2XQ7A

Pentameric ligand gated ion channel glic in complex with cadmium ion (cd2+)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
310
structure length
310
Chain Sequence
PPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAFDPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLERFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDDVFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILPMLFILFISWTAFWSTSYEANVTLVVSTLIAHIAFNILVETNLPKTPYMTYTGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFLLANIILAFLFFGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLR4197 PROTEIN
publication title Structural Basis of Open Channel Block in a Prokaryotic Pentameric Ligand-Gated Ion Channel
pubmed doi rcsb
source organism Gloeobacter violaceus pcc 7421
molecule tags Membrane protein
total genus 77
structure length 310
sequence length 310
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-09-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02931 Neur_chan_LBD Neurotransmitter-gated ion-channel ligand binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.390 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Neurotransmitter-gated ion-channel transmembrane domain 2xq7A02
2.70.170.10 Mainly Beta Distorted Sandwich Acetylcholine Binding Protein; Chain: A, Neurotransmitter-gated ion-channel ligand-binding domain 2xq7A01
3P50A 5L4HA 3ZKRA 2ZJUA 4HFIA 2PH9A 2ZJVA 5J5FA 5HCMA 3P4WA 4PIRA 2XNVA 5J5HA 2BYQA 4ALXA 2XYTA 5AINA 4Z90A 5L47A 3UU5A 3UU4A 4QH5A 2BYPA 5TVCA 3ZDGA 2PGZA 3JAFA 2XQ9A 3RQWA 5JMEA 5FJVA 4QABA 4ZZCA 2MAWA 4A97A 5J5GA 4HFEA 5IUXA 3IGQA 4ZR6A 2X00A 3GUAA 3U8LA 5BRXA 4TWFA 3WTHA 3PMZA 3U8NA 3C84A 4ZJSA 5CFBA 4TNVA 4XHEA 2YMDA 4QACA 3SH1A 3JADA 3WTNA 4D01A 2BJ0A 2BG9A 1UV6A 3WTJA 5AFMB 5AFJA 4UM1A 5LXBA 5J0ZA 4AFHA 4QH4A 4TWDA 4UM3P 4ILCA 4F8HA 2Y7YA 2XQ4A 5AFLA 3U8JA 2Y58A 4BFQA 4NPPA 4TWHA 2UZ6A 4LMJA 5HEJA 2LKHA 5AFKA 3ZDHA 2VL0A 1OEDA 2Y57A 4FRRA 4HFCA 2XQ3A 3WTLA 2LM2A 3UU3A 3WTIA 4ZZBA 4HQPA 5HEGA 3WTOA 2BG9C 4ZK4A 4HFBA 3WTMA 2Y56A 2XQAA 2XYSA 4IL9A 4ZRUA 4AFGA 3T4MA 5AFNA 2WNLA 5HCJA 3RI5A 3U8MA 4ZJTA 4UM3S 5J5IA 3RQUA 3TLSA 5AFHA 4WV9A 4ILAA 2YN6A 4COFA 4QAAA 1UX2A 2XQ5A 5HEUA 3UQ4A 5LG3A 4HFDA 2QC1B 4UY2A 4IREA 3RIAA 4DBMA 3EI0A 1OEDC 3TLUA 5HEOA 4ILBA 4UXUA 4QH1A 3RIFA 2YOEA 4X5TA 5KE4A 2M6IA 5CO5A 4LMKA 3RHWA 3U8KA 2XQ8A 3JAEA 2WN9A 2XZ6A 2M6BA 2BYNA 4IL4A 3WIPA 2C9TA 4TNWA 2W8GA 2XNTA 3LSVA 2BG9E 4A98A 5KZUA 2LKGA 5L4EA 1I9BA 2BR7A 2LLYA 2BYRA 3TLTA 2WNJA 2X00D 2YMEA 4HFHA 4EZ1A 4ZK1A 5BW2A 3UUBA 3EHZA 2BG9B 2BYSA 4Z91A 2YKSA 5AFMA 2W8FA 3C79A 5SYOA 2Y54A 1UW6A 2WZYA 4XK9A 4AFTA 3WTKA 3TLVA 4BQTA 2XNUA 5BP0A 3SQ6A 1OEDE 3SIOA 3UU6A 3PEOA 2WNCA 4B5DA 4NZBA 4UM3A 3UQ7A 2XZ5A 3TLWA 2XQ7A 3EAMA 3SQ9A 2BR8A 2XQ6A 2KSRA 1OEDB 3UU8A 5HEHA 4LMLA
chains in the Genus database with same CATH superfamily
2IMLA 2UXXB 4P0BA 4O4HE 3UTKA 3ZLIA 4YXDA 3UU5A 3UU4A 3QOFA 4NIQA 4QH5A 1WR0A 2I59A 2MAWA 4TZ4C 5CFBA 2EHOD 2BG9A 2X0YA 1MIVA 3ZPOA 4OFZA 3ZT6A 1IJ5A 5L3FB 4IDQA 3AVSA 1HG5A 3QUJA 2WWVA 2LKHA 4H9RC 5CB4E 1WCRA 2IHR1 3WTIA 1CHUA 4ZK4A 4ZI2C 3T4MA 2H88A 3UUXB 2QGSA 4ZS2A 3PU8A 3EUHA 1J5ET 1UCUA 2UXNB 3CX7B 4UY2A 3EI0A 2KWHA 4OYJA 1YKHB 3AE8A 2Z6EA 2ES0A 1HNZT 2K24A 5LGUB 1ZEEA 1MNDA 4DNDA 4DR4T 2XNTA 3LSVA 3LK42 2KZ7B 3EVYA 2A3DA 3BQLA 1J5WA 3CWZB 3ETUA 4TV9E 3AE2A 2W0GA 3BK9A 5J2UE 3AAIA 2ACXA 2EHOB 3UU6A 3UQ7A 1R8IA 2LRKA 3MA9A 3Q2MA 2BR8A 3V5UA 3PUQA 2KINB 2E2AA 3RPUA 1BR2A 2W67A 3ZYLA 2E5LT 4O8SA 2JIWA 2QA7A 2FJEA 2NR4A 3HA4A 1W0BA 3NKZA 3VR9A 4Z8XA 3SH1A 3IBPA 3A5XA 3ZT7A 4F8HA 1Z8UA 5AFLA 4YSZA 2UZ6A 4O2BE 3NRXA 3P4RA 5HEJA 3KVBA 4DVDA 5AQMB 5AQNB 1YQ4A 3WTLA 5FYMA 2XUEA 5AQFB 4ZJTA 5J5IA 5AQGB 1S94A 5FP3A 2IW5B 3L39A 2YDSA 3VKGA 2EHOA 2W00A 3MJXA 1E2AA 3EABA 2XTLA 1X79A 4EYUA 3P4PA 4U74A 4ERRA 5ABFB 4L5GA 4TNWA 5FXZA 2IUBA 3UUBA 4HKAA 5FL0A 4DR2T 4C90A 