2XQWA

Structure of factor h domains 19-20 in complex with complement c3d
Total Genus 118
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
118
sequence length
294
structure length
294
Chain Sequence
MLDAERLKHLIVTPSGAGEQNMIGMTPTVIAVHYLDETEQWEKFGLEKRQGALELIKKGYTQQLAFRQPSSAFAAFVKRAPSTWLTAYVVKVFSLAVNLIAIDSQVLCGAVKWLILEKQKPDGVFQEDAPVIHQEMIGGLRNNNEKDMALTAFVLISLQEAKDICEEQVNSLPGSITKAGDFLEANYMNLQRSYTVAIAGYALAQMGRLKGPLLNKFLTTAKDKNRWEDPGKQLYNVEATSYALLALLQLKDFDFVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKDAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dual Interaction of Factor H with C3D and Glycosaminoglycans in Host-Nonhost Discrimination by Complement.
pubmed doi rcsb
molecule keywords COMPLEMENT C3
source organism Homo sapiens
molecule tags Immune system
total genus 118
structure length 294
sequence length 294
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.50.10.20 Mainly Alpha Alpha/alpha barrel Glycosyltransferase Glycosyltransferase 2xqwA00
1H36A 3D5RA 1H3AA 1H35A 3E37B 1H3CA 3E30B 2V3PA 2SQCA 3E32B 1O6HA 4GTPB 1H3BA 1N9AB 3Q75B 3PZ2B 3OXUA 1FPPB 3SQCA 4LNGB 2BB6A 3DSSB 3PZ1B 3C72B 1O1SB 4L9PB 2NOJA 1TN8B 4LNVA 1O6RA 1N4RB 4GTVB 4YDOB 3E33B 5JPMB 2BEDB 1TNOB 1FT2B 2B39A 1TNUB 4ZH1A 4V1RA 4D4DA 2BB5A 2XQWA 1QSJA 2A73B 1TNZB 2WIIB 4ZRPA 1UMPA 1NL4B 4LNBB 2H6IB 3KSLB 1H39A 2XWJB 2F0YB 1W6JA 4YDEB 5AGDA 1O5MB 4FXKB 3DSXB 5FO8B 4V1SA 1N95B 3PZ3B 3KQ4A 2V8IA 2GOXA 2IEJB 2BBCA 2WY7A 1QBQB 1GSZA 2PMVA 3Q79B 3Q7AB 4KKJA 1LTXB 1TNBB 4D4BA 1GHQA 3Q7FB 4D4CA 5JPNB 4FXGB 5FO7B 1SA5B 3E34B 1W6KA 3SFXB 2H6GB 1NI1B 2V8KA 4GTSB 3KSQB 4GTMB 5FO9B 1GXMA 4BOKA 2R2LB 1O6QA 1N4PB 1LD7B 1R76A 1O1TB 4GTQB 4D4AA 1X81B 4MU9A 4D94A 1QQFA 3DSWB 2WY8A 3G6JB 1O79A 1TNYB 3K7XA 1C3DA 3HXBB 3PZ4B 1DCEB 4KKIA 2V8JA 2G02A 3CU7A 1N4QB 1H37A 1O1RB 3DSVB 3SFYB 4GTTB 5FOBB 3EUVB 1FT1B 3DSTB 2H6FB 1KZOB 3RJ3A 1D8DB 2ZIRB 3HXEB 4ZRQA 4MBGB 3DRAB 3OEDA 1SA4B 3EU5B 4C1SA 3Q78B 1D8EB 3DSUB 3KLSA 4GTOB 1JCRB 3HXCB 1GXNA 1KZPB 1TN7B 2PN5A 1N4SB 3HXFB 4ONTA 1LD8B 1N94B 3D5SA 1TN6B 1MZCB 4EHMB 4GTRB 1GXOA 4M76A 2V3NA 1JCQB 1HZFA 2WINB 1SQCA 3HXDB 2H6HB 2I07B 2XWBB 1S64B 2G0DA 2ZISB 1S63B 3DPYB 4BOJA 1JCSB 3Q73B
chains in the Genus database with same CATH superfamily
