMEA 1I9BA 2W66A 3WTHA 2K3WA 4BFQA 4PJJA 1I94T 2XM1A 5AFKA 4UF0A 1U5PA 4I4TE 5LHIB 3I0OA 1N33T 4JUYA 4QHOA 4CZZB 2BBJA 2E9XA 5JDHA 1M62A 3V5SA 4H63H 2CMRA 4CXWA 3ABVA 5FP3A 4EGWA 4A5XA 2XPKA 5ABEA 4P09A 4U2ZA 3C64A 4XAXB 5L2LA 2D5UA 2ES0A 5FXZA 5FL1A 3RLFF 2BKNA 5LGTB 4FI5A 2A9UA 1MIVA 3ZYLA 3CWZB 3WTOA 4IDOA 1EZ3A 4P0BA 1VOMA 4BJNA 3FXEB 3AE2A 2UXXB 4JI2T 3AE4A 2HH7A 3SFDA 3PDYA 2CWOA 2W00A 3B57A 4XHEA 4DV5T 3FZFB 5LGNB 4C91A 3SFEA 5AFHA 2LM2A 4PIRA 4ISSA 5BW2A 3TKLB 2K9AA 5HEHA 4EXTA 1E7PA 3HA4A 3EABA 4DVDA 5J5HA 4LMLA 4TWFA 4YXDA 3UQ4A 2VL0A 3JCFA 1BR4A 4X1IE 4H9QC 4QH5A 2Y56A 3AE3A 4IDQA 2BR8A 1ZEEA 2Q9QC 3CK6A 1KNZA 4ZZCA 3SOLA 2BS3A 4LF9T 2UXBT 1GQEA 2E5LT 3LSVA 4LF6T 3FBLA 2FJAA 2MAWA 2PBIA 3L8RA 5TVCA 2V5CA 2KMFA 2X51A 2WNCA 3PUQA 3WTJA 4WW0A 4Z8XA 5JDMA 2YN6A 3P8CD 3P4WA 3ZMUB 3C4XA 2X9XA 3C98B 2ZJUA 4O4HE 4HFEA 4AQGA 2XAJB 4O4LE 4LF7T 2UZ6A 3KFWX 1ZKEA 3U8JA 2KLQA 2R6GF 1J5ET 2WY2A 4EOZB 2XAQB 2L9QA 2L8KA 2MOZA 2ZM6T 4ILCA 4JEUB 2WDVA 4L9IA 2EHOB 4QX8B 2BYRA 1HNZT 2XAHB 2LM9A 1JNRA 3TLUA 3GN5A 3OYZA 2V6YB 4DUZT 2XYSA 5KX5E 3RHWA 3MACA 2NW9A 5CO5A 3AEDA 2Q9QD 2WN9A 2UXDT 2IC9A 3NVOA 3QC9A 3VR8A 2XJ7A 3H3AA 5AQNB 1XNRT 2A2FX 4AFTA 4ALXA 1SE7A 3ANWB 4OX9T 2B76A 4WNKA 3CX6B 1UX5A 3PUGA 5AQMB 4B3TT 1W9RA 2CXFA 1MNEA 3M65A 4AQFC 5AQJB 2WDQA 3KV4A 3IBPA 5HEOA 3UT5E 2Y48B 2NWBA 3GUAA 2NTXA 2JQKA 4TZ4C 4YT0A 2XQ3A 2C5IT 4AKLA 3N9LA 3K8PC 2PJQA 1HS7A 3U8MA 2V7LA 2E8IA 2WNLA 4QX7B 1UGOA 2NW8A 1BR2A 2LEHA 1ZHCA 2W62A 2BYNA 1D1AA 4UIGA 2KINB 3K3NA 3UUMA 5ABFB 1IBLT 1VRBA 5TAOA 4MHCA 1MMDA 3HL6A 3RKGA 2V7JA 4K0KT 5FMNA 4YSZA 2ZM0A 3KVBA 4LFCT 3ZSSA 4QH4A 2KWIB 4AKGA 4U74A 4YTNA 2V26A 5CB4E 2P9BA 2K24A 3HKBE 4UF0B 1OEDC 2J47A 2D9DA 2OLTA 1T7SA 4LF4T 1D1CA 3C79A 4X20E 5IYZE 3HI2A 3OVUA 3M3ZB 2XQ6A 4DR6T 2LSKA 3QB5K 5CA1E 1UX2A 3EVYA 2CBIA 2E9XB 4DV6T 3VHLA 4TWHA 4UY2A 3CPZA 3AE5A 3HKEE 4OK0A 4WBNE 2CLYB 5AINA 5KE4A 3HKDE 3P50A 4HE8A 3QOFA 3JAFA 4UR9A 3Q5EA 1HX8A 2VK9A 3IGQA 4NUVA 3CQCB 5JQGE 3PU3A 3IEEA 4WBOA 5FJVA 2UUAT 4IL4A 1XWMA 2LSIA 1DU2A 2D2SA 2Z6EA 4CXYA 1J1JA 3PUWF 5A1LA 3NZPA 2QYWA 5ADXL 4F6RC 3RQWA 3QK6A 4HFVA 4B6XA 4QWNB 3KV9A 3KV6A 1KNRA 4O4IE 2BKPA 4TV9E 2FJBA 5H6RB 2BBHA 4HGAA 4DV7T 4ZZBA 3KBTA 2X9YA 5ABGA 4J2CA 2C5KT 4PAGA 3A5XA 5J1GA 5DABA 5AFMA 2VQET 5AQUB 2YU1A 2WWUA 5JDFA 3EAMA 2WMOA 2WZIA 5J5IA 2X9WA 1HR0T 2WAUA 4UV8B 1D0XA 2MTQA 4U3CA 5AQSB 2BYPA 2LSGA 2VVNA 3IA3A 4UVBB 1U4QA 4TWDA 2X0HA 3C84A 2E5VA 4IREA 3PUVF 2X00D 3SRZA 2DCFA 2JQQA 4XBFB 3Q5XA 3KBUA 3EDUA 4O4JE 5E0OA 1D1BA 3VU7H 4BAYB 2XQ8A 2V8SV 4PJMA 2WMNA 3RF1A 5DQVA 2PGZA 4DV0T 2M6IA 5F3JA 1M7KA 3D0TA 5HWXA 3RRWA 1IZNB 3QNUA 2VKJA 2D0UA 3AA0B 2F4VT 3AEGA 1J5WA 3AA1B 5JR9C 5EK4A 3ZT5A 5ABFA 2NR4A 2XUEA 2W8GA 4I0UA 5LP6E 2W61A 3RIUC 4ZOLE 4DNDA 3U78A 2XQ9A 5LCYA 2WQYA 4UM3A 2IAKA 2DHRA 3U8KA 4A56A 3KV5A 2IW5B 3E0ZA 3S4UA 2V7KA 2DWGA 3RX6A 2LOSA 1NENA 2VVSA 2XYTA 2VWAA 2VL8A 3OJAA 2JMHA 3F31A 2N9DA 3GN5B 3NBXX 2E2AA 3C50A 3AE6A 4B5DA 3RC8A 1R8IA 2K48A 4H9OC 2OV9A 3NRXA 4DV3T 4ZI3C 5FYMA 4EB6E 1FIOA 1BR1A 1LVKA 3TLTA 2DI4A 1YKHB 5FY7A 4I55E 5F5WA 5KZUA 2JMKA 2H7OA 3Q9DA 3ZJ1A 5AQTB 4QKNA 3AE8A 1YKEB 3HKCE 3QB5A 5L3GB 3G06A 4DBQA 3IF8B 1KK7A 4Q25A 2QC1B 4LF5T 5FKYA 2Y57A 3AEEA 1SHZC 