2XQ7A

Pentameric ligand gated ion channel glic in complex with cadmium ion (cd2+)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein
molecule keywords GLR4197 PROTEIN
total genus 77
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq7A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq7A01
4ZRUA 3UQ4A 4AFGA 4NZBA 2VL0A 5AFMB 3EI0A 2XQ4A 3UUBA 4WV9A 3RI5A 3ZKRA 3ZDGA 5HEUA 5J5HA 3P50A 2LLYA 3SIOA 2Y54A 4UM3A 5AINA 4QH1A 5IUXA 4HFHA 4IREA 4UY2A 4LMJA 5SYOA 3ZDHA 5HEHA 5J5IA 1UW6A 2WNCA 4HFCA 4EZ1A 2LKHA 2XNTA 2Y56A 2W8GA 2BYPA 2WNLA 4ZJSA 4ZJTA 5LXBA 3WTOA 2C9TA 4TNWA 2WZYA 4TNVA 4D01A 4NPPA 4TWHA 3UQ7A 4B5DA 4AFTA 4IL9A 3SH1A 3WTJA 1OEDA 2BR8A 4UM3S 5BRXA 3UU4A 2XZ5A 4HFIA 1I9BA 3WTIA 5AFKA 4LMKA 5L4HA 2W8FA 2WNJA 1UV6A 1UX2A 2XQ8A 5J0ZA 2YOEA 5TVCA 3U8NA 2M6IA 3TLSA 5JMEA 4QH5A 3TLTA 2YN6A 4HFDA 2X00D 3C84A 5J5FA 2YMEA 5L47A 3PEOA 3JADA 1OEDE 2Y58A 3LSVA 2MAWA 2XQAA 5AFMA 2KSRA 5HCMA 3C79A 4ZR6A 3WTHA 4DBMA 2BYSA 2QC1B 2M6BA 4XHEA 2YKSA 4TWDA 3RHWA 2BYNA 3PMZA 5KZUA 4UM1A 5L4EA 2X00A 3P4WA 1OEDC 4HFEA 3SQ6A 3U8KA 2XQ3A 3RIAA 2LKGA 2UZ6A 2BYQA 3SQ9A 4ILAA 4ZZBA 2PGZA 4BFQA 4X5TA 3JAEA 5AFJA 1OEDB 3WTLA 4ZK4A 3WTMA 3IGQA 4COFA 2Y57A 4A98A 2BR7A 2LM2A 2YMDA 2XZ6A 3UU3A 3UU6A 4BQTA 5LG3A 5KE4A 5CO5A 5AFLA 2BYRA 2Y7YA 5HCJA 2ZJVA 4QABA 3WTNA 3UU8A 5J5GA 3U8LA 3TLWA 2XNVA 4ILCA 5AFHA 2WN9A 4UXUA 4QAAA 2BG9E 3EHZA 3EAMA 3RIFA 4FRRA 4ALXA 3GUAA 4Z90A 4ZZCA 5FJVA 3UU5A 4QH4A 4TWFA 2XNUA 4PIRA 4Z91A 5HEGA 5BP0A 3WTKA 2XQ9A 4IL4A 5HEOA 3TLVA 4HFBA 2BJ0A 3RQUA 3T4MA 2XQ7A 3TLUA 2PH9A 4QACA 2XYTA 5HEJA 5BW2A 2BG9C 4A97A 5AFNA 4ILBA 3WIPA 3U8MA 4ZK1A 5CFBA 2XQ6A 2XYSA 2ZJUA 4UM3P 2BG9B 2XQ5A 3JAFA 4XK9A 4AFHA 4LMLA 4HQPA 3RQWA 2BG9A 3U8JA 4F8HA
chains in the Genus database with same CATH superfamily
1XNRT 4YTNA 4P1NA 3ZEFB 2XZEA 3ETUA 3BK9A 4LMJA 4EAHA 4PJLA 4HEAA 3O1IA 4HFCA 4EEDA 4DVDA 4CI2B 5AQVB 2CM0A 4XZCA 1IJ6A 5IHYA 2BVLA 3AA0B 4TWHA 1S94A 3JC6D 4K0UA 4IL9A 2LOSA 3UU4A 5AFKA 1UGOA 3KVAA 2NOXA 4GKKT 4KMCA 4KBMB 4P0BA 3AB3B 4KUMB 1N34T 4LFBT 3K3QC 3OBVE 1JNRA 3E08A 5EZYE 5IYZE 2UU9T 3LSVA 3DJBA 2LOPA 1W0BA 3D0TA 1MMDA 2XM2A 2QC1B 4DBQA 4UM1A 2X00A 4ISSA 4I4TE 5LB7B 4YSXA 2PGZA 2A3DA 4X5TA 3RC3A 2FUPA 2YU2A 4COFA 2WCAA 3P4QA 2XZ6A 4U3CA 3V5SA 5LBQB 3PUGA 4ALXA 3AEEA 4QH4A 1EZ3A 4JUYA 5JREA 1WLXA 2WDVA 5F3JA 1J5WA 2CBJA 3U8MA 3RH3A 3I9WA 1UX5A 2CPTA 1FEWA 1ZOYA 3A8YC 5FY7A 2E9XA 2C0SA 5LXTE 1W9RA 2UUAT 2LE8A 2LHRA 2J4GA 5LGNB 4H9SE 3AAAB 4IDZA 3J7Yq 1E2AA 4ZEYA 2B76A 3N9NA 3AE6A 3N2OA 1LKXA 2DWKA 3AE9A 4DV3T 5LGUB 3UQ7A 3T1HT 4UM3S 2L9QA 1D0XA 4G63A 2K3WA 4H9OC 3VKGA 5CJ5A 4TN7B 1FMWA 2VWAA 3EDVA 4ZI3D 2MOZA 5LMNT 1MMGA 3JADA 2E9XC 2WP9A 3IA3A 2W66A 5L3DB 4EYYR 3EABA 3ZT7A 3KBUA 3IEEA 2M6BA 2YKSA 5KZUA 2J62A 1OXZA 3AVSA 3I0OA 3WTLA 4QHOA 1B7TA 2BR7A 4JI0T 1XZYA 2PTFA 3TLWA 4DV5T 2DCFA 3PUZF 5AFHA 3UU5A 2XQ9A 3KV6A 4L9IA 4IIJE 2K5BB 2WB5A 4YTPA 1SUMB 5JDNA 4A97A 3L3PA 5FP3A 2XQ6A 1I6ZA 5ADXL 2L8KA 3HR0A 4YJ2E 4DUYT 5HCMA 4OK0A 4F8HA 4A56A 4X1YE 5ABFA 5AQFB 5AFMB 4M1PA 4WV9A 4UIGA 4EIWA 1U4QA 4QH1A 4UY2A 2BDEA 2BYPA 3NWIA 4HKAA 2LT3A 3SFEA 2XSBA 4DR5T 5AQRB 3OJAA 3Q5WA 1J5ET 2WZIA 2JPFA 2CMRA 3U3IA 4YXDA 2YMEA 2Y48B 3P4RA 2ZM2A 3UTKA 5JDFA 4QXBB 1D1BA 1Z8UA 4TZ4C 3PMZA 4YHHT 2X66A 3TKLB 5L4EA 3ZMZB 1T72A 3RIAA 4ZZBA 4H9RC 4CI1B 4UF0A 3NKZA 3EUHA 2V5CA 4CXWA 4IE5A 1XMOT 2V8SV 4DR1T 1IZNB 2D9DA 2KINB 5LG3A 3WTNA 1G73A 2YDSA 3O1JA 4XAXB 4HFVA 4ZZCA 4Z91A 2WU5A 3AA6B 3RX6A 5JDHA 3PUYF 3MZKB 5JRCA 3ETVA 4IE7A 4TUYE 4TV9E 1HNXT 1CHUA 1KEYA 3RYFE 2BG9B 1X9BA 4AFHA 4H63H 5JRCB 5J2TE 5FY0A 4AIUA 3ZC1A 4GKJT 2X67A 4OHFA 1US7B 2XQ4A 2BS2A 3RI5A 3ZDGA 1S35A 1N32T 3FB2A 5SYOA 5J5IA 2XJ7A 4DR7T 2A72A 3P7IA 2XM1A 4YFSA 2J1DG 3PJAA 2VB6A 1WR6A 4I0UA 5DJQC 3RRWA 3CKDA 