2XQXA

Structure of the family 32 carbohydrate-binding module from streptococcus pneumoniae endod
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
147
structure length
147
Chain Sequence
ASNIVPGATVIDSTFPKTEGGEGIEGMLNGTITSLSDKWSSAQLSGSVDIRLTKPRTVVRWVMDHAGAGGESVNDGLMNTKDFDLYYKDADGEWKLAKEVRGNKAHVTDITLDKPITAQDWRLNVVTSDNGTPWKAIRIYNWKMYEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Analysis of a Putative Family 32 Carbohydrate-Binding Module from the Streptococcus Pneumoniae Enzyme Endod.
pubmed doi rcsb
source organism Streptococcus pneumoniae
molecule tags Sugar binding protein
molecule keywords ENDO-BETA-N-ACETYLGLUCOSAMINIDASE D
total genus 31
structure length 147
sequence length 147
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-09-07
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2xqxA00
2W1UA 3GM8A 1JZ4A 1XC6A 4A6OA 4D0QA 3MBWA 3P6BA 2BGOA 2Y6GA 3A7QA 3ETPA 1CZTA 4Z2AA 3IIIA 5DMYA 1BHGA 3ACIA 2VL4A 2VC9A 2LW8A 3I3BA 4CUBA 1UX7A 1US2A 2W87A 3J7HA 3A21A 3WQBA 5C70A 1JYWA 4KWUA 4ARYA 1UZ0A 1W8OA 2KD7A 3DYPA 1UMHA 2W47A 3C7FA 3HNYM 3WF1A 3OBAA 5LA2A 1DLCA 2ZEZA 4JKKA 4QX1A 4RYDA 3IDAA 1P8JA 2WUHA 4PF1A 3F2ZA 2VZSA 2DDUA 4DUVA 3FL7A 1SDDB 1JYXA 4TTGA 2VCAA 3THDA 4MADA 2JDAA 2Y6HA 3WNKA 3OGRA 2VQUA 3CDZB 2ZEWA 4LQRA 4A45A 2Y6JA 2DCKA 2QQIA 3PUIA 1JZ3A 2E26A 2E32A 2RVAA 4DEQA 5F7UA 3U37A 3WNOA 3WNNA 1TVGA 2WYSA 3WNLA 2ZEYA 4LPLA 5EJ1B 4QB1A 5IJRA 3VD5A 3C7HA 4BDVB 1EUUA 5LCWL 3ZM8A 4JKLA 1XNTA 2E31A 2ORXA 1NX9A 3I3EA 3C7OA 2HLEA 2L9LA 4XVHA 1PMHX 2VZRA 2XOMA 2W1WA 2Z4FA 4XUOA 4A41A 1JYNA 4PT6A 2VMDA 1UYZA 2VM9A 3NNGA 3T2QA 4JHZA 2WN3A 2ID4A 3T0AA 3DECA 1OF4A 2EICA 2WAAA 3SKVA 2YFZA 1XNAA 2V4VA 3P1IA 4P08A 1H6YA 4M4RA 2W9XA 1NUKA 1UYYA 2V72A 4GWIA 2EIDA 2W95A 1O8SA 4A4AA 3ACFA 3MV01 3K4DA 1IQDC 2W1QA 5HXMA 1OD3A 2YC4A 3THCA 5IFTA 3CQOA 2EIBA 3IAQA 2VZOA 3C7GA 5EIYB 5DPNA 1SG3A 5C71A 4OZOA 1NKGA 4GZ9A 1JI6A 1UYXA 1JZ7A 4XZUG 3I2JA 3HOBA 4DXTA 4CUAA 2QQJA 3WNPA 2J22A 3IB3A 2J1RA 5DN2A 2VMCA 3MUZ1 3UESA 2WO1A 4AAXA 3NQHA 1NAEA 1ULOA 1HN1A 3HNBM 4P5YA 2J1UA 3OGSA 2BZDA 5JXIA 5B4XA 5IYYA 4E8CA 2YB7A 4P00B 4QDRA 3AC0A 3WF0A 4UOJA 3CKHA 3ACHA 4CVUA 2WO3A 1GUIA 1PX3A 3I3DA 4D8MA 2BGPA 2VZVA 1K42A 2XHNA 2JKXA 1MPXA 1XPWA 4QDQA 4OMDA 4A42A 2PQSA 5JXGA 2J7MA 3VD4A 5I0DA 5LA0A 3LEKA 1CZSA 2JE8A 2BBAA 2XONA 2WBKA 3A22A 3WNMA 3T2PA 4CU7A 2QQKA 4ET7A 3VDBA 4QX2A 4W8JA 2VR4A 4AG4A 2VZTA 3WF3A 3OGVA 3WF2A 2VZQA 3A23A 3EYPA 3MO4A 4QB6A 2J1TA 1OF3A 1UWWA 4DXRA 3C8XA 2VZ1A 1GOHA 3LPGA 1JZ5A 2ZEXA 3FHQA 3HJRA 4GWJA 3VDCA 2C9KA 3I2IA 1W99A 1T2XA 3SEEA 1F4AA 3K75B 2QQOA 2VQTA 5JXJA 1LNSA 3MV11 4MGSA 4QB2A 1W8NA 2WN2A 1GQPA 1O8PA 4CU8A 4A3ZA 1JYVA 2HYXA 4M4PA 3DYMA 2QQLA 2YFUA 1JZ2A 3JXSA 4TXWA 2C26A 3C7EA 4DUWA 2Y8KA 1OH4A 2X09A 3CZUA 2WO2A 2LS6A 1L7QA 1GOFA 1UY4A 1D7PM 2VCBA 1UY2A 2CDOA 2VZPA 3T0BA 3I2KA 2R7EB 3WF4A 2VCCA 3T0DA 3ACGA 5CZKA 3VD7A 4OUEA 1K12A 2EIEA 2ORZA 4BK4A 1YQ2A 3OB8A 2VJXA 4E8DA 3NJXA 2CDPA 3PUHA 1UY0A 2Y64A 1W9WA 1WKYA 5G04L 4QX3A 4ZY9A 4ZXEA 1PMJX 5JMOA 4UAPA 4CU9A 3FHAA 2QQNA 4QPWA 2VMFA 4JX0A 1US3A 2VOTA 1JU3A 4JKMA 2B9VA 1PX4A 3T2OA 1KEXA 2C4XA 1K3IA 3W5NA 5JR2A 1K45A 3K4AA 5FUIA 2W3JA 4QAWA 2V5DA 4KI5M 4OYUA 2WABA 5JXHA 1O59A 2Y6KA 4QDSA 5B4NA 3CIHA 4ARXA 3HNMA 2X05A 3T09A 2BERA 2J1AA 4CUCA 5IFPA 2YC2A 3UETA 1JZ8A 3I2FA 3I97A 4RN5A 3UNPA 2WZ8A 3K46A 2W1SA 3VD9A 5DQ0A 3T08A 4XUTA 2WQ8A 2WDBA 4HG6B 3SKJE 3CMGA 4UI9L 1GOGA 4BXSV 5J1XA 4W4ZA 1DYOA 1SHWB 4DXSA 3HPNA 2W5FA 4XUQA 3GXUA 4LHSA 2RJ2A 2X10A 4LKSA 3OEAA 5EJZB 1GMMA 2J1EA 2DCJA 4BJ0A 3HN3A 5HPOA 4MGQA 4OMCA 3W5MA 4W50A 1UY3A 4L0PA 1CX1A 2YG0A 3I2HA 1RYYA 1UMIA 5LA1A 4IUGA 4MOAA 5C7GA 2JD9A 1W0NA 3NRUA 3WSOA 2J1SA 2VZ3A 5A1AA 3LPFA 5IHRA 3OG2A 4BK5A 2E33A 1KGYA 1F4HA 1ULPA 3IAPA 3K4ZA 1H6XA 2Y6LA 4DUXA 4FI9A 1EUTA 3BN6A 3MUY1 3VDAA 2W46A 1CIYA 1OT5A 3GGLA 4XURA 2VTFA 3LEIA 2OKXA 3BGAA 3CZJA 4DEVA 3ECQA 4QX0A 1W9TA 2WZEA 4PQQA 4CU6A 1L7RA 3GDBA 1I5PA 4KMQA 3FN9A 3LEGA 1GU3A 3LQCA 5CYYA 4MO3M 3LE0A 3SEPA 2W91A 4ZZ8A 4P02B 1DP0A 4A44A 3K77A 2VMEA 1TG7A 1JHJA 1UY1A 1WCQA 1UXXX 4YPJA 1JU4A 2QBXA 2W92A 2ZXQA 3NJVA 4XUPA 1R64A 1J83A 3D3AA 3I2GA 1W9SA 3OEBA 1GNYA 2J1VA 3E1F1 3VD3A 5JUVA 1UXZA 1CZVA 2QQMA 3EB7A 3HEIA 4XUNA 3WEZA 2W94A 3DYOA 1J84A 2VZUA 2B4KA 1JZ6A 2XQXA 2WAOA 4ZZ5A 3ABZA 2RV9A 2VO5A 5G05L
chains in the Genus database with same CATH superfamily
1ONAA 1AL21 5JPMB 1GZCA 1OVSA 4RQPB 4D0QA 2BDRA 2HJIA 2IVIB 3K48A 5ACA3 2PAMA 5A7WA 1EYBA 5A6YA 2BGOA 5ISLA 4IGQA 2ZX3A 3OBZA 5A32B 4D6SA 3A7QA 1W3VA 1QJX3 3VKOA 1CZTA 5C3OA 3HVDA 4PIZA 5FZ3A 1AR92 4HBNA 1J1TA 1GZWB 2G9FA 3OYWA 1BHGA 1FX5A 4CDQA 4WM7A 5DMYA 1J59A 1V9U3 2VL4A 3ACIA 3IDCB 2A71A 4FTBA 2LW8A 4IERA 1N3PA 4FXKB 4CUBA 2W87A 1ZREA 4XPVA 2OUHA 5IVCA 2TEPA 3A21A 4CEWC 4LNVA 2FMDA 1PVXA 2FDGA 2ZKLA 2R6QA 1VP6A 2KD7A 3DYPA 1UMHA 3HNYM 3MIGA 5CKMA 3WW4A 3NV4A 3VGIA 3B02A 2ZGNA 1OLMA 2XLAA 2X5IB 4XDQA 1I1EA 4AR2A 3WXPA 3IDAA 5L9BA 2A70A 2WUHA 3SNMA 4AI9A 3I54A 2VZSA 3LGRA 2DDUA 4IEOA 1ZZBA 1HQLA 2A5ZA 2CU5A 5KR7A 1JYXA 4TTGA 1DBNA 1LODA 1WA4A 5EJ3A 2QQPA 3SQOA 2LTNA 4FQZA 2OA2A 4IEQA 4RHV3 1H2NA 1SFNA 2MEV1 2UY8A 3GBGA 3VBHB 1W2OA 4OZXA 4X6QB 1ULCA 2Y6HA 4FPGA 4META 3RI8A 4I01A 2VQ0A 3OGRA 5I0SA 3I49A 3TWIA 4Z1VA 2NM1A 4A45A 4NIHA 1RUOA 4QPGC 3M3QA 4Z92B 3VBRB 2VOXA 3PLQA 3O1OA 3LWCA 4AHYA 3GZUC 1LOCA 2E26A 4M0NA 1ULDA 3ZXFA 1SPPA 2ARBA 2RVAA 4FPHA 4ATFA 3RZHA 4S2HA 4YW3A 1ZRCA 1Y3TA 1XNKA 5FZ6A 4BQXA 1TVGA 1BK1A 3JBG1 4OI2A 1AXKA 2VBDA 4QXHA 1OOPA 1POV0 4GMP3 3WR0A 3VD5A 3AJZA 4CCOA 1YFWA 3C7HA 4UYBA 2WNEA 2ZHNA 4Q8LA 2ZMKA 1YC61 3JCIA 3LIGA 1M4WA 1XNTA 3L2YA 3TEXA 5FXWA 1FMD3 2AUYA 2JIJA 2E7TA 2HLEA 2L9LA 3KCYA 1VBB3 1PK6C 2ZAHA 3O1VA 2XOMA 3MLJA 4YM1A 1OHFA 4M3CF 1SDWA 4JDNA 4YZ3A 3NV2A 2OYZA 4ONUA 4AFBA 1RJ8A 1Q8VA 1YIFA 1D4M2 3W59A 1F15A 1UYZA 2WS91 1BEV2 1WD3A 4LO6B 1OOPC 4IEPA 2WN3A 3T2QA 5HV0A 1O3SA 3KCCA 3ZSLA 3T0AA 4Q5OA 1YHFA 1C8NA 3LIHA 2ZGUA 2IFRA 4CCEA 1Z7S3 1A6CA 5FK7A 5I0UA 1XNAA 1YXWA 2ENRA 3KF3A 2V4VA 4FFIA 4NAOA 4XHXA 2JDYA 5FKBA 4AGRA 1V6JA 3BALA 2FZ2A 1QXRA 1CN1A 1NUKA 1UZVA 2W9XA 4G4FA 1QEXA 2XWBB 3LCPA 5AVPA 4AGVA 3LSEA 5BNOB 1MS9A 1NXMA 1O8SA 3P3PA 1QJX1 1SLLA 4TLFA 3ACFA 1F5FA 3OJBA 1W0PA 3K4DA 1S0BA 1IQDC 3QH6A 4XZPA 3FLRA 5CADA 5IK4A 5KWRA 5HXMA 1VMFA 2DVDA 3TAYA 4DXZA 5C5UA 4E4DX 4DO0A 5LBBA 4FCAA 4YZ2A 1MZ6A 2D44A 3CQOA 2C0ZA 4XFBA 1R093 3MLLA 3IAQA 5CU1A 1E5IA 4M0HA 2WL1A 2GC1A 4GALA 2P6CA 4QHZA 5JR7B 4Q26A 3ES4A 3H0OA 1KS4A 1QJFA 1AR73 2GAUA 4HKLA 2A7AA 2NPIA 5KHKA 2VOWA 4NHKA 1MQTA 1WW5A 3RZZA 1IKQA 4ZHNA 2C1FA 4MGZE 5BNQA 4XZUG 3ZYRA 3ZX7A 3KGZA 4AQTA 4CCKA 5A6ZA 4UBHA 5A6QA 5J36A 2R072 4QX5A 4XBLA 4DXTA 4CUAA 1BYHA 2J22A 3PNAA 4MHUA 3IB3A 2J1RA 4WM7C 1O4ZA 5FP3A 3T1MA 5AC92 1AUYA 4YM2A 4YGCA 3CJIB 1YNAA 3VBSC 3NQHA 3AZWA 3NO8A 1COV3 1O7FA 2JG9A 1HXS2 3AXEA 4HXCA 1X36A 3T3YA 1AR91 3HNBM 3AP7A 3KSCA 5FPVA 5CKQA 3PUSA 1E5HA 1S0GA 4LBQB 2HWC2 4K9SA 1KXGA 4TLGA 2EALA 4N43C 3J8F1 1C57A 2J1UA 2BZDA 3J7LA 4FFGA 4BZ4A 2C5DA 3NAPA 1CJPA 2A6WA 1O5LA 2VE1A 5APAA 1CIWA 1CAWA 1GANA 4J6GA 5GKAC 5HCBA 1GFF2 2V09A 3WF0A 5J3UA 4I09A 1ST8A 2D6NA 3LEMA 4LBOA 2WO3A 4QPIC 2EAKA 2R063 4BQ1A 5FQ0A 3K3NA 1LB2A 4Y22B 4BMBA 2HH9A 2R061 2ZHMA 4D8MA 2BGPA 2VZVA 1K42A 2XHNA 2MEV2 4KQ7A 1W6MA 3AYDA 4JV4A 4HSLA 1XPWA 2DCZA 2DVBA 1OKOA 3AK0A 3I3QA 3I59B 4GB33 1R092 2HWF3 4L97A 5H9PA 5T52A 3FC0A 1TE1B 2J7MA 4A42A 5I0DA 1AF9A 1C4RA 1CZSA 5LA0A 3VD4A 4YG3A 3V56A 3Q8AA 4IEVA 3N9OA 4LBKA 2PMWB 4Z07A 2FDJA 2EF6A 2I2SA 2K2SA 3AX4A 4MUVA 5FZLA 2FDKA 4DY5A 1YYNA 5IVEA 2D97A 1RVF3 3WNMA 1RUF2 3ZVXA 4LE3A 3EO6A 2DVFA 2QQKA 3NJYA 1Q8PA 4INDA 3FMGA 2V5YA 3VDBA 1OOPB 1W06A 4W8JA 1QH6A 2BUKA 3UYJA 5C8CB 3UKTA 2HWF1 2VW1A 3Q8BA 3FE5A 4AG4A 1UKRA 3OGVA 1PGL1 3V0AB 5CEHA 1RUH3 4JHTA 1O4TA 4I3PA 1YLLA 1UZYA 1W6PA 1A8MA 2TUNA 1ZBE3 1QOOA 2RDRA 5IAVA 2VZ1A 1SCSA 2AREA 3ES1A 5IVJA 4QHBA 3VHOA 3HJRA 3FHQA 4GWJA 1D0HA 1WW4A 4CUGA 3I2IA 1AL23 1CAUB 3U75A 4AHXA 2OZJA 1S0EA 1QJY2 1OLME 1T2XA 5DG1A 5FY9A 4D7TA 1F4AA 4B7KA 3CJXA 3K75B 4WVMB 5ACA1 4XQ4A 2VTXA 2ZGKA 1QDCA 2VQTA 3HAGA 1YIPA 4JGZA 3GZAA 1LNSA 1W2NA 3WLUA 5IK8A 4Y22A 3TBDA 2Q1MA 3LOIA 2RR11 5JPNB 3O1RA 4XMIA 1W8NA 2WN2A 4KWKA 2PHLA 4OQ8A 2ZGSA 4IETA 3HQXA 1S2EA 4E27A 1NCRA 1H9PA 3RZKA 2O14A 1SZBA 1DFQA 1PZ9A 1ND3B 4H7LA 1YEWA 4GB32 4PCRA 5FP7A 5JIAA 2ZOEB 1HIXA 2WFPA 3GNEA 4KNCA 2DYCA 4TXWA 3VHNA 3VBRA 2C26A 3C7EA 5F32A 3MHZA 4I2OA 2Q1ZB 4GJZA 2R042 5FREA 3CZUA 4CSWA 2WO2A 4K3UA 2GP5A 4FOVA 4JZRA 2ILMA 4Q1RA 1E5RA 2LS6A 4K1ZA 4BIOA 4DS0A 4NWWA 1HV1A 1UY4A 4WM7B 1YRZA 3OYWB 4P9LA 3RZJA 1H1MA 4HMZA 4V2WA 3AKTA 2CDOA 3ZXAC 3NNMA 3WG4A 2VCCA 3KS7A 1QHDA 2WLPA 2D6PA 3E5XA 3PJQA 2VH9A 3H9AA 1BBT3 3R4SA 3VD7A 1NXD1 2EIEA 3SMHA 4DPNA 3B93A 3L2HA 4NHXA 4IE4A 2VOVA 2BOJA 2E7QA 3CO2A 2OUJA 4FOWA 3VBHC 3OD0A 1NQJA 4CDUB 4BIFA 1XYNA 1REDA 3LA3A 4KU8A 2DU0A 5JMOA 2P2KA 3MW3A 5A33B 2FDHA 2RS31 5AFBA 1BMV2 2Y0OA 4CU9A 5AFEA 2G9ZA 2QQNA 2IC1A 1QGLA 3MF6A 4YFZA 1Q8QA 4GKXA 5ABJA 4QQ2A 4COUA 2UY9A 1F5JA 1US3A 1HRV3 1JU3A 2A73B 1HRI2 3JBG3 3JU9A 1LU1A 4NOTA 4YG6A 1PX4A 1VRH3 1KEXA 2YGMA 1RUC2 1W6QB 5JR2A 1W8FA 1IOAA 3FX3A 2DF7A 2JG9C 4XAAA 2BNMA 2EAAA 4QAWA 5LZ6A 4NPLA 2MEV3 2V5DA 2YROA 3AZXA 5SV5A 3W21A 3WHUA 3WHTA 2IXHA 1R081 1O59A 3TRSB 3ORJA 4XFFA 3CIHA 2P37A 1WBLA 2IWGB 4Q4X3 1VBB1 2BERA 3MW2A 5FUPA 4BQYA 1OLQA 2OX0A 4Y20B 5C3SA 2XJRA 1WW7A 1VIWB 4XABA 3LDRA 4ISRA 3WP4A 2ZX4A 1NLQA 3PVOA 4RA0A 1JZ8A 3ASIA 4G3YC 3UNPA 3GJBA 3LD8A 1TME1 4XFHA 5FXVA 4AGGA 5F3IA 