2X68A 4EZHA 3TLSA 3O9XA 2ZMAA 4H9RC 1BR0A 2W8FA 3F57A 4HFIA 2N1GA 3OPCA 3P7IA 3UU8A 2UUCT 4IE0A 2W2UA 2G0UA 3R6NA 3AVRA 2VASA 5L3BB 1XDOA 3PUZF 2H3RA 3PURA 5AQHB 2DNXA 5CFBA 2I59A 3RIUA 2XASB 4KX6A 3ZYKA 4M1PA 5HEJA 1W0AA 3BQKA 3UUNA 3PEOA 5FXVA 2Y58A 4ILAA 4YJ3E 3WTMA 4MFRA 3K3OA 3BQLA 1NWMX 2PFVA 3OKQA 4ZK4A 2LT3A 2YKSA 1CHUA 4JI5T 4LFAT 5HXSA 2I6HA 2V1DB 4H9PC 2LJLA 4ZS3A 2XZEA 4KP3C 5LBQB 3WI3A 2BVLA 2WCAA 2M6BA 4YFSA 4PK6A 1ZV4X 5JTGA 2WNJA 5JH7E 2CE7A 5L4EA 4D01A 3L09A 2ZJVA 3ZDHA 1UW6A 2YINA 3AE1A 5L3FB 5AQKB 3PUYF 3U8NA 4HWHA 2H89A 3DP7A 3PV0F 3VRAA 3LJCA 3TLWA 4GKKT 4HTEA 3UULA 2KXPB 3A8YC 2BJ0A 4AIUA 2CXLA 1KNPA 2X66A 4K0UA 4GKJT 2L3LA 2XQ7A 5HWYA 3ZYMA 4YTPA 2WZHA 4CQIA 5BP0A 2C9TA 3N5LA 1E2AA 4OYJA 2DLRA 2XQAA 4AKRB 3I0QA 4GIWA 1UV6A 2MYSA 3FHNA 4U72A 5AFMB 2HPJA 4ZJSA 1AJ3A 2BG9C 2LE8A 3ETVA 3ZMTB 2QRXA 5AQGB 1JNZA 4N78D 1Z0PA 3EDVA 4EZ4A 4NXMT 4U7IA 5FXWA 3RIFA 1QSDA 3WTKA 1D0ZA 4ADZA 4QH1A 2V5DA 4O2BE 3DJBA 4YHJA 4DR4T 3PUSA 4DIDB 3EHZA 1SA0E 4DR2T 3T1YT 2Q9QA 2X0LB 3Q5DA 2BYQA 1ZOYA 3N9OA 5JRCA 3UQ7A 2XNTA 3PUXF 3LFMA 2WP9A 4HFDA 3AEBA 3CMLA 2H88A 1I6ZA 5AQQB 4GOUA 4TN7B 4L5GA 5EZYE 2EHOC 4P0AA 1SUMB 4U33A 3CX7B 1WFDA 3JC6C 4LF8T 3ZCJA 2C5JA 2IIUA 4DR5T 2XQ4A 5HXHA 1N34T 3NKZA 4JBWF 4QXBB 2CBJA 2VKOA 3Q2MA 2YDQA 4PK5A 4CI2B 4ZRUA 4DMVA 3N9MA 5AFNA 1HX1B 3VR9A 4YTMA 2LHNA 2NP9A 2XTLA 3AE7A 3GMIA 3N2GE 3AB3B 4PK4A 1XDPA 3UU6A 4ERRA 2XNUA 3MZKB 5CGMA 5GONE 3T1HT 4YSYA 1MMAA 3DTOA 2LKGA 4DR1T 3Q5WA 3ZMSB 4IDNA 4IDPA 2UU9T 4EYYR 3L39A 1FMVA 4MBQA 3UFGA 5AQOB 2XNVA 1YW0A 2Y54A 2BVMA 4YHHT 4E7SA 4GYSA 2SPCA 3MXZA 1WYBA 3ONJA 2LRKA 3CX8B 4KHPT 1YQ3A 3FBZA 2VB6A 4DV2T 4CN4A 4KHZF 1WLXA 5J5GA 2LSYA 2YMDA 4G63A 3JAEA 4JI6T 1H7CA 2XM2A 5SYOA 5LYJE 3AE9A 3SH1A 3WAJA 4LFBT 3LBXA 3I9WA 2JQ9A 4FJOA 3AAEB 3ESLA 2EHOD 3C4ZA 3JADA 4XK9A 1OEDE 1E1HB 2RP4A 4UXNB 5DJQC 1N32T 5LMUT 3W15B 3A7MA 3FZLB 5LJMA 3JC6D 1UURA 4AQFA 3P4QA 4PJNA 2OA5A 5L4HA 3AAAB 3I9YA 4YLHA 2JIWA 4MALA 3H3MA 3E08A 4UM3S 3SQ9A 2XZ6A 5HXRA 1XZYA 4AKIA 4HWDA 4QXCB 4HWCA 2BYSA 3PE0A 5KMGP 3K3QC 2KNDA 3HR0A 4E7ZA 1S35A 1IJ6A 4DO0A 1LVFA 5LG3A 2E9XC 1ZP0A 4AFHA 2XAGB 3VRBA 2CLYC 3F2EA 3RH3A 4ZEYA 2QGSA 4KI0F 2KWHA 1KF6A 2CPTA 2VQFT 4HFBA 4TUYE 3WIPA 2NW7A 4IDZA 1IJ5A 2XAFB 4BA9A 1T98A 3WTLA 1WRDA 2J62A 4IE7A 4BQTA 2ZM8A 5J5FA 2YOEA 5JDQA 2LKHA 2X9HA 4CN6A 2AXDS 2C0SA 4TNVA 4H9SE 2VKDA 5LG4A 4ZS2A 5JMEA 4H63V 4HEAA 1XMOT 1OEDA 2XQYA 3ZC1A 5LGUB 4NIQA 4ZI7E 2BR7A 2JJ9A 5LB7B 2M67A 3RQUA 4UV9B 2X00A 3N2KE 1OXZA 3P4RA 4PJLA 3LK42 2ZM2A 3ZN1B 2XSBA 3B13A 5AQVB 4EEBA 3SWHA 1XMQT 1G73A 4AKHA 5C8YE 2JQHA 3RI5A 4JI1T 3WTNA 1FEWA 4U31A 2MPKA 5HEGA 4DV1T 2CCQA 1WR6A 3P4PA 2K5BB 3VKGA 2ACXA 5BR8T 1D0YA 4MLKA 4AQYT 3LDQB 1HG5A 4B3MT 2PG8A 4ISTA 1WYCA 1X9BA 5IHYA 2ODUA 2CA5A 5AFLA 3AAIA 2WWVA 3O1JA 3IHRA 4F8HA 1UUSA 4I50E 4HFCA 5HEUA 1WCRA 5FY0A 1S94A 4HN9A 5C2TA 1MMGA 2AE9A 3ZJ2A 4WZXA 5FL0A 5L3CB 5HYAA 3MKDA 2YU2A 4IT4A 3MJXA 2QVAA 4YY3T 1VCSA 2ACZA 1G8XA 2YEVC 3OYXA 4B3ST 2UUBT 2BDEA 2NTYA 5FY1A 3RKOA 3T4MA 3C51A 5LMNT 3TLVA 3CIRA 1MNDA 2Q9QB 2DL1A 4QABA 4LMJA 3AVSA 3K1SA 3PJAJ 5KDMC 1B7TA 5L3EB 4EIWA 5JRCB 3FZKB 2BZBA 4DV4T 1YD8G 3AECA 1MIYA 2UXNB 3LG7A 4X1YE 4IE5A 4OHFA 3FXDB 2H7VC 2KSRA 4JI3T 3ZDGA