3E32B 1H3BA 1G9JA 5M7YA 4J5TA 2ZZRA 1FO3A 1AYXA 2ZBLA 1CEMA 2NOJA 1N23A 4LNVA 5DGRA 3RX8A 3RENA 1N4RB 5JPMB 3QSPA 3GT5A 3P5PA 5IL8A 4ZH5A 1FP3A 2XQWA 1TF4A 3QT3A 4D4DA 1QSJA 1NL4B 1RWFA 1N24A 1VD5A 1FAEA 1H39A 2GH4A 3H3KA 3QXQA 3TF4A 5AGDA 4Z4JA 4FXKB 1RWAA 1KFGA 4WVCA 4RNQA 4WVBA 1HX9A 3WKHA 1N7OA 1F9OA 1XWTA 1GSZA 1KKTA 5IKHA 4D4BA 3Q7FB 1HXAA 3QWTA 5DGQA 4FXGB 3ANIA 3E34B 1K72A 1FMIA 1W6KA 3VSMA 4AYRA 3W5MA 5CA3A 4GTSB 3KSQB 2WYNA 4GTMB 3ACTA 5FO9B 2R2LB 1N4PB 5ILHA 3G6JB 1O79A 2JF4A 1C3DA 2FUTA 3HXBB 5ILJA 4E1YA 1OJMA 2G02A 4DI5A 1N4QB 3M78A 3SDRA 1GLMA 1H13A 1UG9A 1ULVA 4OZWA 3WIRA 1RQ5A 3NNBA 3DSTB 2H6FB 5ILKA 1RWCA 3HXEB 4ZRQA 3OEDA 1SA4B 1RWHA 3Q78B 3DSUB 3VXDA 3RX7A 1HM2A 4AYOA 3QT9A 1N94B 1V7VA 1X1HA 4GAXA 3RRSA 2V3NA 1JCQB 4WU0A 5IL3A 2G0DA 2ZISB 1S63B 1UT9A 4Q88A 4MMHA 2VN7A 1H35A 1OJNA 3G4FA 2EACA 2V3PA 3E30B 3E73A 3AFJA 2SQCA 1O6HA 2F6DA 3VW5A 1X9DA 1GAHA 1FBWA 1HXGA 4GTVB 4YDOB 3E33B 3W7SA 1N22A 4F10A 5E2JA 4ZH1A 2Q1FA 3QPFA 2XFGA 3K11A 2DRSA 2E22A 3N0FA 3AFLA 2BRWA 3SDTA 3EQAA 3X17A 1W6JA 1NXCA 1O5MB 1AGMA 2B4FA 4V1SA 1IS9A 1HXCA 2GOXA 3P2CA 2BBCA 3WIQA 3M02A 2ONGA 4L6XA 1TNBB 5DHIA 1LOHA 5M7IA 5FO7B 1SA5B 1G6IA 2V8KA 2RI8A 5DHKA 4F13A 5EAUA 1LD7B 4FNVA 1LF6A 4D4AA 3NFVA 5JMFA 4MU9A 3DSWB 2WY8A 1C82A 1DL2A 3PZ4B 4KKIA 1N1ZA 4WVAA 3GZKA 3CU7A 4Z4LA 3WIWA 5FOBB 1EGUA 3EUVB 3H2WA 5IK6A 1KRFA 1KZOB 3D3IA 1D8DB 2FUQA 3WKIA 4OK4A 2DRRA 1N1BA 2FV1A 3M7BA 1D8EB 4LIXA 4GTOB 1WZZA 3S4CA 3HXCB 1GXNA 3M77A 1TN7B 1KSDA 2PN5A 4ONTA 1H14A 3ACSA 1LD8B 2A8ZA 2X03A 3WC3A 3D5SA 1TN6B 1RW9A 5IK0A 1HN0A 3PYAA 4EHMB 2FUZA 1LXMA 4M76A 4KTRA 3HXDB 1SQCA 3W7TA 3DPYB 2DROA 4Q2BA 1F9GA 3QFZA 3E37B 1H3CA 5IKAA 2P0VA 1N9AB 5ILZA 2FBAA 3M01A 5IM1A 1FPPB 3SQCA 2QNOA 4OK2A 3C72B 1O1SB 2RGKA 4L9PB 1DOGA 1TN8B 3T33A 1KSCA 5CD2A 4EL8A 3N0GA 3W7UA 1L1YA 2AHFA 1FT2B 2EABA 1TNUB 4V1RA 5GY3A 2JG0A 1N7NA 4ZRPA 1UMPA 2YIKA 2H6IB 1IA6A 3KSLB 2XWJB 4XUVA 4YDEB 1N21A 3DSXB 4ZG8A 3A3VA 5GZKA 1JS4A 3W5NA 1G9GA 4KTPA 3GLYA 3KQ4A 2E24A 1X1JA 2CQSA 2EAEA 3SAEA 3E6UA 3VSNA 2IEJB 2WY7A 3WKFA 1QBQB 2PMVA 3Q79B 3Q7AB 4DOEA 1NC5A 2WDAA 1GHQA 4D4CA 3LZ9A 5JMDA 1WU5A 4OJZA 3SFXB 1NI1B 2RI9A 1LXKA 1GXMA 4NEIA 1W3YA 1R76A 1WU4A 1KWFA 2BRVX 1X81B 1I8QA 4D94A 1V5DA 3EU8A 1TNYB 5GW7A 2JJBA 3RSYA 1L2AA 3A0OA 1DCEB 3SDUA 1GA2A 1HMWA 2D5JA 1KS8A 2OKXA 3DSVB 3M74A 3SFYB 2CQTA 1HMUA 3E80A 3SDVA 2ZIRB 1H54A 5C05A 1CLCA 1V7WA 1OJPA 3M7LA 1JCRB 3WKGA 1KZPB 1G87A 1CB8A 3ANKA 3G4DA 3M76A 1MZCB 3M7CA 4GTRB 1GXOA 2H6HB 1HV6A 3M72A 2I07B 2XWBB 4QT9A 4BOJA 2ONHA 1V7XA 1H36A 3D5RA 4YCRA 1H3AA 5ILDA 4TXTA 2AHGA 1XW2A 4DODA 3H7LA 3S9VA 3M00A 4GTPB 3E7JA 3Q75B 3PZ2B 3OXUA 1KREA 3S4DA 4LNGB 