4HTEA 2CCQA 3SQ6A 3PEOA 2ZMAA 1UGOA 5L2LA 4GYRA 1XNQT 5AQTB 3W15B 5LGTB 4ALXA 1E1HB 5FKYA 5AQJB 2PGZA 4YSXA 3N9OA 2LHNA 5FJVA 3C4WA 3U8LA 4B5DA 4EV6A 3WTNA 1BR4A 3RIUA 5C3JA 3E0ZA 1T8BA 4ILCA 4I4TE 5FY0A 4H63H 2PG8A 4KBMB 2D0UA 2V6XA 5ABEA 1Y01A 4MFRA 5AFUL 2VL0A 4YT0A 4JUYA 4HQPA 1M62A 2CXLA 2JQ9A 2Y56A 5JRCB 4AFGA 2Q9QC 2ZM0A 3IEEA 2UXBT 3LBXB 1HR0T 2OLTA 4GKJT 5DABA 2XQ5A 4WNKA 2DL1A 3RKOA 2ODUA 2QC1B 2UXCT 4IREA 2CEAA 3U78A 2YOEA 2XHEB 2ACZA 4IE4A 2XZ6A 3P7IA 4PW8A 5KZUA 5F5WA 4UV8B 2LKGA 2NTYA 3Q5DA 4JI0T 5BW2A 4ZK1A 1WLXA 2W8FA 2YINA 5LB7B 1YKEB 2H7VC 4ZI3D 3TLWA 1XWMA 3EAMA 3UULA 2X67A 4CXWA 2HHHT 2DWGA 4Q25A 3GA8A 5L4HA 4EXTA 3AEBA 2ZJUA 2ZJVA 5J5FA 3U3IA 3P4WA 2XNVA 2PJQA 5JRCA 2HH7A 3H3MA 5JQGE 2ZLYA 3P4QA 5J5GA 3LBXA 2BBJA 3UFGA 3N2OA 4AQGA 2BBHA 4A5XA 3O4XE 1VCTA 3ZMTB 3Q5XA 1KNPA 1HF8A 5L3CB 2C5JA 2LSGA 4IDNA 3HI2A 4KP3C 1D0XA 3AEAA 2XQ3A 3A7MA 1US7B 4GK5E 3C98B 2WB5A 4HFBA 4JEHB 2XYSA 1QLBA 1HFAA 4ZOLE 5AQLB 5GONE 4WV9A 5HEUA 3UQ4A 3K1SA 2CXDA 2LEHA 4OX9T 1D1CA 3KV9A 2C5IT 4U7YA 3SS1A 3UFEA 5J2TE 3CMLA 2D5UA 2FJDA 2M6IA 5ADXL 2LHRA 1L0VA 4ZXLA 4DV7T 3WIPA 2BG9E 4BAYB 2D2SA 4JLEA 1MMAA 4CZZB 3KINB 2HPLA 2YKSA 3C79A 5LMUT 2HPJA 4JI8T 4XK9A 4AFTA 1VCSA 4KUMB 2WNCA 5LHGB 3VRAA 5HAXA 5LHIB 3NZQA 1EZ3A 5J1GA 4LMLA 3P50A 5E0OA 3GWHA 1MIYA 2UUCT 2BYQA 2LT3A 2XQ9A 3T1HT 3MACA 2G0UA 5FMNA 4FJOA 4QXCB 5CA0E 3ZMSB 5AFJA 4NXMT 4PK4A 3E08A 1IBKT 2LSKA 3CQCB 5JDQA 2WDRA 4AQYT 1OEDA 2Y57A 2XASB 3RYIE 1ZV4X 4KMCA 3AE6A 3ZSTA 2VQFT 4P0AA 5AFHA 2VKDA 2YN6A 4IE6A 4HFDA 3C4XA 4ILBA 3SFEA 4X5TA 1WRDA 4TX5A 5KE4A 1HTJF 5HXHA 1UK5A 2WN9A 4X62T 4JI7T 1NWMX 2C9TA 2WP9A 2WBLA 4AIUA 2KWIB 4LFCT 4DBQA 2DHRA 4TN7B 3AEFA 4DR7T 2BG9B 5CGMA 4Z91A 2Y48B 4WBNE 3ZMZB 3LG7A 2N9DA 1XNRT 4O4LE 4A56A 5M4YA 4BJNA 5H6QB 4JI2T 5TAOA 2NWBA 4YTPA 1SE7A 2VKJA 2CLYB 2YK0A 3KV5A 4A97A 3A8YC 3P4SA 3RF1A 5C2TA 5JR9B 4I55E 2X51A 5AFMB 5FXWA 4PJNA 4MBQA 3QB5A 1FEWA 3AB3B 3HL6A 5F8PA 3T1YT 4AKGA 3AE1A 3EDUA 1UX4A 3RYCE 3ANWA 3VR8A 3FHNA 3K3QC 1T7SA 2VURA 2IC6A 4PK5A 5AFNA 1LVKA 3HKCE 4YY3T 2X9YA 2EHOC 5BMVE 4DIDB 2VVNA 2W61A 1AJ3A 4AQFA 2XAFB 5EZYE 1E7PA 4M1PA 4QKNA 5F3JA 3U8KA 2XM1A 1CUNA 3CQGB 5KX5E 2AXDS 3Q9DA 1KF6A 2WZHA 1LRZA 4AKLA 4YHHT 5JR9A 3I0QA 5AFMA 4UIGA 5LP6E 3WTKA 4IT4A 4H63V 4KHPT 2ZM8A 2A72A 4MLKA 3ETVA 2W63A 3J9X1 2XZ5A 3ABVA 2XQ6A 4CN1A 3AA7B 3U8NA 3V5SA 4I43B 2XQYA 2MYSA 4U3CA 2WSSV 5IWAT 5FVLA 1HNXT 4ZZCA 5IUXA 3IGQA 4DMWA 3C84A 1UUSA 3RIUC 1W09A 3CKDA 4LF4T 3J7Yq 2BKPA 4AFHA 4TUYE 4UM3P 4IE0A 2JMKA 4E7ZA 2FJBA 4JBWF 4HWCA 4U2ZA 4IHJE 3ZDHA 2C5KT 4ISSA 1SHZC 2XY8B 3UU3A 3WTMA 4ZRUA 5HCJA 5LCYA 1NAFA 3RLFF 3TLSA 3RKGA 2LSIA 3NVOA 4I50E 2V8SV 3AE5A 3ZMVB 4XZCA 4UXUA 4X66T 5AQVB 5JDMA 3RIFA 2WCAA 3KVAA 2ZM6T 4LMKA 5H6RB 2BS2A 3CX6B 3UUNA 3S4UA 2OA5A 4IDPA 3I9YA 1U5PA 2LLYA 4LFAT 4DR3T 2WZIA 1SUMB 3HKBE 2UXDT 3HKDE 4DV6T 2X0HA 5JDHA 2FBWA 4NZBA 1G73A 2QRXA 4DV3T 2B1EA 3LDQB 2XQ7A 2XAHB 2WDVA 4ZJSA 4YHJA 4CI1B 3FZLB 2PH9A 3ZC0A 5LBQB 3SOLA 2ODVA 1H7CA 2QYWA 2X0LB 3PUYF 5FXVA 4UM1A 2KLQA 3UT5E 1FJGT 4QH4A 3NWIA 3MKDA 3KBUA 4CXYA 2C0SA 4TWHA 1MNEA 2BS3A 3SWHA 2CHOA 3X1DA 2JPFA 2DNXA 1W9RA 4O4IE 3PU3A 5HEGA 4UVBB 4IL9A 3ZJ1A 4E7SA 2PBIA 4QAAA 4UXNB 3MXZA 3H37A 3H3AA 4C91A 5HWYA 5FY1A 3QK6A 2YU1A 4XBFB 2N2NA 3O1HA 3QB5K 3F2EA 3F57A 4CI2B 3MZKB 3KV4A 2MPKA 2WY2A 3RC3A 2BZBA 2UUAT 1WR6A 2WU5A 3AAAB 4P09A 2BR7A 4GYSA 3WI3A 2IIUA 3VKHA 1Y64B 1D1BA 3TLVA 1OEDE 3FB2A 4CQIA 2CRBA 5LGNB 4EAHA 4I0UA 4KHZF 2KSRA 3R84B 4WW0A 3AE9A 2VASA 4LF9T 2PFVA 4HFIA 1HCIA 5HXEA 1D0YA 3Q5WA 2E9XD 5AINA 1IZNB 3ZDGA 5JMEA 4QABA 3GUAA 3WTHA 2WS3A 5HXCA 5AQHB 4NUUA 4ZI3C 5JTGA 2XAQB 4QHOA 2DWKA 4X65T 3R6NA 2H89A 2XPKA 1UX2A 2YDRA 5CJ5A 2F4VT 3GMIA 2X9WA 1KEYA 4EOZB 3TLUA 4BA9A 2DLRA 4YLHA 2CA5A 4H9SE 2BS4A 4HN9A 2CWOA 5HWXA 2B76A 4WZXA 1KNRA 5C8YE 1V9DA 2JJ9A 3OBVE 3NZPA 5FXXA 5IYZE 2E9XB 4DV5T 2Y6XA 3AE4A 4LF6T 2WMNA 3QNUA 2YDQA 2XNUA 