chains in the Genus database with same CATH topology
4ALXA 3RI5A 5CFBA 4NPPA 2BG9E 2MAWA 2BYPA 3UU6A 3WTNA 3C79A 2XNUA 5TVCA 4AFGA 5HEGA 5HEJA 2WNCA 4EZ1A 2XQ6A 4UM1A 3PEOA 2XQAA 4TWDA 1UX2A 2BYSA 4LMKA 3WTJA 4DBMA 4ZK1A 5HCMA 3UUBA 3C84A 2Y58A 1UV6A 2LKGA 4TWHA 4HQPA 4UY2A 3RIAA 4ILAA 5AFMB 4HFHA 2YN6A 5LG3A 4IREA 2X00D 4B5DA 3P4WA 4Z90A 2XNVA 5AFJA 3WTMA 4AFHA 2Y54A 5HEOA 4ZJSA 3WTOA 5AINA 5KE4A 3P50A 2ZJUA 2BG9C 3JAFA 4HFEA 3GUAA 3WTIA 5AFLA 4NZBA 4ZK4A 2YKSA 4A97A 2XZ5A 3UU4A 3TLTA 4ZJTA 4Z91A 4HFBA 4X5TA 4F8HA 3SQ9A 3WIPA 2XQ8A 5KZUA 2UZ6A 4COFA 3IGQA 2XQ3A 3RIFA 3WTKA 3WTLA 4HFCA 4QH1A 5HEUA 4BQTA 2PGZA 2M6BA 4ILBA 3U8JA 5FJVA 4UM3P 3EHZA 3U8MA 4IL4A 5J5FA 4TNWA 2M6IA 4XHEA 4FRRA 5J5GA 2YOEA 2WNLA 5J0ZA 2LKHA 2WNJA 2YMDA 5HCJA 4TNVA 4WV9A 3JAEA 2BYQA 5BRXA 2Y7YA 2YMEA 1I9BA 5AFHA 2LM2A 3UQ7A 4PIRA 3WTHA 2XNTA 5L4EA 4QAAA 5JMEA 2WZYA 4ILCA 4UXUA 5SYOA 2ZJVA 4D01A 4BFQA 5BW2A 3ZDHA 1OEDA 5HEHA 4HFDA 1UW6A 2BYNA 4ZR6A 3RQWA 3SH1A 2LLYA 2W8GA 2QC1B 3SIOA 2BYRA 3U8NA 5AFKA 2Y57A 3UU5A 5J5HA 3ZKRA 4LMLA 2BR7A 4TWFA 3JADA 5LXBA 3T4MA 2XQ9A 3TLSA 3UQ4A 4XK9A 1OEDE 3TLUA 2W8FA 4ZZBA 2VL0A 3TLVA 3TLWA 4UM3A 4HFIA 4QH5A 3PMZA 4IL9A 3RQUA 4QABA 4LMJA 3UU8A 2XYSA 3SQ6A 3RHWA 2Y56A 3U8KA 2XQ4A 2X00A 5CO5A 2BJ0A 2XQ5A 5BP0A 2BR8A 4QH4A 3EI0A 2WN9A 3U8LA 5L47A 5L4HA 5AFMA 4ZZCA 1OEDB 2BG9A 3UU3A 4ZRUA 2XQ7A 2PH9A 3EAMA 5AFNA 2BG9B 5J5IA 2XYTA 2KSRA 5IUXA 4A98A 4QACA 1OEDC 4UM3S 3LSVA 3ZDGA 2XZ6A 4AFTA 2C9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ALX A;  3RI5 A;  5CFB A;  4NPP A;  2BG9 E;  2MAW A;  2BYP A;  3UU6 A;  3WTN A;  3C79 A;  2XNU A;  5TVC A;  4AFG A;  5HEG A;  5HEJ A;  2WNC A;  4EZ1 A;  2XQ6 A;  4UM1 A;  3PEO A;  2XQA A;  4TWD A;  1UX2 A;  2BYS A;  4LMK A;  3WTJ A;  4DBM A;  4ZK1 A;  5HCM A;  3UUB A;  3C84 A;  2Y58 A;  1UV6 A;  2LKG A;  4TWH A;  4HQP A;  4UY2 A;  3RIA A;  4ILA A;  5AFM B;  4HFH A;  2YN6 A;  5LG3 A;  4IRE A;  2X00 D;  4B5D A;  3P4W A;  4Z90 A;  2XNV A;  5AFJ A;  3WTM A;  4AFH A;  2Y54 A;  5HEO A;  4ZJS A;  3WTO A;  5AIN A;  5KE4 A;  3P50 A;  2ZJU A;  2BG9 C;  3JAF A;  4HFE A;  3GUA A;  3WTI A;  5AFL A;  4NZB A;  4ZK4 A;  2YKS A;  4A97 A;  2XZ5 A;  3UU4 A;  3TLT A;  4ZJT A;  4Z91 A;  4HFB A;  4X5T A;  4F8H A;  3SQ9 A;  3WIP A;  2XQ8 A;  5KZU A;  2UZ6 A;  4COF A;  3IGQ A;  2XQ3 A;  3RIF A;  3WTK A;  3WTL A;  4HFC A;  4QH1 A;  5HEU A;  4BQT A;  2PGZ A;  2M6B A;  4ILB A;  3U8J A;  5FJV A;  4UM3 P;  3EHZ A;  3U8M A;  4IL4 A;  5J5F A;  4TNW A;  2M6I A;  4XHE A;  4FRR A;  5J5G A;  2YOE A;  2WNL A;  5J0Z A;  2LKH A;  2WNJ A;  2YMD A;  5HCJ A;  4TNV A;  4WV9 A;  3JAE A;  2BYQ A;  5BRX A;  2Y7Y A;  2YME A;  1I9B A;  5AFH A;  2LM2 A;  3UQ7 A;  4PIR A;  3WTH A;  2XNT A;  5L4E A;  4QAA A;  5JME A;  2WZY A;  4ILC A;  4UXU A;  5SYO A;  2ZJV A;  4D01 A;  4BFQ A;  5BW2 A;  3ZDH A;  1OED A;  5HEH A;  4HFD A;  1UW6 A;  2BYN A;  4ZR6 A;  3RQW A;  3SH1 A;  2LLY A;  2W8G A;  2QC1 B;  3SIO A;  2BYR A;  3U8N A;  5AFK A;  2Y57 A;  3UU5 A;  5J5H A;  3ZKR A;  4LML A;  2BR7 A;  4TWF A;  3JAD A;  5LXB A;  3T4M A;  2XQ9 A;  3TLS A;  3UQ4 A;  4XK9 A;  1OED E;  3TLU A;  2W8F A;  4ZZB A;  2VL0 A;  3TLV A;  3TLW A;  4UM3 A;  4HFI A;  4QH5 A;  3PMZ A;  4IL9 A;  3RQU A;  4QAB A;  4LMJ A;  3UU8 A;  2XYS A;  3SQ6 A;  3RHW A;  2Y56 A;  3U8K A;  2XQ4 A;  2X00 A;  5CO5 A;  2BJ0 A;  2XQ5 A;  5BP0 A;  2BR8 A;  4QH4 A;  3EI0 A;  2WN9 A;  3U8L A;  5L47 A;  5L4H A;  5AFM A;  4ZZC A;  1OED B;  2BG9 A;  3UU3 A;  4ZRU A;  2XQ7 A;  2PH9 A;  3EAM A;  5AFN A;  2BG9 B;  5J5I A;  2XYT A;  2KSR A;  5IUX A;  4A98 A;  4QAC A;  1OED C;  4UM3 S;  3LSV A;  3ZDG A;  2XZ6 A;  4AFT A;  2C9T A; 