3AECA 3R6NA 4AFTA 4IDOA 2ODVA 4H9QC 2PG8A 3WAKA 3T1YT 3C84A 2LSKA 5AQNB 2BVMA 3UULA 5AFMA 4LFAT 4IE6A 3AE1A 3E22E 3HA4A 4UELA 1VRBA 2K48A 1MIYA 3AXJB 2YK0A 1QUUA 1MMNA 4ILAA 4H63V 5ABHA 5C2TA 2M67A 2JRKA 4PJNA 2CEAA 1OWAA 2LM2A 3UU6A 1LVFA 2V7KA 4H9NC 3MA9A 2G0UA 2ZLYA 3ZCIA 1VCSA 3EAMA 4JI3T 2XNUA 4LF4T 5JTGA 2VKHA 3WTKA 4UR9A 2LSJA 3ZJ2A 4G2AA 3EVYA 2W62A 3FZLB 1ZEEA 4NUUA 2CCQA 3VHLA 3RKGA 4I55E 2WMOA 4HQPA 3RLFF 5CGMA 3CIRA 3O9XA 5HEUA 3VRAA 3R84B 3RPUA 4QX7B 2C5KT 2RPAA 4IE4A 5FVLA 4CXXA 2VQFT 1T8BA 2FBWA 3FZKB 3KBTA 4WW0A 3IBPA 3WI3A 2WY2A 5LMUT 4MLKA 5L2LA 4JBWF 3WTIA 5TAOA 2ACZA 2I0MA 2L3LA 2LSGA 3I9YA 3U8NA 1KNZA 1SHZC 4O4LE 3TLTA 4B3MT 5J5FA 2A9UA 3N2KE 3LJCA 1MNEA 1YW0A 3H3AA 2RA1A 4B3RT 2LEHA 3RGLA 2CHNA 2DHRA 1N33T 2V7MA 5CB4E 4EXTA 2W4XA 5ABFB 4A5XA 3AVRA 1BR1A 2JQ9A 1UCUA 3KINB 5HYAA 4YY3T 1R8IA 4B6XA 2Q9QD 4AKRB 3OPCA 2XTLA 5HEGA 3GWHA 2XPKA 3GA8A 2H88A 5HEJA 4ILBA 4LF5T 2KNDA 1WYCA 4N78D 5AQOB 2UXCT 3L8RA 5J2UE 2NW7A 3AXJA 2Q9QA 2UXXB 4AKIA 2ZM8A 3ZMVB 3WAJA 4YSZA 3C98B 3N9MA 2Y56A 4MFRA 4X66T 2WNLA 3ZSSA 2K24A 4YTMA 3SFDA 2XSAA 4IDNA 2VKDA 4X62T 2H89A 1IBMT 3P4PA 5HWXA 2LSYA 1KFYA 5KXJA 5JMEA 3QOFA 4DUZT 1SE7A 5LHHB 2YEVC 3JC6C 5E0OA 2X51A 4JI6T 4PFPA 1SA0E 4FJOA 3CVRA 3AEFA 4QXCB 4GK0E 3P4WA 2HPJA 1HX8A 4ZI3C 4UXNB 4YLHA 1LRZA 2V6XA 4O4IE 4DV1T 5LCYA 5J5GA 4UXUA 2H7VC 2ZM0A 3AEGA 5JH7E 4PIRA 3C51A 1U5PA 2W2UA 3UFGA 1X79A 2EHOA 5FMNA 3LBXA 4PJMA 2Q9QC 2KWHA 4YT0A 1NENA 4CN1A 5FXWA 5LHGB 3PJAJ 5F8PA 4DNDA 2V7IA 4KHZF 1UX4A 1ZV4X 4XBFB 2CXFA 2GK9A 2WS3A 2X9WA 1YQ4A 3KVBA 4U74A 5L3BB 2UUBT 4X20E 5HEHA 1UW6A 2WNCA 4CI3B 3RIUC 2MBGA 2W8GA 2P9BA 5JDMA 4ZJTA 2WZYA 4LF7T 3UFEA 4B5DA 2IAKA 4ZS2A 2W8FA 3CX6B 1YD8G 1T98A 4JEHB 1KF6A 2AXDS 1T7SA 3RYCE 5AQLB 4DBMA 1ZHCA 5ETWA 3LK2B 1W0AA 4X1IE 2QYWA 2CA5A 3SQ9A 3JAEA 4X65T 2Y6XA 5CO5A 2Y7YA 3UU8A 3U8LA 4UV8B 4KHPT 2BG9E 3EHZA 3BQIA 3QK6A 5HXHA 3L09A 4AISA 2BJ0A 1O3XA 3MK7C 2XQ7A 2PH9A 1KK7A 2W63A 5AQGB 3FBLA 5FXZA 2KXPB 2ODUA 2QGSA 3JAFA 3ANWA 4B3TT 3ZLIA 4EB6E 2C9TA 3A7MA 4ZRUA 4NZBA 5L3GB 1M7KA 2LRLA 5FXVA 3QB5K 1LVKA 3MKDA 2NW9A 3C4XA 2H7OA 3N9LA 1NEKA 5F5WA 1YXRA 2A2FX 2UXBT 4JYAT 3WTJA 3SWHA 1XWMA 3K8PC 4LMKA 4JI4T 2HN1A 2CHOA 2VQET 3BQLA 2DLRA 3N2GE 4QH5A 3OTOT 2WDRA 4PK5A 4UV9B 1OEDE 1NWMX 3A5XA 3N5LA 2XAJB 4CXYA 4PAGA 2HHHT 3FXDB 3CPZA 2IHR1 2SPCA 4BFQA 3PUQA 1KNPA 3IGQA 4JEUB 5AQHB 2ACXA 4HTEA 3ZYKA 1D1CA 4ILCA 5AQMB 5JDGA 2E2AA 2X9XA 4LFCT 5M4YA 2XASB 2OLTA 3CMLA 4HN9A 1BR2A 3C4WA 3ABVA 1V9DA 3PUAA 1D0YA 2WBLA 2XYSA 1VOMA 5CA1E 1HNZT 2D0TA 3VRBA 4U31A 2BG9A 2VURA 5LA6E 3UQ4A 3EI0A 2ZMAA 4GIWA 3RYIE 2Y8DA 2LSIA 4BA9A 1HX1B 2LLYA 1W09A 2BBJA 3FZFB 3S4UA 2F4VT 4E7ZA 4GOUA 3PUSA 4AKGA 1FIOA 3SOLA 4DV6T 2N2NA 5AQIB 4C91A 2BR8A 1NAFA 3C50A 4JI2T 3VR9A 2CLYB 4GK5E 4NXMT 3ESLA 3PUXF 4ISTA 3HKCE 2KLQA 5AQKB 3PUWF 2X00D 2LJLA 5LYJE 3PEOA 2XQAA 3SRZA 3WTHA 4ZR6A 5LG4A 3VKHA 4J2CA 4XHEA 1DU2A 2X0HA 2BYNA 3AEAA 3U8KA 2BBHA 2H3RA 2D0UA 5FKYA 4EOZB 5AFJA 4ZK4A 4ADZA 4A98A 3HL6A 4TV8E 3KV9A 2YMDA 4LF9T 1HCIA 4ILUA 3VU7H 2V26A 2ZJVA 1HG2A 1Z0PA 4EYUA 2VVNA 1KNRA 3OVUA 3PURA 3GUAA 4TWFA 3MACA 5BP0A 3N9QA 5AQUB 3E0ZA 2CRBA 1WFDA 3WIPA 5HXRA 4F6RC 4ZS3A 2ZJUA 3ZN0B 3FHNA 3RQWA 3F2EA 3J9X1 4V1Av 2WDQA 1J1JA 5C3JA 3HI2A 5J5HA 2XQYA 3KFWX 5LNKA 2WM9A 1GQEA 2CE7A 2DNXA 3ZDHA 3Q9DA 1WRDA 1IAPA 5JR9C 2D2SA 3B13A 3LBXB 5FL1A 4EV6A 3WTOA 2PBIA 4TNVA 3PV0F 3ONLC 2XZ5A 1I9BA 2WNJA 3ZC0A 4ZHQE 2JQHA 2XQ8A 4JI1T 2QVAA 3TLSA 1HG5A 3GN5B 1YQ3A 4AQYT 4CN6A 2DL1A 4O2AE 4K0KT 5FY1A 2WWUA 3OYXA 4HFEA 2BYQA 2JQQA 4NXNT 1AJ3A 3I0QA 2VKOA 3P8CD 4IT4A 1XDOA 2MYSA 3H3MA 2JMHA 4U7YA 5JR9A 4AI6A 2VL8A 1UK5A 2WU2A 4BJNA 2WN9A 4QAAA 3FXEB 4ANJA 4IGUA 4DV2T 2W61A 1D0ZA 4IL4A 5KX5E 5FXXA 2KMFA 3DP7A 2HN2A 3T4MA 4U7IA 4KP3C 2WQYA 3AE2A 