1XWQA 2BB6A 1F9DA 3DSSB 3QRYA 3PZ1B 4JJJA 1FBOA 1O6RA 1HM3A 3M73A 3QDEA 2BEDB 1TNOB 4FJQA 2B39A 2BB5A 2A73B 1TNZB 2WIIB 4LNBB 1V5CA 2AFAA 3EZ8A 2F0YB 2DRQA 1GAIA 1N20A 3M71A 5FO8B 2GZ6A 2VN4A 3ANJA 3QG0A 1N95B 3S4BA 1OJOA 3PZ3B 1N7RA 2V8IA 3QFYA 5EATA 3W7XA 1N7QA 3WUXA 4KKJA 2J5CA 1LTXB 3M7EA 5JPNB 4OZVA 3QXFA 1FCEA 1H12A 4TF4A 2H6GB 4CE7A 5ILIA 4BOKA 1O6QA 2Z07A 4FUSA 1O1TB 2EADA 4GTQB 3RX5A 4L0GA 1QQFA 5CZLA 5EASA 3K7XA 3PMMA 2V8JA 4MMIA 1RWGA 1H37A 3PYBA 1O1RB 5ILYA 4GTTB 4CJ0A 1FO2A 1LF9A 2WCOA 1QAZA 1FT1B 3RJ3A 3CIHA 4CJ1A 2BRPA 3S4AA 1N7PA 4MBGB 3DRAB 3EU5B 5IK9A 3ON6A 2NVPA 1J0NA 4C1SA 1HCUA 1F1SA 3KLSA 3M75A 5KKBA 4AYPA 1N4SB 3HXFB 2D8LA 3SDQA 4AYQA 5MEHA 2FV0A 1X1IA 3P5RA 2WINB 1HZFA 4GL3A 1S64B 1WU6A 3W7WA 1J0MA 1JCSB 3Q73B 1IA7A
chains in the Genus database with same CATH topology
3E32B 1H3BA 1G9JA 5M7YA 4J5TA 2ZZRA 1FO3A 1AYXA 2ZBLA 1CEMA 2NOJA 4LNVA 5DGRA 3RX8A 3RENA 1N4RB 5JPMB 3QSPA 3GT5A 3P5PA 4ZH5A 4D4DA 1FP3A 2XQWA 1TF4A 3QT3A 1QSJA 1NL4B 1VD5A 1FAEA 1H39A 2GH4A 3H3KA 3QXQA 3TF4A 5AGDA 4Z4JA 4FXKB 1KFGA 4WVCA 4WVBA 3WKHA 1F9OA 1XWTA 1GSZA 1KKTA 4D4BA 3Q7FB 3QWTA 5DGQA 4FXGB 3ANIA 3E34B 1K72A 1FMIA 1W6KA 4AYRA 3W5MA 5CA3A 4GTSB 3KSQB 2WYNA 4GTMB 3ACTA 5FO9B 2R2LB 1N4PB 3G6JB 1O79A 2JF4A 1C3DA 3HXBB 2G02A 1N4QB 3M78A 3SDRA 1GLMA 1H13A 1UG9A 1ULVA 3WIRA 1RQ5A 3DSTB 2H6FB 3HXEB 4ZRQA 3OEDA 1SA4B 3Q78B 3DSUB 3VXDA 3RX7A 4AYOA 3QT9A 1N94B 1V7VA 3RRSA 2V3NA 1JCQB 4WU0A 2G0DA 2ZISB 1S63B 1UT9A 4Q88A 2VN7A 1H35A 2EACA 2V3PA 3E30B 3E73A 3AFJA 2SQCA 1O6HA 2F6DA 3VW5A 1X9DA 1GAHA 1FBWA 4GTVB 4YDOB 3E33B 3W7SA 5E2JA 4ZH1A 3QPFA 2XFGA 3K11A 2DRSA 3SDTA 3EQAA 3X17A 1W6JA 1NXCA 1O5MB 1AGMA 2B4FA 4V1SA 1IS9A 2GOXA 3P2CA 2BBCA 3WIQA 4L6XA 1TNBB 5M7IA 5FO7B 1SA5B 1G6IA 2V8KA 2RI8A 1LD7B 1LF6A 4D4AA 4MU9A 3DSWB 2WY8A 1DL2A 3PZ4B 4KKIA 4WVAA 3GZKA 3CU7A 4Z4LA 3WIWA 5FOBB 3EUVB 3H2WA 1KRFA 1KZOB 3D3IA 1D8DB 3WKIA 2DRRA 2FV1A 3M7BA 1D8EB 4LIXA 4GTOB 1WZZA 3S4CA 3HXCB 1GXNA 3M77A 1TN7B 1KSDA 2PN5A 4ONTA 1H14A 3ACSA 1LD8B 2A8ZA 3WC3A 3D5SA 1TN6B 3PYAA 4EHMB 2FUZA 4M76A 4KTRA 3HXDB 1SQCA 3W7TA 3DPYB 2DROA 4Q2BA 3QFZA 3E37B 1H3CA 2P0VA 1N9AB 2FBAA 1FPPB 3SQCA 2QNOA 3C72B 1O1SB 2RGKA 4L9PB 1DOGA 1TN8B 3T33A 1KSCA 5CD2A 4EL8A 3W7UA 1L1YA 2AHFA 1FT2B 2EABA 1TNUB 4V1RA 5GY3A 2JG0A 4ZRPA 1UMPA 2YIKA 2H6IB 1IA6A 3KSLB 2XWJB 4XUVA 4YDEB 3DSXB 4ZG8A 3A3VA 5GZKA 1JS4A 3W5NA 1G9GA 4KTPA 3GLYA 3KQ4A 2CQSA 2EAEA 3SAEA 3E6UA 2IEJB 2WY7A 3WKFA 1QBQB 2PMVA 3Q79B 