#chains in the Genus database with same CATH topology
 5ABH A;  3PTR B;  3OTO T;  4U2Y A;  3ZLI A;  1LKX A;  2V6X A;  4KMC A;  3BK9 A;  4AFG A;  1UX4 A;  2BS4 A;  4UM1 A;  4TX5 A;  4ZK1 A;  3AXJ B;  4JI4 T;  5JR9 A;  3OBV E;  4YJ2 E;  1YXR A;  4AI6 A;  5AFJ A;  4JI7 T;  3MA9 A;  3ZN0 B;  5HXC A;  4GK0 E;  2WS3 A;  2CHO A;  1O3X A;  4GYR A;  2DWK A;  1HG2 A;  2V7I A;  3ZT6 A;  2W63 A;  1HNX T;  3RYC E;  5LHG B;  4CI1 B;  2FBW A;  4CN1 A;  3V5U A;  4JV5 T;  2IDO B;  1IBK T;  4CI3 B;  4KUM B;  4ZI3 D;  2UXC T;  2WZY A;  3UFE A;  4H9N C;  5AQF B;  1HNW T;  3ZEF B;  3J7Y q;  4ASK A;  3FB2 A;  4EYU A;  5J2T E;  4IGU A;  2BS2 A;  5HXE A;  4JEH B;  4DR3 T;  3PMZ A;  3NRY A;  1NEK A;  3N9N A;  5EK2 A;  4O2A E;  3ZPO A;  1QUU A;  4X65 T;  3U8L A;  5L47 A;  3AEA A;  2WU2 A;  2BG9 B;  2CM0 A;  3N9Q A;  2XSA A;  3LBX B;  4PNI A;  5J2U E;  5IUX A;  2D0T A;  4NPP A;  5IWA T;  3U3I A;  1L0V A;  2MBG A;  1N36 T;  4DBM A;  4DBR A;  5HCM A;  3ETU A;  5CJ5 A;  2HPL A;  1W0B A;  4HFH A;  3PJA A;  2J4G A;  4OFZ A;  5F8P A;  1CUN A;  3RYI E;  2W67 A;  4NZB A;  2N2N A;  4HWF A;  4A97 A;  3ONX A;  2XZ5 A;  2CWY A;  2WBL A;  3R84 B;  4IE6 A;  4DR7 T;  3NZQ A;  5JDL A;  2LOP A;  1W09 A;  5M4Y A;  3T8O A;  4B3R T;  2V7M A;  4PFP A;  2X0Y A;  2A3D A;  1NAF A;  4WV9 A;  5AQP B;  3QUJ A;  4JLE A;  5BMV E;  1YQ4 A;  4UXU A;  3ZCI A;  2PTF A;  2LLY A;  1T8B A;  1UK5 A;  5LXT E;  3SIO A;  4UVA B;  5HAX A;  3N2O A;  3I1A A;  2JRK A;  5LXB A;  5FXX A;  5LNK A;  5LA6 E;  1KEY A;  4IIJ E;  2CXD A;  4CXX A;  2XHE B;  4AXP A;  3CQG B;  1OED B;  3UU3 A;  4UEL A;  5L3D B;  2VKH A;  4QAC A;  5LOV E;  2J1D G;  1V9D A;  2BG9 E;  5AQL B;  5LJN A;  3ZT7 A;  3AXJ A;  2Y8D A;  2VUR A;  4LMK A;  4WYV A;  5DQW A;  3RIA A;  3O4X E;  1VCT A;  4Z90 A;  5JRE A;  3ZC0 A;  4JYA T;  1LRZ A;  4ZI2 C;  4BJM A;  4EAH A;  3WTI A;  1OWA A;  1KFY A;  3EUH A;  5FVK A;  4COF A;  3P4S A;  5EK3 A;  2WB5 A;  5ETW A;  4FRR A;  5CA0 E;  2KZ7 B;  2YDR A;  4YSX A;  4QAA A;  4C90 A;  2ODV A;  4X62 T;  2X67 A;  5AQR B;  4P1N A;  5JDN A;  3MK7 C;  2LRL A;  2QA7 A;  1IAP A;  1UCU A;  2NOX A;  1X79 A;  4L0R A;  2LSJ A;  1HCI A;  4GK5 E;  1US7 B;  3ZMZ B;  4OYK A;  4ANJ A;  2JPF A;  2LHR A;  4O8S A;  2XQ5 A;  4EV6 A;  2ZLY A;  1T72 A;  1WR0 A;  3UTK A;  1Y64 B;  3O1H A;  2BG9 A;  3LK2 B;  3O1I A;  4DMW A;  3KDS E;  2FUP A;  2YK0 A;  2IUB A;  5LBM A;  4ZXL A;  2HN1 A;  4A98 A;  4X66 T;  4EED A;  2W4X A;  4NXN T;  2WSS V;  4UEM A;  4I43 B;  2IC6 A;  3ONL C;  3RGL A;  3UUB A;  3UUX B;  3AA7 B;  4JI8 T;  2YDS A;  4HQP A;  3CQX C;  2CRB A;  2Y6X A;  5FVL A;  3RYF E;  3CKD A;  4TV8 E;  4ZI2 D;  3FZM B;  1MMN A;  3KIN B;  2EHO A;  4KBM B;  3UU4 A;  4Z91 A;  4X5T A;  3KVA A;  2CHN A;  2B1E A;  2HHH T;  3E22 E;  2CEA A;  