4HWDA 4EEBA 5KDMC 4LMLA 3ZPOA 3Q5DA 5KE4A 4IE0A 3AA1B 3C64A 4H9PC 3U78A 3RF1A 4UM3A 2V1DB 4L5GA 4AQFC 3ZT6A 3L39A 4UVAB 5L3CB 1ZKEA 3OKQA 5LJNA 4BJMA 4E7SA 2X0LB 4D01A 5BMVE 2BKPA 2BKNA 4DR2T 2CBIA 5AQQB 3NBXX 4JLEA 5ABEA 1UV6A 5J0ZA 4ZI7E 3HKEE 4P0AA 2X9YA 2IC9A 1IBKT 2XHEB 4UVCB 2MAWA 3AE4A 3C79A 2J47A 4OFZA 5LGTB 2UXDT 3ZMSB 3RHWA 3RYHE 2NTXA 2X9HA 4NIQA 3T8OA 2LKGA 2FJEA 4L0RA 2KZ7B 4DR6T 5H6QB 3SS1A 5HWYA 2X0YA 2VVSA 2BYRA 2ZM6T 4TX5A 3QB5A 3UUXB 2XNVA 2NTYA 4MHCA 4AKLA 3F57A 2B1EA 5FNVE 4BAYB 1BR4A 5HEOA 4HWCA 4QACA 4EGWA 2BG9C 2JIWA 5CFBA 1VCTA 5DQWA 3CX8B 4IHJE 4MBQA 2IDOB 5IWAT 4FRRA 1FMVA 5AFUL 2WMNA 4P09A 4QX8B 2JQKA 3N9OA 4KX6A 2W00A 4HGAA 3ZJ1A 3PDYA 3H37A 4X64T 4CN4A 5CA0E 3BQKA 2WAUA 1QSDA 3AEBA 4ZJSA 4TNWA 2CXLA 3HKBE 2V7LA 3O1HA 2XAQB 3M3ZB 3SH1A 2EHOB 1ZP0A 4ZXLA 3IF8B 4U2YA 2QA7A 1UX2A 3G06A 2C5IT 2ES0A 2PFVA 4EZ4A 4C90A 5LP6E 5C8YE 4CQIA 2LRKA 5DQVA 2CWOA 2PJQA 3B57A 1E1HB 3NRXA 4ZI2D 3AE5A 2WSSV 1QLBA 1YKHB 1IBLT 2IIUA 4YHJA 2UUCT 4KI0F 4JI8T 1MNDA 5HCJA 1H7CA 2V7JA 1XMQT 4GYSA 1IJ5A 3Q5EA 3RQUA 2V6YA 3TLUA 2KWIB 4U33A 3W15B 5HXEA 4LF6T 2Z6EA 3U8JA 3GMIA 1N36T 3FBZA 2D5UA 2VL0A 4ASKA 5AINA 4UF0B 4HFHA 5BR8T 2LM9A 5JVDE 5AQJB 4EZ1A 3OYZA 4YSYA 5HXSA 2E5VA 4NPPA 5H6RB 2IMLA 3DTOA 1WR0A 2HPLA 3F31A 5AQPB 4HFIA 3PUVF 4I50E 2IW5B 4AQGA 5JDLA 3UUMA 5FYMA 5TVCA 4DBRA 4HFDA 5L3FB 2Y58A 2NP9A 3PTRB 1MIVA 4PFOA 2BYSA 3UT5E 2I6HA 3C4ZA 4DO0A 2CLYC 3B5MA 2LHNA 3KDSE 2YINA 4QWNB 1XDPA 3ZSTA 5AFLA 2Q9QB 3LK3B 3RIFA 4DIDB 4HFBA 2XAHB 4AKHA 1HS7A 4O4JE 2V6YB 4DR3T 4DR4T 5J1GA 4IDPA 1UURA 2XQ5A 3JCFA 1I94T 2XAFB 2HH7A 3K1SA 4UEMA 2E8IA 3NZQA 3K3OA 3UUBA 2EHOC 3QUJA 3VR8A 3ZMUB 3SIOA 5LOVE 4JI5T 4OYJA 4PK4A 2I59A 2IUBA 2V5DA 2LKHA 2FJBA 3QNUA 2OV9A 2AE9A 3MJXA 5L4HA 1MIWA 4AQFA 3O4XE 4ERRA 2RP4A 2M6IA 3I1AA 1E7PA 2JJ9A 5L47A 2XAGB 2FJDA 4ZOLE 3Q5XA 3AE7A 3FZMB 1Y01A 4Z8XA 2XUEA 1MMAA 4WZXA 2XQ3A 2UZ6A 3CQGB 2EHOD 3PU3A 2C5JA 4PJJA 4BQTA 2VK9A 3ZYMA 5FJVA 2E9XD 3CK6A 2W67A 2R6GF 5AQTB 2UXNB 1Y64B 4ZK1A 3ZT5A 4CZZB 3AE8A 1JNZA 4UM3P 3LK42 3ONJA 4XK9A 2MTQA 4DV0T 3HKDE 4HWIB 3CQCB 5JR9B 4AFGA 1HNWT 1BR0A 5KMGP 2KT9A 3AE3A 4YJ3E 3NVOA 3RC8A 3P50A 4X1KE 5EK3A 2VASA 5LXBA 1WYBA 4HE8A 3N9PA 1L0VA 5LBMA 4JI7T 5BRXA 2DI4A 2NR4A 3LG7A 5JQGE 4GYRA 1HTJF 2YDQA 3X1DA 2YN6A 2BS3A 5GONE 4WYVA 2X68A 4NUVA 2E9XB 2KSRA 4I43B 3UUNA 4DMVA 4IDQA 2VKJA 4UVBB 3AAEB 4OX9T 2K9AA 1OEDC 3AA7B 4DV7T 3PU8A 3QC9A 1OEDB 2Y57A 1XNQT 2MPKA 4U2ZA 4QABA 4WBNE 1WCRA 2BZBA 4Z90A 1G8XA 3CQXC 4ZI2C 4PK6A 3AAIA 1HFAA 1M62A 4O2BE 3ANWB 2DWGA 4HWFA 3M65A 2BKOA 3FZHB 2JMKA 5DABA 2W0GA 1CUNA 3NZPA 4AXPA 2NWBA 3ZKRA 3V5UA 4DMWA 4QKNA 2Y54A 2OA5A 3LFMA 4MALA 5IUXA 4IREA 5ABGA 4DV4T 4WNKA 2XNTA 2CXDA 3ZMTB 1HF8A 1OEDA 3ONXA 4PNIA 1FJGT 3P4SA 3ZN1B 3ZCJA 2YDRA 2YOEA 3PE0A 3K3NA 5FL0A 4WBOA 3LDQB 2E5LT 2WZHA 4EZHA 2NW8A 4QXHB 3Q2MA 2WWVA 4TWDA 3RRCA 4U72A 1YKEB 2N1GA 3MXZA 3SQ6A 5LHIB 3NRYA 4JV5T 3GN5A 5EK2A 3KV5A 3KV4A 3WTMA 1D1AA 1UUSA 5HXCA 3ZYLA 1HR0T 3CWZB 3RIUA 3EDUA 3UU3A 4O4HE 2BS4A 5FVKA 2IC6A 4Q25A 4FI5A 4O8SA 3TLVA 5L3EB 5A1LA 5LJMA 2QRXA 5JDQA 4B3ST 2XYTA 5BW2A 5EK4A 5AFNA 4OYKA 5HAXA 2XY8B 3AEDA 3CX7B 5AQSB 2N9DA 3IHRA 4PW8A 2YU1A 2FJAA 4HWHA 3RKOA 2CWYA 4LF8T
chains in the Genus database with same CATH topology