3Q7AB 4DOEA 1NC5A 1GHQA 4D4CA 1WU5A 3SFXB 1NI1B 2RI9A 1GXMA 1R76A 1WU4A 1KWFA 1X81B 4D94A 1V5DA 3EU8A 1TNYB 5GW7A 2JJBA 3RSYA 1L2AA 3SDUA 1DCEB 1GA2A 2D5JA 1KS8A 2OKXA 3DSVB 3M74A 3SFYB 2CQTA 3SDVA 2ZIRB 1H54A 1CLCA 1V7WA 3M7LA 1JCRB 3WKGA 1KZPB 1G87A 3ANKA 3M76A 1MZCB 3M7CA 4GTRB 1GXOA 2H6HB 3M72A 2I07B 2XWBB 4QT9A 4BOJA 1V7XA 1H36A 3D5RA 4YCRA 1H3AA 4TXTA 2AHGA 1XW2A 4DODA 3H7LA 3S9VA 4GTPB 3Q75B 3PZ2B 3OXUA 1KREA 3S4DA 4LNGB 1XWQA 2BB6A 1F9DA 3DSSB 3QRYA 3PZ1B 4JJJA 1FBOA 1O6RA 3M73A 3QDEA 2BEDB 1TNOB 2B39A 2BB5A 2A73B 1TNZB 2WIIB 4LNBB 1V5CA 2AFAA 3EZ8A 2F0YB 2DRQA 1GAIA 3M71A 5FO8B 2GZ6A 2VN4A 3ANJA 3QG0A 1N95B 3S4BA 3PZ3B 2V8IA 3QFYA 3W7XA 3WUXA 4KKJA 1LTXB 3M7EA 5JPNB 3QXFA 1FCEA 1H12A 4TF4A 2H6GB 4CE7A 4BOKA 1O6QA 2Z07A 4FUSA 1O1TB 2EADA 4GTQB 3RX5A 4L0GA 1QQFA 5CZLA 3K7XA 3PMMA 2V8JA 3PYBA 1H37A 1O1RB 4GTTB 4CJ0A 1FO2A 1LF9A 1FT1B 3RJ3A 3CIHA 4CJ1A 3S4AA 4MBGB 3DRAB 3EU5B 3ON6A 2NVPA 4C1SA 1HCUA 3KLSA 3M75A 5KKBA 4AYPA 1N4SB 3HXFB 2D8LA 3SDQA 4AYQA 5MEHA 2FV0A 3P5RA 2WINB 1HZFA 4GL3A 1S64B 1WU6A 3W7WA 1JCSB 3Q73B 1IA7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H36 A;  3D5R A;  1H3A A;  1H35 A;  3E37 B;  1H3C A;  3E30 B;  2V3P A;  2SQC A;  3E32 B;  1O6H A;  4GTP B;  1H3B A;  1N9A B;  3Q75 B;  3PZ2 B;  3OXU A;  1FPP B;  3SQC A;  4LNG B;  2BB6 A;  3DSS B;  3PZ1 B;  3C72 B;  1O1S B;  4L9P B;  2NOJ A;  1TN8 B;  4LNV A;  1O6R A;  1N4R B;  4GTV B;  4YDO B;  3E33 B;  5JPM B;  2BED B;  1TNO B;  1FT2 B;  2B39 A;  1TNU B;  4ZH1 A;  4V1R A;  4D4D A;  2BB5 A;  2XQW A;  1QSJ A;  2A73 B;  1TNZ B;  2WII B;  4ZRP A;  1UMP A;  1NL4 B;  4LNB B;  2H6I B;  3KSL B;  1H39 A;  2XWJ B;  2F0Y B;  1W6J A;  4YDE B;  5AGD A;  1O5M B;  4FXK B;  3DSX B;  5FO8 B;  4V1S A;  1N95 B;  3PZ3 B;  3KQ4 A;  2V8I A;  2GOX A;  2IEJ B;  2BBC A;  2WY7 A;  1QBQ B;  1GSZ A;  2PMV A;  3Q79 B;  3Q7A B;  4KKJ A;  1LTX B;  1TNB B;  4D4B A;  1GHQ A;  3Q7F B;  4D4C A;  5JPN B;  4FXG B;  5FO7 B;  1SA5 B;  3E34 B;  1W6K A;  3SFX B;  2H6G B;  1NI1 B;  2V8K A;  4GTS B;  3KSQ B;  4GTM B;  5FO9 B;  1GXM A;  4BOK A;  2R2L B;  1O6Q A;  1N4P B;  1LD7 B;  1R76 A;  1O1T B;  4GTQ B;  4D4A A;  1X81 B;  4MU9 A;  4D94 A;  1QQF A;  3DSW B;  2WY8 A;  3G6J B;  1O79 A;  1TNY B;  3K7X A;  1C3D A;  3HXB B;  3PZ4 B;  1DCE B;  4KKI A;  2V8J A;  2G02 A;  3CU7 A;  1N4Q B;  1H37 A;  1O1R B;  3DSV B;  3SFY B;  4GTT B;  5FOB B;  3EUV B;  1FT1 B;  3DST B;  2H6F B;  1KZO B;  3RJ3 A;  1D8D B;  2ZIR