1IBM T;  4ILB A;  2V6Y A;  4TNW A;  5AFU L;  5JR9 B;  3J9X 1;  5J0Z A;  3PU8 A;  3GWH A;  5HCJ A;  2IML A;  5BRX A;  3B5M A;  2Y7Y A;  3PUA A;  2BKO A;  2IHR 1;  2HN2 A;  3C4W A;  2GK9 A;  4HKA A;  4ILU A;  4AIS A;  3GA8 A;  3UU5 A;  3ZKR A;  1HTJ F;  3ANW A;  1MIW A;  5C3J A;  5JDG A;  4HWI B;  5LHH B;  4X1K E;  4ZHQ E;  4IL9 A;  2KT9 A;  4PFO A;  2A72 A;  1FMW A;  3SQ6 A;  3N9P A;  3L3P A;  2XY8 B;  3EI0 A;  3VKH A;  2WU5 A;  2WDR A;  2I0M A;  4IHJ E;  4IE4 A;  2PH9 A;  3X1D A;  1FJG T;  3BQI A;  1Y01 A;  2RA1 A;  2W0G A;  3ZST A;  1HF8 A;  4XZC A;  4ZR6 A;  3CVR A;  2RPA A;  2WM9 A;  4V1A v;  4EZ1 A;  4DUY T;  4X64 T;  4G2A A;  3RC3 A;  1QLB A;  4QXH B;  4PW8 A;  3FZH B;  1HFA A;  5H6Q B;  5FNV E;  2FJE A;  3RRC A;  5KXJ A;  1XNQ T;  2FJD A;  3ZMV B;  5AQI B;  3AEF A;  3LK3 B;  4U7Y A;  5JVD E;  3WAK A;  1Z8U A;  4UVC B;  4JI0 T;  3SS1 A;  4ZJT A;  3RPU A;  3RYH E;  4NUU A;  3H37 A;  3NWI A;  4UM3 P;  2E9X D;  3AA6 B;  2YME A;  1I9B A;  2W66 A;  3WTH A;  2K3W A;  4BFQ A;  4PJJ A;  1I94 T;  2XM1 A;  5AFK A;  4UF0 A;  1U5P A;  4I4T E;  5LHI B;  3I0O A;  1N33 T;  4JUY A;  4QHO A;  4CZZ B;  2BBJ A;  2E9X A;  5JDH A;  1M62 A;  3V5S A;  4H63 H;  2CMR A;  4CXW A;  3ABV A;  5FP3 A;  4EGW A;  4A5X A;  2XPK A;  5ABE A;  4P09 A;  4U2Z A;  3C64 A;  4XAX B;  5L2L A;  2D5U A;  2ES0 A;  5FXZ A;  5FL1 A;  3RLF F;  2BKN A;  5LGT B;  4FI5 A;  2A9U A;  1MIV A;  3ZYL A;  3CWZ B;  3WTO A;  4IDO A;  1EZ3 A;  4P0B A;  1VOM A;  4BJN A;  3FXE B;  3AE2 A;  2UXX B;  4JI2 T;  3AE4 A;  2HH7 A;  3SFD A;  3PDY A;  2CWO A;  2W00 A;  3B57 A;  4XHE A;  4DV5 T;  3FZF B;  5LGN B;  4C91 A;  3SFE A;  5AFH A;  2LM2 A;  4PIR A;  4ISS A;  5BW2 A;  3TKL B;  2K9A A;  5HEH A;  4EXT A;  1E7P A;  3HA4 A;  3EAB A;  4DVD A;  5J5H A;  4LML A;  4TWF A;  4YXD A;  3UQ4 A;  2VL0 A;  3JCF A;  1BR4 A;  4X1I E;  4H9Q C;  4QH5 A;  2Y56 A;  3AE3 A;  4IDQ A;  2BR8 A;  1ZEE A;  2Q9Q C;  3CK6 A;  1KNZ A;  4ZZC A;  3SOL A;  2BS3 A;  4LF9 T;  2UXB T;  1GQE A;  2E5L T;  3LSV A;  4LF6 T;  3FBL A;  2FJA A;  2MAW A;  2PBI A;  3L8R A;  5TVC A;  2V5C A;  2KMF A;  2X51 A;  2WNC A;  3PUQ A;  3WTJ A;  4WW0 A;  4Z8X A;  5JDM A;  2YN6 A;  3P8C D;  3P4W A;  3ZMU B;  3C4X A;  2X9X A;  3C98 B;  2ZJU A;  4O4H E;  4HFE A;  4AQG A;  2XAJ B;  4O4L E;  4LF7 T;  2UZ6 A;  3KFW X;  1ZKE A;  3U8J A;  2KLQ A;  2R6G F;  1J5E T;  2WY2 A;  4EOZ B;  2XAQ B;  2L9Q A;  2L8K A;  2MOZ A;  2ZM6 T;  4ILC A;  4JEU B;  2WDV A;  4L9I A;  2EHO B;  4QX8 B;  2BYR A;  1HNZ T;  2XAH B;  2LM9 A;  1JNR A;  3TLU A;  3GN5 A;  3OYZ A;  2V6Y B;  4DUZ T;  2XYS A;  5KX5 E;  3RHW A;  3MAC A;  2NW9 A;  5CO5 A;  3AED A;  2Q9Q D;  2WN9 A;  2UXD T;  2IC9 A;  3NVO A;  3QC9 A;  3VR8 A;  2XJ7 A;  3H3A A;  5AQN B;  1XNR T;  2A2F X;  4AFT A;  4ALX A;  1SE7 A;  3ANW B;  4OX9 T;  2B76 A;  4WNK A;  3CX6 B;  1UX5 A;  3PUG A;  5AQM B;  4B3T T;  1W9R A;  2CXF A;  1MNE A;  3M65 A;  4AQF C;  5AQJ B;  2WDQ A;  3KV4 A;  3IBP A;  5HEO A;  3UT5 E;  2Y48 B;  2NWB A;  3GUA A;  2NTX A;  2JQK A;  4TZ4 C;  4YT0 A;  2XQ3 A;  2C5I T;  4AKL A;  3N9L A;  3K8P C;  2PJQ A;  1HS7 A;  3U8M A;  2V7L A;  2E8I A;  2WNL A;  4QX7 B;  1UGO A;  2NW8 A;  1BR2 A;  2LEH A;  1ZHC A;  2W62 A;  2BYN A;  