5BP0A 4PNIA 1OXZA 4PJJA 3QC9A 3PUGA 1KNZA 1VRBA 2V1DB 3G06A 3B13A 5DQVA 5L3GB 1OEDB 2BKOA 5HEHA 3N9MA 2BVLA 3ZKRA 3M3ZB 3SFDA 5TVCA 4AXPA 3FZMB 4UV9B 4HEAA 2K5BB 2VWAA 2JQHA 3AEGA 4TWFA 2V5CA 4QX7B 2HN2A 1UV6A 3WTJA 4LFBT 1FMVA 2KMFA 1XDOA 2X9XA 4NPPA 5AQIB 2V7JA 2P9BA 2XAGB 5EK4A 4B3RT 1BR0A 2CPTA 3OTOT 3CQXC 3HKEE 4PAGA 2I0MA 2M67A 1HX8A 3RRWA 5KXJA 1SA0E 2YEVC 3LK2B 2BG9C 2CWYA 2E9XA 3N2KE 1IBMT 1D1AA 2CM0A 4K0UA 5LG3A 4XAXB 1M7KA 2KXPB 2XSAA 4JEUB 4DR6T 5LNKA 5JVDE 5LJNA 2JMHA 3PURA 4AKHA 3AA1B 3OYXA 4F6RC 4O2AE 5AQKB 4ASKA 4X1KE 2CLYC 2I6HA 3PV0F 1W0AA 2BYNA 2X66A 4DMVA 5JR9C 2VK9A 4ISTA 2X68A 3AE7A 4LF8T 3O1IA 3DTOA 2Y54A 3AXJB 2D9DA 1HS7A 3JC6D 1I94T 2AE9A 2VL8A 4B3MT 4LMJA 3ANWB 4O4JE 3VHLA 2UU9T 4CXXA 5LXTE 2XYTA 4ZI7E 2BYPA 3LJCA 3JAFA 4HFEA 4UEMA 3E22E 4TNVA 4PJLA 4U2YA 2NP9A 5J0ZA 4DV0T 4MALA 4HGAA 2H3RA 4JI5T 2LSYA 3K3NA 2J47A 5AFKA 2H7OA 4DR5T 1D0ZA 3ZCJA 4X1IE 5JREA 5LMNT 2XZEA 5AQRB 2WM9A 1MIWA 5LHHB 1IJ6A 3AXJA 4ILAA 4COFA 1LVFA 3N9PA 1YQ3A 2W2UA 4V1Av 4DBMA 2E5VA 2V5DA 3RGLA 2Y8DA 5FL1A 3L8RA 5AQQB 3RRCA 2NW9A 1YD8G 3ZCIA 2BDEA 3OJAA 4JV5T 3LFMA 2LOPA 3AVRA 5L4EA 2V7LA 1IAPA 4HE8A 3ZYKA 4B3TT 5JDFA 3F31A 4JI3T 2V6YB 3RYHE 5IHYA 5L3BB 4UF0A 3RH3A 4MHCA 4UM3A 3K8PC 3CK6A 2W4XA 5AQOB 5KDMC 2Y7YA 3UU8A 4X64T 2CXFA 4HFVA 4QWNB 4FI5A 4H9PC 2FJAA 5AQPB 2A9UA 4ZI2D 3BQIA 5JH7E 3OKQA 3JCFA 4EEBA 3PMZA 2YMDA 4QACA 2RA1A 4JYAT 2N1GA 4J2CA 1WFDA 1O3XA 4TWDA 1N33T 4JI6T 3U8JA 2ZM2A 3BQKA 3PUZF 4FRRA 5LG4A 4HFCA 2VKOA 4U31A 3PJAA 3PUWF 4H9QC 2XM2A 3RI5A 2V7KA 1U4QA 4OK0A 3C51A 4U7IA 2WDQA 3O9XA 1N34T 3CVRA 2W62A 2V6YA 4CI3B 1ZP0A 4AKIA 2L8KA 5JDLA 4QH1A 5AQUB 3KFWX 3N9NA 1YW0A 1J1JA 4N78D 4UVCB 1DU2A 4HWDA 4BJMA 5ABHA 1I9BA 4AI6A 3TLTA 5BR8T 4EZ1A 4PFPA 2K48A 2A2FX 4IE7A 3PE0A 4X1YE 5LYJE 3L09A 2LOSA 3N2GE 3LK3B 3OPCA 4Z90A 3FZHB 4YJ3E 2HN1A 2BVMA 4NUVA 2WQYA 3AECA 2KNDA 4D01A 3JADA 3CX8B 5HXRA 3SRZA 4IDZA 4PFOA 1HX1B 1NEKA 3ZYMA 3PDYA 3FXEB 3OYZA 1N36T 1UX5A 4EB6E 3EDVA 1WYBA 2MTQA 2LJLA 4IDOA 3FBLA 1HG2A 1JNRA 1T98A 4WBOA 2DI4A 1XDPA 1FIOA 5CO5A 2GK9A 3FZFB 5LOVE 3O1JA 3WAJA 3DP7A 2BYRA 2X00D 3AE3A 5ETWA 4HFHA 4H9NC 3AEEA 1ZKEA 4GIWA 4AISA 2BYSA 2NW7A 2JRKA 4TV8E 1KK7A 5KMGP 4L9IA 4IGUA 5EK3A 3ZT5A 2VB6A 3M65A 3AA6B 2XJ7A 2X9HA 3AAEB 4QX8B 5ABFA 4PIRA 5DJQC 3I1AA 4G63A 3RQWA 2Q9QD 4ZR6A 5JDGA 4XHEA 2J62A 2BJ0A 2E8IA 4ILUA 3ZN0B 2V7IA 1UURA 1FMWA 2XQ4A 4BFQA 4GK0E 2NOXA 4UELA 3ONLC 3VU7H 2RPAA 3PTRB 4B3ST 4DV1T 2E9XC 2LRLA 2V7MA 3WTOA 5LJMA 2XQAA 4DUZT 1XMQT 2XAJB 4UM3S 1Z0PA 3RQUA 3AA0B 1MMGA 3DJBA 3I0OA 1B7TA 1OEDC 2MBGA 1IBLT 2VKHA 4DV2T 4NXNT 2XQ8A 2J4GA 4G2AA 1GQEA 3ZEFB 2M6BA 3KBTA 4IL4A 4U72A 3FXDB 4OYKA 2WNJA 2YMEA 2JQQA 3B5MA 4EZ4A 1XMOT 5SYOA 2KT9A 5FVKA 2IDOB 2Q9QB 4X20E 3UUMA 1MMDA 5FY7A 1ZHCA 3I9WA 5LBMA 1G8XA 5L3DB 5CA1E 2FUPA 1JNZA 2RP4A 3ZC1A 2MOZA 3NBXX 3IHRA 2DCFA 2VQET 4UR9A 4YTNA 4HWIB 3N9QA 2X00A 1OWAA 4AKRB 4UVAB 2YU2A 2OV9A 3N5LA 4GKKT 3PUAA 3ZMUB 1S35A 2WMOA 1KFYA 2IC9A 1I6ZA 3AEDA 4EGWA 4DUYT 2LM2A 3PUVF 4L0RA 4IE5A 4YSYA 3D0TA 5EK2A 2WNLA 3U8MA 2Q9QA 3ZSSA 3ONJA 3KV6A 3PJAJ 3RIAA 2CBIA 4P1NA 4EEDA 3GN5B 3ONXA 2NW8A 3WAKA 1QUUA 4KI0F 3T8OA 4ZS3A 3VRBA 2QVAA 2WU2A 4QXBB 2W8GA 3IF8B 4EZHA 4WYVA 4AQFC 4JI1T 2LSJA 5ABGA 2V26A 4QXHB 1MMNA 1NENA 1UW6A 4B6XA 3C4ZA 2L3LA 4DO0A 4BQTA 3C50A 4LF5T 3IA3A 2IAKA 3B57A 4ANJA 4LF7T 3L3PA 3PUXF 2CHNA 5L3EB 3ESLA 2WAUA 4DBRA 3RYFE 5HCMA 2D0TA 5J5HA 4PJMA 5A1LA 3KDSE 4HWFA 2NTXA 5L47A 1HNWT 5BRXA 1N32T 4ADZA 4DV4T 5HYAA 3FZKB 3MK7C 4YFSA 2K9AA 4EYYR 4ZEYA 2CMRA 5LXBA 3CPZA 3JC6C 2Y58A 4YJ2E 2JQKA 3GN5A 1BR1A 5DQWA 2UUBT 4CN6A 4KX6A 3CIRA 2BKNA 4JI4T 1ZOYA 1VOMA 4OHFA 1LKXA 2K3WA 4ZZBA 3ZN1B 3P8CD 5FNVE 1YXRA 4IIJE 3TKLB 4PK6A 3C64A 3RC8A 3OVUA 4CN4A 4UF0B 2R6GF 3PUSA 2SPCA 3RX6A 3HR0A 2J1DG 5HEOA 5JDNA 2L9QA 1X9BA 1XZYA 1QSDA 3ZJ2A 3RHWA 3JAEA 1WYCA 4YTMA 2VVSA 4A98A 2PTFA 2WWUA 5AQSB 4EIWA 3Q5EA 2CBJA 4GOUA 2LE8A 1T72A 3EHZA 2LM9A 2WZYA 3K3OA 4ZHQE 3N9LA 4HWHA 4K0KT 4DR1T 3FBZA 3SIOA 4H9OC 2W66A 2CE7A 5HXSA 3NRYA 3SQ9A 5LA6E 2XSBA 4U33A