2OZ6A 5DQ0A 2DVAA 4MV2A 3T08A 4XJ9A 3V0BA 5FXZA 1R083 1CD3G 4XTPA 1LU2A 2ZX1A 2AH2A 3NW4A 4UF0A 3CMGA 4UI9L 2JG8A 5GZDA 3AMNA 3SKJE 1OUXA 1AR71 1LOGA 4YRDA 3ROUA 2XVKA 1JUHA 4Z8BA 2W0XA 1QQP1 4U36A 2YU2A 4LHSA 2X10A 4E2GA 5FO9B 4AEMA 4DMIA 1U5IA 2FCUA 4PLOA 3FUOA 5EPAA 4QHOA 4CXWA 1FI2A 3OEAA 2IXLA 3QH7A 3UT0A 5JOWA 3MGUA 2WNUA 2F4LA 2Y33A 2D6KA 2DCJA 4RHV1 4UW5A 4B4PA 3HN3A 5EWSA 2EA7A 3AYAA 5AC91 3UK9A 4PBOA 4MGQA 1Z0HA 4UW4A 4OMCA 4LA3A 3DXTA 4FOYA 1GBGA 4GXLA 1QNWA 3SCFA 4LK7A 3MPPG 4AFDA 1PIV3 5IWFA 1Y43B 3RQ0A 1HW5A 2DCTA 2JJ6A 2WINB 1MVQA 1S0JA 4O61A 3T30A 3VKNA 5JZGA 5C3RA 3S7EA 5C7GA 1OKQA 2JD9A 4XF0A 1W0NA 1PGL2 1HX6A 1AYN1 1WW6A 3WSOA 4AEDB 2CNAA 2VZ3A 2XJQA 2NMNA 3LPFA 2AC1A 2R043 1AYN3 4TSVA 4Y24A 1UW8A 3SCHA 3IWZA 4GJYA 5JAXA 2R32A 1KGYA 3UL2A 3IAPA 4KWJA 4XFGA 3PTYA 4DUXA 3WW2A 1G9DA 3MUY1 2NQYA 2W46A 5DAXA 2XJPA 1C3HA 1CIYA 1OT5A 1F35A 3GGLA 4HVRA 4IV1A 4XURA 1Y4WA 2H0BA 4ZONA 3O12A 1AR82 1OI6A 2XJVA 5LBFA 2P3JA 5A33A 3FLPA 3ZYJB 2H0VA 2XH6A 1K5MC 1QOTA 4QX0A 5DUWA 5EYYA 2D6OX 5FFOC 2A3XA 5FMBA 1FOD1 2VY0A 3GDBA 4KMQA 2A3WA 3LEGA 3N9PA 1GU3A 2A6YA 3USUB 1PIV2 4GMP1 2QJVA 3J26N 3LE0A 1IHMA 2ZS6B 1PO22 1S0IA 1WWYA 4MXVA 5CFDA 3SEPA 4HONA 1DP0A 1RUD2 1VBC2 5CFCC 4CDQB 1DCSA 5CNAA 5A7OA 2VXRA 3J7NA 2DV9A 2IXKA 2RS53 3IIAA 4YLZA 3ZPOA 4YPJA 3MICA 2WZR1 3URFA 3J8F2 4IEZA 2W92A 5FMCA 1PM4A 1QJZA 3L9JT 1Y9QA 4O9GA 1R64A 3WY6A 2WC2A 4GAZA 3VHRA 3WW1A 1CPMA 1LGNA 4RQPA 3B5LB 2GNDA 1H2LA 1UU6A 2BP6A 2NMOA 2AENA 3ZIWA 4WM8A 2PLV2 4EWAA 5JUVA 3MLKA 1ODMA 2LRPA 2Q8EA 4MG2A 3LFMA 1NY72 2OS2A 3HEIA 4S2FA 5A80A 3ZFGB 1TEIA 2JDHA 1RUC1 4XQWA 3DYOA 3AZYA 5K8SA 4Y1UA 5FZMA 4XFIA 5FZEA 1LHVA 1X82A 2VNOA 1J3RA 2ZKNA 4RS5A 5FO8B 3NNJA 1PIV1 5GZGA 3NKTA 4J25A 4Y5SA 1GNZA 1CAXA 2BTVC 4KL1A 4IV1C 2B45X 5A7WB 4CDQC 2GC2A 2GC3A 3SLIA 4WVMA 1VBE2 2R062 1KFXL 4GKYA 3P5BA 1LCLA 1MACA 5T5OA 1G9BA 4FSJA 4PI0A 3THTA 3ZXKA 4Q29A 4YWAA 3IN9A 4BQ5A 3HWJA 2VC9A 1S0CA 1X50A 2Y0IA 2VAUA 1W6PB 3B9CA 4N53A 2UYBA 2E63A 2CL2A 1SLBA 1YO8A 5EP9A 5DUXA 5FLHA 5LBCA 2XKOA 1ZRIA 4F3JA 4Y1VA 3WQBA 4UFLA 1EY2A 5BNNB 2ZGPA 4OI1A 1VBA1 4CP9A 1JYWA 4KWUA 3MI8A 2B46X 2W47A 1GICA 3C7FA 1VMJA 2PTMA 1VRBA 2ZGTA 3WF1A 1H8TA 3OBAA 4XETA 5FYMA 1Q56A 4JKKA 3M2MA 1UX6A 3POBA 4ISQA 5J96B 2JECA 4IEWA 4PF1A 4LORA 2B39A 2YPDA 3VKLA 3D82A 3KHBA 2QFEA 5CVRA 3GBFA 4Q27A 5K0UA 1DU3D 1NE4A 3TOJA 1U5XA 4MADA 1VB4A 1ZBE2 4Y1XA 4B7EA 3BB6A 3V0BB 4W6XA 3ZN4A 1MS4A 1DG6A 2JDAA 1PMIA 4DRVA 4NHLA 1UN1A 4L8QA 1UD1A 4QGLA 3AP6A 1VBA2 4URTA 1VBC3 4BLIA 3PVBB 1V6KA 2VQUA 2ZEWA 3CDZB 5EQUA 3R6SA 5FOBB 3B9IA 1QXPA 3WG1A 2DCKA 1QIQA 2QQIA 2VD7A 4CDXB 1IG3A 2LUWA 2E32A 3WDXA 4Q4Y2 4I3GA 5IUQA 5I8SA 5F7UA 2GH8A 5JDBA 3PIGA 5DG2A 3WNOA 2WYSA 4WVZA 4P9JA 2ZEYA 1WZXA 1VBD2 5EJ1B 4XILA 2OVUA 1EP0A 5GLVA 5IJRA 2O8QA 4CEYB 1NQDA 4OHZA 4CCNA 4EZHA 1RMU2 4QKNA 1LRHA 3N9NA 4BDVB 5M0TA 2HWF2 3U4XA 3TNPB 1ENRA 5JOXA 5LCWL 3KVBA 1CPNA 3WP5A 4GH4B 1HXS1 1Q5OA 3TEWA 4R4ZA 4RS5B 1FATA 2DWRA 3UKNA 4JRAA 1NX9A 1AYN2 3C7OA 2G9GA 4XJUA 4A2UA 2RS12 5F8PA 5HI0A 4GH4C 4RSUA 3IDBB 2W52A 4XUOA 5F3GA 1CX4A 3VBOC 1R1A2 1DQ0A 4A41A 3VZNA 4Q4X2 2FDFA 3LKJA 3WG2A 3S6PA 1O3RA 1BEV1 1LGBA 5LA9A 4WM8B 4KGQA 3NNGA 4JHZA 4W65A 3ZR5A 4MGIE 3VHPA 2ID4A 1AJOA 2EICA 3DECA 3SKVA 1YJKA 2YFZA 1U0AA 1CJDA 1G6NA 1JOPA 3B69A 2V73A 1G86A 3ZIXA 3ZXGA 2CYFA 4GWIA 1HRI3 3JBG2 3O0WA 4CDWA 2I74A 5LK5A 4HETA 4ZU7A 5FJKA 4A4AA 4OI0A 2VCMA 3LF7A 3EHKA 4O65A 3VBSB 1PNGA 1RUD1 4ZS2A 4ZKTB 1MZEA 1GZ9A 1I6XA 3LDKA 2D5HA 4DZGA 4COYA 2P5BA 1CESA 1EV13 1OD3A 4ASMB 1N3QA 3V64A 3THCA 2HWE3 5IFTA 2A6ZA 3VB9A 1AYM2 1EPWA 2GN3A 2EIBA 4PIYA 5FP4A 2R0FA 3ZYPA 3POSA 3GCXA 4KG0A 4B8EA 1RJ7A 4ZPIA 2DU1A 1W8TA 3MIEA 1VBA3 3H42B 2AZ5A 4FPCA 2WS92 3RGBA 5CBLA 4R9CA 5GJ6A 2VVFA 3KZ4C 2XJTA 1JI6A 1OD5A 2RM22 3M3EA 2ZCWA 4LBMA 4W6WA 4DY3A 5KXDA 3DL3A 4WZFA 4DRRA 4XHBA 4XE9A 3ZFGC 2QQJA 5FIXA 1ZZ9A 4N8MA 2K46A 3POIA 4C1XA 4LHNA 1LOEA 3RZGA 5DN2A 3AKQA 2CGPA 4JGYC 3GJAA 3DEMA 3ME2A 1AX1A 4UWDA 4BQ2A 4D6QA 2VXJA 1NAEA 1HN1A 1W2UA 1WLWA 2EXIA 1VBD3 4IE0A 4IV1B 4NE9A 5E88A 1ZBA1 3D5OA 3P3NA 2KA3A 2YPJA 3VBRC 4AVBA 5I8TA 1RUJ3 3U78A 5B4XA 5JXIA 3UKVA 4Q4Y3 1VALA 4HZFA 1PVC1 4LXLA 2LM3A 3VBUB 3ZN6B 5EZWA 1YQ5A 5A1FA 4P00B 4AYUA 5FY1A 1VJ2A 3CKHA 1A8DA 2YUEA 5FYUA 1REFA 5FY0A 1GUIA 4AEDA 1K5MB 4QPGA 3IBMA 3HIFA 4Q4V1 5LRRA 1ND2A 2ZHKA 3OGJA 1SBDA 1MPXA 5BUVA 4QDQA 4A7ZA 2XPJA 1B35A 3LEKA 4Q4W1 1POV3 2GMMA 4GMP0 4YNIA 2WQZC 1GKBA 2YXSA 4CCDA 3CL1A 2BBAA 3PVNA 5FO7B 3FHIB 1IQAA 1OA4A 4IE5A 2VNRA 1JYTA 4HOOA 5AVAA 3RPQA 4LO8A 5FOJB 5L9RA 5F2WA 2HWB3 4Y20A 2PLV3 2BNNA 3ZO0B 2XB6C 2P3IA 4XXPA 5CB7A 4AEDC 1NA1A 2B9UA 4YVWB 1UZWA 1YQ8A 1QJEA 2VZTA 1GWLA 3E5UA 2RM23 4LKDA 5ANQA 4JGYA 2VZQA 1JUIA 1YFXA 3A23A 3EYPA 4MHRA 4XACA 4BB3A 4FBFA 2OW4A 3DPRC 1GP4A 2RS52 5ERLA 1V6IA 1ZZ7A 4DXRA 2QVSB 4CXXA 1GOHA 1UOJA 3ZSEA 2VOKA 3GYDA 5FMOL 3AP5A 3POEA 2GALA 4LLOA 5A7SA 3U1XA 3PU3A 1SACA 5H9QA 2Q1FA 2QQOA 4YW2A 5JXJA 4OHYA 3AYCA 5F37A 3ZYHA 1AR61 2QCSB 4GWMA 4HPKA 1FPN3 4CPBD 2HEVF 5CFDC 1C1FA 2PYTA 2WT0A 4MGSA 5DUVA 2GNMA 1O8PA 4CU8A 1J1LA 1RIRA 2VBPA 3KV4A 4Q0PA 1JYVA 2HYXA 5E8AA 1AVBA 3D0JA 3DYMA 1VMHA 4H14A 1ZBE1 3C2UA 2HKXA 2YFUA 4I30A 1JBCA 2P34A 4Q1PA 4QPYA 3ILFA 1YI7A 2NN8A 2HWB2 4Z2WA 1IKPA 2Y8KA 4MSVA 1AXZA 1MEC2 3R4DB 1L7QA 3UGFA 4UW6A 1GOFA 3AMPA 3MFCA 3NJZA 1PVC3 3X29B 4R9DA 1N3OA 2E51A 4JGYB 1OQDA 1UKGA 5C5TA 2VZPA 5FLJA 3ZFFB 2WFF1 3QACA 4RHV2 3RWNA 3WF4A 4B4QA 3VZMA 4BQ3A 5C33A 3E6BA 1VBD1 4NR1A 2IXCA 3RZMA 4C0BA 1WMDA 1WCUA 3RS6A 4OUEA 4NIDA 5GM0A 4BK4A 1T6BX 4M3CB 3OB8A 5EHDA 2VJXA 3RMXA 2XXZA 1W6OA 2CDPA 3RRDA 1AYM3 3ETQA 1HJGA 1RITA 1ENQA 1Y7BA 5FZDA 1N1YA 4XBNA 1C28A 4ZY9A 1W3XA 1MZFA 4U2AA 5FPZA 4ZXEA 1AYM1 1PMJX 4QM8A 3ZLIA 3Q9OA 3O1UA 4GQ7A 5L7OC 3FHAA 1RUJ2 1TMF3 4YSFA 2OXBA 4FFHA 1OLRA 4NROA 3LAGA 1AHSA 2X53S 3EBRA 1G9AA 1QJU3 4JKMA 4TZDA 4KH9A 3F95A 1K3IA 2UU8A 3S5QA 4JDOA 2ERFA 2PAKA 4QX7A 1K45A 1BBT2 1VRH1 2WO7A 5FPAA 4CEYC 1RB8G 1J3QA 4QQLA 2ZMLA 2W3JA 4D6RA 1AR93 3APBA 1ND3A 4WVVA 1JH5A 1V6NA 5FXXA 3VBUA 2WABA 5JXHA 3N7LA 2VULA 5DAVA 4QDSA 2CGNA 4AFAA 2PHFA 5B4NA 3EJKA 3H3ZA 3ZMNA 4ARXA 4AW7A 1WLTA 3LOBA 1W28A 2PHRA 3JD71 5FPBA 4NHMA 2KR2A 2RS33 5F6KA 2BW8A 5IFPA 1S2KA 3FBYA 4LIUA 3TB0A 5C9AC 3UETA 3I2FA 2VUAA 1HKDA 3I97A 4RN5A 5BNPA 2WZ8A 2W1SA 1E57A 1KQRA 1OURA 1PK6A 3VD9A 3JZVA 4UBGA 2EVXA 4AI8A 5F5AA 5GALA 5DZFA 2WZR2 1AJKA 1KJLA 3R4UA 2WDBA 3OPWA 4HG6B 3ZOIA 5BXXA 2ETEA 2D3PA 3R05A 1SBFA 3N36A 1W9FA 1BVVA 2B5HA 4PDWB 3WG3A 1EV12 1BLZA 4B3NA 1O5UA 5EV7A 4FXGB 3ZN6A 3RDIA 1SFPA 1ULGA 1SHWB 3OUIA 2W5FA 3RNSA 1OXCA 2ZBJA 1V9U1 4N90A 4R8HA 3ZKYA 3KCXA 4QGNA 1H4HA 3GHNA 1RUG3 1CAWB 3OTFA 3IPVB 3VL8A 4TN7A 3H1WA 3JQXA 3OY8A 3Q8EA 2VECA 1NE6A 1MZ5A 3ZYFA 3J7MA 4DQAA 3JUUA 4LJHA 4PBPA 3JB8A 4MYEA 1H8TC 4LBQA 1G9CA 4GD4A 4W50A 4XF9A 4EE2A 2JG9B 4XJAA 3ZXLA 5LB6A 4L0PA 4IEYA 2JDKA 1QQP3 4AQSA 1UPIA 2A3YA 1ZRFA 5FZIA 4OUMA 2YG0A 1TME2 3BOPA 3OSDA 3TEYA 1RYYA 1QU0A 2CSGA 2RHPA 4GIQA 4IUGA 4EN9B 2TBVA 3IKWA 5DUUA 2TNFA 1QDOA 1GSLA 3GZEA 2DFBA 1O4YA 1RVF2 4COZA 3A4UA 5F3EA 4RL7A 3OG2A 1G9FA 1FOD3 3QBQA 1IGOA 2DBNA 3K3OA 2E33A 3O1SA 2RDSA 2D43A 4NN0A 1F4HA 1ULPA 5ANNA 1VBC1 4AVCA 5DABA 4B29A 2OPWA 5HCFA 2MNGA 1EUTA 5E6HA 4CA9A 1B09A 4K20A 2VQAA 3ELNA 5C3PA 5JOZA 1BXHA 1LULA 2QE3A 4CP2A 3FBMA 2OKXA 1IS5A 2WYFA 4QXCA 4D3WA 2QTWB 1HDKA 3ECQA 2WZEA 1WD4A 3ILNA 3T2TA 1OQEA 1XB9A 4YVSA 1GZWA 1W6NB 3FN9A 4S2GA 2WRAA 2PQQA 5CYYA 1H1AA 3WVJA 1G8WA 1L7LA 4ZZ8A 4P02B 4A44A 4CCJA 1XQNA 3HQRA 5FLIA 4FAHA 1FXZA 1BK0A 1UY1A 1HRV1 3ZPYA 3OGGA 2ZXQA 3CBNA 1OQ1A 5IVVA 4XUPA 2V4AA 4BWOA 4UFKA 1DYPA 4ORFA 2LROA 3TYJA 1J83A 4IEXA 3MFAA 3GHMA 2YZ4A 3PMEA 4L11A 1HV0A 2RJKA 4DIQA 1OH3A 1DLLA 4XTMA 3E1F1 5DAQA 3S57A 3LB9A 2CAUA 3KV6A 1X9TA 1UZZA 4BM8A 1O91A 2D3SA 1UXZA 2CTVA 1ZA4A 1LECA 4CCCA 3HT2A 5BNNC 2ZGQA 3AL5A 4XUNA 2P3KA 3CLPA 3MYXA 3CNAA 1RXGA 4XQDA 1ASJ3 3G6JB 4W6YA 5C8WA 2FD8A 3BU7A 2XBO3 4KG8A 4MZUA 3VDDC 1PGW2 2D98A 5KXEA 1N1TA 2B4KA 4UXAA 4Q8KA 4MX3A 1RUE3 1LJ7A 2WAOA 4XMAA 4ES9A 2RR12 2Q8DA 1CVNA 5FYIA 5G05L 4ASKA 3GM8A 3H3UA 1RUD3 4A6OA 4XDPA 4HL0A 4QX8A 4NPRA 4C90A 4XF4A 3MBWA 4LO4B 2RS32 3M7AA 1CAVA 4UFIA 4ATEA 3DXUA 3LFIA 4JC1A 5FCCA 4Q4V2 4Q0VA 1QJY1 1AR83 1HB2A 3ETPA 2F4PA 2Z42A 2WNVC 4Y1ZA 4Z2AA 3IIIA 4I02A 5E16A 1UL9A 4O9EA 4N9HA 5KHHA 1V00A 3WZ1A 3TEZA 1RC6A 3DUIA 2BFUS 1VE0A 3I3BA 2CAVA 2YMZA 1UX7A 1RHI2 2ZPXA 3INAA 5FY7A 3E5QA 5FZHA 3J7HA 3K2OA 2EXKA 1TQ5A 5FYHA 4AXOA 5C9AA 1NY71 2Z2SB 1ZRRA 5H9RA 1LHNA 3U07A 1D2SA 1DQ5A 1FNZA 1GZTA 1LKNA 5DAPA 5FZ8A 1LOFA 4ASLA 1D0GA 4QMAA 3M70A 4E9KA 5LA2A 4R9BA 4RYDA 4CZSA 3ALQA 3F2ZA 4QPIA 3BTAA 2QQVA 3BKZA 1MS1A 4DUVA 3FL7A 3BTZA 1T6GC 1XE0A 4GA9A 4YM3A 2WT1A 1S4CA 1ZZCA 5F1RA 1GWMA 5GZCA 4N53B 2P17A 4N7IA 5FY4A 2XVLA 1WMEA 5IK7A 2YY1A 4XAEA 1C8M3 4PI2A 3GZTB 3WUDA 5FR3A 4BXFA 2G4IA 2BU9A 2R16A 3WNKA 4Y26A 1NG0A 1URXA 3KMHA 5FY5A 3V65A 5BNOC 1BBT1 1VRH2 1D2QA 4LQRA 1UU5A 3ST7A 5FYZA 1K5JA 3VBSA 1J58A 3PUIA 2BVVA 1FOD2 1MR5A 3PU8A 5CISA 5A7PA 3GCWA 1MEC3 3SC7X 1XNBA 3U37A 4AL9A 3AYEA 1SLIA 5A3MA 3HQUA 3VZKA 2XGXA 4QKDA 3WNLA 4LPLA 4QQHA 4AF9A 3POWA 4QB1A 4KWLA 1H2KA 1H4GA 2XLFA 5FP9A 3HD8B 3POGA 4OHWA 2BEOA 1EUUA 1R1ZA 5FYYA 4HFSA 2D3RA 4J1WA 1NLSA 3ZM8A 4JKLA 5FZKA 2FDIA 5KHGA 5IVFA 1LOBA 3B00A 3HBZA 2PXJA 2B8MA 2ZZQA 3VBOB 1PZ7A 2JDUA 2YBPA 4TWTA 2WLQA 1WBFA 2YBKA 1PMHX 2VZRA 5GLWA 3WDTA 2Z4FA 3JD73 1CONA 2JEMA 1SBEA 1JW6A 1AX0A 2JWPA 5L73A 4AHZA 1D4M1 1IS6A 1GWKA 2OQ6A 1NCQC 2GU9A 4PT6A 5FZ1A 2VMDA 2VM9A 1LENA 