B;  3HXE B;  4ZRQ A;  4MBG B;  3DRA B;  3OED A;  1SA4 B;  3EU5 B;  4C1S A;  3Q78 B;  1D8E B;  3DSU B;  3KLS A;  4GTO B;  1JCR B;  3HXC B;  1GXN A;  1KZP B;  1TN7 B;  2PN5 A;  1N4S B;  3HXF B;  4ONT A;  1LD8 B;  1N94 B;  3D5S A;  1TN6 B;  1MZC B;  4EHM B;  4GTR B;  1GXO A;  4M76 A;  2V3N A;  1JCQ B;  1HZF A;  2WIN B;  1SQC A;  3HXD B;  2H6H B;  2I07 B;  2XWB B;  1S64 B;  2G0D A;  2ZIS B;  1S63 B;  3DPY B;  4BOJ A;  1JCS B;  3Q73 B; 
#chains in the Genus database with same CATH topology
 3E32 B;  1H3B A;  1G9J A;  5M7Y A;  4J5T A;  2ZZR A;  1FO3 A;  1AYX A;  2ZBL A;  1CEM A;  2NOJ A;  1N23 A;  4LNV A;  5DGR A;  3RX8 A;  3REN A;  1N4R B;  5JPM B;  3QSP A;  3GT5 A;  3P5P A;  5IL8 A;  4ZH5 A;  1FP3 A;  2XQW A;  1TF4 A;  3QT3 A;  4D4D A;  1QSJ A;  1NL4 B;  1RWF A;  1N24 A;  1VD5 A;  1FAE A;  1H39 A;  2GH4 A;  3H3K A;  3QXQ A;  3TF4 A;  5AGD A;  4Z4J A;  4FXK B;  1RWA A;  1KFG A;  4WVC A;  4RNQ A;  4WVB A;  1HX9 A;  3WKH A;  1N7O A;  1F9O A;  1XWT A;  1GSZ A;  1KKT A;  5IKH A;  4D4B A;  3Q7F B;  1HXA A;  3QWT A;  5DGQ A;  4FXG B;  3ANI A;  3E34 B;  1K72 A;  1FMI A;  1W6K A;  3VSM A;  4AYR A;  3W5M A;  5CA3 A;  4GTS B;  3KSQ B;  2WYN A;  4GTM B;  3ACT A;  5FO9 B;  2R2L B;  1N4P B;  5ILH A;  3G6J B;  1O79 A;  2JF4 A;  1C3D A;  2FUT A;  3HXB B;  5ILJ A;  4E1Y A;  1OJM A;  2G02 A;  4DI5 A;  1N4Q B;  3M78 A;  3SDR A;  1GLM A;  1H13 A;  1UG9 A;  1ULV A;  4OZW A;  3WIR A;  1RQ5 A;  3NNB A;  3DST B;  2H6F B;  5ILK A;  1RWC A;  3HXE B;  4ZRQ A;  3OED A;  1SA4 B;  1RWH A;  3Q78 B;  3DSU B;  3VXD A;  3RX7 A;  1HM2 A;  4AYO A;  3QT9 A;  1N94 B;  1V7V A;  1X1H A;  4GAX A;  3RRS A;  2V3N A;  1JCQ B;  4WU0 A;  5IL3 A;  2G0D A;  2ZIS B;  1S63 B;  1UT9 A;  4Q88 A;  4MMH A;  2VN7 A;  1H35 A;  1OJN A;  3G4F A;  2EAC A;  2V3P A;  3E30 B;  3E73 A;  3AFJ A;  2SQC A;  1O6H A;  2F6D A;  3VW5 A;  1X9D A;  1GAH A;  1FBW A;  1HXG A;  4GTV B;  4YDO B;  3E33 B;  3W7S A;  1N22 A;  4F10 A;  5E2J A;  4ZH1 A;  2Q1F A;  3QPF A;  2XFG A;  3K11 A;  2DRS A;  2E22 A;  3N0F A;  3AFL A;  2BRW A;  3SDT A;  3EQA A;  3X17 A;  1W6J A;  1NXC A;  1O5M B;  1AGM A;  2B4F A;  4V1S A;  1IS9 A;  1HXC A;  2GOX A;  3P2C A;  2BBC A;  3WIQ A;  3M02 A;  2ONG A;  4L6X A;  1TNB B;  5DHI A;  1LOH A;  5M7I A;  5FO7 B;  1SA5 B;  1G6I A;  2V8K A;  2RI8 A;  5DHK A;  4F13 A;  5EAU A;  1LD7 B;  4FNV A;  1LF6 A;  4D4A A;  3NFV A;  5JMF A;  4MU9 A;  3DSW B;  2WY8 A;  1C82 A;  1DL2 A;  3PZ4 B;  4KKI A;  1N1Z A;  