chains in the Genus database with same CATH topology
3P50A 5L4HA 3ZKRA 2ZJUA 4HFIA 2PH9A 2ZJVA 5J5FA 5HCMA 3P4WA 4PIRA 2XNVA 5J5HA 2BYQA 4ALXA 2XYTA 5AINA 4Z90A 5L47A 3UU5A 3UU4A 4QH5A 2BYPA 5TVCA 3ZDGA 2PGZA 3JAFA 2XQ9A 3RQWA 5JMEA 5FJVA 4QABA 4ZZCA 2MAWA 4A97A 5J5GA 4HFEA 5IUXA 3IGQA 4ZR6A 2X00A 3GUAA 3U8LA 5BRXA 4TWFA 3WTHA 3PMZA 3U8NA 3C84A 4ZJSA 5CFBA 4TNVA 4XHEA 2YMDA 4QACA 3SH1A 3JADA 3WTNA 4D01A 2BJ0A 2BG9A 1UV6A 3WTJA 5AFMB 5AFJA 4UM1A 5LXBA 5J0ZA 4AFHA 4QH4A 4TWDA 4UM3P 4ILCA 4F8HA 2Y7YA 2XQ4A 5AFLA 3U8JA 2Y58A 4BFQA 4NPPA 4TWHA 2UZ6A 4LMJA 5HEJA 2LKHA 5AFKA 3ZDHA 2VL0A 1OEDA 2Y57A 4FRRA 4HFCA 2XQ3A 3WTLA 2LM2A 3UU3A 3WTIA 4ZZBA 4HQPA 5HEGA 3WTOA 2BG9C 4ZK4A 4HFBA 3WTMA 2Y56A 2XQAA 2XYSA 4IL9A 4ZRUA 4AFGA 3T4MA 5AFNA 2WNLA 5HCJA 3RI5A 3U8MA 4ZJTA 4UM3S 5J5IA 3RQUA 3TLSA 5AFHA 4WV9A 4ILAA 2YN6A 4COFA 4QAAA 1UX2A 2XQ5A 5HEUA 3UQ4A 5LG3A 4HFDA 2QC1B 4UY2A 4IREA 3RIAA 4DBMA 3EI0A 1OEDC 3TLUA 5HEOA 4ILBA 4UXUA 4QH1A 3RIFA 2YOEA 4X5TA 5KE4A 2M6IA 5CO5A 4LMKA 3RHWA 3U8KA 2XQ8A 3JAEA 2WN9A 2XZ6A 2M6BA 2BYNA 4IL4A 3WIPA 2C9TA 4TNWA 2W8GA 2XNTA 3LSVA 2BG9E 4A98A 5KZUA 2LKGA 5L4EA 1I9BA 2BR7A 2LLYA 2BYRA 3TLTA 2WNJA 2X00D 2YMEA 4HFHA 4EZ1A 4ZK1A 5BW2A 3UUBA 3EHZA 2BG9B 2BYSA 4Z91A 2YKSA 5AFMA 2W8FA 3C79A 5SYOA 2Y54A 1UW6A 2WZYA 4XK9A 4AFTA 3WTKA 3TLVA 4BQTA 2XNUA 5BP0A 3SQ6A 1OEDE 3SIOA 3UU6A 3PEOA 2WNCA 4B5DA 4NZBA 4UM3A 3UQ7A 2XZ5A 3TLWA 2XQ7A 3EAMA 3SQ9A 2BR8A 2XQ6A 2KSRA 1OEDB 3UU8A 5HEHA 4LMLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P50 A;  5L4H A;  3ZKR A;  2ZJU A;  4HFI A;  2PH9 A;  2ZJV A;  5J5F A;  5HCM A;  3P4W A;  4PIR A;  2XNV A;  5J5H A;  2BYQ A;  4ALX A;  2XYT A;  5AIN A;  4Z90 A;  5L47 A;  3UU5 A;  3UU4 A;  4QH5 A;  2BYP A;  5TVC A;  3ZDG A;  2PGZ A;  3JAF A;  2XQ9 A;  3RQW A;  5JME A;  5FJV A;  4QAB A;  4ZZC A;  2MAW A;  4A97 A;  5J5G A;  4HFE A;  5IUX A;  3IGQ A;  4ZR6 A;  2X00 A;  3GUA A;  3U8L A;  5BRX A;  4TWF A;  3WTH A;  3PMZ A;  3U8N A;  3C84 A;  4ZJS A;  5CFB A;  4TNV A;  4XHE A;  2YMD A;  4QAC A;  3SH1 A;  3JAD A;  3WTN A;  4D01 A;  2BJ0 A;  2BG9 A;  1UV6 A;  3WTJ A;  5AFM B;  5AFJ A;  4UM1 A;  5LXB A;  5J0Z A;  4AFH A;  4QH4 A;  4TWD A;  4UM3 P;  4ILC A;  4F8H A;  2Y7Y A;  2XQ4 A;  5AFL A;  3U8J A;  2Y58 A;  4BFQ A;  4NPP A;  4TWH A;  2UZ6 A;  4LMJ A;  5HEJ A;  2LKH A;  5AFK A;  3ZDH A;  2VL0 A;  1OED A;  2Y57 A;  4FRR A;  4HFC A;  2XQ3 A;  3WTL A;  2LM2 A;  3UU3 A;  3WTI A;  4ZZB A;  4HQP A;  5HEG A;  3WTO A;  2BG9 C;  4ZK4 A;  4HFB A;  3WTM A;  2Y56 A;  2XQA A;  2XYS A;  4IL9 A;  4ZRU A;  4AFG A;  3T4M A;  5AFN A;  2WNL A;  5HCJ A;  3RI5 A;  3U8M A;  4ZJT A;  4UM3 S;  5J5I A;  3RQU A;  3TLS A;  5AFH A;  4WV9 A;  4ILA A;  2YN6 A;  4COF A;  4QAA A;  1UX2 A;  2XQ5 A;  5HEU A;  3UQ4 A;  5LG3 A;  4HFD A;  2QC1 B;  4UY2 A;  4IRE A;  3RIA A;  4DBM A;  3EI0 A;  1OED C;  3TLU A;  5HEO A;  4ILB A;  4UXU A;  4QH1 A;  3RIF A;  2YOE A;  4X5T A;  5KE4 A;  2M6I A;  5CO5 A;  4LMK A;  3RHW A;  3U8K A;  2XQ8 A;  3JAE A;  2WN9 A;  2XZ6 A;  2M6B A;  2BYN A;  4IL4 A;  3WIP A;  2C9T A;  4TNW A;  2W8G A;  2XNT A;  3LSV A;  2BG9 E;  4A98 A;  5KZU A;  2LKG A;  5L4E A;  1I9B A;  2BR7 A;  2LLY A;  2BYR A;  3TLT A;  2WNJ A;  2X00 D;  2YME A;  4HFH A;  4EZ1 A;  4ZK1 A;  5BW2 A;  3UUB A;  3EHZ A;  2BG9 B;  2BYS A;  4Z91 A;  2YKS A;  5AFM A;  2W8F A;  3C79 A;  5SYO A;  2Y54 A;  1UW6 A;  2WZY A;  4XK9 A;  4AFT A;  3WTK A;  3TLV A;  4BQT A;  2XNU A;  5BP0 A;  3SQ6 A;  1OED E;  3SIO A;  3UU6 A;  3PEO A;  2WNC A;  4B5D A;  4NZB A;  4UM3 A;  3UQ7 A;  2XZ5 A;  3TLW A;  2XQ7 A;  3EAM A;  3SQ9 A;  2BR8 A;  2XQ6 A;  2KSR A;  1OED B;  3UU8 A;  5HEH A;  4LML A; 
#chains in the Genus database with same CATH topology