5A3LA 4LIVA 2MHFA 1YCIA 1OBNA 4CDUC 1NCRC 3M3OA 1FV3A 3P1IA 4XCBA 3ZR6A 3BUCA 4KU7A 4P08A 3QOPA 5C9AB 1H6YA 4M4RA 1UYYA 2V72A 2W95A 1OMIA 1Y9MA 4LHLA 4IESA 3TN91 1HRI1 3FUQA 1QJX2 2WT2A 3MV01 3SXWA 4EV0A 1C5IA 1ZZ8A 5HBAA 1XRUA 1A3KA 5FZOA 5LEJA 3HN1A 4LA2A 5KHIA 5L7OB 2GN7A 2Q0AA 2JDZA 5HV4A 1MS5A 5JSRA 2WNUB 1RHI3 2WZPP 4GH4A 4MH0E 1AXYA 1UIJA 3BI3A 3DPRA 4LT5A 5EIYB 5EXOA 2DUQA 4NHYA 1ULEA 5FAXA 1IS4A 5C71A 5DZEA 2I07B 5CG8A 5J98B 4OZOA 4BQ4A 2ZGOA 4OUSA 3MPBA 5CKNA 1Q3EA 1H8TB 1X8MA 2QQUA 1LOFC 1JZ7A 2JD4A 1ALYA 2JG8B 1GP5A 3NSTA 2VGDA 4LULA 4I0AA 4LLFA 2RS13 4CDXA 1DZTA 2XKPA 4AEKA 5L7OA 1FMD2 3KD4A 1IG0A 2GSYA 1LHWA 2XUEA 3ACLA 1FPN1 2VMCA 2ZX0A 3UESA 1XBFA 2WO1A 3KF5A 1Q8OA 4AAXA 2JX9A 3AMMA 1S2BA 3N3HA 4QQPA 4QU1A 4E4HA 1XSRA 3J8F3 4RGGA 1ULOA 2BFUL 2VMIA 2VVEA 5DDJ3 2UYAA 3RYPA 1RMU1 4DNYA 2VW2A 1WGPA 2XWJB 1LHOA 4R52A 2FHRA 2DVGA 3RJ2X 1DF0A 3ZDSA 5IYYA 4BPZA 1HB1A 2ZGLA 1KFUL 2ZGRA 1AL22 3NL1A 3AC0A 3AZVA 4KGGA 4P5HA 3RJRA 4QQOA 1KD7A 2ET7A 2HWD3 1LESA 2VUDA 2DBIA 4EN6B 1ZVFA 5JSOA 4D69A 1BQPA 1C8M1 3WQ0A 3I3DA 4CP1A 4ZS3A 1GQHA 2JKXA 2O8OA 4OMDA 4ES8A 3B3QE 2QUOA 5T50A 4XIOA 2RS51 1H8VA 5IVBA 3WOGA 2JB8A 4UFHA 1PGW1 3ZXJA 2JENA 2JE8A 2RE9A 2UWAA 3Q8FA 4EROA 1YI9A 3AM2A 4OHXA 2C24A 2PLV1 4P9IA 3C3VA 4F8AA 4YVWC 3FLTA 3T2PA 3ZMOA 4XJ8A 1XXNA 4CPBA 4V1PA 4IXLA 5KXBA 1VAMA 1YJLA 4XCAA 3UGGA 1QMJA 1QH7A 3UGHA 4AVAA 5FWEA 3EXUA 3WF3A 4JAAA 1Y9GA 1XNCA 2OIIA 4EYUA 2KXLA 4RQPC 1O6UA 3MO4A 3AJYA 2J1TA 1HQNA 1OF3A 1QOSA 1UWWA 4M3CE 2W08A 4QB6A 5LBEA 2O1QA 1W2AX 1XE8A 4HSJA 3LPGA 4RFRB 4RFT0 4IL7A 4TYSA 1JTZX 5FV3A 4N43A 3VDCA 3WDWA 5A3PA 1W04A 2RDNA 1W99A 3SEEA 1HB3A 1WUVA 2FCVA 5FZFA 2JDMA 1R1A3 2CHHA 4AVTA 5A3TA 1MS8A 2YBSA 3Q8CA 3LDBA 3SH5A 2HWC3 4CDWC 4NUBA 2ARXA 3I7DA 4QPIB 5FZAA 4UFJA 4YW4A 4QB2A 3S30A 2D93A 1GQPA 2GZWA 1U5YA 4SLIA 4Y1YA 4CTEA 4FQ4A 2WNVB 4A3ZA 1JYIA 4K8RB 1DYKA 5FYVA 3USSA 1X7NA 3POJA 3NV1A 4M4PA 4BQWA 5AC93 2YGLA 1VAKA 2GNBA 4FPOB 4B1LA 5F5IA 2WQ4A 2CGOA 4CP0A 3KV5A 1JZ2A 3S0MA 1NA1C 3JXSA 4NRMA 4COVA 1YQCA 3AFGA 4DUWA 1HLCA 3VZJA 1C5HA 3LA2A 1DQ2A 5T3NA 1STMA 1IS3A 2XMLA 2R0HA 3JB4C 3O7OA 4Y3OA 3WQ7A 2ET1A 3MZHA 1DGWA 2IFWA 4O7XA 5FPLA 3SH4A 3J4UH 3WV6A 4NO4A 4EQVA 2VCBA 2VUCA 3O0XA 1COV1 3WD5A 4F83A 5IW0A 3BIWE 3T0BA 3I2KA 4EWDA 1NCRB 2HWE1 5GZEA 2R7EB 5C8CA 4EN8B 5FZBA 3RYRA 3A0KA 3ACGA 5GLZA 3T0DA 2IZWA 3WDUA 2D6MA 1AX2A 2ORZA 4YM0A 3FJSA 2ARCA 1YQ2A 5KBFA 1OUSA 2D40A 4HVQA 1ND2C 1UMZA 1AR62 4P9WA 2PHWA 1CGPA 2Y64A 1PVC2 1S55A 1ZM1A 3BYWA 3VKFC 5G04L 3ON7A 2GMPA 3FFZA 1V6OA 4IV3B 4SBVA 3AB0A 4PF5A 5D2AA 2OPKA 2WA4A 1H2MA 1VLNA 2HBUA 3NNFA 1RXFA 4UAPA 4KBZA 1WMXA 2WNOA 3VKMA 4QPWA 3I3MA 1LEMA 4JX0A 2WNUC 2VMGA 4P14A 2HWD1 2EXHA 4PDWC 1BCXA 5DDJ1 3GF6A 2C4XA 2QZ3A 3W5NA 3V0AA 4ITCA 3ATGA 3IMNA 3K4AA 1RUNA 3AP4A 1W6OB 2R49A 5F39A 4QM9A 5KC6A 5I8YA 4KI5M 4LBQD 1ND3C 4D7SA 4I0BA 2JG8C 4OYUA 1D4M3 4MVTA 1IPSA 3TNQA 4M01A 2F6BA 1BEV3 3AXDA 1GLHA 1PO23 2DCYA 1LHUA 1GV9A 4XF1A 3DV8A 3T09A 1W0OA 1OPOA 2PHXA 2WJSA 5LRSA 1XJAA 4FT8A 4AHWA 3HR9A 2J1AA 4YZ5A 1NCQA 4X8PA 2DFCA 4NJ4A 4BISA 3WX5A 3M3CA 1NLRA 4BOWA 5BYNA 4FTSA 1DGRN 2YC2A 1DGLA 1W6QA 2GMEA 1RUG1 2VPVA 4OULA 3K46A 3UJOA 4AI3A 3ZSMA 1W6MB 3ZSJA 2Y6FA 4FPKA 4RR3C 5C6CA 4IQPA 4XUTA 1JYCA 5E89A 5F3CA 2QKDA 1RHI1 2PA7A 2BWAA 2JDPA 2A6VA 2VNGA 1GOGA 4BXSV 3N9QA 4HVOA 1YUDA 4D94A 2VNVA 5J1XA 1YFYA 1F9KA 4CDUA 1N1VA 4JQRA 3KVAA 5A7NA 2LALA 4W4ZA 4FPJA 3CHXA 3VUOA 1DYOA 1UOGA 3GXUA 2RJ2A 3ZN5A 1ACCA 3TN93 4K21A 4LKSA 4CEWA 5LWBA 5T55A 3QCWA 4BHPA 1QJY3 4QXKA 2JDNA 1ENXA 5EJZB 5JVVA 2DUOA 1RUI3 1V0AA 4M00A 5DAWA 2J1EA 2JICA 3DF0A 3NNLA 2JKBA 3KHCA 5T5JA 4L92A 2R30A 4RR3A 1LAJA 2QZ2A 2AEYA 2J42A 2WR9A 1UOFA 4NIIA 3WCRA 3QLQA 3J9SA 5FJHA 1RUE1 4C0HA 2AYHA 4YW7A 4NRQA 1IPJA 1RUF1 3H8RA 4LKFA 3U4SA 3WQ1A 5BNOA 1CX1A 1XSQA 4Q2FA 1MS0A 1H30A 2X5IC 4MOAA 5F5QA 1SMVA 3A0NA 3IT8A 1V6MA 2XUMA 2ZJCA 3M8LA 1VB2A 3D6EA 5A1AA 3B01A 3QD6A 2P4EA 3IPVA 4FPYA 4XFCA 3O1PA 1GQGA 5A3NA 5DDJ2 2MPFA 1TMF1 5I93A 4FO9A 4HKOA 4ZU5A 3OBRA 1H6XA 3POYA 4HK8A 3RFRA 3KGLA 1NOVA 4FI9A 3CF6E 3BN6A 1HRV2 5JIUA 2DTWA 2KM2A 4MLOA 1REEA 2E6VA 2VTFA 1B35B 3LEIA 2JE9A 2ZX2A 3WINE 3AFKA 1ENSA 5D1IA 5FZ7A 3ZXDA 4JTNA 2GDFA 2PELA 3KV9A 5FUNA 1W9TA 2QDRA 1CAUA 4PQQA 4IV3A 4BMEA 4E2SA 4CU6A 1Q8SA 1I5PA 2BNOA 4WZCA 5T5PA 4K6BA 3ZYBA 2ZMNA 3D4KA 1JN2P 3LZZA 2RDQA 3K77A 3AP9A 2VMEA 3THPA 3KWVA 4HK9A 3MIBA 1WCQA 4H3WA 3N7KA 1ASJ1 2I45A 4H7MA 3BTXA 1XYPA 4BE3A 1V70A 3FFQA 1A34A 4L99A 1NZCA 1UF2C 1Z78A 3NJVA 3VBFB 3WDYA 2EIGA 3I2GA 4HLTA 2HWE2 3OEBA 1PM7A 3BU0A 5F5CA 1JXNA 1QY4A 5IAXA 2YHJA 2VW0A 4XJWA 3U10A 3JQWA 2PHTA 2AEZA 3OBTA 5D8AB 1CZVA 3EB7A 5D8AA 4E4ZA 3AKSA 1B35C 4EWEA 2R071 3H8OA 1APNA 2WA3A 5I91A 5J7MA 5FBZA 2AGSA 5A1LA 5J37A 1PO12 2VZUA 2CY6A 1HQWA 1F31A 4QGMA 3ABZA 4ZZ5A 3H8XA 3VBFA 2RV9A 1QKQA 1RUE2 2VO5A 2WWUA 3O1TA 1JOBA 5FK8A 4DFSA 2W1UA 4IE6A 1ULFA 1JZ4A 2PFWA 1XC6A 4HANA 1E5SA 4M3CA 3WUCA 3PUQA 4AFMA 1CAVB 3P6BA 1SPPB 4CXYA 4A7KA 4HKWA 4XC9A 2HEWF 2HWD2 2Y6GA 2RMU1 2VVDA 1ZZ6A 2XG3A 2CV6A 2RG4A 2JXAA 5ACA2 4FOQA 4NWVA 4FPFA 3WT3A 5JMCA 4PQ9A 1JODA 2RMU3 4JCKA 4WVWA 5IT6A 1PO11 2ZGMA 5A70A 2C6SA 1UU4A 4QXBA 4YZ4A 4OQ9A 1M06G 1COV2 1US2A 4RS5C 5F9TA 5J48A 3I59A 2NZ9A 1W03A 3ENRA 4YW5A 2H6BA 4YGBA 2XDVA 1RMU3 3IM0A 5FY8A 5C70A 4LKEA 3BPSA 1LOAA 5HXVA 2Y34A 4JRLA 4RGAA 1TMF2 4HN1A 3G7DA 4XDOA 1UZ0A 4YW6A 4ARYA 1W8OA 3BCWA 2YV8A 2X5IA 5CIRA 4CCMA 3HBKA 4DINB 4YGEA 1MQTB 4G9SB 3I8TA 1CWPA 1DLCA 2ZEZA 3IMMA 4QU2A 3FZ3A 4QX1A 1TZOA 3NAPB 1DZRA 1WMFA 3N35A 4WM8C 4YW1A 1P8JA 2YU1A 2C9AA 4AI1A 4FAGA 4FFFA 2WKKA 3H1MA 1HJFA 2ZABA 4HPKB 1SLAA 1SDDB 2RS11 4LO7A 4XBQA 4NPMA 3ZFFA 5FPXA 2VCAA 3THDA 3NAPC 2WWSA 1KDMA 3UV9A 4JQTA 1C8M2 2RR13 4MGTA 5FPUA 3OF1A 4IE7A 3CJIA 1JS9A 4FVVA 4LBLA 2X8KA 1FYUA 1WCSA 1EPZA 1OVPA 4LMFA 4CDWB 1H1IA 4N7UA 5LW9A 2Y6JA 1ZBA3 1JZ3A 4UT5A 4GULA 2HYKA 1RUJ1 2XJUA 4AVSA 3EQEA 4DEQA 5JI9A 4CEWB 4ZXKA 3WNNA 4UFMA 4K7JA 4XEZA 1BMV1 3VZLA 3OY8B 3AVSA 1TME3 4LOTA 4Y5TA 1A78A 5JI7A 5F2SA 5JOYA 2BV4A 4FTEA 2D5FA 4AK3A 1EAH1 2GC0A 3UJQA 4NIAA 1OC1A 3KT7A 1UNBA 2ZACA 5FZGA 2DTYA 2E31A 4Z82A 2ORXA 3PL0A 3I3EA 1OFSA 4HT1T 4XVHA 5C3QA 3PTRB 5BNPC 1J3PA 2N7GA 2W1WA 4ZU4A 3SHRA 2JIGA 2FZ1A 1JYNA 2YC0A 3RZLA 4XIKA 4Y4YA 1SLTA 3DCQA 4OCTA 2SLIA 3EMRA 3B94A 3NMBA 4CEYA 4GB31 4FP3A 2BVBA 3H3LA 2BOIA 3VDDB 5C8CC 1X8EA 1UO9A 1OF4A 2WAAA 3DPRB 1QJU1 3LA7A 4A7YA 5LASA 5I0RA 4K1YA 1RL3A 3SH3A 2Q8CA 2BGCA 5KHJA 4LE4A 1DDLA 2EIDA 3RI9A 1XOYA 4IW3A 2H6CA 2ZTNA 4QKBA 3VBUC 5FBJA 2FCTA 1N47A 1GNHA 4J1XA 1HN0A 3DN7A 3SITA 1S0DA 4PDWA 4AWDA 2DURA 4I0WB 1PO21 3MIHA 4OLLA 2W1QA 1BJQA 1D4VB 3AL6A 2YC4A 2IXJA 3D0SA 2HBTA 1ZRDA 3VV1A 3KM5A 1PK6B 4CYDA 2NLRA 1AR63 1UQXA 2GNTA 2WSUA 4NRPA 5BNPB 5IATA 3H1YA 4XW3A 1DGWX 2VZOA 3C7GA 5LATA 1HB4A 4PLNA 2UURA 5DPNA 1SG3A 2WNVA 1SQ4A 4EJRA 1I9RA 4FPEA 1NKGA 4GZ9A 2E7AA 1VPHA 5BNNA 1UYXA 3KQ4B 4N9IA 4XFAA 1SCRA 3I2JA 3IDEA 1DHKB 2GP3A 4YFWA 3HOBA 3M4FA 4K8FA 1VR3A 3WNPA 2X29A 3K51A 5FP8A 1BKZA 3PURA 3ZFFC 5FMOS 1KJRA 2VMHA 2BWCA 4R9AA 5KC5A 2JB4A 3MUZ1 3VBHA 3T1LA 1R082 3T4HB 3U0ZA 1SEFA 5I0TA 4LR4A 4P5YA 3M1HA 4MGKE 3AMHA 3D8CA 4RR3B 3RWKX 1V9U2 2RMU2 4FP2A 2VG9A 4XJZA 5GZFA 1VBE1 3NWKA 1NT0A 3OGSA 3PJYA 4AI0A 5IVYA 4AEJA 4L9BA 5IK5A 4CCLA 4LUKA 4EN7B 1LGCA 4YVSC 5BPXA 4BU2A 4DB5A 4E8CA 2OQ7A 5A6XA 5CA6A 2YB7A 4QDRA 1ODNA 2A75A 4IGPA 4UOJA 3ACHA 3MEPA 4CVUA 3ILRA 3USUA 4Q4V3 1W8WA 4LBNA 1PX3A 2PHDA 1RUH1 1Z7S1 1EAH3 5E1RA 5LY1A 3H8UA 3BOWA 5CFCA 2Y38A 4R4XA 3W9AA 1AR72 1GR3A 2PN5A 5EFUA 5FZ0A 1MS3A 3NVCA 2PQSA 5JXGA 1YWKA 4UW3A 5DZGA 2FQPA 1YQ6A 3BIEA 5FKCA 1RVF1 1FAYA 4YGDA 1XE7A 5T5LA 2XONA 2W68A 3WW3A 2WBKA 4L2NA 3A22A 1R1A1 5HCAA 1I5ZA 4AQ6A 3VBFC 5A32A 2Z5WA 2BBVA 1NCQB 1RGSA 5FZ4A 4CU7A 4ET7A 4QX2A 2XBO1 3H7JA 3IZOA 5JZGC 2IUWA 2VR4A 4E4SA 1NA1B 4YVWA 4MXWB 3WF2A 1RINA 2ES3A 3NV3A 5C4WA 2EXJA 2QNKA 3MF9A 5DXDA 3C8XA 1UCXA 3ZDVA 2D7FA 4LBJA 4P9YA 2HEYF 1H0BA 2K0GA 5F6LB 1JZ5A 1XYOA 2ZEXA 3I2DA 2C9KA 5A7QA 1DQ1A 3MIFA 1DGRA 4GWNA 2CWMA 3BTYA 5SV8A 5JCTA 5L36A 3WP6A 1G7YA 5GLTA 2ADEA 2HWC1 5L9VA 1QQP2 4XXAA 1GYKA 1IZ3A 4IGOA 4QD2A 1BZWA 4F7ZA 2Q4SA 3MV11 3I4IA 1K5MA 2W39A 4PLMA 4QPGB 3VN4A 2NP0A 4H2AA 1CQ9A 1W05A 2XR4A 3RYKA 5JSPA 3AMQA 4CDXC 1KS5A 4LTAA 1PO13 1SFYA 1IPKA 4Q0SA 2AR6A 1XU2A 3OCPA 1CR7A 3NKGA 4LEJA 3DGTA 3N9LA 5FTTC 5T54A 3KB5A 3WCSA 5JZGB 2A1XA 4Y5Z0 4YYOA 2QQLA 1ZNPA 3CU7A 4S2DA 1QWRA 1UIKA 1NYWA 1UAIA 1QNYA 1OH4A 5GLUA 2ZHLA 2X09A 2R041 4YZ1A 1VBE3 2DUPA 3SISA 5K9YA 4X6RB 2WSVA 5FZ9A 2K9ZA 3U14A 4QKFA 3WNXA 4C1WA 1ZA7A 2WFF3 5FYSA 4A3XA 1D7PM 3AVRA 4RD7A 5TSWA 3O14A 3S7IA 1JMUB 2YYOA 1UY2A 3AKPA 3MIDA 2R1DA 3POFA 2Y26A 2JE7A 2UWBA 4MXWA 1ND2B 1OA3A 2BJSA 1KITA 2CWSA 2Z79A 4OVEA 1WCKA 5CZKA 1K12A 3VL9A 1VAVA 4MGYE 2O0OA 1PGSA 1RUH2 1EAH2 4E8DA 3NJXA 5JLVA 1S1AA 1CAXB 2E53A 3PUHA 4LUMA 1UY0A 5J09A 4BYYA 2XQRA 1W9WA 3HT1A 1WKYA 4Q4W3 3BVCA 4QX3A 3ZYGA 4YVSB 2Z69A 4LOSA 4NIGA 3RVHA 1OSGA 5FZCA 2WIIB 5FZOB 1WLCA 4LHKA 4BCUA 1ZX5A 4Q4Y1 1V6LA 2VTXJ 4C8DA 3M3IA 4E2QA 3ZFGA 3H50A 1GP6A 2PAEA 2VMFA 3GBWA 2AACA 5LK7B 2VOTA 2FMYA 5CFCB 1DQ6A 2XL7A 4LO5B 3W58A 3OUHA 2FBEA 4V2VA 1LEDA 2B9VA 3AKRA 3T2OA 4JDMA 3OPTA 1KDKA 3PVEA 5EYXA 1MQTC 2E9QA 5LY2A 5BV6A 3E6DA 4A6SA 3VZOA 5FUIA 5FYBA 4YARA 1RTVA 1X9PA 1X33A 4AAPA 4OHVA 3E97A 1OFNA 1XNDA 1U12A 1FPN2 5HCHA 1DIWA 4WV8A 1Q43A 4AVVA 3KT4A 1LTEA 1O3QA 2Y6KA 1FMD1 2BYVE 2P3YA 2WFF2 3AZZA 5FRAA 1JOJA 5K4LA 3VLBB 3ZYIB 2NYYA 3HNMA 1XU1A 1UOBA 2X05A 3MW4A 4PJYA 3ZXEA 4B1MA 4BA6A 1VBB2 1FV2A 1JHNA 1W8HA 4IEUA 5A3OA 2G19A 3JD72 4X8NA 3ZFEA 4CUCA 4Q4X1 2ZA9A 4OI4A 3FWEA 3O5SA 2XVGA 1NZIA 3T4VA 5ABJB 2XHKA 1N1SA 1UPSA 3PHMA 2B42B 2A6XA 4FPLA 3O1MA 1POQA 3VBOA 2XL9A 2Y60A 5D21A 1ASJ2 2WQ8A 1RUI2 2OT7A 4N43B 5ABJC 3PIJA 1U5ZA 1F2NA 4Q0UA 2RJLA 4NAMA 3RMYA 5JWPA 2W2IA 1FNYA 2P1BA 3O0VA 3B7MA 3TN92 3PUAA 1PZ8A 1OPMA 1EV11 1WLDA 2P6HA 1YFUA 3CJIC 4Q0QA 4AI2A 4DXSA 3HPNA 4XUQA 1RUF3 2R073 4AQ2A 1LR5A 2ARAA 1ZBA2 5LEKA 4B4RA 3ZFEC 1S0FA 4JTOA 3N9MA 1W2TA 4JGZB 3OPZA 2BPA2 5FYCA 1AR81 1GMMA 1W39A 2YDEA 4P9GA 1MVEA 2BQPA 3ZSKA 4BH9A 5CFDB 4JVAA 5FWJA 2XJSA 4BJ0A 1DZQA 3OOXA 5HPOA 4LITA 1RUI1 2ZZJA 3W5MA 3H7YA 1UY3A 3S5AA 4EN0A 1DQ4A 3SCGA 2XBO2 5FDBA 5CG9A 4C91A 1AZDA 3DKWA 4D7YA 3I2HA 4YG0A 1MEC1 1QF3A 1UMIA 1I3HA 3RSJA 5LA1A 1F8VA 3LSDA 4PIXA 3R0RA 3BODA 4NVPA 3GALA 3NRUA 3DKQA 3OUJA 2Q30A 1W9YA 2J1SA 4PHZA 1QXJA 3WP3A 5IHRA 1FT9A 4BK5A 3HMYA 4RGKA 3E6CC 3MDPA 3VDDA 4URAA 4N53C 4WBBA 1HXS3 3K4ZA 5L19A 2Y6LA 4HN0A 2UWCA 3VDAA 2D6LX 5D8AC 1Z7S2 1WCDJ 2QQWA 1BVP1 4XF3A 4UF0B 4JGZC 3OD4A 2B7YA 4QWNA 2Q8OA 4AOCA 4BLJA 1W8ZA 3ITQA 3BGAA 4CP9B 3CZJA 4AE2A 4DEVA 1WA6X 4COWA 4DOUA 2XLGA 2IVJA 1L7RA 4IV3C 3W20A 5CAZA 2Q5TA 4IDZA 3N7MA 5C4WC 5FQ0B 3N7JA 4AZZA 2QDNA 2GH2A 3LQCA 1O3TA 4MO3M 5A3WA 5FMDA 1KRIA 4H55A 3BPZA 2W91A 2PHUA 3CEWA 3PMSA 3KLSA 5H9SA 2WS93 5C4WB 3ZKUA 1OA2A 5K0UB 1TG7A 1JHJA 2R1BA 1PHMA 1UXXX 1RUC3 1JU4A 1C1LA 1UYPA 1PNFA 2QBXA 2VUJA 4Y4RA 4XYXA 1AL0G 4CE8A 1QJU2 5FYTA 1H9WA 4XOGA 4CRQA 5K0UC 1RUG2 3D3AA 2VBBA 1W9SA 3N4MA 2F17A 3I2OA 2G1MA 3U11A 4AFCA 3KQRA 1GNYA 2J1VA 5B2GB 3VD3A 2SBAA 4NMIA 3KT1A 5A3UA 1W8UA 1W6NA 3ZFEB 2RM21 2QQMA 2IXIA 2BRTA 1R091 3WDVA 2HWB1 3WEZA 3PDQA 4QT6A 2W94A 2WZR3 2WWJA 4OFGA 4Q4W2 4Y33A 2ADDA 2ZAAA 1L3JA 1J84A 1POV1 4EZ4A 1SLCA 1TNRA 4P9XA 2VU9A 4K40A 1JZ6A 2XQXA 1TNFA 3RG0A 5BY5A 2ATFA 5KXCA 4LK6A 1W90A 5K7PA 1ZYBA 4KBBA
chains in the Genus database with same CATH topology
2W1UA 3GM8A 1JZ4A 1XC6A 4A6OA 4D0QA 3MBWA 3P6BA 2BGOA 2Y6GA 3A7QA 3ETPA 1CZTA 4Z2AA 3IIIA 5DMYA 1BHGA 3ACIA 2VL4A 2VC9A 2LW8A 3I3BA 4CUBA 1UX7A 1US2A 2W87A 3J7HA 3A21A 3WQBA 5C70A 1JYWA 4KWUA 4ARYA 1UZ0A 1W8OA 2KD7A 3DYPA 1UMHA 2W47A 3C7FA 3HNYM 3WF1A 3OBAA 5LA2A 1DLCA 2ZEZA 4JKKA 4QX1A 4RYDA 3IDAA 1P8JA 2WUHA 4PF1A 3F2ZA 2VZSA 2DDUA 4DUVA 3FL7A 1SDDB 1JYXA 4TTGA 2VCAA 3THDA 4MADA 2JDAA 2Y6HA 3WNKA 3OGRA 2VQUA 3CDZB 2ZEWA 4LQRA 4A45A 2Y6JA 2DCKA 2QQIA 3PUIA 1JZ3A 2E26A 2E32A 2RVAA 4DEQA 5F7UA 3U37A 3WNOA 3WNNA 1TVGA 2WYSA 3WNLA 2ZEYA 4LPLA 5EJ1B 4QB1A 5IJRA 3VD5A 3C7HA 4BDVB 1EUUA 5LCWL 3ZM8A 4JKLA 1XNTA 2E31A 2ORXA 1NX9A 3I3EA 3C7OA 2HLEA 2L9LA 4XVHA 1PMHX 2VZRA 2XOMA 2W1WA 2Z4FA 4XUOA 4A41A 1JYNA 4PT6A 2VMDA 1UYZA 2VM9A 3NNGA 3T2QA 4JHZA 2WN3A 2ID4A 3T0AA 3DECA 1OF4A 2EICA 2WAAA 3SKVA 2YFZA 1XNAA 2V4VA 3P1IA 4P08A 1H6YA 4M4RA 2W9XA 1NUKA 1UYYA 2V72A 4GWIA 2EIDA 2W95A 1O8SA 4A4AA 3ACFA 3MV01 3K4DA 1IQDC 2W1QA 5HXMA 1OD3A 2YC4A 3THCA 5IFTA 3CQOA 2EIBA 3IAQA 2VZOA 3C7GA 5EIYB 5DPNA 1SG3A 5C71A 4OZOA 1NKGA 4GZ9A 1JI6A 1UYXA 1JZ7A 4XZUG 3I2JA 3HOBA 4DXTA 4CUAA 2QQJA 3WNPA 2J22A 3IB3A 2J1RA 5DN2A 2VMCA 3MUZ1 3UESA 2WO1A 4AAXA 3NQHA 1NAEA 1ULOA 1HN1A 3HNBM 4P5YA 2J1UA 3OGSA 2BZDA 5JXIA 5B4XA 5IYYA 4E8CA 2YB7A 4P00B 4QDRA 3AC0A 3WF0A 4UOJA 3CKHA 3ACHA 4CVUA 2WO3A 1GUIA 1PX3A 3I3DA 4D8MA 2BGPA 2VZVA 1K42A 2XHNA 2JKXA 1MPXA 1XPWA 4QDQA 4OMDA 4A42A 2PQSA 5JXGA 2J7MA 3VD4A 5I0DA 5LA0A 3LEKA 1CZSA 2JE8A 2BBAA 2XONA 2WBKA 3A22A 3WNMA 3T2PA 4CU7A 2QQKA 4ET7A 3VDBA 4QX2A 4W8JA 2VR4A 4AG4A 2VZTA 3WF3A 3OGVA 3WF2A 2VZQA 3A23A 3EYPA 3MO4A 4QB6A 2J1TA 1OF3A 1UWWA 4DXRA 3C8XA 2VZ1A 1GOHA 3LPGA 1JZ5A 2ZEXA 3FHQA 3HJRA 4GWJA 3VDCA 2C9KA 3I2IA 1W99A 1T2XA 3SEEA 1F4AA 3K75B 2QQOA 2VQTA 5JXJA 1LNSA 3MV11 4MGSA 4QB2A 1W8NA 2WN2A 1GQPA 1O8PA 4CU8A 4A3ZA 1JYVA 2HYXA 4M4PA 3DYMA 2QQLA 2YFUA 1JZ2A 3JXSA 4TXWA 2C26A 3C7EA 4DUWA 2Y8KA 1OH4A 2X09A 3CZUA 2WO2A 2LS6A 1L7QA 1GOFA 1UY4A 1D7PM 2VCBA 1UY2A 2CDOA 2VZPA 3T0BA 3I2KA 2R7EB 3WF4A 2VCCA 3T0DA 3ACGA 5CZKA 3VD7A 4OUEA 1K12A 2EIEA 2ORZA 4BK4A 1YQ2A 3OB8A 2VJXA 4E8DA 3NJXA 2CDPA 3PUHA 1UY0A 2Y64A 1W9WA 1WKYA 5G04L 4QX3A 4ZY9A 4ZXEA 1PMJX 5JMOA 4UAPA 4CU9A 3FHAA 2QQNA 4QPWA 2VMFA 4JX0A 1US3A 2VOTA 1JU3A 4JKMA 2B9VA 1PX4A 3T2OA 1KEXA 2C4XA 1K3IA 3W5NA 5JR2A 1K45A 3K4AA 5FUIA 2W3JA 4QAWA 2V5DA 4KI5M 4OYUA 2WABA 5JXHA 1O59A 2Y6KA 4QDSA 5B4NA 3CIHA 4ARXA 3HNMA 2X05A 3T09A 2BERA 2J1AA 4CUCA 5IFPA 2YC2A 3UETA 1JZ8A 3I2FA 3I97A 4RN5A 3UNPA 2WZ8A 3K46A 2W1SA 3VD9A 5DQ0A 3T08A 4XUTA 2WQ8A 2WDBA 4HG6B 3SKJE 3CMGA 4UI9L 1GOGA 4BXSV 5J1XA 4W4ZA 1DYOA 1SHWB 4DXSA 3HPNA 2W5FA 4XUQA 3GXUA 4LHSA 2RJ2A 2X10A 4LKSA 3OEAA 5EJZB 1GMMA 2J1EA 2DCJA 4BJ0A 3HN3A 5HPOA 4MGQA 4OMCA 3W5MA 4W50A 1UY3A 4L0PA 1CX1A 2YG0A 3I2HA 1RYYA 1UMIA 5LA1A 4IUGA 4MOAA 5C7GA 2JD9A 1W0NA 3NRUA 3WSOA 2J1SA 2VZ3A 5A1AA 3LPFA 5IHRA 3OG2A 4BK5A 2E33A 1KGYA 1F4HA 1ULPA 3IAPA 3K4ZA 1H6XA 2Y6LA 4DUXA 4FI9A 1EUTA 3BN6A 3MUY1 3VDAA 2W46A 1CIYA 1OT5A 3GGLA 4XURA 2VTFA 3LEIA 2OKXA 3BGAA 3CZJA 4DEVA 3ECQA 4QX0A 1W9TA 2WZEA 4PQQA 4CU6A 1L7RA 3GDBA 1I5PA 4KMQA 3FN9A 3LEGA 1GU3A 3LQCA 5CYYA 4MO3M 3LE0A 3SEPA 2W91A 4ZZ8A 4P02B 1DP0A 4A44A 3K77A 2VMEA 1TG7A 1JHJA 1UY1A 1WCQA 1UXXX 4YPJA 1JU4A 2QBXA 2W92A 2ZXQA 3NJVA 4XUPA 1R64A 1J83A 3D3AA 3I2GA 1W9SA 3OEBA 1GNYA 2J1VA 3E1F1 3VD3A 5JUVA 1UXZA 1CZVA 2QQMA 3EB7A 3HEIA 4XUNA 3WEZA 2W94A 3DYOA 1J84A 2VZUA 2B4KA 1JZ6A 2XQXA 2WAOA 4ZZ5A 3ABZA 2RV9A 2VO5A 5G05L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W1U A;  3GM8 A;  1JZ4 A;  1XC6 A;  4A6O A;  4D0Q A;  3MBW A;  3P6B A;  2BGO A;  2Y6G A;  3A7Q A;  3ETP A;  1CZT A;  4Z2A A;  3III A;  5DMY A;  1BHG A;  3ACI A;  2VL4 A;  2VC9 A;  2LW8 A;  3I3B A;  4CUB A;  1UX7 A;  1US2 A;  2W87 A;  3J7H A;  3A21 A;  3WQB A;  5C70 A;  1JYW A;  4KWU A;  4ARY A;  1UZ0 A;  1W8O A;  2KD7 A;  3DYP A;  1UMH A;  2W47 A;  3C7F A;  3HNY M;  3WF1 A;  3OBA A;  5LA2 A;  1DLC A;  2ZEZ A;  4JKK A;  4QX1 A;  4RYD A;  3IDA A;  1P8J A;  2WUH A;  4PF1 A;  3F2Z A;  2VZS A;  2DDU A;  4DUV A;  3FL7 A;  1SDD B;  1JYX A;  4TTG A;  2VCA A;  3THD A;  4MAD A;  2JDA A;  2Y6H A;  3WNK A;  3OGR A;  2VQU A;  3CDZ B;  2ZEW A;  4LQR A;  4A45 A;  2Y6J A;  2DCK A;  2QQI A;  3PUI A;  1JZ3 A;  2E26 A;  2E32 A;  2RVA A;  4DEQ A;  5F7U A;  3U37 A;  3WNO A;  3WNN A;  1TVG A;  2WYS A;  3WNL A;  2ZEY A;  4LPL A;  5EJ1 B;  4QB1 A;  5IJR A;  3VD5 A;  3C7H A;  4BDV B;  1EUU A;  5LCW L;  3ZM8 A;  4JKL A;  1XNT A;  2E31 A;  2ORX A;  1NX9 A;  3I3E A;  3C7O A;  2HLE A;  2L9L A;  4XVH A;  1PMH X;  2VZR A;  2XOM A;  2W1W A;  2Z4F A;  4XUO A;  4A41 A;  1JYN A;  4PT6 A;  2VMD A;  1UYZ A;  2VM9 A;  3NNG A;  3T2Q A;  4JHZ A;  2WN3 A;  2ID4 A;  3T0A A;  3DEC A;  1OF4 A;  2EIC A;  2WAA A;  3SKV A;  2YFZ A;  1XNA A;  2V4V A;  3P1I A;  4P08 A;  1H6Y A;  4M4R A;  2W9X A;  1NUK A;  1UYY A;  2V72 A;  4GWI A;  2EID A;  2W95 A;  1O8S A;  4A4A A;  3ACF A;  3MV0 1;  3K4D A;  1IQD C;  2W1Q A;  5HXM A;  1OD3 A;  2YC4 A;  3THC A;  5IFT A;  3CQO A;  2EIB A;  3IAQ A;  2VZO A;  3C7G A;  5EIY B;  5DPN A;  1SG3 A;  5C71 A;  4OZO A;  1NKG A;  4GZ9 A;  1JI6 A;  1UYX A;  1JZ7 A;  4XZU G;  3I2J A;  3HOB A;  4DXT A;  4CUA A;  2QQJ A;  3WNP A;  2J22 A;  3IB3 A;  2J1R A;  5DN2 A;  2VMC A;  3MUZ 1;  3UES A;  2WO1 A;  4AAX A;  3NQH A;  1NAE A;  1ULO A;  1HN1 A;  3HNB M;  4P5Y A;  2J1U A;  3OGS A;  2BZD A;  5JXI A;  5B4X A;  5IYY A;  4E8C A;  2YB7 A;  4P00 B;  4QDR A;  3AC0 A;  3WF0 A;  4UOJ A;  3CKH A;  3ACH A;  4CVU A;  2WO3 A;  1GUI A;  1PX3 A;  3I3D A;  4D8M A;  2BGP A;  2VZV A;  1K42 A;  2XHN A;  2JKX A;  1MPX A;  1XPW A;  4QDQ A;  4OMD A;  4A42 A;  2PQS A;  5JXG A;  2J7M A;  3VD4 A;  5I0D A;  5LA0 A;  3LEK A;  1CZS A;  2JE8 A;  2BBA A;  2XON A;  2WBK A;  3A22 A;  3WNM A;  3T2P A;  4CU7 A;  2QQK A;  4ET7 A;  3VDB A;  4QX2 A;  4W8J A;  2VR4 A;  4AG4 A;  2VZT A;  3WF3 A;  3OGV A;  3WF2 A;  2VZQ A;  3A23 A;  3EYP A;  3MO4 A;  4QB6 A;  2J1T A;  1OF3 A;  1UWW A;  4DXR A;  3C8X A;  2VZ1 A;  1GOH A;  3LPG A;  1JZ5 A;  2ZEX A;  3FHQ A;  3HJR A;  4GWJ A;  3VDC A;  2C9K A;  3I2I A;  1W99 A;  1T2X A;  3SEE A;  1F4A A;  3K75 B;  2QQO A;  2VQT A;  5JXJ A;  1LNS A;  3MV1 1;  4MGS A;  4QB2 A;  1W8N A;  2WN2 A;  1GQP A;  1O8P A;  4CU8 A;  4A3Z A;  1JYV A;  2HYX A;  4M4P A;  3DYM A;  2QQL A;  2YFU A;  1JZ2 A;  3JXS A;  4TXW A;  2C26 A;  3C7E A;  4DUW A;  2Y8K A;  1OH4 A;  2X09 A;  3CZU A;  2WO2 A;  2LS6 A;  1L7Q A;  1GOF A;  1UY4 A;  1D7P M;  2VCB A;  1UY2 A;  2CDO A;  2VZP A;  3T0B A;  3I2K A;  2R7E B;  3WF4 A;  2VCC A;  3T0D A;  3ACG A;  5CZK A;  3VD7 A;  4OUE A;  1K12 A;  2EIE A;  2ORZ A;  4BK4 A;  1YQ2 A;  3OB8 A;  2VJX A;  4E8D A;  3NJX A;  2CDP A;  3PUH A;  1UY0 A;  2Y64 A;  1W9W A;  1WKY A;  5G04 L;  4QX3 A;  4ZY9 A;  4ZXE A;  1PMJ X;  5JMO A;  4UAP A;  4CU9 A;  3FHA A;  2QQN A;  4QPW A;  2VMF A;  4JX0 A;  1US3 A;  2VOT A;  1JU3 A;  4JKM A;  2B9V A;  1PX4 A;  3T2O A;  1KEX A;  2C4X A;  1K3I A;  3W5N A;  5JR2 A;  1K45 A;  3K4A A;  5FUI A;  2W3J A;  4QAW A;  2V5D A;  4KI5 M;  4OYU A;  2WAB A;  5JXH A;  1O59 A;  2Y6K A;  4QDS A;  5B4N A;  3CIH A;  4ARX A;  3HNM A;  2X05 A;  3T09 A;  2BER A;  2J1A A;  4CUC A;  5IFP A;  2YC2 A;  3UET A;  1JZ8 A;  3I2F A;  3I97 A;  4RN5 A;  3UNP A;  2WZ8 A;  3K46 A;  2W1S A;  3VD9 A;  5DQ0 A;  3T08 A;  4XUT A;  2WQ8 A;  2WDB A;  4HG6 B;  3SKJ E;  3CMG A;  4UI9 L;  1GOG A;  4BXS V;  5J1X A;  4W4Z A;  1DYO A;  1SHW B;  4DXS A;  3HPN A;  2W5F A;  4XUQ A;  3GXU A;  4LHS A;  2RJ2 A;  2X10 A;  4LKS A;  3OEA A;  5EJZ B;  1GMM A;  2J1E A;  2DCJ A;  4BJ0 A;  3HN3 A;  5HPO A;  4MGQ A;  4OMC A;  3W5M A;  4W50 A;  1UY3 A;  4L0P A;  1CX1 A;  2YG0 A;  3I2H A;  1RYY A;  1UMI A;  5LA1 A;  4IUG A;  4MOA A;  5C7G A;  2JD9 A;  1W0N A;  3NRU A;  3WSO A;  2J1S A;  2VZ3 A;  5A1A A;  3LPF A;  5IHR A;  3OG2 A;  4BK5 A;  2E33 A;  1KGY A;  1F4H A;  1ULP A;  3IAP A;  3K4Z A;  1H6X A;  2Y6L A;  4DUX A;  4FI9 A;  1EUT A;  3BN6 A;  3MUY 1;  3VDA A;  2W46 A;  1CIY A;  1OT5 A;  3GGL A;  4XUR A;  2VTF A;  3LEI A;  2OKX A;  3BGA A;  3CZJ A;  4DEV A;  3ECQ A;  4QX0 A;  1W9T A;  2WZE A;  4PQQ A;  4CU6 A;  1L7R A;  3GDB A;  1I5P A;  4KMQ A;  3FN9 A;  3LEG A;  1GU3 A;  3LQC A;  5CYY A;  4MO3 M;  3LE0 A;  3SEP A;  2W91 A;  4ZZ8 A;  4P02 B;  1DP0 A;  4A44 A;  3K77 A;  2VME A;  1TG7 A;  1JHJ A;  1UY1 A;  1WCQ A;  1UXX X;  4YPJ A;  1JU4 A;  2QBX A;  2W92 A;  2ZXQ A;  3NJV A;  4XUP A;  1R64 A;  1J83 A;  3D3A A;  3I2G A;  1W9S A;  3OEB A;  1GNY A;  2J1V A;  3E1F 1;  3VD3 A;  5JUV A;  1UXZ A;  1CZV A;  2QQM A;  3EB7 A;  3HEI A;  4XUN A;  3WEZ A;  2W94 A;  3DYO A;  1J84 A;  2VZU A;  2B4K A;  1JZ6 A;  2XQX A;  2WAO A;  4ZZ5 A;  3ABZ A;  2RV9 A;  2VO5 A;  5G05 L; 