1D1A A;  4UIG A;  2KIN B;  3K3N A;  3UUM A;  5ABF B;  1IBL T;  1VRB A;  5TAO A;  4MHC A;  1MMD A;  3HL6 A;  3RKG A;  2V7J A;  4K0K T;  5FMN A;  4YSZ A;  2ZM0 A;  3KVB A;  4LFC T;  3ZSS A;  4QH4 A;  2KWI B;  4AKG A;  4U74 A;  4YTN A;  2V26 A;  5CB4 E;  2P9B A;  2K24 A;  3HKB E;  4UF0 B;  1OED C;  2J47 A;  2D9D A;  2OLT A;  1T7S A;  4LF4 T;  1D1C A;  3C79 A;  4X20 E;  5IYZ E;  3HI2 A;  3OVU A;  3M3Z B;  2XQ6 A;  4DR6 T;  2LSK A;  3QB5 K;  5CA1 E;  1UX2 A;  3EVY A;  2CBI A;  2E9X B;  4DV6 T;  3VHL A;  4TWH A;  4UY2 A;  3CPZ A;  3AE5 A;  3HKE E;  4OK0 A;  4WBN E;  2CLY B;  5AIN A;  5KE4 A;  3HKD E;  3P50 A;  4HE8 A;  3QOF A;  3JAF A;  4UR9 A;  3Q5E A;  1HX8 A;  2VK9 A;  3IGQ A;  4NUV A;  3CQC B;  5JQG E;  3PU3 A;  3IEE A;  4WBO A;  5FJV A;  2UUA T;  4IL4 A;  1XWM A;  2LSI A;  1DU2 A;  2D2S A;  2Z6E A;  4CXY A;  1J1J A;  3PUW F;  5A1L A;  3NZP A;  2QYW A;  5ADX L;  4F6R C;  3RQW A;  3QK6 A;  4HFV A;  4B6X A;  4QWN B;  3KV9 A;  3KV6 A;  1KNR A;  4O4I E;  2BKP A;  4TV9 E;  2FJB A;  5H6R B;  2BBH A;  4HGA A;  4DV7 T;  4ZZB A;  3KBT A;  2X9Y A;  5ABG A;  4J2C A;  2C5K T;  4PAG A;  3A5X A;  5J1G A;  5DAB A;  5AFM A;  2VQE T;  5AQU B;  2YU1 A;  2WWU A;  5JDF A;  3EAM A;  2WMO A;  2WZI A;  5J5I A;  2X9W A;  1HR0 T;  2WAU A;  4UV8 B;  1D0X A;  2MTQ A;  4U3C A;  5AQS B;  2BYP A;  2LSG A;  2VVN A;  3IA3 A;  4UVB B;  1U4Q A;  4TWD A;  2X0H A;  3C84 A;  2E5V A;  4IRE A;  3PUV F;  2X00 D;  3SRZ A;  2DCF A;  2JQQ A;  4XBF B;  3Q5X A;  3KBU A;  3EDU A;  4O4J E;  5E0O A;  1D1B A;  3VU7 H;  4BAY B;  2XQ8 A;  2V8S V;  4PJM A;  2WMN A;  3RF1 A;  5DQV A;  2PGZ A;  4DV0 T;  2M6I A;  5F3J A;  1M7K A;  3D0T A;  5HWX A;  3RRW A;  1IZN B;  3QNU A;  2VKJ A;  2D0U A;  3AA0 B;  2F4V T;  3AEG A;  1J5W A;  3AA1 B;  5JR9 C;  5EK4 A;  3ZT5 A;  5ABF A;  2NR4 A;  2XUE A;  2W8G A;  4I0U A;  5LP6 E;  2W61 A;  3RIU C;  4ZOL E;  4DND A;  3U78 A;  2XQ9 A;  5LCY A;  2WQY A;  4UM3 A;  2IAK A;  2DHR A;  3U8K A;  4A56 A;  3KV5 A;  2IW5 B;  3E0Z A;  3S4U A;  2V7K A;  2DWG A;  3RX6 A;  2LOS A;  1NEN A;  2VVS A;  2XYT A;  2VWA A;  2VL8 A;  3OJA A;  2JMH A;  3F31 A;  2N9D A;  3GN5 B;  3NBX X;  2E2A A;  3C50 A;  3AE6 A;  4B5D A;  3RC8 A;  1R8I A;  2K48 A;  4H9O C;  2OV9 A;  3NRX A;  4DV3 T;  4ZI3 C;  5FYM A;  4EB6 E;  1FIO A;  1BR1 A;  1LVK A;  3TLT A;  2DI4 A;  1YKH B;  5FY7 A;  4I55 E;  5F5W A;  5KZU A;  2JMK A;  2H7O A;  3Q9D A;  3ZJ1 A;  5AQT B;  4QKN A;  3AE8 A;  1YKE B;  3HKC E;  3QB5 A;  5L3G B;  3G06 A;  4DBQ A;  3IF8 B;  1KK7 A;  4Q25 A;  2QC1 B;  4LF5 T;  5FKY A;  2Y57 A;  3AEE A;  1SHZ C;  2X68 A;  4EZH A;  3TLS A;  3O9X A;  2ZMA A;  4H9R C;  1BR0 A;  2W8F A;  3F57 A;  4HFI A;  2N1G A;  3OPC A;  3P7I A;  3UU8 A;  2UUC T;  4IE0 A;  2W2U A;  2G0U A;  3R6N A;  3AVR A;  2VAS A;  5L3B B;  1XDO A;  3PUZ F;  2H3R A;  3PUR A;  5AQH B;  2DNX A;  5CFB A;  2I59 A;  3RIU A;  2XAS B;  4KX6 A;  3ZYK A;  4M1P A;  5HEJ A;  1W0A A;  3BQK A;  3UUN A;  3PEO A;  5FXV A;  2Y58 A;  4ILA A;  4YJ3 E;  3WTM A;  4MFR A;  3K3O A;  3BQL A;  1NWM X;  2PFV A;  3OKQ A;  4ZK4 A;  2LT3 A;  2YKS A;  1CHU A;  4JI5 T;  4LFA T;  5HXS A;  2I6H A;  2V1D B;  4H9P C;  2LJL A;  4ZS3 A;  2XZE A;  4KP3 C;  5LBQ B;  3WI3 A;  2BVL