4ZRUA 3UQ4A 4AFGA 4NZBA 2VL0A 5AFMB 3EI0A 2XQ4A 3UUBA 4WV9A 3RI5A 3ZKRA 3ZDGA 5HEUA 5J5HA 3P50A 2LLYA 3SIOA 2Y54A 4UM3A 5AINA 4QH1A 5IUXA 4HFHA 4IREA 4UY2A 4LMJA 5SYOA 3ZDHA 5HEHA 5J5IA 1UW6A 2WNCA 4HFCA 4EZ1A 2LKHA 2XNTA 2Y56A 2W8GA 2BYPA 2WNLA 4ZJSA 4ZJTA 5LXBA 3WTOA 2C9TA 4TNWA 2WZYA 4TNVA 4D01A 4NPPA 4TWHA 3UQ7A 4B5DA 4AFTA 4IL9A 3SH1A 3WTJA 1OEDA 2BR8A 4UM3S 5BRXA 3UU4A 2XZ5A 4HFIA 1I9BA 3WTIA 5AFKA 4LMKA 5L4HA 2W8FA 2WNJA 1UV6A 1UX2A 2XQ8A 5J0ZA 2YOEA 5TVCA 3U8NA 2M6IA 3TLSA 5JMEA 4QH5A 3TLTA 2YN6A 4HFDA 2X00D 3C84A 5J5FA 2YMEA 5L47A 3PEOA 3JADA 1OEDE 2Y58A 3LSVA 2MAWA 2XQAA 5AFMA 2KSRA 5HCMA 3C79A 4ZR6A 3WTHA 4DBMA 2BYSA 2QC1B 2M6BA 4XHEA 2YKSA 4TWDA 3RHWA 2BYNA 3PMZA 5KZUA 4UM1A 5L4EA 2X00A 3P4WA 1OEDC 4HFEA 3SQ6A 3U8KA 2XQ3A 3RIAA 2LKGA 2UZ6A 2BYQA 3SQ9A 4ILAA 4ZZBA 2PGZA 4BFQA 4X5TA 3JAEA 5AFJA 1OEDB 3WTLA 4ZK4A 3WTMA 3IGQA 4COFA 2Y57A 4A98A 2BR7A 2LM2A 2YMDA 2XZ6A 3UU3A 3UU6A 4BQTA 5LG3A 5KE4A 5CO5A 5AFLA 2BYRA 2Y7YA 5HCJA 2ZJVA 4QABA 3WTNA 3UU8A 5J5GA 3U8LA 3TLWA 2XNVA 4ILCA 5AFHA 2WN9A 4UXUA 4QAAA 2BG9E 3EHZA 3EAMA 3RIFA 4FRRA 4ALXA 3GUAA 4Z90A 4ZZCA 5FJVA 3UU5A 4QH4A 4TWFA 2XNUA 4PIRA 4Z91A 5HEGA 5BP0A 3WTKA 2XQ9A 4IL4A 5HEOA 3TLVA 4HFBA 2BJ0A 3RQUA 3T4MA 2XQ7A 3TLUA 2PH9A 4QACA 2XYTA 5HEJA 5BW2A 2BG9C 4A97A 5AFNA 4ILBA 3WIPA 3U8MA 4ZK1A 5CFBA 2XQ6A 2XYSA 2ZJUA 4UM3P 2BG9B 2XQ5A 3JAFA 4XK9A 4AFHA 4LMLA 4HQPA 3RQWA 2BG9A 3U8JA 4F8HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZRU A;  3UQ4 A;  4AFG A;  4NZB A;  2VL0 A;  5AFM B;  3EI0 A;  2XQ4 A;  3UUB A;  4WV9 A;  3RI5 A;  3ZKR A;  3ZDG A;  5HEU A;  5J5H A;  3P50 A;  2LLY A;  3SIO A;  2Y54 A;  4UM3 A;  5AIN A;  4QH1 A;  5IUX A;  4HFH A;  4IRE A;  4UY2 A;  4LMJ A;  5SYO A;  3ZDH A;  5HEH A;  5J5I A;  1UW6 A;  2WNC A;  4HFC A;  4EZ1 A;  2LKH A;  2XNT A;  2Y56 A;  2W8G A;  2BYP A;  2WNL A;  4ZJS A;  4ZJT A;  5LXB A;  3WTO A;  2C9T A;  4TNW A;  2WZY A;  4TNV A;  4D01 A;  4NPP A;  4TWH A;  3UQ7 A;  4B5D A;  4AFT A;  4IL9 A;  3SH1 A;  3WTJ A;  1OED A;  2BR8 A;  4UM3 S;  5BRX A;  3UU4 A;  2XZ5 A;  4HFI A;  1I9B A;  3WTI A;  5AFK A;  4LMK A;  5L4H A;  2W8F A;  2WNJ A;  1UV6 A;  1UX2 A;  2XQ8 A;  5J0Z A;  2YOE A;  5TVC A;  3U8N A;  2M6I A;  3TLS A;  5JME A;  4QH5 A;  3TLT A;  2YN6 A;  4HFD A;  2X00 D;  3C84 A;  5J5F A;  2YME A;  5L47 A;  3PEO A;  3JAD A;  1OED E;  2Y58 A;  3LSV A;  2MAW A;  2XQA A;  5AFM A;  2KSR A;  5HCM A;  3C79 A;  4ZR6 A;  3WTH A;  4DBM A;  2BYS A;  2QC1 B;  2M6B A;  4XHE A;  2YKS A;  4TWD A;  3RHW A;  2BYN A;  3PMZ A;  5KZU A;  4UM1 A;  5L4E A;  2X00 A;  3P4W A;  1OED C;  4HFE A;  3SQ6 A;  3U8K A;  2XQ3 A;  3RIA A;  2LKG A;  2UZ6 A;  2BYQ A;  3SQ9 A;  4ILA A;  4ZZB A;  2PGZ A;  4BFQ A;  4X5T A;  3JAE A;  5AFJ A;  1OED B;  3WTL A;  4ZK4 A;  3WTM A;  3IGQ A;  4COF A;  2Y57 A;  4A98 A;  2BR7 A;  2LM2 A;  2YMD A;  2XZ6 A;  3UU3 A;  3UU6 A;  4BQT A;  5LG3 A;  5KE4 A;  5CO5 A;  5AFL A;  2BYR A;  2Y7Y A;  5HCJ A;  2ZJV A;  4QAB A;  3WTN A;  3UU8 A;  5J5G A;  3U8L A;  3TLW A;  2XNV A;  4ILC A;  5AFH A;  2WN9 A;  4UXU A;  4QAA A;  2BG9 E;  3EHZ A;  3EAM A;  3RIF A;  4FRR A;  4ALX A;  3GUA A;  4Z90 A;  4ZZC A;  5FJV A;  3UU5 A;  4QH4 A;  4TWF A;  2XNU A;  4PIR A;  4Z91 A;  5HEG A;  5BP0 A;  3WTK A;  2XQ9 A;  4IL4 A;  5HEO A;  3TLV A;  4HFB A;  2BJ0 A;  3RQU A;  3T4M A;  2XQ7 A;  3TLU A;  2PH9 A;  4QAC A;  2XYT A;  5HEJ A;  5BW2 A;  2BG9 C;  4A97 A;  5AFN A;  4ILB A;  3WIP A;  3U8M A;  4ZK1 A;  5CFB A;  2XQ6 A;  2XYS A;  2ZJU A;  4UM3 P;  2BG9 B;  2XQ5 A;  3JAF A;  4XK9 A;  4AFH A;  4LML A;  4HQP A;  3RQW A;  2BG9 A;  3U8J A;  4F8H A; 
#chains in the Genus database with same CATH topology
 1XNR T;  4YTN A;  4P1N A;  3ZEF B;  2XZE A;  3ETU A;  3BK9 A;  4LMJ A;  4EAH A;  4PJL A;  4HEA A;  3O1I A;  4HFC A;  4EED A;  4DVD A;  4CI2 B;  5AQV B;  2CM0 A;  4XZC A;  1IJ6 A;  5IHY A;  2BVL A;  3AA0 B;  4TWH A;  1S94 A;  3JC6 D;  4K0U A;  4IL9 A;  2LOS A;  3UU4 A;  5AFK A;  1UGO A;  3KVA A;  2NOX A;  4GKK T;  4KMC A;  4KBM B;  4P0B A;  3AB3 B;  4KUM B;  1N34 T;  4LFB T;  3K3Q C;  3OBV E;  1JNR A;  3E08 A;  5EZY E;  5IYZ E;  2UU9 T;  3LSV A;  3DJB A;  2LOP A;  1W0B A;  3D0T A;  1MMD A;  2XM2 A;  2QC1 B;  4DBQ A;  4UM1 A;  2X00 A;  4ISS A;  4I4T E;  5LB7 B;  4YSX A;  