#chains in the Genus database with same CATH topology
 1ONA A;  1AL2 1;  5JPM B;  1GZC A;  1OVS A;  4RQP B;  4D0Q A;  2BDR A;  2HJI A;  2IVI B;  3K48 A;  5ACA 3;  2PAM A;  5A7W A;  1EYB A;  5A6Y A;  2BGO A;  5ISL A;  4IGQ A;  2ZX3 A;  3OBZ A;  5A32 B;  4D6S A;  3A7Q A;  1W3V A;  1QJX 3;  3VKO A;  1CZT A;  5C3O A;  3HVD A;  4PIZ A;  5FZ3 A;  1AR9 2;  4HBN A;  1J1T A;  1GZW B;  2G9F A;  3OYW A;  1BHG A;  1FX5 A;  4CDQ A;  4WM7 A;  5DMY A;  1J59 A;  1V9U 3;  2VL4 A;  3ACI A;  3IDC B;  2A71 A;  4FTB A;  2LW8 A;  4IER A;  1N3P A;  4FXK B;  4CUB A;  2W87 A;  1ZRE A;  4XPV A;  2OUH A;  5IVC A;  2TEP A;  3A21 A;  4CEW C;  4LNV A;  2FMD A;  1PVX A;  2FDG A;  2ZKL A;  2R6Q A;  1VP6 A;  2KD7 A;  3DYP A;  1UMH A;  3HNY M;  3MIG A;  5CKM A;  3WW4 A;  3NV4 A;  3VGI A;  3B02 A;  2ZGN A;  1OLM A;  2XLA A;  2X5I B;  4XDQ A;  1I1E A;  4AR2 A;  3WXP A;  3IDA A;  5L9B A;  2A70 A;  2WUH A;  3SNM A;  4AI9 A;  3I54 A;  2VZS A;  3LGR A;  2DDU A;  4IEO A;  1ZZB A;  1HQL A;  2A5Z A;  2CU5 A;  5KR7 A;  1JYX A;  4TTG A;  1DBN A;  1LOD A;  1WA4 A;  5EJ3 A;  2QQP A;  3SQO A;  2LTN A;  4FQZ A;  2OA2 A;  4IEQ A;  4RHV 3;  1H2N A;  1SFN A;  2MEV 1;  2UY8 A;  3GBG A;  3VBH B;  1W2O A;  4OZX A;  4X6Q B;  1ULC A;  2Y6H A;  4FPG A;  4MET A;  3RI8 A;  4I01 A;  2VQ0 A;  3OGR A;  5I0S A;  3I49 A;  3TWI A;  4Z1V A;  2NM1 A;  4A45 A;  4NIH A;  1RUO A;  4QPG C;  3M3Q A;  4Z92 B;  3VBR B;  2VOX A;  3PLQ A;  3O1O A;  3LWC A;  4AHY A;  3GZU C;  1LOC A;  2E26 A;  4M0N A;  1ULD A;  3ZXF A;  1SPP A;  2ARB A;  2RVA A;  4FPH A;  4ATF A;  3RZH A;  4S2H A;  4YW3 A;  1ZRC A;  1Y3T A;  1XNK A;  5FZ6 A;  4BQX A;  1TVG A;  1BK1 A;  3JBG 1;  4OI2 A;  1AXK A;  2VBD A;  4QXH A;  1OOP A;  1POV 0;  4GMP 3;  3WR0 A;  3VD5 A;  3AJZ A;  4CCO A;  1YFW A;  3C7H A;  4UYB A;  2WNE A;  2ZHN A;  4Q8L A;  2ZMK A;  1YC6 1;  3JCI A;  3LIG A;  1M4W A;  1XNT A;  3L2Y A;  3TEX A;  5FXW A;  1FMD 3;  2AUY A;  2JIJ A;  2E7T A;  2HLE A;  2L9L A;  3KCY A;  1VBB 3;  1PK6 C;  2ZAH A;  3O1V A;  2XOM A;  3MLJ A;  4YM1 A;  1OHF A;  4M3C F;  1SDW A;  4JDN A;  4YZ3 A;  3NV2 A;  2OYZ A;  4ONU A;  4AFB A;  1RJ8 A;  1Q8V A;  1YIF A;  1D4M 2;  3W59 A;  1F15 A;  1UYZ A;  2WS9 1;  1BEV 2;  1WD3 A;  4LO6 B;  1OOP C;  4IEP A;  2WN3 A;  3T2Q A;  5HV0 A;  1O3S A;  3KCC A;  3ZSL A;  3T0A A;  4Q5O A;  1YHF A;  1C8N A;  3LIH A;  2ZGU A;  2IFR A;  4CCE A;  1Z7S 3;  1A6C A;  5FK7 A;  5I0U A;  1XNA A;  1YXW A;  2ENR A;  3KF3 A;  2V4V A;  4FFI A;  4NAO A;  4XHX A;  2JDY A;  5FKB A;  4AGR A;  1V6J A;  3BAL A;  2FZ2 A;  1QXR A;  1CN1 A;  1NUK A;  1UZV A;  2W9X A;  4G4F A;  1QEX A;  2XWB B;  3LCP A;  5AVP A;  4AGV A;  3LSE A;  5BNO B;  1MS9 A;  1NXM A;  1O8S A;  3P3P A;  1QJX 1;  1SLL A;  4TLF A;  3ACF A;  1F5F A;  3OJB A;  1W0P A;  3K4D A;  1S0B A;  1IQD C;  3QH6 A;  4XZP A;  3FLR A;  5CAD A;  5IK4 A;  5KWR A;  5HXM A;  1VMF A;  2DVD A;  3TAY A;  4DXZ A;  5C5U A;  4E4D X;  4DO0 A;  5LBB A;  4FCA A;  4YZ2 A;  1MZ6 A;  2D44 A;  3CQO A;  2C0Z A;  4XFB A;  1R09 3;  3MLL A;  3IAQ A;  5CU1 A;  1E5I A;  4M0H A;  2WL1 A;  2GC1 A;  4GAL A;  2P6C A;  4QHZ A;  5JR7 B;  4Q26 A;  3ES4 A;  3H0O A;  1KS4 A;  1QJF A;  1AR7 3;  2GAU A;  4HKL A;  2A7A A;  2NPI A;  5KHK A;  2VOW A;  4NHK A;  1MQT A;  1WW5 A;  3RZZ A;  1IKQ A;  4ZHN A;  2C1F A;  4MGZ E;  5BNQ A;  4XZU G;  3ZYR A;  3ZX7 A;  3KGZ A;  4AQT A;  4CCK A;  5A6Z A;  4UBH A;  5A6Q A;  5J36 A;  2R07 2;  4QX5 A;  4XBL A;  4DXT A;  4CUA A;  1BYH A;  2J22 A;  3PNA A;  4MHU A;  3IB3 A;  2J1R A;  4WM7 C;  1O4Z A;  5FP3 A;  3T1M A;  5AC9 2;  1AUY A;  4YM2 A;  4YGC A;  3CJI B;  1YNA A;  3VBS C;  3NQH A;  3AZW A;  3NO8 A;  1COV 3;  1O7F A;  2JG9 A;  1HXS 2;  3AXE A;  4HXC A;  1X36 A;  3T3Y A;  1AR9 1;  3HNB M;  3AP7 A;  3KSC A;  5FPV A;  5CKQ A;  3PUS A;  1E5H A;  1S0G A;  4LBQ B;  2HWC 2;  4K9S A;  1KXG A;  4TLG A;  2EAL A;  4N43 C;  3J8F 1;  1C57 A;  2J1U A;  2BZD A;  3J7L A;  4FFG A;  4BZ4 A;  2C5D A;  3NAP A;  1CJP A;  2A6W A;  1O5L A;  2VE1 A;  5APA A;  1CIW A;  1CAW A;  1GAN A;  4J6G A;  5GKA C;  5HCB A;  1GFF 2;  2V09 A;  3WF0 A;  5J3U A;  4I09 A;  1ST8 A;  2D6N A;  3LEM A;  4LBO A;  2WO3 A;  4QPI C;  2EAK A;  2R06 3;  4BQ1 A;  5FQ0 A;  3K3N A;  1LB2 A;  4Y22 B;  4BMB A;  2HH9 A;  2R06 1;  2ZHM A;  4D8M A;  2BGP A;  2VZV A;  1K42 A;  2XHN A;  2MEV 2;  4KQ7 A;  1W6M A;  3AYD A;  4JV4 A;  4HSL A;  1XPW A;  2DCZ A;  2DVB A;  1OKO A;  3AK0 A;  3I3Q A;  3I59 B;  4GB3 3;  1R09 2;  2HWF 3;  4L97 A;  5H9P A;  5T52 A;  3FC0 A;  1TE1 B;  2J7M A;  4A42 A;  5I0D A;  1AF9 A;  1C4R A;  1CZS A;  5LA0 A;  3VD4 A;  4YG3 A;  3V56 A;  3Q8A A;  4IEV A;  3N9O A;  4LBK A;  2PMW B;  4Z07 A;  2FDJ A;  2EF6 A;  2I2S A;  2K2S A;  3AX4 A;  4MUV A;  5FZL A;  2FDK A;  4DY5 A;  1YYN A;  5IVE A;  2D97 A;  1RVF 3;  3WNM A;  1RUF 2;  3ZVX A;  4LE3 A;  3EO6 A;  2DVF A;  2QQK A;  3NJY A;  1Q8P A;  4IND A;  3FMG A;  2V5Y A;  3VDB A;  1OOP B;  1W06 A;  4W8J A;  1QH6 A;  2BUK A;  3UYJ A;  5C8C B;  3UKT A;  2HWF 1;  2VW1 A;  3Q8B A;  3FE5 A;  4AG4 A;  1UKR A;  3OGV A;  1PGL 1;  3V0A B;  5CEH A;  1RUH 3;  4JHT A;  1O4T A;  4I3P A;  1YLL A;  1UZY A;  1W6P A;  1A8M A;  2TUN A;  1ZBE 3;  1QOO A;  2RDR A;  5IAV A;  2VZ1 A;  1SCS A;  2ARE A;  3ES1 A;  5IVJ A;  4QHB A;  3VHO A;  3HJR A;  3FHQ A;  4GWJ A;  1D0H A;  1WW4 A;  4CUG A;  3I2I A;  1AL2 3;  1CAU B;  3U75 A;  4AHX A;  2OZJ A;  1S0E A;  1QJY 2;  1OLM E;  1T2X A;  5DG1 A;  5FY9 A;  4D7T A;  1F4A A;  4B7K A;  3CJX A;  3K75 B;  4WVM B;  5ACA 1;  4XQ4 A;  2VTX A;  2ZGK A;  1QDC A;  2VQT A;  3HAG A;  1YIP A;  4JGZ A;  3GZA A;  1LNS A;  1W2N A;  3WLU A;  5IK8 A;  4Y22 A;  3TBD A;  2Q1M A;  3LOI A;  2RR1 1;  5JPN B;  3O1R A;  4XMI A;  1W8N A;  2WN2 A;  4KWK A;  2PHL A;  4OQ8 A;  2ZGS A;  4IET A;  3HQX A;  1S2E A;  4E27 A;  1NCR A;  1H9P A;  3RZK A;  2O14 A;  1SZB A;  1DFQ A;  1PZ9 A;  1ND3 B;  4H7L A;  1YEW A;  4GB3 2;  4PCR A;  5FP7 A;  5JIA A;  2ZOE B;  1HIX A;  2WFP A;  3GNE A;  4KNC A;  2DYC A;  4TXW A;  3VHN A;  3VBR A;  2C26 A;  3C7E A;  5F32 A;  3MHZ A;  4I2O A;  2Q1Z B;  4GJZ A;  2R04 2;  5FRE A;  3CZU A;  4CSW A;  2WO2 A;  4K3U A;  2GP5 A;  4FOV A;  4JZR A;  2ILM A;  4Q1R A;  1E5R A;  2LS6 A;  4K1Z A;  4BIO A;  4DS0 A;  4NWW A;  1HV1 A;  1UY4 A;  4WM7 B;  1YRZ A;  3OYW B;  4P9L A;  3RZJ A;  1H1M A;  4HMZ A;  4V2W A;  3AKT A;  2CDO A;  3ZXA C;  3NNM A;  3WG4 A;  2VCC A;  3KS7 A;  1QHD A;  2WLP A;  2D6P A;  3E5X A;  3PJQ A;  2VH9 A;  3H9A A;  1BBT 3;  3R4S A;  3VD7 A;  1NXD 1;  2EIE A;  3SMH A;  4DPN A;  3B93 A;  3L2H A;  4NHX A;  4IE4 A;  2VOV A;  2BOJ A;  2E7Q A;  3CO2 A;  2OUJ A;  4FOW A;  3VBH C;  3OD0 A;  1NQJ A;  4CDU B;  4BIF A;  1XYN A;  1RED A;  3LA3 A;  4KU8 A;  2DU0 A;  5JMO A;  2P2K A;  3MW3 A;  5A33 B;  2FDH A;  2RS3 1;  5AFB A;  1BMV 2;  2Y0O A;  4CU9 A;  5AFE A;  2G9Z A;  2QQN A;  2IC1 A;  1QGL A;  3MF6 A;  4YFZ A;  1Q8Q A;  4GKX A;  5ABJ A;  4QQ2 A;  4COU A;  2UY9 A;  1F5J A;  1US3 A;  1HRV 3;  1JU3 A;  2A73 B;  1HRI 2;  3JBG 3;  3JU9 A;  1LU1 A;  4NOT A;  4YG6 A;  1PX4 A;  1VRH 3;  1KEX A;  2YGM A;  1RUC 2;  1W6Q B;  5JR2 A;  1W8F A;  1IOA A;  3FX3 A;  2DF7 A;  2JG9 C;  4XAA A;  2BNM A;  2EAA A;  4QAW A;  5LZ6 A;  4NPL A;  2MEV 3;  2V5D A;  2YRO A;  3AZX A;  5SV5 A;  3W21 A;  3WHU A;  3WHT A;  2IXH A;  1R08 1;  1O59 A;  3TRS B;  3ORJ A;  4XFF A;  3CIH A;  2P37 A;  1WBL A;  2IWG B;  4Q4X 3;  1VBB 1;  2BER A;  3MW2 A;  5FUP A;  4BQY A;  1OLQ A;  2OX0 A;  4Y20 B;  5C3S A;  2XJR A;  1WW7 A;  1VIW B;  4XAB A;  3LDR A;  4ISR A;  3WP4 A;  2ZX4 A;  1NLQ A;  3PVO A;  4RA0 A;  1JZ8 A;  3ASI A;  4G3Y C;  3UNP A;  3GJB A;  3LD8 A;  1TME 1;  4XFH A;  5FXV A;  4AGG A;  5F3I A;  2OZ6 A;  5DQ0 A;  2DVA A;  4MV2 A;  3T08 A;  4XJ9 A;  3V0B A;  5FXZ A;  1R08 3;  1CD3 G;  4XTP A;  1LU2 A;  2ZX1 A;  2AH2 A;  3NW4 A;  4UF0 A;  3CMG A;  4UI9 L;  2JG8 A;  5GZD A;  3AMN A;  3SKJ E;  1OUX A;  1AR7 1;  1LOG A;  4YRD A;  3ROU A;  2XVK A;  1JUH A;  4Z8B A;  2W0X A;  1QQP 1;  4U36 A;  2YU2 A;  4LHS A;  2X10 A;  4E2G A;  5FO9 B;  4AEM A;  4DMI A;  1U5I A;  2FCU A;  4PLO A;  3FUO A;  5EPA A;  4QHO A;  4CXW A;  1FI2 A;  3OEA A;  2IXL A;  3QH7 A;  3UT0 A;  5JOW A;  3MGU A;  2WNU A;  2F4L A;  2Y33 A;  2D6K A;  2DCJ A;  4RHV 1;  4UW5 A;  4B4P A;  3HN3 A;  5EWS A;  2EA7 A;  