 2IML A;  2UXX B;  4P0B A;  4O4H E;  3UTK A;  3ZLI A;  4YXD A;  3UU5 A;  3UU4 A;  3QOF A;  4NIQ A;  4QH5 A;  1WR0 A;  2I59 A;  2MAW A;  4TZ4 C;  5CFB A;  2EHO D;  2BG9 A;  2X0Y A;  1MIV A;  3ZPO A;  4OFZ A;  3ZT6 A;  1IJ5 A;  5L3F B;  4IDQ A;  3AVS A;  1HG5 A;  3QUJ A;  2WWV A;  2LKH A;  4H9R C;  5CB4 E;  1WCR A;  2IHR 1;  3WTI A;  1CHU A;  4ZK4 A;  4ZI2 C;  3T4M A;  2H88 A;  3UUX B;  2QGS A;  4ZS2 A;  3PU8 A;  3EUH A;  1J5E T;  1UCU A;  2UXN B;  3CX7 B;  4UY2 A;  3EI0 A;  2KWH A;  4OYJ A;  1YKH B;  3AE8 A;  2Z6E A;  2ES0 A;  1HNZ T;  2K24 A;  5LGU B;  1ZEE A;  1MND A;  4DND A;  4DR4 T;  2XNT A;  3LSV A;  3LK4 2;  2KZ7 B;  3EVY A;  2A3D A;  3BQL A;  1J5W A;  3CWZ B;  3ETU A;  4TV9 E;  3AE2 A;  2W0G A;  3BK9 A;  5J2U E;  3AAI A;  2ACX A;  2EHO B;  3UU6 A;  3UQ7 A;  1R8I A;  2LRK A;  3MA9 A;  3Q2M A;  2BR8 A;  3V5U A;  3PUQ A;  2KIN B;  2E2A A;  3RPU A;  1BR2 A;  2W67 A;  3ZYL A;  2E5L T;  4O8S A;  2JIW A;  2QA7 A;  2FJE A;  2NR4 A;  3HA4 A;  1W0B A;  3NKZ A;  3VR9 A;  4Z8X A;  3SH1 A;  3IBP A;  3A5X A;  3ZT7 A;  4F8H A;  1Z8U A;  5AFL A;  4YSZ A;  2UZ6 A;  4O2B E;  3NRX A;  3P4R A;  5HEJ A;  3KVB A;  4DVD A;  5AQM B;  5AQN B;  1YQ4 A;  3WTL A;  5FYM A;  2XUE A;  5AQF B;  4ZJT A;  5J5I A;  5AQG B;  1S94 A;  5FP3 A;  2IW5 B;  3L39 A;  2YDS A;  3VKG A;  2EHO A;  2W00 A;  3MJX A;  1E2A A;  3EAB A;  2XTL A;  1X79 A;  4EYU A;  3P4P A;  4U74 A;  4ERR A;  5ABF B;  4L5G A;  4TNW A;  5FXZ A;  2IUB A;  3UUB A;  4HKA A;  5FL0 A;  4DR2 T;  4C90 A;  4HTE A;  2CCQ A;  3SQ6 A;  3PEO A;  2ZMA A;  1UGO A;  5L2L A;  4GYR A;  1XNQ T;  5AQT B;  3W15 B;  5LGT B;  4ALX A;  1E1H B;  5FKY A;  5AQJ B;  2PGZ A;  4YSX A;  3N9O A;  2LHN A;  5FJV A;  3C4W A;  3U8L A;  4B5D A;  4EV6 A;  3WTN A;  1BR4 A;  3RIU A;  5C3J A;  3E0Z A;  1T8B A;  4ILC A;  4I4T E;  5FY0 A;  4H63 H;  2PG8 A;  4KBM B;  2D0U A;  2V6X A;  5ABE A;  1Y01 A;  4MFR A;  5AFU L;  2VL0 A;  4YT0 A;  4JUY A;  4HQP A;  1M62 A;  2CXL A;  2JQ9 A;  2Y56 A;  5JRC B;  4AFG A;  2Q9Q C;  2ZM0 A;  3IEE A;  2UXB T;  3LBX B;  1HR0 T;  2OLT A;  4GKJ T;  5DAB A;  2XQ5 A;  4WNK A;  2DL1 A;  3RKO A;  2ODU A;  2QC1 B;  2UXC T;  4IRE A;  2CEA A;  3U78 A;  2YOE A;  2XHE B;  2ACZ A;  4IE4 A;  2XZ6 A;  3P7I A;  4PW8 A;  5KZU A;  5F5W A;  4UV8 B;  2LKG A;  2NTY A;  3Q5D A;  4JI0 T;  5BW2 A;  4ZK1 A;  1WLX A;  2W8F A;  2YIN A;  5LB7 B;  1YKE B;  2H7V C;  4ZI3 D;  3TLW A;  1XWM A;  3EAM A;  3UUL A;  2X67 A;  4CXW A;  2HHH T;  2DWG A;  4Q25 A;  3GA8 A;  5L4H A;  4EXT A;  3AEB A;  2ZJU A;  2ZJV A;  5J5F A;  3U3I A;  3P4W A;  2XNV A;  2PJQ A;  5JRC A;  2HH7 A;  3H3M A;  5JQG E;  2ZLY A;  3P4Q A;  5J5G A;  3LBX A;  2BBJ A;  3UFG A;  3N2O A;  4AQG A;  2BBH A;  4A5X A;  3O4X E;  1VCT A;  3ZMT B;  3Q5X A;  1KNP A;  1HF8 A;  5L3C B;  2C5J A;  2LSG A;  4IDN A;  3HI2 A;  4KP3 C;  1D0X A;  3AEA A;  2XQ3 A;  3A7M A;  1US7 B;  4GK5 E;  3C98 B;  2WB5 A;  4HFB A;  4JEH B;  2XYS A;  1QLB A;  1HFA A;  4ZOL E;  5AQL B;  5GON E;  4WV9 A;  5HEU A;  3UQ4 A;  3K1S A;  2CXD A;  2LEH A;  4OX9 T;  1D1C A;  3KV9 A;  2C5I T;  4U7Y A;  3SS1 A;  3UFE A;  5J2T E;  3CML A;  2D5U A;  2FJD A;  2M6I A;  5ADX L;  2LHR A;  1L0V A;  4ZXL A;  4DV7 T;  3WIP A;  2BG9 E;  4BAY B;  2D2S A;  4JLE A;  1MMA A;  4CZZ B;  3KIN B;  2HPL A;  2YKS A;  3C79 A;  5LMU T;  2HPJ A;  4JI8 T;  4XK9 A;  4AFT A;  1VCS A;  4KUM B;  2WNC A;  5LHG B;  3VRA A;  5HAX A;  5LHI B;  3NZQ A;  1EZ3 A;  5J1G A;  4LML A;  3P50 A;  5E0O A;  3GWH A;  1MIY A;  2UUC T;  2BYQ A;  2LT3 A;  2XQ9 A;  3T1H T;  3MAC A;  2G0U A;  5FMN A;  4FJO A;  4QXC B;  5CA0 E;  3ZMS B;  5AFJ A;  4NXM T;  4PK4 A;  3E08 A;  1IBK T;  2LSK A;  3CQC B;  5JDQ A;  2WDR A;  4AQY T;  1OED A;  2Y57 A;  2XAS B;  3RYI E;  1ZV4 X;  4KMC A;  3AE6 A;  3ZST A;  2VQF T;  4P0A A;  5AFH A;  2VKD A;  2YN6 A;  4IE6 A;  4HFD A;  3C4X A;  4ILB A;  3SFE A;  4X5T A;  1WRD A;  4TX5 A;  5KE4 A;  1HTJ F;  5HXH A;  1UK5 A;  2WN9 A;  4X62 T;  4JI7 