4WVA A;  3GZK A;  3CU7 A;  4Z4L A;  3WIW A;  5FOB B;  1EGU A;  3EUV B;  3H2W A;  5IK6 A;  1KRF A;  1KZO B;  3D3I A;  1D8D B;  2FUQ A;  3WKI A;  4OK4 A;  2DRR A;  1N1B A;  2FV1 A;  3M7B A;  1D8E B;  4LIX A;  4GTO B;  1WZZ A;  3S4C A;  3HXC B;  1GXN A;  3M77 A;  1TN7 B;  1KSD A;  2PN5 A;  4ONT A;  1H14 A;  3ACS A;  1LD8 B;  2A8Z A;  2X03 A;  3WC3 A;  3D5S A;  1TN6 B;  1RW9 A;  5IK0 A;  1HN0 A;  3PYA A;  4EHM B;  2FUZ A;  1LXM A;  4M76 A;  4KTR A;  3HXD B;  1SQC A;  3W7T A;  3DPY B;  2DRO A;  4Q2B A;  1F9G A;  3QFZ A;  3E37 B;  1H3C A;  5IKA A;  2P0V A;  1N9A B;  5ILZ A;  2FBA A;  3M01 A;  5IM1 A;  1FPP B;  3SQC A;  2QNO A;  4OK2 A;  3C72 B;  1O1S B;  2RGK A;  4L9P B;  1DOG A;  1TN8 B;  3T33 A;  1KSC A;  5CD2 A;  4EL8 A;  3N0G A;  3W7U A;  1L1Y A;  2AHF A;  1FT2 B;  2EAB A;  1TNU B;  4V1R A;  5GY3 A;  2JG0 A;  1N7N A;  4ZRP A;  1UMP A;  2YIK A;  2H6I B;  1IA6 A;  3KSL B;  2XWJ B;  4XUV A;  4YDE B;  1N21 A;  3DSX B;  4ZG8 A;  3A3V A;  5GZK A;  1JS4 A;  3W5N A;  1G9G A;  4KTP A;  3GLY A;  3KQ4 A;  2E24 A;  1X1J A;  2CQS A;  2EAE A;  3SAE A;  3E6U A;  3VSN A;  2IEJ B;  2WY7 A;  3WKF A;  1QBQ B;  2PMV A;  3Q79 B;  3Q7A B;  4DOE A;  1NC5 A;  2WDA A;  1GHQ A;  4D4C A;  3LZ9 A;  5JMD A;  1WU5 A;  4OJZ A;  3SFX B;  1NI1 B;  2RI9 A;  1LXK A;  1GXM A;  4NEI A;  1W3Y A;  1R76 A;  1WU4 A;  1KWF A;  2BRV X;  1X81 B;  1I8Q A;  4D94 A;  1V5D A;  3EU8 A;  1TNY B;  5GW7 A;  2JJB A;  3RSY A;  1L2A A;  3A0O A;  1DCE B;  3SDU A;  1GA2 A;  1HMW A;  2D5J A;  1KS8 A;  2OKX A;  3DSV B;  3M74 A;  3SFY B;  2CQT A;  1HMU A;  3E80 A;  3SDV A;  2ZIR B;  1H54 A;  5C05 A;  1CLC A;  1V7W A;  1OJP A;  3M7L A;  1JCR B;  3WKG A;  1KZP B;  1G87 A;  1CB8 A;  3ANK A;  3G4D A;  3M76 A;  1MZC B;  3M7C A;  4GTR B;  1GXO A;  2H6H B;  1HV6 A;  3M72 A;  2I07 B;  2XWB B;  4QT9 A;  4BOJ A;  2ONH A;  1V7X A;  1H36 A;  3D5R A;  4YCR A;  1H3A A;  5ILD A;  4TXT A;  2AHG A;  1XW2 A;  4DOD A;  3H7L A;  3S9V A;  3M00 A;  4GTP B;  3E7J A;  3Q75 B;  3PZ2 B;  3OXU A;  1KRE A;  3S4D A;  4LNG B;  1XWQ A;  2BB6 A;  1F9D A;  3DSS B;  3QRY A;  3PZ1 B;  4JJJ A;  1FBO A;  1O6R A;  1HM3 A;  3M73 A;  3QDE A;  2BED B;  1TNO B;  4FJQ A;  2B39 A;  2BB5 A;  2A73 B;  1TNZ B;  2WII B;  4LNB B;  1V5C A;  2AFA A;  3EZ8 A;  2F0Y B;  2DRQ A;  1GAI A;  1N20 A;  3M71 A;  5FO8 B;  2GZ6 A;  2VN4 A;  3ANJ A;  3QG0 A;  1N95 B;  3S4B A;  1OJO A;  3PZ3 B;  1N7R A;  2V8I A;  3QFY A;  5EAT A;  3W7X A;  1N7Q A;  3WUX A;  