3AYA A;  5AC9 1;  3UK9 A;  4PBO A;  4MGQ A;  1Z0H A;  4UW4 A;  4OMC A;  4LA3 A;  3DXT A;  4FOY A;  1GBG A;  4GXL A;  1QNW A;  3SCF A;  4LK7 A;  3MPP G;  4AFD A;  1PIV 3;  5IWF A;  1Y43 B;  3RQ0 A;  1HW5 A;  2DCT A;  2JJ6 A;  2WIN B;  1MVQ A;  1S0J A;  4O61 A;  3T30 A;  3VKN A;  5JZG A;  5C3R A;  3S7E A;  5C7G A;  1OKQ A;  2JD9 A;  4XF0 A;  1W0N A;  1PGL 2;  1HX6 A;  1AYN 1;  1WW6 A;  3WSO A;  4AED B;  2CNA A;  2VZ3 A;  2XJQ A;  2NMN A;  3LPF A;  2AC1 A;  2R04 3;  1AYN 3;  4TSV A;  4Y24 A;  1UW8 A;  3SCH A;  3IWZ A;  4GJY A;  5JAX A;  2R32 A;  1KGY A;  3UL2 A;  3IAP A;  4KWJ A;  4XFG A;  3PTY A;  4DUX A;  3WW2 A;  1G9D A;  3MUY 1;  2NQY A;  2W46 A;  5DAX A;  2XJP A;  1C3H A;  1CIY A;  1OT5 A;  1F35 A;  3GGL A;  4HVR A;  4IV1 A;  4XUR A;  1Y4W A;  2H0B A;  4ZON A;  3O12 A;  1AR8 2;  1OI6 A;  2XJV A;  5LBF A;  2P3J A;  5A33 A;  3FLP A;  3ZYJ B;  2H0V A;  2XH6 A;  1K5M C;  1QOT A;  4QX0 A;  5DUW A;  5EYY A;  2D6O X;  5FFO C;  2A3X A;  5FMB A;  1FOD 1;  2VY0 A;  3GDB A;  4KMQ A;  2A3W A;  3LEG A;  3N9P A;  1GU3 A;  2A6Y A;  3USU B;  1PIV 2;  4GMP 1;  2QJV A;  3J26 N;  3LE0 A;  1IHM A;  2ZS6 B;  1PO2 2;  1S0I A;  1WWY A;  4MXV A;  5CFD A;  3SEP A;  4HON A;  1DP0 A;  1RUD 2;  1VBC 2;  5CFC C;  4CDQ B;  1DCS A;  5CNA A;  5A7O A;  2VXR A;  3J7N A;  2DV9 A;  2IXK A;  2RS5 3;  3IIA A;  4YLZ A;  3ZPO A;  4YPJ A;  3MIC A;  2WZR 1;  3URF A;  3J8F 2;  4IEZ A;  2W92 A;  5FMC A;  1PM4 A;  1QJZ A;  3L9J T;  1Y9Q A;  4O9G A;  1R64 A;  3WY6 A;  2WC2 A;  4GAZ A;  3VHR A;  3WW1 A;  1CPM A;  1LGN A;  4RQP A;  3B5L B;  2GND A;  1H2L A;  1UU6 A;  2BP6 A;  2NMO A;  2AEN A;  3ZIW A;  4WM8 A;  2PLV 2;  4EWA A;  5JUV A;  3MLK A;  1ODM A;  2LRP A;  2Q8E A;  4MG2 A;  3LFM A;  1NY7 2;  2OS2 A;  3HEI A;  4S2F A;  5A80 A;  3ZFG B;  1TEI A;  2JDH A;  1RUC 1;  4XQW A;  3DYO A;  3AZY A;  5K8S A;  4Y1U A;  5FZM A;  4XFI A;  5FZE A;  1LHV A;  1X82 A;  2VNO A;  1J3R A;  2ZKN A;  4RS5 A;  5FO8 B;  3NNJ A;  1PIV 1;  5GZG A;  3NKT A;  4J25 A;  4Y5S A;  1GNZ A;  1CAX A;  2BTV C;  4KL1 A;  4IV1 C;  2B45 X;  5A7W B;  4CDQ C;  2GC2 A;  2GC3 A;  3SLI A;  4WVM A;  1VBE 2;  2R06 2;  1KFX L;  4GKY A;  3P5B A;  1LCL A;  1MAC A;  5T5O A;  1G9B A;  4FSJ A;  4PI0 A;  3THT A;  3ZXK A;  4Q29 A;  4YWA A;  3IN9 A;  4BQ5 A;  3HWJ A;  2VC9 A;  1S0C A;  1X50 A;  2Y0I A;  2VAU A;  1W6P B;  3B9C A;  4N53 A;  2UYB A;  2E63 A;  2CL2 A;  1SLB A;  1YO8 A;  5EP9 A;  5DUX A;  5FLH A;  5LBC A;  2XKO A;  1ZRI A;  4F3J A;  4Y1V A;  3WQB A;  4UFL A;  1EY2 A;  5BNN B;  2ZGP A;  4OI1 A;  1VBA 1;  4CP9 A;  1JYW A;  4KWU A;  3MI8 A;  2B46 X;  2W47 A;  1GIC A;  3C7F A;  1VMJ A;  2PTM A;  1VRB A;  2ZGT A;  3WF1 A;  1H8T A;  3OBA A;  4XET A;  5FYM A;  1Q56 A;  4JKK A;  3M2M A;  1UX6 A;  3POB A;  4ISQ A;  5J96 B;  2JEC A;  4IEW A;  4PF1 A;  4LOR A;  2B39 A;  2YPD A;  3VKL A;  3D82 A;  3KHB A;  2QFE A;  5CVR A;  3GBF A;  4Q27 A;  5K0U A;  1DU3 D;  1NE4 A;  3TOJ A;  1U5X A;  4MAD A;  1VB4 A;  1ZBE 2;  4Y1X A;  4B7E A;  3BB6 A;  3V0B B;  4W6X A;  3ZN4 A;  1MS4 A;  1DG6 A;  2JDA A;  1PMI A;  4DRV A;  4NHL A;  1UN1 A;  4L8Q A;  1UD1 A;  4QGL A;  3AP6 A;  1VBA 2;  4URT A;  1VBC 3;  4BLI A;  3PVB B;  1V6K A;  2VQU A;  2ZEW A;  3CDZ B;  5EQU A;  3R6S A;  5FOB B;  3B9I A;  1QXP A;  3WG1 A;  2DCK A;  1QIQ A;  2QQI A;  2VD7 A;  4CDX B;  1IG3 A;  2LUW A;  2E32 A;  3WDX A;  4Q4Y 2;  4I3G A;  5IUQ A;  5I8S A;  5F7U A;  2GH8 A;  5JDB A;  3PIG A;  5DG2 A;  3WNO A;  2WYS A;  4WVZ A;  4P9J A;  2ZEY A;  1WZX A;  1VBD 2;  5EJ1 B;  4XIL A;  2OVU A;  1EP0 A;  5GLV A;  5IJR A;  2O8Q A;  4CEY B;  1NQD A;  4OHZ A;  4CCN A;  4EZH A;  1RMU 2;  4QKN A;  1LRH A;  3N9N A;  4BDV B;  5M0T A;  2HWF 2;  3U4X A;  3TNP B;  1ENR A;  5JOX A;  5LCW L;  3KVB A;  1CPN A;  3WP5 A;  4GH4 B;  1HXS 1;  1Q5O A;  3TEW A;  4R4Z A;  4RS5 B;  1FAT A;  2DWR A;  3UKN A;  4JRA A;  1NX9 A;  1AYN 2;  3C7O A;  2G9G A;  4XJU A;  4A2U A;  2RS1 2;  5F8P A;  5HI0 A;  4GH4 C;  4RSU A;  3IDB B;  2W52 A;  4XUO A;  5F3G A;  1CX4 A;  3VBO C;  1R1A 2;  1DQ0 A;  4A41 A;  3VZN A;  4Q4X 2;  2FDF A;  3LKJ A;  3WG2 A;  3S6P A;  1O3R A;  1BEV 1;  1LGB A;  5LA9 A;  4WM8 B;  4KGQ A;  3NNG A;  4JHZ A;  4W65 A;  3ZR5 A;  4MGI E;  3VHP A;  2ID4 A;  1AJO A;  2EIC A;  3DEC A;  3SKV A;  1YJK A;  2YFZ A;  1U0A A;  1CJD A;  1G6N A;  1JOP A;  3B69 A;  2V73 A;  1G86 A;  3ZIX A;  3ZXG A;  2CYF A;  4GWI A;  1HRI 3;  3JBG 2;  3O0W A;  4CDW A;  2I74 A;  5LK5 A;  4HET A;  4ZU7 A;  5FJK A;  4A4A A;  4OI0 A;  2VCM A;  3LF7 A;  3EHK A;  4O65 A;  3VBS B;  1PNG A;  1RUD 1;  4ZS2 A;  4ZKT B;  1MZE A;  1GZ9 A;  1I6X A;  3LDK A;  2D5H A;  4DZG A;  4COY A;  2P5B A;  1CES A;  1EV1 3;  1OD3 A;  4ASM B;  1N3Q A;  3V64 A;  3THC A;  2HWE 3;  5IFT A;  2A6Z A;  3VB9 A;  1AYM 2;  1EPW A;  2GN3 A;  2EIB A;  4PIY A;  5FP4 A;  2R0F A;  3ZYP A;  3POS A;  3GCX A;  4KG0 A;  4B8E A;  1RJ7 A;  4ZPI A;  2DU1 A;  1W8T A;  3MIE A;  1VBA 3;  3H42 B;  2AZ5 A;  4FPC A;  2WS9 2;  3RGB A;  5CBL A;  4R9C A;  5GJ6 A;  2VVF A;  3KZ4 C;  2XJT A;  1JI6 A;  1OD5 A;  2RM2 2;  3M3E A;  2ZCW A;  4LBM A;  4W6W A;  4DY3 A;  5KXD A;  3DL3 A;  4WZF A;  4DRR A;  4XHB A;  4XE9 A;  3ZFG C;  2QQJ A;  5FIX A;  1ZZ9 A;  4N8M A;  2K46 A;  3POI A;  4C1X A;  4LHN A;  1LOE A;  3RZG A;  5DN2 A;  3AKQ A;  2CGP A;  4JGY C;  3GJA A;  3DEM A;  3ME2 A;  1AX1 A;  4UWD A;  4BQ2 A;  4D6Q A;  2VXJ A;  1NAE A;  1HN1 A;  1W2U A;  1WLW A;  2EXI A;  1VBD 3;  4IE0 A;  4IV1 B;  4NE9 A;  5E88 A;  1ZBA 1;  3D5O A;  3P3N A;  2KA3 A;  2YPJ A;  3VBR C;  4AVB A;  5I8T A;  1RUJ 3;  3U78 A;  5B4X A;  5JXI A;  3UKV A;  4Q4Y 3;  1VAL A;  4HZF A;  1PVC 1;  4LXL A;  2LM3 A;  3VBU B;  3ZN6 B;  5EZW A;  1YQ5 A;  5A1F A;  4P00 B;  4AYU A;  5FY1 A;  1VJ2 A;  3CKH A;  1A8D A;  2YUE A;  5FYU A;  1REF A;  5FY0 A;  1GUI A;  4AED A;  1K5M B;  4QPG A;  3IBM A;  3HIF A;  4Q4V 1;  5LRR A;  1ND2 A;  2ZHK A;  3OGJ A;  1SBD A;  1MPX A;  5BUV A;  4QDQ A;  4A7Z A;  2XPJ A;  1B35 A;  3LEK A;  4Q4W 1;  1POV 3;  2GMM A;  4GMP 0;  4YNI A;  2WQZ C;  1GKB A;  2YXS A;  4CCD A;  3CL1 A;  2BBA A;  3PVN A;  5FO7 B;  3FHI B;  1IQA A;  1OA4 A;  4IE5 A;  2VNR A;  1JYT A;  4HOO A;  5AVA A;  3RPQ A;  4LO8 A;  5FOJ B;  5L9R A;  5F2W A;  2HWB 3;  4Y20 A;  2PLV 3;  2BNN A;  3ZO0 B;  2XB6 C;  2P3I A;  4XXP A;  5CB7 A;  4AED C;  1NA1 A;  2B9U A;  4YVW B;  1UZW A;  1YQ8 A;  1QJE A;  2VZT A;  1GWL A;  3E5U A;  2RM2 3;  4LKD A;  5ANQ A;  4JGY A;  2VZQ A;  1JUI A;  1YFX A;  3A23 A;  3EYP A;  4MHR A;  4XAC A;  4BB3 A;  4FBF A;  2OW4 A;  3DPR C;  1GP4 A;  2RS5 2;  5ERL A;  1V6I A;  1ZZ7 A;  4DXR A;  2QVS B;  4CXX A;  1GOH A;  1UOJ A;  3ZSE A;  2VOK A;  3GYD A;  5FMO L;  3AP5 A;  3POE A;  2GAL A;  4LLO A;  5A7S A;  3U1X A;  3PU3 A;  1SAC A;  5H9Q A;  2Q1F A;  2QQO A;  4YW2 A;  5JXJ A;  4OHY A;  3AYC A;  5F37 A;  3ZYH A;  1AR6 1;  2QCS B;  4GWM A;  4HPK A;  1FPN 3;  4CPB D;  2HEV F;  5CFD C;  1C1F A;  2PYT A;  2WT0 A;  4MGS A;  5DUV A;  2GNM A;  1O8P A;  4CU8 A;  1J1L A;  1RIR A;  2VBP A;  3KV4 A;  4Q0P A;  1JYV A;  2HYX A;  5E8A A;  1AVB A;  3D0J A;  3DYM A;  1VMH A;  4H14 A;  1ZBE 1;  3C2U A;  2HKX A;  2YFU A;  4I30 A;  1JBC A;  2P34 A;  4Q1P A;  4QPY A;  3ILF A;  1YI7 A;  2NN8 A;  2HWB 2;  4Z2W A;  1IKP A;  2Y8K A;  4MSV A;  1AXZ A;  1MEC 2;  3R4D B;  1L7Q A;  3UGF A;  4UW6 A;  1GOF A;  3AMP A;  3MFC A;  3NJZ A;  1PVC 3;  3X29 B;  4R9D A;  1N3O A;  2E51 A;  4JGY B;  1OQD A;  1UKG A;  5C5T A;  2VZP A;  5FLJ A;  3ZFF B;  2WFF 1;  3QAC A;  4RHV 2;  3RWN A;  3WF4 A;  4B4Q A;  3VZM A;  4BQ3 A;  5C33 A;  3E6B A;  1VBD 1;  4NR1 A;  2IXC A;  3RZM A;  4C0B A;  1WMD A;  1WCU A;  3RS6 A;  4OUE A;  4NID A;  5GM0 A;  4BK4 A;  1T6B X;  4M3C B;  3OB8 A;  5EHD A;  2VJX A;  3RMX A;  2XXZ A;  1W6O A;  2CDP A;  3RRD A;  1AYM 3;  3ETQ A;  1HJG A;  1RIT A;  1ENQ A;  1Y7B A;  5FZD A;  1N1Y A;  4XBN A;  1C28 A;  4ZY9 A;  1W3X A;  1MZF A;  4U2A A;  5FPZ A;  4ZXE A;  1AYM 1;  1PMJ X;  4QM8 A;  3ZLI A;  3Q9O A;  3O1U A;  4GQ7 A;  5L7O C;  3FHA A;  1RUJ 2;  1TMF 3;  4YSF A;  2OXB A;  4FFH A;  1OLR A;  4NRO A;  3LAG A;  1AHS A;  2X53 S;  3EBR A;  1G9A A;  1QJU 3;  4JKM A;  4TZD A;  4KH9 A;  3F95 A;  1K3I A;  2UU8 A;  3S5Q A;  4JDO A;  2ERF A;  2PAK A;  4QX7 A;  1K45 A;  1BBT 2;  1VRH 1;  2WO7 A;  5FPA A;  4CEY C;  1RB8 G;  1J3Q A;  4QQL A;  2ZML A;  2W3J A;  4D6R A;  1AR9 3;  3APB A;  1ND3 A;  4WVV A;  1JH5 A;  1V6N A;  5FXX A;  3VBU A;  2WAB A;  5JXH A;  3N7L A;  2VUL A;  5DAV A;  4QDS A;  2CGN A;  4AFA A;  2PHF A;  5B4N A;  3EJK A;  3H3Z A;  3ZMN A;  4ARX A;  4AW7 A;  1WLT A;  3LOB A;  1W28 A;  2PHR A;  3JD7 1;  5FPB A;  4NHM A;  2KR2 A;  2RS3 3;  5F6K A;  2BW8 A;  5IFP A;  1S2K A;  3FBY A;  4LIU A;  3TB0 A;  5C9A C;  3UET A;  3I2F A;  2VUA A;  1HKD A;  3I97 A;  4RN5 A;  5BNP A;  2WZ8 A;  2W1S A;  1E57 A;  1KQR A;  1OUR A;  1PK6 A;  3VD9 A;  3JZV A;  4UBG A;  2EVX A;  4AI8 A;  5F5A A;  5GAL A;  5DZF A;  2WZR 2;  1AJK A;  1KJL A;  3R4U A;  2WDB A;  3OPW A;  4HG6 B;  3ZOI A;  5BXX A;  2ETE A;  2D3P A;  3R05 A;  1SBF A;  3N36 A;  1W9F A;  1BVV A;  2B5H A;  4PDW B;  3WG3 A;  1EV1 2;  1BLZ A;  4B3N A;  1O5U A;  5EV7 A;  4FXG B;  3ZN6 A;  3RDI A;  1SFP A;  1ULG A;  1SHW B;  3OUI A;  2W5F A;  3RNS A;  1OXC A;  2ZBJ A;  1V9U 1;  4N90 A;  4R8H A;  3ZKY A;  3KCX A;  4QGN A;  1H4H A;  3GHN A;  1RUG 3;  1CAW B;  3OTF A;  3IPV B;  3VL8 A;  4TN7 A;  3H1W A;  3JQX A;  3OY8 A;  3Q8E A;  2VEC A;  1NE6 A;  1MZ5 A;  3ZYF A;  3J7M A;  4DQA