T;  1NWM X;  2C9T A;  2WP9 A;  2WBL A;  4AIU A;  2KWI B;  4LFC T;  4DBQ A;  2DHR A;  4TN7 B;  3AEF A;  4DR7 T;  2BG9 B;  5CGM A;  4Z91 A;  2Y48 B;  4WBN E;  3ZMZ B;  3LG7 A;  2N9D A;  1XNR T;  4O4L E;  4A56 A;  5M4Y A;  4BJN A;  5H6Q B;  4JI2 T;  5TAO A;  2NWB A;  4YTP A;  1SE7 A;  2VKJ A;  2CLY B;  2YK0 A;  3KV5 A;  4A97 A;  3A8Y C;  3P4S A;  3RF1 A;  5C2T A;  5JR9 B;  4I55 E;  2X51 A;  5AFM B;  5FXW A;  4PJN A;  4MBQ A;  3QB5 A;  1FEW A;  3AB3 B;  3HL6 A;  5F8P A;  3T1Y T;  4AKG A;  3AE1 A;  3EDU A;  1UX4 A;  3RYC E;  3ANW A;  3VR8 A;  3FHN A;  3K3Q C;  1T7S A;  2VUR A;  2IC6 A;  4PK5 A;  5AFN A;  1LVK A;  3HKC E;  4YY3 T;  2X9Y A;  2EHO C;  5BMV E;  4DID B;  2VVN A;  2W61 A;  1AJ3 A;  4AQF A;  2XAF B;  5EZY E;  1E7P A;  4M1P A;  4QKN A;  5F3J A;  3U8K A;  2XM1 A;  1CUN A;  3CQG B;  5KX5 E;  2AXD S;  3Q9D A;  1KF6 A;  2WZH A;  1LRZ A;  4AKL A;  4YHH T;  5JR9 A;  3I0Q A;  5AFM A;  4UIG A;  5LP6 E;  3WTK A;  4IT4 A;  4H63 V;  4KHP T;  2ZM8 A;  2A72 A;  4MLK A;  3ETV A;  2W63 A;  3J9X 1;  2XZ5 A;  3ABV A;  2XQ6 A;  4CN1 A;  3AA7 B;  3U8N A;  3V5S A;  4I43 B;  2XQY A;  2MYS A;  4U3C A;  2WSS V;  5IWA T;  5FVL A;  1HNX T;  4ZZC A;  5IUX A;  3IGQ A;  4DMW A;  3C84 A;  1UUS A;  3RIU C;  1W09 A;  3CKD A;  4LF4 T;  3J7Y q;  2BKP A;  4AFH A;  4TUY E;  4UM3 P;  4IE0 A;  2JMK A;  4E7Z A;  2FJB A;  4JBW F;  4HWC A;  4U2Z A;  4IHJ E;  3ZDH A;  2C5K T;  4ISS A;  1SHZ C;  2XY8 B;  3UU3 A;  3WTM A;  4ZRU A;  5HCJ A;  5LCY A;  1NAF A;  3RLF F;  3TLS A;  3RKG A;  2LSI A;  3NVO A;  4I50 E;  2V8S V;  3AE5 A;  3ZMV B;  4XZC A;  4UXU A;  4X66 T;  5AQV B;  5JDM A;  3RIF A;  2WCA A;  3KVA A;  2ZM6 T;  4LMK A;  5H6R B;  2BS2 A;  3CX6 B;  3UUN A;  3S4U A;  2OA5 A;  4IDP A;  3I9Y A;  1U5P A;  2LLY A;  4LFA T;  4DR3 T;  2WZI A;  1SUM B;  3HKB E;  2UXD T;  3HKD E;  4DV6 T;  2X0H A;  5JDH A;  2FBW A;  4NZB A;  1G73 A;  2QRX A;  4DV3 T;  2B1E A;  3LDQ B;  2XQ7 A;  2XAH B;  2WDV A;  4ZJS A;  4YHJ A;  4CI1 B;  3FZL B;  2PH9 A;  3ZC0 A;  5LBQ B;  3SOL A;  2ODV A;  1H7C A;  2QYW A;  2X0L B;  3PUY F;  5FXV A;  4UM1 A;  2KLQ A;  3UT5 E;  1FJG T;  4QH4 A;  3NWI A;  3MKD A;  3KBU A;  4CXY A;  2C0S A;  4TWH A;  1MNE A;  2BS3 A;  3SWH A;  2CHO A;  3X1D A;  2JPF A;  2DNX A;  1W9R A;  4O4I E;  3PU3 A;  5HEG A;  4UVB B;  4IL9 A;  3ZJ1 A;  4E7S A;  2PBI A;  4QAA A;  4UXN B;  3MXZ A;  3H37 A;  3H3A A;  4C91 A;  5HWY A;  5FY1 A;  3QK6 A;  2YU1 A;  4XBF B;  2N2N A;  3O1H A;  3QB5 K;  3F2E A;  3F57 A;  4CI2 B;  3MZK B;  3KV4 A;  2MPK A;  2WY2 A;  3RC3 A;  2BZB A;  2UUA T;  1WR6 A;  2WU5 A;  3AAA B;  4P09 A;  2BR7 A;  4GYS A;  3WI3 A;  2IIU A;  3VKH A;  1Y64 B;  1D1B A;  3TLV A;  1OED E;  3FB2 A;  4CQI A;  2CRB A;  5LGN B;  4EAH A;  4I0U A;  4KHZ F;  2KSR A;  3R84 B;  4WW0 A;  3AE9 A;  2VAS A;  4LF9 T;  2PFV A;  4HFI A;  1HCI A;  5HXE A;  1D0Y A;  3Q5W A;  2E9X D;  5AIN A;  1IZN B;  3ZDG A;  5JME A;  4QAB A;  3GUA A;  3WTH A;  2WS3 A;  5HXC A;  5AQH B;  4NUU A;  4ZI3 C;  5JTG A;  2XAQ B;  4QHO A;  2DWK A;  4X65 T;  3R6N A;  2H89 A;  2XPK A;  1UX2 A;  2YDR A;  5CJ5 A;  2F4V T;  3GMI A;  2X9W A;  1KEY A;  4EOZ B;  3TLU A;  4BA9 A;  2DLR A;  4YLH A;  2CA5 A;  4H9S E;  2BS4 A;  4HN9 A;  2CWO A;  5HWX A;  2B76 A;  4WZX A;  1KNR A;  5C8Y E;  1V9D A;  2JJ9 A;  3OBV E;  3NZP A;  5FXX A;  5IYZ E;  2E9X B;  4DV5 T;  2Y6X A;  3AE4 A;  4LF6 T;  2WMN A;  3QNU A;  2YDQ A;  2XNU A;  5BP0 A;  4PNI A;  1OXZ A;  4PJJ A;  3QC9 A;  3PUG A;  1KNZ A;  1VRB A;  2V1D B;  3G06 A;  3B13 A;  5DQV A;  5L3G B;  1OED B;  2BKO A;  5HEH A;  3N9M A;  2BVL A;  3ZKR A;  3M3Z B;  3SFD A;  5TVC A;  4AXP A;  3FZM B;  4UV9 B;  4HEA A;  2K5B B;  2VWA A;  2JQH A;  3AEG A;  4TWF A;  2V5C A;  4QX7 B;  2HN2 A;  1UV6 A;  3WTJ A;  4LFB T;  1FMV A;  2KMF A;  1XDO A;  2X9X A;  4NPP A;  5AQI B;  2V7J A;  2P9B A;  2XAG B;  5EK4 A;  4B3R T;  1BR0 A;  2CPT A;  3OTO T;  3CQX C;  