4KKJ A;  2J5C A;  1LTX B;  3M7E A;  5JPN B;  4OZV A;  3QXF A;  1FCE A;  1H12 A;  4TF4 A;  2H6G B;  4CE7 A;  5ILI A;  4BOK A;  1O6Q A;  2Z07 A;  4FUS A;  1O1T B;  2EAD A;  4GTQ B;  3RX5 A;  4L0G A;  1QQF A;  5CZL A;  5EAS A;  3K7X A;  3PMM A;  2V8J A;  4MMI A;  1RWG A;  1H37 A;  3PYB A;  1O1R B;  5ILY A;  4GTT B;  4CJ0 A;  1FO2 A;  1LF9 A;  2WCO A;  1QAZ A;  1FT1 B;  3RJ3 A;  3CIH A;  4CJ1 A;  2BRP A;  3S4A A;  1N7P A;  4MBG B;  3DRA B;  3EU5 B;  5IK9 A;  3ON6 A;  2NVP A;  1J0N A;  4C1S A;  1HCU A;  1F1S A;  3KLS A;  3M75 A;  5KKB A;  4AYP A;  1N4S B;  3HXF B;  2D8L A;  3SDQ A;  4AYQ A;  5MEH A;  2FV0 A;  1X1I A;  3P5R A;  2WIN B;  1HZF A;  4GL3 A;  1S64 B;  1WU6 A;  3W7W A;  1J0M A;  1JCS B;  3Q73 B;  1IA7 A; 
#chains in the Genus database with same CATH homology
 3E32 B;  1H3B A;  1G9J A;  5M7Y A;  4J5T A;  2ZZR A;  1FO3 A;  1AYX A;  2ZBL A;  1CEM A;  2NOJ A;  4LNV A;  5DGR A;  3RX8 A;  3REN A;  1N4R B;  5JPM B;  3QSP A;  3GT5 A;  3P5P A;  4ZH5 A;  4D4D A;  1FP3 A;  2XQW A;  1TF4 A;  3QT3 A;  1QSJ A;  1NL4 B;  1VD5 A;  1FAE A;  1H39 A;  2GH4 A;  3H3K A;  3QXQ A;  3TF4 A;  5AGD A;  4Z4J A;  4FXK B;  1KFG A;  4WVC A;  4WVB A;  3WKH A;  1F9O A;  1XWT A;  1GSZ A;  1KKT A;  4D4B A;  3Q7F B;  3QWT A;  5DGQ A;  4FXG B;  3ANI A;  3E34 B;  1K72 A;  1FMI A;  1W6K A;  4AYR A;  3W5M A;  5CA3 A;  4GTS B;  3KSQ B;  2WYN A;  4GTM B;  3ACT A;  5FO9 B;  2R2L B;  1N4P B;  3G6J B;  1O79 A;  2JF4 A;  1C3D A;  3HXB B;  2G02 A;  1N4Q B;  3M78 A;  3SDR A;  1GLM A;  1H13 A;  1UG9 A;  1ULV A;  3WIR A;  1RQ5 A;  3DST B;  2H6F B;  3HXE B;  4ZRQ A;  3OED A;  1SA4 B;  3Q78 B;  3DSU B;  3VXD A;  3RX7 A;  4AYO A;  3QT9 A;  1N94 B;  1V7V A;  3RRS A;  2V3N A;  1JCQ B;  4WU0 A;  2G0D A;  2ZIS B;  1S63 B;  1UT9 A;  4Q88 A;  2VN7 A;  1H35 A;  2EAC A;  2V3P A;  3E30 B;  3E73 A;  3AFJ A;  2SQC A;  1O6H A;  2F6D A;  3VW5 A;  1X9D A;  1GAH A;  1FBW A;  4GTV B;  4YDO B;  3E33 B;  3W7S A;  5E2J A;  4ZH1 A;  3QPF A;  2XFG A;  3K11 A;  2DRS A;  3SDT A;  3EQA A;  3X17 A;  1W6J A;  1NXC A;  1O5M B;  1AGM A;  2B4F A;  4V1S A;  1IS9 A;  2GOX A;  3P2C A;  2BBC A;  3WIQ A;  4L6X A;  1TNB B;  5M7I A;  5FO7 B;  1SA5 B;  1G6I A;  2V8K A;  2RI8 A;  1LD7 B;  1LF6 A;  4D4A A;  4MU9 A;  3DSW B;  2WY8 A;  1DL2 A;  3PZ4 B;  4KKI A;  4WVA A;  3GZK A;  3CU7 A;  4Z4L A;  3WIW A;  5FOB B;  3EUV B;  3H2W A;  1KRF A;  1KZO B;  3D3I A;  1D8D B;  3WKI A;  2DRR A;  2FV1 A;  3M7B A;  1D8E B;  4LIX A;  4GTO