A;  3JUU A;  4LJH A;  4PBP A;  3JB8 A;  4MYE A;  1H8T C;  4LBQ A;  1G9C A;  4GD4 A;  4W50 A;  4XF9 A;  4EE2 A;  2JG9 B;  4XJA A;  3ZXL A;  5LB6 A;  4L0P A;  4IEY A;  2JDK A;  1QQP 3;  4AQS A;  1UPI A;  2A3Y A;  1ZRF A;  5FZI A;  4OUM A;  2YG0 A;  1TME 2;  3BOP A;  3OSD A;  3TEY A;  1RYY A;  1QU0 A;  2CSG A;  2RHP A;  4GIQ A;  4IUG A;  4EN9 B;  2TBV A;  3IKW A;  5DUU A;  2TNF A;  1QDO A;  1GSL A;  3GZE A;  2DFB A;  1O4Y A;  1RVF 2;  4COZ A;  3A4U A;  5F3E A;  4RL7 A;  3OG2 A;  1G9F A;  1FOD 3;  3QBQ A;  1IGO A;  2DBN A;  3K3O A;  2E33 A;  3O1S A;  2RDS A;  2D43 A;  4NN0 A;  1F4H A;  1ULP A;  5ANN A;  1VBC 1;  4AVC A;  5DAB A;  4B29 A;  2OPW A;  5HCF A;  2MNG A;  1EUT A;  5E6H A;  4CA9 A;  1B09 A;  4K20 A;  2VQA A;  3ELN A;  5C3P A;  5JOZ A;  1BXH A;  1LUL A;  2QE3 A;  4CP2 A;  3FBM A;  2OKX A;  1IS5 A;  2WYF A;  4QXC A;  4D3W A;  2QTW B;  1HDK A;  3ECQ A;  2WZE A;  1WD4 A;  3ILN A;  3T2T A;  1OQE A;  1XB9 A;  4YVS A;  1GZW A;  1W6N B;  3FN9 A;  4S2G A;  2WRA A;  2PQQ A;  5CYY A;  1H1A A;  3WVJ A;  1G8W A;  1L7L A;  4ZZ8 A;  4P02 B;  4A44 A;  4CCJ A;  1XQN A;  3HQR A;  5FLI A;  4FAH A;  1FXZ A;  1BK0 A;  1UY1 A;  1HRV 1;  3ZPY A;  3OGG A;  2ZXQ A;  3CBN A;  1OQ1 A;  5IVV A;  4XUP A;  2V4A A;  4BWO A;  4UFK A;  1DYP A;  4ORF A;  2LRO A;  3TYJ A;  1J83 A;  4IEX A;  3MFA A;  3GHM A;  2YZ4 A;  3PME A;  4L11 A;  1HV0 A;  2RJK A;  4DIQ A;  1OH3 A;  1DLL A;  4XTM A;  3E1F 1;  5DAQ A;  3S57 A;  3LB9 A;  2CAU A;  3KV6 A;  1X9T A;  1UZZ A;  4BM8 A;  1O91 A;  2D3S A;  1UXZ A;  2CTV A;  1ZA4 A;  1LEC A;  4CCC A;  3HT2 A;  5BNN C;  2ZGQ A;  3AL5 A;  4XUN A;  2P3K A;  3CLP A;  3MYX A;  3CNA A;  1RXG A;  4XQD A;  1ASJ 3;  3G6J B;  4W6Y A;  5C8W A;  2FD8 A;  3BU7 A;  2XBO 3;  4KG8 A;  4MZU A;  3VDD C;  1PGW 2;  2D98 A;  5KXE A;  1N1T A;  2B4K A;  4UXA A;  4Q8K A;  4MX3 A;  1RUE 3;  1LJ7 A;  2WAO A;  4XMA A;  4ES9 A;  2RR1 2;  2Q8D A;  1CVN A;  5FYI A;  5G05 L;  4ASK A;  3GM8 A;  3H3U A;  1RUD 3;  4A6O A;  4XDP A;  4HL0 A;  4QX8 A;  4NPR A;  4C90 A;  4XF4 A;  3MBW A;  4LO4 B;  2RS3 2;  3M7A A;  1CAV A;  4UFI A;  4ATE A;  3DXU A;  3LFI A;  4JC1 A;  5FCC A;  4Q4V 2;  4Q0V A;  1QJY 1;  1AR8 3;  1HB2 A;  3ETP A;  2F4P A;  2Z42 A;  2WNV C;  4Y1Z A;  4Z2A A;  3III A;  4I02 A;  5E16 A;  1UL9 A;  4O9E A;  4N9H A;  5KHH A;  1V00 A;  3WZ1 A;  3TEZ A;  1RC6 A;  3DUI A;  2BFU S;  1VE0 A;  3I3B A;  2CAV A;  2YMZ A;  1UX7 A;  1RHI 2;  2ZPX A;  3INA A;  5FY7 A;  3E5Q A;  5FZH A;  3J7H A;  3K2O A;  2EXK A;  1TQ5 A;  5FYH A;  4AXO A;  5C9A A;  1NY7 1;  2Z2S B;  1ZRR A;  5H9R A;  1LHN A;  3U07 A;  1D2S A;  1DQ5 A;  1FNZ A;  1GZT A;  1LKN A;  5DAP A;  5FZ8 A;  1LOF A;  4ASL A;  1D0G A;  4QMA A;  3M70 A;  4E9K A;  5LA2 A;  4R9B A;  4RYD A;  4CZS A;  3ALQ A;  3F2Z A;  4QPI A;  3BTA A;  2QQV A;  3BKZ A;  1MS1 A;  4DUV A;  3FL7 A;  3BTZ A;  1T6G C;  1XE0 A;  4GA9 A;  4YM3 A;  2WT1 A;  1S4C A;  1ZZC A;  5F1R A;  1GWM A;  5GZC A;  4N53 B;  2P17 A;  4N7I A;  5FY4 A;  2XVL A;  1WME A;  5IK7 A;  2YY1 A;  4XAE A;  1C8M 3;  4PI2 A;  3GZT B;  3WUD A;  5FR3 A;  4BXF A;  2G4I A;  2BU9 A;  2R16 A;  3WNK A;  4Y26 A;  1NG0 A;  1URX A;  3KMH A;  5FY5 A;  3V65 A;  5BNO C;  1BBT 1;  1VRH 2;  1D2Q A;  4LQR A;  1UU5 A;  3ST7 A;  5FYZ A;  1K5J A;  3VBS A;  1J58 A;  3PUI A;  2BVV A;  1FOD 2;  1MR5 A;  3PU8 A;  5CIS A;  5A7P A;  3GCW A;  1MEC 3;  3SC7 X;  1XNB A;  3U37 A;  4AL9 A;  3AYE A;  1SLI A;  5A3M A;  3HQU A;  3VZK A;  2XGX A;  4QKD A;  3WNL A;  4LPL A;  4QQH A;  4AF9 A;  3POW A;  4QB1 A;  4KWL A;  1H2K A;  1H4G A;  2XLF A;  5FP9 A;  3HD8 B;  3POG A;  4OHW A;  2BEO A;  1EUU A;  1R1Z A;  5FYY A;  4HFS A;  2D3R A;  4J1W A;  1NLS A;  3ZM8 A;  4JKL A;  5FZK A;  2FDI A;  5KHG A;  5IVF A;  1LOB A;  3B00 A;  3HBZ A;  2PXJ A;  2B8M A;  2ZZQ A;  3VBO B;  1PZ7 A;  2JDU A;  2YBP A;  4TWT A;  2WLQ A;  1WBF A;  2YBK A;  1PMH X;  2VZR A;  5GLW A;  3WDT A;  2Z4F A;  3JD7 3;  1CON A;  2JEM A;  1SBE A;  1JW6 A;  1AX0 A;  2JWP A;  5L73 A;  4AHZ A;  1D4M 1;  1IS6 A;  1GWK A;  2OQ6 A;  1NCQ C;  2GU9 A;  4PT6 A;  5FZ1 A;  2VMD A;  2VM9 A;  1LEN A;  5A3L A;  4LIV A;  2MHF A;  1YCI A;  1OBN A;  4CDU C;  1NCR C;  3M3O A;  1FV3 A;  3P1I A;  4XCB A;  3ZR6 A;  3BUC A;  4KU7 A;  4P08 A;  3QOP A;  5C9A B;  1H6Y A;  4M4R A;  1UYY A;  2V72 A;  2W95 A;  1OMI A;  1Y9M A;  4LHL A;  4IES A;  3TN9 1;  1HRI 1;  3FUQ A;  1QJX 2;  2WT2 A;  3MV0 1;  3SXW A;  4EV0 A;  1C5I A;  1ZZ8 A;  5HBA A;  1XRU A;  1A3K A;  5FZO A;  5LEJ A;  3HN1 A;  4LA2 A;  5KHI A;  5L7O B;  2GN7 A;  2Q0A A;  2JDZ A;  5HV4 A;  1MS5 A;  5JSR A;  2WNU B;  1RHI 3;  2WZP P;  4GH4 A;  4MH0 E;  1AXY A;  1UIJ A;  3BI3 A;  3DPR A;  4LT5 A;  5EIY B;  5EXO A;  2DUQ A;  4NHY A;  1ULE A;  5FAX A;  1IS4 A;  5C71 A;  5DZE A;  2I07 B;  5CG8 A;  5J98 B;  4OZO A;  4BQ4 A;  2ZGO A;  4OUS A;  3MPB A;  5CKN A;  1Q3E A;  1H8T B;  1X8M A;  2QQU A;  1LOF C;  1JZ7 A;  2JD4 A;  1ALY A;  2JG8 B;  1GP5 A;  3NST A;  2VGD A;  4LUL A;  4I0A A;  4LLF A;  2RS1 3;  4CDX A;  1DZT A;  2XKP A;  4AEK A;  5L7O A;  1FMD 2;  3KD4 A;  1IG0 A;  2GSY A;  1LHW A;  2XUE A;  3ACL A;  1FPN 1;  2VMC A;  2ZX0 A;  3UES A;  1XBF A;  2WO1 A;  3KF5 A;  1Q8O A;  4AAX A;  2JX9 A;  3AMM A;  1S2B A;  3N3H A;  4QQP A;  4QU1 A;  4E4H A;  1XSR A;  3J8F 3;  4RGG A;  1ULO A;  2BFU L;  2VMI A;  2VVE A;  5DDJ 3;  2UYA A;  3RYP A;  1RMU 1;  4DNY A;  2VW2 A;  1WGP A;  2XWJ B;  1LHO A;  4R52 A;  2FHR A;  2DVG A;  3RJ2 X;  1DF0 A;  3ZDS A;  5IYY A;  4BPZ A;  1HB1 A;  2ZGL A;  1KFU L;  2ZGR A;  1AL2 2;  3NL1 A;  3AC0 A;  3AZV A;  4KGG A;  4P5H A;  3RJR A;  4QQO A;  1KD7 A;  2ET7 A;  2HWD 3;  1LES A;  2VUD A;  2DBI A;  4EN6 B;  1ZVF A;  5JSO A;  4D69 A;  1BQP A;  1C8M 1;  3WQ0 A;  3I3D A;  4CP1 A;  4ZS3 A;  1GQH A;  2JKX A;  2O8O A;  4OMD A;  4ES8 A;  3B3Q E;  2QUO A;  5T50 A;  4XIO A;  2RS5 1;  1H8V A;  5IVB A;  3WOG A;  2JB8 A;  4UFH A;  1PGW 1;  3ZXJ A;  2JEN A;  2JE8 A;  2RE9 A;  2UWA A;  3Q8F A;  4ERO A;  1YI9 A;  3AM2 A;  4OHX A;  2C24 A;  2PLV 1;  4P9I A;  3C3V A;  4F8A A;  4YVW C;  3FLT A;  3T2P A;  3ZMO A;  4XJ8 A;  1XXN A;  4CPB A;  4V1P A;  4IXL A;  5KXB A;  1VAM A;  1YJL A;  4XCA A;  3UGG A;  1QMJ A;  1QH7 A;  3UGH A;  4AVA A;  5FWE A;  3EXU A;  3WF3 A;  4JAA A;  1Y9G A;  1XNC A;  2OII A;  4EYU A;  2KXL A;  4RQP C;  1O6U A;  3MO4 A;  3AJY A;  2J1T A;  1HQN A;  1OF3 A;  1QOS A;  1UWW A;  4M3C E;  2W08 A;  4QB6 A;  5LBE A;  2O1Q A;  1W2A X;  1XE8 A;  4HSJ A;  3LPG A;  4RFR B;  4RFT 0;  4IL7 A;  4TYS A;  1JTZ X;  5FV3 A;  4N43 A;  3VDC A;  3WDW A;  5A3P A;  1W04 A;  2RDN A;  1W99 A;  3SEE A;  1HB3 A;  1WUV A;  2FCV A;  5FZF A;  2JDM A;  1R1A 3;  2CHH A;  4AVT A;  5A3T A;  1MS8 A;  2YBS A;  3Q8C A;  3LDB A;  3SH5 A;  2HWC 3;  4CDW C;  4NUB A;  2ARX A;  3I7D A;  4QPI B;  5FZA A;  4UFJ A;  4YW4 A;  4QB2 A;  3S30 A;  2D93 A;  1GQP A;  2GZW A;  1U5Y A;  4SLI A;  4Y1Y A;  4CTE A;  4FQ4 A;  2WNV B;  4A3Z A;  1JYI A;  4K8R B;  1DYK A;  5FYV A;  3USS A;  1X7N A;  3POJ A;  3NV1 A;  4M4P A;  4BQW A;  5AC9 3;  2YGL A;  1VAK A;  2GNB A;  4FPO B;  4B1L A;  5F5I A;  2WQ4 A;  2CGO A;  4CP0 A;  3KV5 A;  1JZ2 A;  3S0M A;  1NA1 C;  3JXS A;  4NRM A;  4COV A;  1YQC A;  3AFG A;  4DUW A;  1HLC A;  3VZJ A;  1C5H A;  3LA2 A;  1DQ2 A;  5T3N A;  1STM A;  1IS3 A;  2XML A;  2R0H A;  3JB4 C;  3O7O A;  4Y3O A;  3WQ7 A;  2ET1 A;  3MZH A;  1DGW A;  2IFW A;  4O7X A;  5FPL A;  3SH4 A;  3J4U H;  3WV6 A;  4NO4 A;  4EQV A;  2VCB A;  2VUC A;  3O0X A;  1COV 1;  3WD5 A;  4F83 A;  5IW0 A;  3BIW E;  3T0B A;  3I2K A;  4EWD A;  1NCR B;  2HWE 1;  5GZE A;  2R7E B;  5C8C A;  4EN8 B;  5FZB A;  3RYR A;  3A0K A;  3ACG A;  5GLZ A;  3T0D A;  2IZW A;  3WDU A;  2D6M A;  1AX2 A;  2ORZ A;  4YM0 A;  3FJS A;  2ARC A;  1YQ2 A;  5KBF A;  1OUS A;  2D40 A;  4HVQ A;  1ND2 C;  1UMZ A;  1AR6 2;  4P9W A;  2PHW A;  1CGP A;  2Y64 A;  1PVC 2;  1S55 A;  1ZM1 A;  3BYW A;  3VKF C;  5G04 L;  3ON7 A;  2GMP A;  3FFZ A;  1V6O A;  4IV3 B;  4SBV A;  3AB0 A;  4PF5 A;  5D2A A;  2OPK A;  2WA4 A;  1H2M A;  1VLN A;  2HBU A;  3NNF A;  1RXF A;  4UAP A;  4KBZ A;  1WMX A;  2WNO A;  3VKM A;  4QPW A;  3I3M A;  1LEM A;  4JX0 A;  2WNU C;  2VMG A;  4P14 A;  2HWD 1;  2EXH A;  4PDW C;  1BCX A;  5DDJ 1;  3GF6 A;  2C4X A;  2QZ3 A;  3W5N A;  3V0A A;  4ITC A;  3ATG A;  3IMN A;  3K4A A;  1RUN A;  3AP4 A;  1W6O B;  2R49 A;  5F39 A;  4QM9 A;  5KC6 A;  5I8Y A;  4KI5 M;  4LBQ D;  1ND3 C;  4D7S A;  4I0B A;  2JG8 C;  4OYU A;  1D4M 3;  4MVT A;  1IPS A;  3TNQ A;  4M01 A;  2F6B A;  1BEV 3;  3AXD A;  1GLH A;  1PO2 3;  2DCY A;  1LHU A;  1GV9 A;  4XF1 A;  3DV8 A;  3T09 A;  1W0O A;  1OPO A;  2PHX A;  2WJS A;  5LRS A;  1XJA A;  4FT8 A;  4AHW A;  3HR9 A;  2J1A A;  4YZ5 A;  1NCQ A;  4X8P A;  2DFC A;  4NJ4 A;  4BIS A;  3WX5 A;  3M3C A;  1NLR A;  4BOW A;  5BYN A;  4FTS A;  1DGR N;  2YC2 A;  1DGL A;  1W6Q A;  2GME A;  1RUG 1;  2VPV A;  4OUL A;  3K46 A;  3UJO A;  4AI3 A;  3ZSM A;  1W6M B;  3ZSJ A;  2Y6F A;  4FPK A;  4RR3 C;  5C6C A;  4IQP A;  4XUT A;  1JYC A;  5E89 A;  5F3C A;  2QKD A;  1RHI 1;  2PA7 A;  2BWA A;  2JDP A;  2A6V A;  2VNG A;  1GOG A;  4BXS V;  3N9Q A;  4HVO A;  1YUD A;  4D94 A;  2VNV A;  5J1X A;  1YFY A;  1F9K A;  4CDU A;  1N1V A;  4JQR A;  3KVA A;  5A7N A;  2LAL A;  4W4Z A;  4FPJ A;  3CHX A;  3VUO A;  1DYO A;  1UOG A;  3GXU A;  2RJ2 A;  3ZN5 A;  1ACC A;  3TN9 3;  4K21 A;  4LKS A;  4CEW A;  5LWB A;  5T55 A;  3QCW A;  4BHP A;  1QJY 3;  4QXK A;  2JDN A;  1ENX A;  5EJZ B;  5JVV A;  2DUO