2PGZ A;  2A3D A;  4X5T A;  3RC3 A;  2FUP A;  2YU2 A;  4COF A;  2WCA A;  3P4Q A;  2XZ6 A;  4U3C A;  3V5S A;  5LBQ B;  3PUG A;  4ALX A;  3AEE A;  4QH4 A;  1EZ3 A;  4JUY A;  5JRE A;  1WLX A;  2WDV A;  5F3J A;  1J5W A;  2CBJ A;  3U8M A;  3RH3 A;  3I9W A;  1UX5 A;  2CPT A;  1FEW A;  1ZOY A;  3A8Y C;  5FY7 A;  2E9X A;  2C0S A;  5LXT E;  1W9R A;  2UUA T;  2LE8 A;  2LHR A;  2J4G A;  5LGN B;  4H9S E;  3AAA B;  4IDZ A;  3J7Y q;  1E2A A;  4ZEY A;  2B76 A;  3N9N A;  3AE6 A;  3N2O A;  1LKX A;  2DWK A;  3AE9 A;  4DV3 T;  5LGU B;  3UQ7 A;  3T1H T;  4UM3 S;  2L9Q A;  1D0X A;  4G63 A;  2K3W A;  4H9O C;  3VKG A;  5CJ5 A;  4TN7 B;  1FMW A;  2VWA A;  3EDV A;  4ZI3 D;  2MOZ A;  5LMN T;  1MMG A;  3JAD A;  2E9X C;  2WP9 A;  3IA3 A;  2W66 A;  5L3D B;  4EYY R;  3EAB A;  3ZT7 A;  3KBU A;  3IEE A;  2M6B A;  2YKS A;  5KZU A;  2J62 A;  1OXZ A;  3AVS A;  3I0O A;  3WTL A;  4QHO A;  1B7T A;  2BR7 A;  4JI0 T;  1XZY A;  2PTF A;  3TLW A;  4DV5 T;  2DCF A;  3PUZ F;  5AFH A;  3UU5 A;  2XQ9 A;  3KV6 A;  4L9I A;  4IIJ E;  2K5B B;  2WB5 A;  4YTP A;  1SUM B;  5JDN A;  4A97 A;  3L3P A;  5FP3 A;  2XQ6 A;  1I6Z A;  5ADX L;  2L8K A;  3HR0 A;  4YJ2 E;  4DUY T;  5HCM A;  4OK0 A;  4F8H A;  4A56 A;  4X1Y E;  5ABF A;  5AQF B;  5AFM B;  4M1P A;  4WV9 A;  4UIG A;  4EIW A;  1U4Q A;  4QH1 A;  4UY2 A;  2BDE A;  2BYP A;  3NWI A;  4HKA A;  2LT3 A;  3SFE A;  2XSB A;  4DR5 T;  5AQR B;  3OJA A;  3Q5W A;  1J5E T;  2WZI A;  2JPF A;  2CMR A;  3U3I A;  4YXD A;  2YME A;  2Y48 B;  3P4R A;  2ZM2 A;  3UTK A;  5JDF A;  4QXB B;  1D1B A;  1Z8U A;  4TZ4 C;  3PMZ A;  4YHH T;  2X66 A;  3TKL B;  5L4E A;  3ZMZ B;  1T72 A;  3RIA A;  4ZZB A;  4H9R C;  4CI1 B;  4UF0 A;  3NKZ A;  3EUH A;  2V5C A;  4CXW A;  4IE5 A;  1XMO T;  2V8S V;  4DR1 T;  1IZN B;  2D9D A;  2KIN B;  5LG3 A;  3WTN A;  1G73 A;  2YDS A;  3O1J A;  4XAX B;  4HFV A;  4ZZC A;  4Z91 A;  2WU5 A;  3AA6 B;  3RX6 A;  5JDH A;  3PUY F;  3MZK B;  5JRC A;  3ETV A;  4IE7 A;  4TUY E;  4TV9 E;  1HNX T;  1CHU A;  1KEY A;  3RYF E;  2BG9 B;  1X9B A;  4AFH A;  4H63 H;  5JRC B;  5J2T E;  5FY0 A;  4AIU A;  3ZC1 A;  4GKJ T;  2X67 A;  4OHF A;  1US7 B;  2XQ4 A;  2BS2 A;  3RI5 A;  3ZDG A;  1S35 A;  1N32 T;  3FB2 A;  5SYO A;  5J5I A;  2XJ7 A;  4DR7 T;  2A72 A;  3P7I A;  2XM1 A;  4YFS A;  2J1D G;  3PJA A;  2VB6 A;  1WR6 A;  4I0U A;  5DJQ C;  3RRW A;  3CKD A;  3AEC A;  3R6N A;  4AFT A;  4IDO A;  2ODV A;  4H9Q C;  2PG8 A;  3WAK A;  3T1Y T;  3C84 A;  2LSK A;  5AQN B;  2BVM A;  3UUL A;  5AFM A;  4LFA T;  4IE6 A;  3AE1 A;  3E22 E;  3HA4 A;  4UEL A;  1VRB A;  2K48 A;  1MIY A;  3AXJ B;  2YK0 A;  1QUU A;  1MMN A;  4ILA A;  4H63 V;  5ABH A;  5C2T A;  2M67 A;  2JRK A;  4PJN A;  2CEA A;  1OWA A;  2LM2 A;  3UU6 A;  1LVF A;  2V7K A;  4H9N C;  3MA9 A;  2G0U A;  2ZLY A;  3ZCI A;  1VCS A;  3EAM A;  4JI3 T;  2XNU A;  4LF4 T;  5JTG A;  2VKH A;  3WTK A;  4UR9 A;  2LSJ A;  3ZJ2 A;  4G2A A;  3EVY A;  2W62 A;  3FZL B;  1ZEE A;  4NUU A;  2CCQ A;  3VHL A;  3RKG A;  4I55 E;  2WMO A;  4HQP A;  3RLF F;  5CGM A;  3CIR A;  3O9X A;  5HEU A;  3VRA A;  3R84 B;  3RPU A;  4QX7 B;  2C5K T;  2RPA A;  4IE4 A;  5FVL A;  4CXX A;  2VQF T;  1T8B A;  2FBW A;  3FZK B;  3KBT A;  4WW0 A;  3IBP A;  3WI3 A;  2WY2 A;  5LMU T;  4MLK A;  5L2L A;  4JBW F;  3WTI A;  5TAO A;  2ACZ A;  2I0M A;  2L3L A;  2LSG A;  3I9Y A;  3U8N A;  1KNZ A;  1SHZ C;  4O4L E;  3TLT A;  4B3M T;  5J5F A;  2A9U A;  3N2K E;  3LJC A;  1MNE A;  1YW0 A;  3H3A A;  2RA1 A;  4B3R T;  2LEH A;  3RGL A;  2CHN A;  2DHR A;  1N33 T;  2V7M A;  5CB4 E;  4EXT A;  2W4X A;  5ABF B;  4A5X A;  3AVR A;  1BR1 A;  2JQ9 A;  1UCU A;  3KIN B;  5HYA A;  4YY3 T;  1R8I A;  4B6X A;  2Q9Q D;  4AKR B;  3OPC A;  2XTL A;  5HEG A;  3GWH A;  2XPK A;  3GA8 A;  2H88 A;  5HEJ A;  4ILB A;  4LF5 T;  2KND A;  