B;  1WZZ A;  3S4C A;  3HXC B;  1GXN A;  3M77 A;  1TN7 B;  1KSD A;  2PN5 A;  4ONT A;  1H14 A;  3ACS A;  1LD8 B;  2A8Z A;  3WC3 A;  3D5S A;  1TN6 B;  3PYA A;  4EHM B;  2FUZ A;  4M76 A;  4KTR A;  3HXD B;  1SQC A;  3W7T A;  3DPY B;  2DRO A;  4Q2B A;  3QFZ A;  3E37 B;  1H3C A;  2P0V A;  1N9A B;  2FBA A;  1FPP B;  3SQC A;  2QNO A;  3C72 B;  1O1S B;  2RGK A;  4L9P B;  1DOG A;  1TN8 B;  3T33 A;  1KSC A;  5CD2 A;  4EL8 A;  3W7U A;  1L1Y A;  2AHF A;  1FT2 B;  2EAB A;  1TNU B;  4V1R A;  5GY3 A;  2JG0 A;  4ZRP A;  1UMP A;  2YIK A;  2H6I B;  1IA6 A;  3KSL B;  2XWJ B;  4XUV A;  4YDE B;  3DSX B;  4ZG8 A;  3A3V A;  5GZK A;  1JS4 A;  3W5N A;  1G9G A;  4KTP A;  3GLY A;  3KQ4 A;  2CQS A;  2EAE A;  3SAE A;  3E6U A;  2IEJ B;  2WY7 A;  3WKF A;  1QBQ B;  2PMV A;  3Q79 B;  3Q7A B;  4DOE A;  1NC5 A;  1GHQ A;  4D4C A;  1WU5 A;  3SFX B;  1NI1 B;  2RI9 A;  1GXM A;  1R76 A;  1WU4 A;  1KWF A;  1X81 B;  4D94 A;  1V5D A;  3EU8 A;  1TNY B;  5GW7 A;  2JJB A;  3RSY A;  1L2A A;  3SDU A;  1DCE B;  1GA2 A;  2D5J A;  1KS8 A;  2OKX A;  3DSV B;  3M74 A;  3SFY B;  2CQT A;  3SDV A;  2ZIR B;  1H54 A;  1CLC A;  1V7W A;  3M7L A;  1JCR B;  3WKG A;  1KZP B;  1G87 A;  3ANK A;  3M76 A;  1MZC B;  3M7C A;  4GTR B;  1GXO A;  2H6H B;  3M72 A;  2I07 B;  2XWB B;  4QT9 A;  4BOJ A;  1V7X A;  1H36 A;  3D5R A;  4YCR A;  1H3A A;  4TXT A;  2AHG A;  1XW2 A;  4DOD A;  3H7L A;  3S9V A;  4GTP B;  3Q75 B;  3PZ2 B;  3OXU A;  1KRE A;  3S4D A;  4LNG B;  1XWQ A;  2BB6 A;  1F9D A;  3DSS B;  3QRY A;  3PZ1 B;  4JJJ A;  1FBO A;  1O6R A;  3M73 A;  3QDE A;  2BED B;  1TNO B;  2B39 A;  2BB5 A;  2A73 B;  1TNZ B;  2WII B;  4LNB B;  1V5C A;  2AFA A;  3EZ8 A;  2F0Y B;  2DRQ A;  1GAI A;  3M71 A;  5FO8 B;  2GZ6 A;  2VN4 A;  3ANJ A;  3QG0 A;  1N95 B;  3S4B A;  3PZ3 B;  2V8I A;  3QFY A;  3W7X A;  3WUX A;  4KKJ A;  1LTX B;  3M7E A;  5JPN B;  3QXF A;  1FCE A;  1H12 A;  4TF4 A;  2H6G B;  4CE7 A;  4BOK A;  1O6Q A;  2Z07 A;  4FUS A;  1O1T B;  2EAD A;  4GTQ B;  3RX5 A;  4L0G A;  1QQF A;  5CZL A;  3K7X A;  3PMM A;  2V8J A;  3PYB A;  1H37 A;  1O1R B;  4GTT B;  4CJ0 A;  1FO2 A;  1LF9 A;  1FT1 B;  3RJ3 A;  3CIH A;  4CJ1 A;  3S4A A;  4MBG B;  3DRA B;  3EU5 B;  3ON6 A;  2NVP A;  4C1S A;  1HCU A;  3KLS A;  3M75 A;  5KKB A;  4AYP A;  1N4S B;  3HXF B;  2D8L A;  3SDQ A;  4AYQ A;  5MEH A;  2FV0 A;  3P5R A;  2WIN B;  1HZF A;  4GL3 A;  1S64 B;  1WU6 A;  3W7W A;  1JCS B;  3Q73 B;  1IA7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...