3HKE E;  4PAG A;  2I0M A;  2M67 A;  1HX8 A;  3RRW A;  5KXJ A;  1SA0 E;  2YEV C;  3LK2 B;  2BG9 C;  2CWY A;  2E9X A;  3N2K E;  1IBM T;  1D1A A;  2CM0 A;  4K0U A;  5LG3 A;  4XAX B;  1M7K A;  2KXP B;  2XSA A;  4JEU B;  4DR6 T;  5LNK A;  5JVD E;  5LJN A;  2JMH A;  3PUR A;  4AKH A;  3AA1 B;  3OYX A;  4F6R C;  4O2A E;  5AQK B;  4ASK A;  4X1K E;  2CLY C;  2I6H A;  3PV0 F;  1W0A A;  2BYN A;  2X66 A;  4DMV A;  5JR9 C;  2VK9 A;  4IST A;  2X68 A;  3AE7 A;  4LF8 T;  3O1I A;  3DTO A;  2Y54 A;  3AXJ B;  2D9D A;  1HS7 A;  3JC6 D;  1I94 T;  2AE9 A;  2VL8 A;  4B3M T;  4LMJ A;  3ANW B;  4O4J E;  3VHL A;  2UU9 T;  4CXX A;  5LXT E;  2XYT A;  4ZI7 E;  2BYP A;  3LJC A;  3JAF A;  4HFE A;  4UEM A;  3E22 E;  4TNV A;  4PJL A;  4U2Y A;  2NP9 A;  5J0Z A;  4DV0 T;  4MAL A;  4HGA A;  2H3R A;  4JI5 T;  2LSY A;  3K3N A;  2J47 A;  5AFK A;  2H7O A;  4DR5 T;  1D0Z A;  3ZCJ A;  4X1I E;  5JRE A;  5LMN T;  2XZE A;  5AQR B;  2WM9 A;  1MIW A;  5LHH B;  1IJ6 A;  3AXJ A;  4ILA A;  4COF A;  1LVF A;  3N9P A;  1YQ3 A;  2W2U A;  4V1A v;  4DBM A;  2E5V A;  2V5D A;  3RGL A;  2Y8D A;  5FL1 A;  3L8R A;  5AQQ B;  3RRC A;  2NW9 A;  1YD8 G;  3ZCI A;  2BDE A;  3OJA A;  4JV5 T;  3LFM A;  2LOP A;  3AVR A;  5L4E A;  2V7L A;  1IAP A;  4HE8 A;  3ZYK A;  4B3T T;  5JDF A;  3F31 A;  4JI3 T;  2V6Y B;  3RYH E;  5IHY A;  5L3B B;  4UF0 A;  3RH3 A;  4MHC A;  4UM3 A;  3K8P C;  3CK6 A;  2W4X A;  5AQO B;  5KDM C;  2Y7Y A;  3UU8 A;  4X64 T;  2CXF A;  4HFV A;  4QWN B;  4FI5 A;  4H9P C;  2FJA A;  5AQP B;  2A9U A;  4ZI2 D;  3BQI A;  5JH7 E;  3OKQ A;  3JCF A;  4EEB A;  3PMZ A;  2YMD A;  4QAC A;  2RA1 A;  4JYA T;  2N1G A;  4J2C A;  1WFD A;  1O3X A;  4TWD A;  1N33 T;  4JI6 T;  3U8J A;  2ZM2 A;  3BQK A;  3PUZ F;  4FRR A;  5LG4 A;  4HFC A;  2VKO A;  4U31 A;  3PJA A;  3PUW F;  4H9Q C;  2XM2 A;  3RI5 A;  2V7K A;  1U4Q A;  4OK0 A;  3C51 A;  4U7I A;  2WDQ A;  3O9X A;  1N34 T;  3CVR A;  2W62 A;  2V6Y A;  4CI3 B;  1ZP0 A;  4AKI A;  2L8K A;  5JDL A;  4QH1 A;  5AQU B;  3KFW X;  3N9N A;  1YW0 A;  1J1J A;  4N78 D;  4UVC B;  1DU2 A;  4HWD A;  4BJM A;  5ABH A;  1I9B A;  4AI6 A;  3TLT A;  5BR8 T;  4EZ1 A;  4PFP A;  2K48 A;  2A2F X;  4IE7 A;  3PE0 A;  4X1Y E;  5LYJ E;  3L09 A;  2LOS A;  3N2G E;  3LK3 B;  3OPC A;  4Z90 A;  3FZH B;  4YJ3 E;  2HN1 A;  2BVM A;  4NUV A;  2WQY A;  3AEC A;  2KND A;  4D01 A;  3JAD A;  3CX8 B;  5HXR A;  3SRZ A;  4IDZ A;  4PFO A;  1HX1 B;  1NEK A;  3ZYM A;  3PDY A;  3FXE B;  3OYZ A;  1N36 T;  1UX5 A;  4EB6 E;  3EDV A;  1WYB A;  2MTQ A;  2LJL A;  4IDO A;  3FBL A;  1HG2 A;  1JNR A;  1T98 A;  4WBO A;  2DI4 A;  1XDP A;  1FIO A;  5CO5 A;  2GK9 A;  3FZF B;  5LOV E;  3O1J A;  3WAJ A;  3DP7 A;  2BYR A;  2X00 D;  3AE3 A;  5ETW A;  4HFH A;  4H9N C;  3AEE A;  1ZKE A;  4GIW A;  4AIS A;  2BYS A;  2NW7 A;  2JRK A;  4TV8 E;  1KK7 A;  5KMG P;  4L9I A;  4IGU A;  5EK3 A;  3ZT5 A;  2VB6 A;  3M65 A;  3AA6 B;  2XJ7 A;  2X9H A;  3AAE B;  4QX8 B;  5ABF A;  4PIR A;  5DJQ C;  3I1A A;  4G63 A;  3RQW A;  2Q9Q D;  4ZR6 A;  5JDG A;  4XHE A;  2J62 A;  2BJ0 A;  2E8I A;  4ILU A;  3ZN0 B;  2V7I A;  1UUR A;  1FMW A;  2XQ4 A;  4BFQ A;  4GK0 E;  2NOX A;  4UEL A;  3ONL C;  3VU7 H;  2RPA A;  3PTR B;  4B3S T;  4DV1 T;  2E9X C;  2LRL A;  2V7M A;  3WTO A;  5LJM A;  2XQA A;  4DUZ T;  1XMQ T;  2XAJ B;  4UM3 S;  1Z0P A;  3RQU A;  3AA0 B;  1MMG A;  3DJB A;  3I0O A;  1B7T A;  1OED C;  2MBG A;  1IBL T;  2VKH A;  4DV2 T;  4NXN T;  2XQ8 A;  2J4G A;  4G2A A;  1GQE A;  3ZEF B;  2M6B A;  3KBT A;  4IL4 A;  4U72 A;  3FXD B;  4OYK A;  2WNJ A;  2YME A;  2JQQ A;  3B5M A;  4EZ4 A;  1XMO T;  5SYO A;  2KT9 A;  5FVK A;  2IDO B;  2Q9Q B;  4X20 E;  3UUM A;  1MMD A;  5FY7 A;  1ZHC A;  3I9W A;  5LBM A;  1G8X A;  5L3D B;  5CA1 E;  2FUP A;  1JNZ A;  2RP4 A;  3ZC1 A;  2MOZ A;  3NBX X;  3IHR A;  2DCF A;  2VQE T;  4UR9 A;  4YTN A;  4HWI B;  3N9Q A;  2X00 A;  1OWA A;  4AKR B;  4UVA B;  2YU2 A;  2OV9 A;  3N5L A;  4GKK