1WYC A;  4N78 D;  5AQO B;  2UXC T;  3L8R A;  5J2U E;  2NW7 A;  3AXJ A;  2Q9Q A;  2UXX B;  4AKI A;  2ZM8 A;  3ZMV B;  3WAJ A;  4YSZ A;  3C98 B;  3N9M A;  2Y56 A;  4MFR A;  4X66 T;  2WNL A;  3ZSS A;  2K24 A;  4YTM A;  3SFD A;  2XSA A;  4IDN A;  2VKD A;  4X62 T;  2H89 A;  1IBM T;  3P4P A;  5HWX A;  2LSY A;  1KFY A;  5KXJ A;  5JME A;  3QOF A;  4DUZ T;  1SE7 A;  5LHH B;  2YEV C;  3JC6 C;  5E0O A;  2X51 A;  4JI6 T;  4PFP A;  1SA0 E;  4FJO A;  3CVR A;  3AEF A;  4QXC B;  4GK0 E;  3P4W A;  2HPJ A;  1HX8 A;  4ZI3 C;  4UXN B;  4YLH A;  1LRZ A;  2V6X A;  4O4I E;  4DV1 T;  5LCY A;  5J5G A;  4UXU A;  2H7V C;  2ZM0 A;  3AEG A;  5JH7 E;  4PIR A;  3C51 A;  1U5P A;  2W2U A;  3UFG A;  1X79 A;  2EHO A;  5FMN A;  3LBX A;  4PJM A;  2Q9Q C;  2KWH A;  4YT0 A;  1NEN A;  4CN1 A;  5FXW A;  5LHG B;  3PJA J;  5F8P A;  4DND A;  2V7I A;  4KHZ F;  1UX4 A;  1ZV4 X;  4XBF B;  2CXF A;  2GK9 A;  2WS3 A;  2X9W A;  1YQ4 A;  3KVB A;  4U74 A;  5L3B B;  2UUB T;  4X20 E;  5HEH A;  1UW6 A;  2WNC A;  4CI3 B;  3RIU C;  2MBG A;  2W8G A;  2P9B A;  5JDM A;  4ZJT A;  2WZY A;  4LF7 T;  3UFE A;  4B5D A;  2IAK A;  4ZS2 A;  2W8F A;  3CX6 B;  1YD8 G;  1T98 A;  4JEH B;  1KF6 A;  2AXD S;  1T7S A;  3RYC E;  5AQL B;  4DBM A;  1ZHC A;  5ETW A;  3LK2 B;  1W0A A;  4X1I E;  2QYW A;  2CA5 A;  3SQ9 A;  3JAE A;  4X65 T;  2Y6X A;  5CO5 A;  2Y7Y A;  3UU8 A;  3U8L A;  4UV8 B;  4KHP T;  2BG9 E;  3EHZ A;  3BQI A;  3QK6 A;  5HXH A;  3L09 A;  4AIS A;  2BJ0 A;  1O3X A;  3MK7 C;  2XQ7 A;  2PH9 A;  1KK7 A;  2W63 A;  5AQG B;  3FBL A;  5FXZ A;  2KXP B;  2ODU A;  2QGS A;  3JAF A;  3ANW A;  4B3T T;  3ZLI A;  4EB6 E;  2C9T A;  3A7M A;  4ZRU A;  4NZB A;  5L3G B;  1M7K A;  2LRL A;  5FXV A;  3QB5 K;  1LVK A;  3MKD A;  2NW9 A;  3C4X A;  2H7O A;  3N9L A;  1NEK A;  5F5W A;  1YXR A;  2A2F X;  2UXB T;  4JYA T;  3WTJ A;  3SWH A;  1XWM A;  3K8P C;  4LMK A;  4JI4 T;  2HN1 A;  2CHO A;  2VQE T;  3BQL A;  2DLR A;  3N2G E;  4QH5 A;  3OTO T;  2WDR A;  4PK5 A;  4UV9 B;  1OED E;  1NWM X;  3A5X A;  3N5L A;  2XAJ B;  4CXY A;  4PAG A;  2HHH T;  3FXD B;  3CPZ A;  2IHR 1;  2SPC A;  4BFQ A;  3PUQ A;  1KNP A;  3IGQ A;  4JEU B;  5AQH B;  2ACX A;  4HTE A;  3ZYK A;  1D1C A;  4ILC A;  5AQM B;  5JDG A;  2E2A A;  2X9X A;  4LFC T;  5M4Y A;  2XAS B;  2OLT A;  3CML A;  4HN9 A;  1BR2 A;  3C4W A;  3ABV A;  1V9D A;  3PUA A;  1D0Y A;  2WBL A;  2XYS A;  1VOM A;  5CA1 E;  1HNZ T;  2D0T A;  3VRB A;  4U31 A;  2BG9 A;  2VUR A;  5LA6 E;  3UQ4 A;  3EI0 A;  2ZMA A;  4GIW A;  3RYI E;  2Y8D A;  2LSI A;  4BA9 A;  1HX1 B;  2LLY A;  1W09 A;  2BBJ A;  3FZF B;  3S4U A;  2F4V T;  4E7Z A;  4GOU A;  3PUS A;  4AKG A;  1FIO A;  3SOL A;  4DV6 T;  2N2N A;  5AQI B;  4C91 A;  2BR8 A;  1NAF A;  3C50 A;  4JI2 T;  3VR9 A;  2CLY B;  4GK5 E;  4NXM T;  3ESL A;  3PUX F;  4IST A;  3HKC E;  2KLQ A;  5AQK B;  3PUW F;  2X00 D;  2LJL A;  5LYJ E;  3PEO A;  2XQA A;  3SRZ A;  3WTH A;  4ZR6 A;  5LG4 A;  3VKH A;  4J2C A;  4XHE A;  1DU2 A;  2X0H A;  2BYN A;  3AEA A;  3U8K A;  2BBH A;  2H3R A;  2D0U A;  5FKY A;  4EOZ B;  5AFJ A;  4ZK4 A;  4ADZ A;  4A98 A;  3HL6 A;  4TV8 E;  3KV9 A;  2YMD A;  4LF9 T;  1HCI A;  4ILU A;  3VU7 H;  2V26 A;  2ZJV A;  1HG2 A;  1Z0P A;  4EYU A;  2VVN A;  1KNR A;  3OVU A;  3PUR A;  3GUA A;  4TWF A;  3MAC A;  5BP0 A;  3N9Q A;  5AQU B;  3E0Z A;  2CRB A;  1WFD A;  3WIP A;  5HXR A;  4F6R C;  4ZS3 A;  2ZJU A;  3ZN0 B;  3FHN A;  3RQW A;  3F2E A;  3J9X 1;  4V1A v;  2WDQ A;  1J1J A;  5C3J A;  3HI2 A;  5J5H A;  2XQY A;  3KFW X;  5LNK A;  2WM9 A;  1GQE A;  2CE7 A;  2DNX A;  3ZDH A;  3Q9D A;  1WRD A;  1IAP A;  5JR9 C;  2D2S A;  3B13 A;  3LBX B;  5FL1 A;  4EV6 A;  3WTO A;  2PBI A;  4TNV A;  3PV0 F;  3ONL C;  2XZ5 A;  1I9B A;  2WNJ A;  3ZC0 A;  4ZHQ E;  2JQH A;  2XQ8 A;  4JI1 T;  2QVA A;  3TLS A;  