A;  2WCA A;  2M6B A;  4YFS A;  4PK6 A;  1ZV4 X;  5JTG A;  2WNJ A;  5JH7 E;  2CE7 A;  5L4E A;  4D01 A;  3L09 A;  2ZJV A;  3ZDH A;  1UW6 A;  2YIN A;  3AE1 A;  5L3F B;  5AQK B;  3PUY F;  3U8N A;  4HWH A;  2H89 A;  3DP7 A;  3PV0 F;  3VRA A;  3LJC A;  3TLW A;  4GKK T;  4HTE A;  3UUL A;  2KXP B;  3A8Y C;  2BJ0 A;  4AIU A;  2CXL A;  1KNP A;  2X66 A;  4K0U A;  4GKJ T;  2L3L A;  2XQ7 A;  5HWY A;  3ZYM A;  4YTP A;  2WZH A;  4CQI A;  5BP0 A;  2C9T A;  3N5L A;  1E2A A;  4OYJ A;  2DLR A;  2XQA A;  4AKR B;  3I0Q A;  4GIW A;  1UV6 A;  2MYS A;  3FHN A;  4U72 A;  5AFM B;  2HPJ A;  4ZJS A;  1AJ3 A;  2BG9 C;  2LE8 A;  3ETV A;  3ZMT B;  2QRX A;  5AQG B;  1JNZ A;  4N78 D;  1Z0P A;  3EDV A;  4EZ4 A;  4NXM T;  4U7I A;  5FXW A;  3RIF A;  1QSD A;  3WTK A;  1D0Z A;  4ADZ A;  4QH1 A;  2V5D A;  4O2B E;  3DJB A;  4YHJ A;  4DR4 T;  3PUS A;  4DID B;  3EHZ A;  1SA0 E;  4DR2 T;  3T1Y T;  2Q9Q A;  2X0L B;  3Q5D A;  2BYQ A;  1ZOY A;  3N9O A;  5JRC A;  3UQ7 A;  2XNT A;  3PUX F;  3LFM A;  2WP9 A;  4HFD A;  3AEB A;  3CML A;  2H88 A;  1I6Z A;  5AQQ B;  4GOU A;  4TN7 B;  4L5G A;  5EZY E;  2EHO C;  4P0A A;  1SUM B;  4U33 A;  3CX7 B;  1WFD A;  3JC6 C;  4LF8 T;  3ZCJ A;  2C5J A;  2IIU A;  4DR5 T;  2XQ4 A;  5HXH A;  1N34 T;  3NKZ A;  4JBW F;  4QXB B;  2CBJ A;  2VKO A;  3Q2M A;  2YDQ A;  4PK5 A;  4CI2 B;  4ZRU A;  4DMV A;  3N9M A;  5AFN A;  1HX1 B;  3VR9 A;  4YTM A;  2LHN A;  2NP9 A;  2XTL A;  3AE7 A;  3GMI A;  3N2G E;  3AB3 B;  4PK4 A;  1XDP A;  3UU6 A;  4ERR A;  2XNU A;  3MZK B;  5CGM A;  5GON E;  3T1H T;  4YSY A;  1MMA A;  3DTO A;  2LKG A;  4DR1 T;  3Q5W A;  3ZMS B;  4IDN A;  4IDP A;  2UU9 T;  4EYY R;  3L39 A;  1FMV A;  4MBQ A;  3UFG A;  5AQO B;  2XNV A;  1YW0 A;  2Y54 A;  2BVM A;  4YHH T;  4E7S A;  4GYS A;  2SPC A;  3MXZ A;  1WYB A;  3ONJ A;  2LRK A;  3CX8 B;  4KHP T;  1YQ3 A;  3FBZ A;  2VB6 A;  4DV2 T;  4CN4 A;  4KHZ F;  1WLX A;  5J5G A;  2LSY A;  2YMD A;  4G63 A;  3JAE A;  4JI6 T;  1H7C A;  2XM2 A;  5SYO A;  5LYJ E;  3AE9 A;  3SH1 A;  3WAJ A;  4LFB T;  3LBX A;  3I9W A;  2JQ9 A;  4FJO A;  3AAE B;  3ESL A;  2EHO D;  3C4Z A;  3JAD A;  4XK9 A;  1OED E;  1E1H B;  2RP4 A;  4UXN B;  5DJQ C;  1N32 T;  5LMU T;  3W15 B;  3A7M A;  3FZL B;  5LJM A;  3JC6 D;  1UUR A;  4AQF A;  3P4Q A;  4PJN A;  2OA5 A;  5L4H A;  3AAA B;  3I9Y A;  4YLH A;  2JIW A;  4MAL A;  3H3M A;  3E08 A;  4UM3 S;  3SQ9 A;  2XZ6 A;  5HXR A;  1XZY A;  4AKI A;  4HWD A;  4QXC B;  4HWC A;  2BYS A;  3PE0 A;  5KMG P;  3K3Q C;  2KND A;  3HR0 A;  4E7Z A;  1S35 A;  1IJ6 A;  4DO0 A;  1LVF A;  5LG3 A;  2E9X C;  1ZP0 A;  4AFH A;  2XAG B;  3VRB A;  2CLY C;  3F2E A;  3RH3 A;  4ZEY A;  2QGS A;  4KI0 F;  2KWH A;  1KF6 A;  2CPT A;  2VQF T;  4HFB A;  4TUY E;  3WIP A;  2NW7 A;  4IDZ A;  1IJ5 A;  2XAF B;  4BA9 A;  1T98 A;  3WTL A;  1WRD A;  2J62 A;  4IE7 A;  4BQT A;  2ZM8 A;  5J5F A;  2YOE A;  5JDQ A;  2LKH A;  2X9H A;  4CN6 A;  2AXD S;  2C0S A;  4TNV A;  4H9S E;  2VKD A;  5LG4 A;  4ZS2 A;  5JME A;  4H63 V;  4HEA A;  1XMO T;  1OED A;  2XQY A;  3ZC1 A;  5LGU B;  4NIQ A;  4ZI7 E;  2BR7 A;  2JJ9 A;  5LB7 B;  2M67 A;  3RQU A;  4UV9 B;  2X00 A;  3N2K E;  1OXZ A;  3P4R A;  4PJL A;  3LK4 2;  2ZM2 A;  3ZN1 B;  2XSB A;  3B13 A;  5AQV B;  4EEB A;  3SWH A;  1XMQ T;  1G73 A;  4AKH A;  5C8Y E;  2JQH A;  3RI5 A;  4JI1 T;  3WTN A;  1FEW A;  4U31 A;  2MPK A;  5HEG A;  4DV1 T;  2CCQ A;  1WR6 A;  3P4P A;  2K5B B;  3VKG A;  2ACX A;  5BR8 T;  1D0Y A;  4MLK A;  4AQY T;  3LDQ B;  1HG5 A;  4B3M T;  2PG8 A;  4IST A;  1WYC A;  1X9B A;  5IHY A;  2ODU A;  2CA5 A;  5AFL A;  3AAI A;  2WWV A;  3O1J A;  3IHR A;  4F8H A;  1UUS A;  4I50 E;  4HFC A;  5HEU A;  1WCR A;  5FY0 A;  1S94 A;  4HN9 A;  5C2T A;  1MMG A;  2AE9 A;  3ZJ2 A;  4WZX A;  5FL0 A;  5L3C B;  5HYA A;  3MKD A;  2YU2 A;  4IT4 A;  3MJX A;  2QVA A;  4YY3 T;  1VCS A;  2ACZ A;  1G8X A;  2YEV C;  3OYX A;  4B3S T;  2UUB T;  2BDE A;  2NTY A;  5FY1 A;  3RKO A;  3T4M A;  3C51 A;  5LMN T;  3TLV A;  3CIR A;  1MND A;  2Q9Q B;  2DL1 A;  4QAB A;  4LMJ A;  3AVS A;  3K1S A;  3PJA J;  5KDM C;  1B7T A;  5L3E B;  4EIW A;  5JRC B;  3FZK B;  2BZB A;  4DV4 T;  1YD8 G;  3AEC A;  1MIY A;  2UXN B;  3LG7 A;  4X1Y E;  4IE5 A;  4OHF A;  3FXD B;  2H7V C;  2KSR A;  4JI3 T;  3ZDG A; 
#chains in the Genus database with same CATH homology
 4ALX A;  3RI5 A;  5CFB A;  4NPP A;  2BG9 E;  2MAW A;  2BYP A;  3UU6 A;  3WTN A;  3C79 A;  2XNU A;  5TVC A;  4AFG A;  5HEG A;  5HEJ A;  2WNC A;  4EZ1 A;  2XQ6 A;  4UM1 A;  3PEO A;  2XQA A;  4TWD A;  1UX2 A;  2BYS A;  4LMK A;  3WTJ A;  4DBM A;  4ZK1 A;  5HCM A;  3UUB A;  3C84 A;  2Y58 A;  1UV6 A;  2LKG A;  4TWH A;  4HQP A;  4UY2 A;  3RIA A;  4ILA A;  5AFM B;  4HFH A;  2YN6 A;  5LG3 A;  4IRE A;  2X00 D;  4B5D A;  3P4W A;  4Z90 A;  2XNV A;  5AFJ A;  3WTM A;  4AFH A;  2Y54 A;  5HEO A;  4ZJS A;  3WTO A;  5AIN A;  5KE4 A;  3P50 A;  2ZJU A;  2BG9 C;  3JAF A;  4HFE A;  3GUA A;  3WTI A;  5AFL A;  4NZB A;  4ZK4 A;  2YKS A;  4A97 A;  2XZ5 A;  3UU4 A;  3TLT A;  4ZJT A;  4Z91 A;  4HFB A;  4X5T A;  4F8H A;  3SQ9 A;  3WIP A;  2XQ8 A;  5KZU A;  2UZ6 A;  4COF A;  3IGQ A;  2XQ3 A;  3RIF A;  3WTK A;  3WTL A;  4HFC A;  4QH1 A;  5HEU A;  4BQT A;  2PGZ A;  2M6B A;  4ILB A;  3U8J A;  5FJV A;  4UM3 P;  3EHZ A;  3U8M A;  4IL4 A;  5J5F A;  4TNW A;  2M6I A;  4XHE A;  4FRR A;  5J5G A;  2YOE A;  2WNL A;  5J0Z A;  2LKH A;  2WNJ A;  2YMD A;  5HCJ A;  4TNV A;  4WV9 A;  3JAE A;  2BYQ A;  5BRX A;  2Y7Y A;  2YME A;  1I9B A;  5AFH A;  2LM2 A;  3UQ7 A;  4PIR A;  3WTH A;  2XNT A;  5L4E A;  4QAA A;  5JME A;  2WZY A;  4ILC A;  4UXU A;  5SYO A;  2ZJV A;  4D01 A;  4BFQ A;  5BW2 A;  3ZDH A;  1OED A;  5HEH A;  4HFD A;  1UW6 A;  2BYN A;  4ZR6 A;  3RQW A;  3SH1 A;  2LLY A;  2W8G A;  2QC1 B;  3SIO A;  2BYR A;  3U8N A;  5AFK A;  2Y57 A;  3UU5 A;  5J5H A;  3ZKR A;  4LML A;  2BR7 A;  4TWF A;  3JAD A;  5LXB A;  3T4M A;  2XQ9 A;  3TLS A;  3UQ4 A;  4XK9 A;  1OED E;  3TLU A;  2W8F A;  4ZZB A;  2VL0 A;  3TLV A;  3TLW A;  4UM3 A;  4HFI A;  4QH5 A;  3PMZ A;  4IL9 A;  3RQU A;  4QAB A;  4LMJ A;  3UU8 A;  2XYS A;  3SQ6 A;  3RHW A;  2Y56 A;  3U8K A;  2XQ4 A;  2X00 A;  5CO5 A;  2BJ0 A;  2XQ5 A;  5BP0 A;  2BR8 A;  4QH4 A;  3EI0 A;  2WN9 A;  3U8L A;  5L47 A;  5L4H A;  5AFM A;  4ZZC A;  1OED B;  2BG9 A;  3UU3 A;  4ZRU A;  2XQ7 A;  2PH9 A;  3EAM A;  5AFN A;  2BG9 B;  5J5I A;  2XYT A;  2KSR A;  5IUX A;  4A98 A;  4QAC A;  1OED C;  4UM3 S;  3LSV A;  3ZDG A;  2XZ6 A;  4AFT A;  2C9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...