T;  3PUA A;  3ZMU B;  1S35 A;  2WMO A;  1KFY A;  2IC9 A;  1I6Z A;  3AED A;  4EGW A;  4DUY T;  2LM2 A;  3PUV F;  4L0R A;  4IE5 A;  4YSY A;  3D0T A;  5EK2 A;  2WNL A;  3U8M A;  2Q9Q A;  3ZSS A;  3ONJ A;  3KV6 A;  3PJA J;  3RIA A;  2CBI A;  4P1N A;  4EED A;  3GN5 B;  3ONX A;  2NW8 A;  3WAK A;  1QUU A;  4KI0 F;  3T8O A;  4ZS3 A;  3VRB A;  2QVA A;  2WU2 A;  4QXB B;  2W8G A;  3IF8 B;  4EZH A;  4WYV A;  4AQF C;  4JI1 T;  2LSJ A;  5ABG A;  2V26 A;  4QXH B;  1MMN A;  1NEN A;  1UW6 A;  4B6X A;  3C4Z A;  2L3L A;  4DO0 A;  4BQT A;  3C50 A;  4LF5 T;  3IA3 A;  2IAK A;  3B57 A;  4ANJ A;  4LF7 T;  3L3P A;  3PUX F;  2CHN A;  5L3E B;  3ESL A;  2WAU A;  4DBR A;  3RYF E;  5HCM A;  2D0T A;  5J5H A;  4PJM A;  5A1L A;  3KDS E;  4HWF A;  2NTX A;  5L47 A;  1HNW T;  5BRX A;  1N32 T;  4ADZ A;  4DV4 T;  5HYA A;  3FZK B;  3MK7 C;  4YFS A;  2K9A A;  4EYY R;  4ZEY A;  2CMR A;  5LXB A;  3CPZ A;  3JC6 C;  2Y58 A;  4YJ2 E;  2JQK A;  3GN5 A;  1BR1 A;  5DQW A;  2UUB T;  4CN6 A;  4KX6 A;  3CIR A;  2BKN A;  4JI4 T;  1ZOY A;  1VOM A;  4OHF A;  1LKX A;  2K3W A;  4ZZB A;  3ZN1 B;  3P8C D;  5FNV E;  1YXR A;  4IIJ E;  3TKL B;  4PK6 A;  3C64 A;  3RC8 A;  3OVU A;  4CN4 A;  4UF0 B;  2R6G F;  3PUS A;  2SPC A;  3RX6 A;  3HR0 A;  2J1D G;  5HEO A;  5JDN A;  2L9Q A;  1X9B A;  1XZY A;  1QSD A;  3ZJ2 A;  3RHW A;  3JAE A;  1WYC A;  4YTM A;  2VVS A;  4A98 A;  2PTF A;  2WWU A;  5AQS B;  4EIW A;  3Q5E A;  2CBJ A;  4GOU A;  2LE8 A;  1T72 A;  3EHZ A;  2LM9 A;  2WZY A;  3K3O A;  4ZHQ E;  3N9L A;  4HWH A;  4K0K T;  4DR1 T;  3FBZ A;  3SIO A;  4H9O C;  2W66 A;  2CE7 A;  5HXS A;  3NRY A;  3SQ9 A;  5LA6 E;  2XSB A;  4U33 A; 
#chains in the Genus database with same CATH homology
 3P50 A;  5L4H A;  3ZKR A;  2ZJU A;  4HFI A;  2PH9 A;  2ZJV A;  5J5F A;  5HCM A;  3P4W A;  4PIR A;  2XNV A;  5J5H A;  2BYQ A;  4ALX A;  2XYT A;  5AIN A;  4Z90 A;  5L47 A;  3UU5 A;  3UU4 A;  4QH5 A;  2BYP A;  5TVC A;  3ZDG A;  2PGZ A;  3JAF A;  2XQ9 A;  3RQW A;  5JME A;  5FJV A;  4QAB A;  4ZZC A;  2MAW A;  4A97 A;  5J5G A;  4HFE A;  5IUX A;  3IGQ A;  4ZR6 A;  2X00 A;  3GUA A;  3U8L A;  5BRX A;  4TWF A;  3WTH A;  3PMZ A;  3U8N A;  3C84 A;  4ZJS A;  5CFB A;  4TNV A;  4XHE A;  2YMD A;  4QAC A;  3SH1 A;  3JAD A;  3WTN A;  4D01 A;  2BJ0 A;  2BG9 A;  1UV6 A;  3WTJ A;  5AFM B;  5AFJ A;  4UM1 A;  5LXB A;  5J0Z A;  4AFH A;  4QH4 A;  4TWD A;  4UM3 P;  4ILC A;  4F8H A;  2Y7Y A;  2XQ4 A;  5AFL A;  3U8J A;  2Y58 A;  4BFQ A;  4NPP A;  4TWH A;  2UZ6 A;  4LMJ A;  5HEJ A;  2LKH A;  5AFK A;  3ZDH A;  2VL0 A;  1OED A;  2Y57 A;  4FRR A;  4HFC A;  2XQ3 A;  3WTL A;  2LM2 A;  3UU3 A;  3WTI A;  4ZZB A;  4HQP A;  5HEG A;  3WTO A;  2BG9 C;  4ZK4 A;  4HFB A;  3WTM A;  2Y56 A;  2XQA A;  2XYS A;  4IL9 A;  4ZRU A;  4AFG A;  3T4M A;  5AFN A;  2WNL A;  5HCJ A;  3RI5 A;  3U8M A;  4ZJT A;  4UM3 S;  5J5I A;  3RQU A;  3TLS A;  5AFH A;  4WV9 A;  4ILA A;  2YN6 A;  4COF A;  4QAA A;  1UX2 A;  2XQ5 A;  5HEU A;  3UQ4 A;  5LG3 A;  4HFD A;  2QC1 B;  4UY2 A;  4IRE A;  3RIA A;  4DBM A;  3EI0 A;  1OED C;  3TLU A;  5HEO A;  4ILB A;  4UXU A;  4QH1 A;  3RIF A;  2YOE A;  4X5T A;  5KE4 A;  2M6I A;  5CO5 A;  4LMK A;  3RHW A;  3U8K A;  2XQ8 A;  3JAE A;  2WN9 A;  2XZ6 A;  2M6B A;  2BYN A;  4IL4 A;  3WIP A;  2C9T A;  4TNW A;  2W8G A;  2XNT A;  3LSV A;  2BG9 E;  4A98 A;  5KZU A;  2LKG A;  5L4E A;  1I9B A;  2BR7 A;  2LLY A;  2BYR A;  3TLT A;  2WNJ A;  2X00 D;  2YME A;  4HFH A;  4EZ1 A;  4ZK1 A;  5BW2 A;  3UUB A;  3EHZ A;  2BG9 B;  2BYS A;  4Z91 A;  2YKS A;  5AFM A;  2W8F A;  3C79 A;  5SYO A;  2Y54 A;  1UW6 A;  2WZY A;  4XK9 A;  4AFT A;  3WTK A;  3TLV A;  4BQT A;  2XNU A;  5BP0 A;  3SQ6 A;  1OED E;  3SIO A;  3UU6 A;  3PEO A;  2WNC A;  4B5D A;  4NZB A;  4UM3 A;  3UQ7 A;  2XZ5 A;  3TLW A;  2XQ7 A;  3EAM A;  3SQ9 A;  2BR8 A;  2XQ6 A;  2KSR A;  1OED B;  3UU8 A;  5HEH A;  4LML A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...