1HG5 A;  3GN5 B;  1YQ3 A;  4AQY T;  4CN6 A;  2DL1 A;  4O2A E;  4K0K T;  5FY1 A;  2WWU A;  3OYX A;  4HFE A;  2BYQ A;  2JQQ A;  4NXN T;  1AJ3 A;  3I0Q A;  2VKO A;  3P8C D;  4IT4 A;  1XDO A;  2MYS A;  3H3M A;  2JMH A;  4U7Y A;  5JR9 A;  4AI6 A;  2VL8 A;  1UK5 A;  2WU2 A;  4BJN A;  2WN9 A;  4QAA A;  3FXE B;  4ANJ A;  4IGU A;  4DV2 T;  2W61 A;  1D0Z A;  4IL4 A;  5KX5 E;  5FXX A;  2KMF A;  3DP7 A;  2HN2 A;  3T4M A;  4U7I A;  4KP3 C;  2WQY A;  3AE2 A;  4HWD A;  4EEB A;  5KDM C;  4LML A;  3ZPO A;  3Q5D A;  5KE4 A;  4IE0 A;  3AA1 B;  3C64 A;  4H9P C;  3U78 A;  3RF1 A;  4UM3 A;  2V1D B;  4L5G A;  4AQF C;  3ZT6 A;  3L39 A;  4UVA B;  5L3C B;  1ZKE A;  3OKQ A;  5LJN A;  4BJM A;  4E7S A;  2X0L B;  4D01 A;  5BMV E;  2BKP A;  2BKN A;  4DR2 T;  2CBI A;  5AQQ B;  3NBX X;  4JLE A;  5ABE A;  1UV6 A;  5J0Z A;  4ZI7 E;  3HKE E;  4P0A A;  2X9Y A;  2IC9 A;  1IBK T;  2XHE B;  4UVC B;  2MAW A;  3AE4 A;  3C79 A;  2J47 A;  4OFZ A;  5LGT B;  2UXD T;  3ZMS B;  3RHW A;  3RYH E;  2NTX A;  2X9H A;  4NIQ A;  3T8O A;  2LKG A;  2FJE A;  4L0R A;  2KZ7 B;  4DR6 T;  5H6Q B;  3SS1 A;  5HWY A;  2X0Y A;  2VVS A;  2BYR A;  2ZM6 T;  4TX5 A;  3QB5 A;  3UUX B;  2XNV A;  2NTY A;  4MHC A;  4AKL A;  3F57 A;  2B1E A;  5FNV E;  4BAY B;  1BR4 A;  5HEO A;  4HWC A;  4QAC A;  4EGW A;  2BG9 C;  2JIW A;  5CFB A;  1VCT A;  5DQW A;  3CX8 B;  4IHJ E;  4MBQ A;  2IDO B;  5IWA T;  4FRR A;  1FMV A;  5AFU L;  2WMN A;  4P09 A;  4QX8 B;  2JQK A;  3N9O A;  4KX6 A;  2W00 A;  4HGA A;  3ZJ1 A;  3PDY A;  3H37 A;  4X64 T;  4CN4 A;  5CA0 E;  3BQK A;  2WAU A;  1QSD A;  3AEB A;  4ZJS A;  4TNW A;  2CXL A;  3HKB E;  2V7L A;  3O1H A;  2XAQ B;  3M3Z B;  3SH1 A;  2EHO B;  1ZP0 A;  4ZXL A;  3IF8 B;  4U2Y A;  2QA7 A;  1UX2 A;  3G06 A;  2C5I T;  2ES0 A;  2PFV A;  4EZ4 A;  4C90 A;  5LP6 E;  5C8Y E;  4CQI A;  2LRK A;  5DQV A;  2CWO A;  2PJQ A;  3B57 A;  1E1H B;  3NRX A;  4ZI2 D;  3AE5 A;  2WSS V;  1QLB A;  1YKH B;  1IBL T;  2IIU A;  4YHJ A;  2UUC T;  4KI0 F;  4JI8 T;  1MND A;  5HCJ A;  1H7C A;  2V7J A;  1XMQ T;  4GYS A;  1IJ5 A;  3Q5E A;  3RQU A;  2V6Y A;  3TLU A;  2KWI B;  4U33 A;  3W15 B;  5HXE A;  4LF6 T;  2Z6E A;  3U8J A;  3GMI A;  1N36 T;  3FBZ A;  2D5U A;  2VL0 A;  4ASK A;  5AIN A;  4UF0 B;  4HFH A;  5BR8 T;  2LM9 A;  5JVD E;  5AQJ B;  4EZ1 A;  3OYZ A;  4YSY A;  5HXS A;  2E5V A;  4NPP A;  5H6R B;  2IML A;  3DTO A;  1WR0 A;  2HPL A;  3F31 A;  5AQP B;  4HFI A;  3PUV F;  4I50 E;  2IW5 B;  4AQG A;  5JDL A;  3UUM A;  5FYM A;  5TVC A;  4DBR A;  4HFD A;  5L3F B;  2Y58 A;  2NP9 A;  3PTR B;  1MIV A;  4PFO A;  2BYS A;  3UT5 E;  2I6H A;  3C4Z A;  4DO0 A;  2CLY C;  3B5M A;  2LHN A;  3KDS E;  2YIN A;  4QWN B;  1XDP A;  3ZST A;  5AFL A;  2Q9Q B;  3LK3 B;  3RIF A;  4DID B;  4HFB A;  2XAH B;  4AKH A;  1HS7 A;  4O4J E;  2V6Y B;  4DR3 T;  4DR4 T;  5J1G A;  4IDP A;  1UUR A;  2XQ5 A;  3JCF A;  1I94 T;  2XAF B;  2HH7 A;  3K1S A;  4UEM A;  2E8I A;  3NZQ A;  3K3O A;  3UUB A;  2EHO C;  3QUJ A;  3VR8 A;  3ZMU B;  3SIO A;  5LOV E;  4JI5 T;  4OYJ A;  4PK4 A;  2I59 A;  2IUB A;  2V5D A;  2LKH A;  2FJB A;  3QNU A;  2OV9 A;  2AE9 A;  3MJX A;  5L4H A;  1MIW A;  4AQF A;  3O4X E;  4ERR A;  2RP4 A;  2M6I A;  3I1A A;  1E7P A;  2JJ9 A;  5L47 A;  2XAG B;  2FJD A;  4ZOL E;  3Q5X A;  3AE7 A;  3FZM B;  1Y01 A;  4Z8X A;  2XUE A;  1MMA A;  4WZX A;  2XQ3 A;  2UZ6 A;  3CQG B;  2EHO D;  3PU3 A;  2C5J A;  4PJJ A;  4BQT A;  2VK9 A;  3ZYM A;  5FJV A;  2E9X D;  3CK6 A;  2W67 A;  2R6G F;  5AQT B;  2UXN B;  1Y64 B;  4ZK1 A;  3ZT5 A;  4CZZ B;  3AE8 A;  1JNZ A;  4UM3 P;  3LK4 2;  3ONJ A;  4XK9 A;  2MTQ A;  4DV0 T;  3HKD E;  4HWI B;  3CQC B;  5JR9 B;  4AFG A;  1HNW T;  1BR0 A;  5KMG P;  2KT9 A;  3AE3 A;  4YJ3 E;  3NVO A;  3RC8 A;  3P50 A;  4X1K E;  5EK3 A;  2VAS A;  5LXB A;  1WYB A;  4HE8 A;  3N9P A;  1L0V A;  5LBM A;  4JI7 T;  5BRX A;  2DI4 A;  2NR4 A;  3LG7 A;  5JQG E;  4GYR A;  1HTJ F;  2YDQ A;  3X1D A;  2YN6 A;  2BS3 A;  5GON E;  4WYV A;  2X68 A;  4NUV A;  2E9X B;  2KSR A;  4I43 B;  3UUN A;  4DMV A;  4IDQ A;  2VKJ A;  4UVB B;  3AAE B;  4OX9 T;  2K9A A;  1OED C;  3AA7 B;  4DV7 T;  3PU8 A;  3QC9 A;  1OED B;  2Y57 A;  1XNQ T;  2MPK A;  4U2Z A;  4QAB A;  4WBN E;  1WCR A;  2BZB A;  4Z90 A;  1G8X A;  3CQX C;  4ZI2 C;  4PK6 A;  3AAI A;  1HFA A;  1M62 A;  4O2B E;  3ANW B;  2DWG A;  4HWF A;  3M65 A;  2BKO A;  3FZH B;  2JMK A;  5DAB A;  2W0G A;  1CUN A;  3NZP A;  4AXP A;  2NWB A;  3ZKR A;  3V5U A;  4DMW A;  4QKN A;  2Y54 A;  2OA5 A;  3LFM A;  4MAL A;  5IUX A;  4IRE A;  5ABG A;  4DV4 T;  4WNK A;  2XNT A;  2CXD A;  3ZMT B;  1HF8 A;  1OED A;  3ONX A;  4PNI A;  1FJG T;  3P4S A;  3ZN1 B;  3ZCJ A;  2YDR A;  2YOE A;  3PE0 A;  3K3N A;  5FL0 A;  4WBO A;  3LDQ B;  2E5L T;  2WZH A;  4EZH A;  2NW8 A;  4QXH B;  3Q2M A;  2WWV A;  4TWD A;  3RRC A;  4U72 A;  1YKE B;  2N1G A;  3MXZ A;  3SQ6 A;  5LHI B;  3NRY A;  4JV5 T;  3GN5 A;  5EK2 A;  3KV5 A;  3KV4 A;  3WTM A;  1D1A A;  1UUS A;  5HXC A;  3ZYL A;  1HR0 T;  3CWZ B;  3RIU A;  3EDU A;  3UU3 A;  4O4H E;  2BS4 A;  5FVK A;  2IC6 A;  4Q25 A;  4FI5 A;  4O8S A;  3TLV A;  5L3E B;  5A1L A;  5LJM A;  2QRX A;  5JDQ A;  4B3S T;  2XYT A;  5BW2 A;  5EK4 A;  5AFN A;  4OYK A;  5HAX A;  2XY8 B;  3AED A;  3CX7 B;  5AQS B;  2N9D A;  3IHR A;  4PW8 A;  2YU1 A;  2FJA A;  4HWH A;  3RKO A;  2CWY A;  4LF8 T; 
#chains in the Genus database with same CATH homology
 4ZRU A;  3UQ4 A;  4AFG A;  4NZB A;  2VL0 A;  5AFM B;  3EI0 A;  2XQ4 A;  3UUB A;  4WV9 A;  3RI5 A;  3ZKR A;  3ZDG A;  5HEU A;  5J5H A;  3P50 A;  2LLY A;  3SIO A;  2Y54 A;  4UM3 A;  5AIN A;  4QH1 A;  5IUX A;  4HFH A;  4IRE A;  4UY2 A;  4LMJ A;  5SYO A;  3ZDH A;  5HEH A;  5J5I A;  1UW6 A;  2WNC A;  4HFC A;  4EZ1 A;  2LKH A;  2XNT A;  2Y56 A;  2W8G A;  2BYP A;  2WNL A;  4ZJS A;  4ZJT A;  5LXB A;  3WTO A;  2C9T A;  4TNW A;  2WZY A;  4TNV A;  4D01 A;  4NPP A;  4TWH A;  3UQ7 A;  4B5D A;  4AFT A;  4IL9 A;  3SH1 A;  3WTJ A;  1OED A;  2BR8 A;  4UM3 S;  5BRX A;  3UU4 A;  2XZ5 A;  4HFI A;  1I9B A;  3WTI A;  5AFK A;  4LMK A;  5L4H A;  2W8F A;  2WNJ A;  1UV6 A;  1UX2 A;  2XQ8 A;  5J0Z A;  2YOE A;  5TVC A;  3U8N A;  2M6I A;  3TLS A;  5JME A;  4QH5 A;  3TLT A;  2YN6 A;  4HFD A;  2X00 D;  3C84 A;  5J5F A;  2YME A;  5L47 A;  3PEO A;  3JAD A;  1OED E;  2Y58 A;  3LSV A;  2MAW A;  2XQA A;  5AFM A;  2KSR A;  5HCM A;  3C79 A;  4ZR6 A;  3WTH A;  4DBM A;  2BYS A;  2QC1 B;  2M6B A;  4XHE A;  2YKS A;  4TWD A;  3RHW A;  2BYN A;  3PMZ A;  5KZU A;  4UM1 A;  5L4E A;  2X00 A;  3P4W A;  1OED C;  4HFE A;  3SQ6 A;  3U8K A;  2XQ3 A;  3RIA A;  2LKG A;  2UZ6 A;  2BYQ A;  3SQ9 A;  4ILA A;  4ZZB A;  2PGZ A;  4BFQ A;  4X5T A;  3JAE A;  5AFJ A;  1OED B;  3WTL A;  4ZK4 A;  3WTM A;  3IGQ A;  4COF A;  2Y57 A;  4A98 A;  2BR7 A;  2LM2 A;  2YMD A;  2XZ6 A;  3UU3 A;  3UU6 A;  4BQT A;  5LG3 A;  5KE4 A;  5CO5 A;  5AFL A;  2BYR A;  2Y7Y A;  5HCJ A;  2ZJV A;  4QAB A;  3WTN A;  3UU8 A;  5J5G A;  3U8L A;  3TLW A;  2XNV A;  4ILC A;  5AFH A;  2WN9 A;  4UXU A;  4QAA A;  2BG9 E;  3EHZ A;  3EAM A;  3RIF A;  4FRR A;  4ALX A;  3GUA A;  4Z90 A;  4ZZC A;  5FJV A;  3UU5 A;  4QH4 A;  4TWF A;  2XNU A;  4PIR A;  4Z91 A;  5HEG A;  5BP0 A;  3WTK A;  2XQ9 A;  4IL4 A;  5HEO A;  3TLV A;  4HFB A;  2BJ0 A;  3RQU A;  3T4M A;  2XQ7 A;  3TLU A;  2PH9 A;  4QAC A;  2XYT A;  5HEJ A;  5BW2 A;  2BG9 C;  4A97 A;  5AFN A;  4ILB A;  3WIP A;  3U8M A;  4ZK1 A;  5CFB A;  2XQ6 A;  2XYS A;  2ZJU A;  4UM3 P;  2BG9 B;  2XQ5 A;  3JAF A;  4XK9 A;  4AFH A;  4LML A;  4HQP A;  3RQW A;  2BG9 A;  3U8J A;  4F8H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...