A;  1RUI 3;  1V0A A;  4M00 A;  5DAW A;  2J1E A;  2JIC A;  3DF0 A;  3NNL A;  2JKB A;  3KHC A;  5T5J A;  4L92 A;  2R30 A;  4RR3 A;  1LAJ A;  2QZ2 A;  2AEY A;  2J42 A;  2WR9 A;  1UOF A;  4NII A;  3WCR A;  3QLQ A;  3J9S A;  5FJH A;  1RUE 1;  4C0H A;  2AYH A;  4YW7 A;  4NRQ A;  1IPJ A;  1RUF 1;  3H8R A;  4LKF A;  3U4S A;  3WQ1 A;  5BNO A;  1CX1 A;  1XSQ A;  4Q2F A;  1MS0 A;  1H30 A;  2X5I C;  4MOA A;  5F5Q A;  1SMV A;  3A0N A;  3IT8 A;  1V6M A;  2XUM A;  2ZJC A;  3M8L A;  1VB2 A;  3D6E A;  5A1A A;  3B01 A;  3QD6 A;  2P4E A;  3IPV A;  4FPY A;  4XFC A;  3O1P A;  1GQG A;  5A3N A;  5DDJ 2;  2MPF A;  1TMF 1;  5I93 A;  4FO9 A;  4HKO A;  4ZU5 A;  3OBR A;  1H6X A;  3POY A;  4HK8 A;  3RFR A;  3KGL A;  1NOV A;  4FI9 A;  3CF6 E;  3BN6 A;  1HRV 2;  5JIU A;  2DTW A;  2KM2 A;  4MLO A;  1REE A;  2E6V A;  2VTF A;  1B35 B;  3LEI A;  2JE9 A;  2ZX2 A;  3WIN E;  3AFK A;  1ENS A;  5D1I A;  5FZ7 A;  3ZXD A;  4JTN A;  2GDF A;  2PEL A;  3KV9 A;  5FUN A;  1W9T A;  2QDR A;  1CAU A;  4PQQ A;  4IV3 A;  4BME A;  4E2S A;  4CU6 A;  1Q8S A;  1I5P A;  2BNO A;  4WZC A;  5T5P A;  4K6B A;  3ZYB A;  2ZMN A;  3D4K A;  1JN2 P;  3LZZ A;  2RDQ A;  3K77 A;  3AP9 A;  2VME A;  3THP A;  3KWV A;  4HK9 A;  3MIB A;  1WCQ A;  4H3W A;  3N7K A;  1ASJ 1;  2I45 A;  4H7M A;  3BTX A;  1XYP A;  4BE3 A;  1V70 A;  3FFQ A;  1A34 A;  4L99 A;  1NZC A;  1UF2 C;  1Z78 A;  3NJV A;  3VBF B;  3WDY A;  2EIG A;  3I2G A;  4HLT A;  2HWE 2;  3OEB A;  1PM7 A;  3BU0 A;  5F5C A;  1JXN A;  1QY4 A;  5IAX A;  2YHJ A;  2VW0 A;  4XJW A;  3U10 A;  3JQW A;  2PHT A;  2AEZ A;  3OBT A;  5D8A B;  1CZV A;  3EB7 A;  5D8A A;  4E4Z A;  3AKS A;  1B35 C;  4EWE A;  2R07 1;  3H8O A;  1APN A;  2WA3 A;  5I91 A;  5J7M A;  5FBZ A;  2AGS A;  5A1L A;  5J37 A;  1PO1 2;  2VZU A;  2CY6 A;  1HQW A;  1F31 A;  4QGM A;  3ABZ A;  4ZZ5 A;  3H8X A;  3VBF A;  2RV9 A;  1QKQ A;  1RUE 2;  2VO5 A;  2WWU A;  3O1T A;  1JOB A;  5FK8 A;  4DFS A;  2W1U A;  4IE6 A;  1ULF A;  1JZ4 A;  2PFW A;  1XC6 A;  4HAN A;  1E5S A;  4M3C A;  3WUC A;  3PUQ A;  4AFM A;  1CAV B;  3P6B A;  1SPP B;  4CXY A;  4A7K A;  4HKW A;  4XC9 A;  2HEW F;  2HWD 2;  2Y6G A;  2RMU 1;  2VVD A;  1ZZ6 A;  2XG3 A;  2CV6 A;  2RG4 A;  2JXA A;  5ACA 2;  4FOQ A;  4NWV A;  4FPF A;  3WT3 A;  5JMC A;  4PQ9 A;  1JOD A;  2RMU 3;  4JCK A;  4WVW A;  5IT6 A;  1PO1 1;  2ZGM A;  5A70 A;  2C6S A;  1UU4 A;  4QXB A;  4YZ4 A;  4OQ9 A;  1M06 G;  1COV 2;  1US2 A;  4RS5 C;  5F9T A;  5J48 A;  3I59 A;  2NZ9 A;  1W03 A;  3ENR A;  4YW5 A;  2H6B A;  4YGB A;  2XDV A;  1RMU 3;  3IM0 A;  5FY8 A;  5C70 A;  4LKE A;  3BPS A;  1LOA A;  5HXV A;  2Y34 A;  4JRL A;  4RGA A;  1TMF 2;  4HN1 A;  3G7D A;  4XDO A;  1UZ0 A;  4YW6 A;  4ARY A;  1W8O A;  3BCW A;  2YV8 A;  2X5I A;  5CIR A;  4CCM A;  3HBK A;  4DIN B;  4YGE A;  1MQT B;  4G9S B;  3I8T A;  1CWP A;  1DLC A;  2ZEZ A;  3IMM A;  4QU2 A;  3FZ3 A;  4QX1 A;  1TZO A;  3NAP B;  1DZR A;  1WMF A;  3N35 A;  4WM8 C;  4YW1 A;  1P8J A;  2YU1 A;  2C9A A;  4AI1 A;  4FAG A;  4FFF A;  2WKK A;  3H1M A;  1HJF A;  2ZAB A;  4HPK B;  1SLA A;  1SDD B;  2RS1 1;  4LO7 A;  4XBQ A;  4NPM A;  3ZFF A;  5FPX A;  2VCA A;  3THD A;  3NAP C;  2WWS A;  1KDM A;  3UV9 A;  4JQT A;  1C8M 2;  2RR1 3;  4MGT A;  5FPU A;  3OF1 A;  4IE7 A;  3CJI A;  1JS9 A;  4FVV A;  4LBL A;  2X8K A;  1FYU A;  1WCS A;  1EPZ A;  1OVP A;  4LMF A;  4CDW B;  1H1I A;  4N7U A;  5LW9 A;  2Y6J A;  1ZBA 3;  1JZ3 A;  4UT5 A;  4GUL A;  2HYK A;  1RUJ 1;  2XJU A;  4AVS A;  3EQE A;  4DEQ A;  5JI9 A;  4CEW B;  4ZXK A;  3WNN A;  4UFM A;  4K7J A;  4XEZ A;  1BMV 1;  3VZL A;  3OY8 B;  3AVS A;  1TME 3;  4LOT A;  4Y5T A;  1A78 A;  5JI7 A;  5F2S A;  5JOY A;  2BV4 A;  4FTE A;  2D5F A;  4AK3 A;  1EAH 1;  2GC0 A;  3UJQ A;  4NIA A;  1OC1 A;  3KT7 A;  1UNB A;  2ZAC A;  5FZG A;  2DTY A;  2E31 A;  4Z82 A;  2ORX A;  3PL0 A;  3I3E A;  1OFS A;  4HT1 T;  4XVH A;  5C3Q A;  3PTR B;  5BNP C;  1J3P A;  2N7G A;  2W1W A;  4ZU4 A;  3SHR A;  2JIG A;  2FZ1 A;  1JYN A;  2YC0 A;  3RZL A;  4XIK A;  4Y4Y A;  1SLT A;  3DCQ A;  4OCT A;  2SLI A;  3EMR A;  3B94 A;  3NMB A;  4CEY A;  4GB3 1;  4FP3 A;  2BVB A;  3H3L A;  2BOI A;  3VDD B;  5C8C C;  1X8E A;  1UO9 A;  1OF4 A;  2WAA A;  3DPR B;  1QJU 1;  3LA7 A;  4A7Y A;  5LAS A;  5I0R A;  4K1Y A;  1RL3 A;  3SH3 A;  2Q8C A;  2BGC A;  5KHJ A;  4LE4 A;  1DDL A;  2EID A;  3RI9 A;  1XOY A;  4IW3 A;  2H6C A;  2ZTN A;  4QKB A;  3VBU C;  5FBJ A;  2FCT A;  1N47 A;  1GNH A;  4J1X A;  1HN0 A;  3DN7 A;  3SIT A;  1S0D A;  4PDW A;  4AWD A;  2DUR A;  4I0W B;  1PO2 1;  3MIH A;  4OLL A;  2W1Q A;  1BJQ A;  1D4V B;  3AL6 A;  2YC4 A;  2IXJ A;  3D0S A;  2HBT A;  1ZRD A;  3VV1 A;  3KM5 A;  1PK6 B;  4CYD A;  2NLR A;  1AR6 3;  1UQX A;  2GNT A;  2WSU A;  4NRP A;  5BNP B;  5IAT A;  3H1Y A;  4XW3 A;  1DGW X;  2VZO A;  3C7G A;  5LAT A;  1HB4 A;  4PLN A;  2UUR A;  5DPN A;  1SG3 A;  2WNV A;  1SQ4 A;  4EJR A;  1I9R A;  4FPE A;  1NKG A;  4GZ9 A;  2E7A A;  1VPH A;  5BNN A;  1UYX A;  3KQ4 B;  4N9I A;  4XFA A;  1SCR A;  3I2J A;  3IDE A;  1DHK B;  2GP3 A;  4YFW A;  3HOB A;  3M4F A;  4K8F A;  1VR3 A;  3WNP A;  2X29 A;  3K51 A;  5FP8 A;  1BKZ A;  3PUR A;  3ZFF C;  5FMO S;  1KJR A;  2VMH A;  2BWC A;  4R9A A;  5KC5 A;  2JB4 A;  3MUZ 1;  3VBH A;  3T1L A;  1R08 2;  3T4H B;  3U0Z A;  1SEF A;  5I0T A;  4LR4 A;  4P5Y A;  3M1H A;  4MGK E;  3AMH A;  3D8C A;  4RR3 B;  3RWK X;  1V9U 2;  2RMU 2;  4FP2 A;  2VG9 A;  4XJZ A;  5GZF A;  1VBE 1;  3NWK A;  1NT0 A;  3OGS A;  3PJY A;  4AI0 A;  5IVY A;  4AEJ A;  4L9B A;  5IK5 A;  4CCL A;  4LUK A;  4EN7 B;  1LGC A;  4YVS C;  5BPX A;  4BU2 A;  4DB5 A;  4E8C A;  2OQ7 A;  5A6X A;  5CA6 A;  2YB7 A;  4QDR A;  1ODN A;  2A75 A;  4IGP A;  4UOJ A;  3ACH A;  3MEP A;  4CVU A;  3ILR A;  3USU A;  4Q4V 3;  1W8W A;  4LBN A;  1PX3 A;  2PHD A;  1RUH 1;  1Z7S 1;  1EAH 3;  5E1R A;  5LY1 A;  3H8U A;  3BOW A;  5CFC A;  2Y38 A;  4R4X A;  3W9A A;  1AR7 2;  1GR3 A;  2PN5 A;  5EFU A;  5FZ0 A;  1MS3 A;  3NVC A;  2PQS A;  5JXG A;  1YWK A;  4UW3 A;  5DZG A;  2FQP A;  1YQ6 A;  3BIE A;  5FKC A;  1RVF 1;  1FAY A;  4YGD A;  1XE7 A;  5T5L A;  2XON A;  2W68 A;  3WW3 A;  2WBK A;  4L2N A;  3A22 A;  1R1A 1;  5HCA A;  1I5Z A;  4AQ6 A;  3VBF C;  5A32 A;  2Z5W A;  2BBV A;  1NCQ B;  1RGS A;  5FZ4 A;  4CU7 A;  4ET7 A;  4QX2 A;  2XBO 1;  3H7J A;  3IZO A;  5JZG C;  2IUW A;  2VR4 A;  4E4S A;  1NA1 B;  4YVW A;  4MXW B;  3WF2 A;  1RIN A;  2ES3 A;  3NV3 A;  5C4W A;  2EXJ A;  2QNK A;  3MF9 A;  5DXD A;  3C8X A;  1UCX A;  3ZDV A;  2D7F A;  4LBJ A;  4P9Y A;  2HEY F;  1H0B A;  2K0G A;  5F6L B;  1JZ5 A;  1XYO A;  2ZEX A;  3I2D A;  2C9K A;  5A7Q A;  1DQ1 A;  3MIF A;  1DGR A;  4GWN A;  2CWM A;  3BTY A;  5SV8 A;  5JCT A;  5L36 A;  3WP6 A;  1G7Y A;  5GLT A;  2ADE A;  2HWC 1;  5L9V A;  1QQP 2;  4XXA A;  1GYK A;  1IZ3 A;  4IGO A;  4QD2 A;  1BZW A;  4F7Z A;  2Q4S A;  3MV1 1;  3I4I A;  1K5M A;  2W39 A;  4PLM A;  4QPG B;  3VN4 A;  2NP0 A;  4H2A A;  1CQ9 A;  1W05 A;  2XR4 A;  3RYK A;  5JSP A;  3AMQ A;  4CDX C;  1KS5 A;  4LTA A;  1PO1 3;  1SFY A;  1IPK A;  4Q0S A;  2AR6 A;  1XU2 A;  3OCP A;  1CR7 A;  3NKG A;  4LEJ A;  3DGT A;  3N9L A;  5FTT C;  5T54 A;  3KB5 A;  3WCS A;  5JZG B;  2A1X A;  4Y5Z 0;  4YYO A;  2QQL A;  1ZNP A;  3CU7 A;  4S2D A;  1QWR A;  1UIK A;  1NYW A;  1UAI A;  1QNY A;  1OH4 A;  5GLU A;  2ZHL A;  2X09 A;  2R04 1;  4YZ1 A;  1VBE 3;  2DUP A;  3SIS A;  5K9Y A;  4X6R B;  2WSV A;  5FZ9 A;  2K9Z A;  3U14 A;  4QKF A;  3WNX A;  4C1W A;  1ZA7 A;  2WFF 3;  5FYS A;  4A3X A;  1D7P M;  3AVR A;  4RD7 A;  5TSW A;  3O14 A;  3S7I A;  1JMU B;  2YYO A;  1UY2 A;  3AKP A;  3MID A;  2R1D A;  3POF A;  2Y26 A;  2JE7 A;  2UWB A;  4MXW A;  1ND2 B;  1OA3 A;  2BJS A;  1KIT A;  2CWS A;  2Z79 A;  4OVE A;  1WCK A;  5CZK A;  1K12 A;  3VL9 A;  1VAV A;  4MGY E;  2O0O A;  1PGS A;  1RUH 2;  1EAH 2;  4E8D A;  3NJX A;  5JLV A;  1S1A A;  1CAX B;  2E53 A;  3PUH A;  4LUM A;  1UY0 A;  5J09 A;  4BYY A;  2XQR A;  1W9W A;  3HT1 A;  1WKY A;  4Q4W 3;  3BVC A;  4QX3 A;  3ZYG A;  4YVS B;  2Z69 A;  4LOS A;  4NIG A;  3RVH A;  1OSG A;  5FZC A;  2WII B;  5FZO B;  1WLC A;  4LHK A;  4BCU A;  1ZX5 A;  4Q4Y 1;  1V6L A;  2VTX J;  4C8D A;  3M3I A;  4E2Q A;  3ZFG A;  3H50 A;  1GP6 A;  2PAE A;  2VMF A;  3GBW A;  2AAC A;  5LK7 B;  2VOT A;  2FMY A;  5CFC B;  1DQ6 A;  2XL7 A;  4LO5 B;  3W58 A;  3OUH A;  2FBE A;  4V2V A;  1LED A;  2B9V A;  3AKR A;  3T2O A;  4JDM A;  3OPT A;  1KDK A;  3PVE A;  5EYX A;  1MQT C;  2E9Q A;  5LY2 A;  5BV6 A;  3E6D A;  4A6S A;  3VZO A;  5FUI A;  5FYB A;  4YAR A;  1RTV A;  1X9P A;  1X33 A;  4AAP A;  4OHV A;  3E97 A;  1OFN A;  1XND A;  1U12 A;  1FPN 2;  5HCH A;  1DIW A;  4WV8 A;  1Q43 A;  4AVV A;  3KT4 A;  1LTE A;  1O3Q A;  2Y6K A;  1FMD 1;  2BYV E;  2P3Y A;  2WFF 2;  3AZZ A;  5FRA A;  1JOJ A;  5K4L A;  3VLB B;  3ZYI B;  2NYY A;  3HNM A;  1XU1 A;  1UOB A;  2X05 A;  3MW4 A;  4PJY A;  3ZXE A;  4B1M A;  4BA6 A;  1VBB 2;  1FV2 A;  1JHN A;  1W8H A;  4IEU A;  5A3O A;  2G19 A;  3JD7 2;  4X8N A;  3ZFE A;  4CUC A;  4Q4X 1;  2ZA9 A;  4OI4 A;  3FWE A;  3O5S A;  2XVG A;  1NZI A;  3T4V A;  5ABJ B;  2XHK A;  1N1S A;  1UPS A;  3PHM A;  2B42 B;  2A6X A;  4FPL A;  3O1M A;  1POQ A;  3VBO A;  2XL9 A;  2Y60 A;  5D21 A;  1ASJ 2;  2WQ8 A;  1RUI 2;  2OT7 A;  4N43 B;  5ABJ C;  3PIJ A;  1U5Z A;  1F2N A;  4Q0U A;  2RJL A;  4NAM A;  3RMY A;  5JWP A;  2W2I A;  1FNY A;  2P1B A;  3O0V A;  3B7M A;  3TN9 2;  3PUA A;  1PZ8 A;  1OPM A;  1EV1 1;  1WLD A;  2P6H A;  1YFU A;  3CJI C;  4Q0Q A;  4AI2 A;  4DXS A;  3HPN A;  4XUQ A;  1RUF 3;  2R07 3;  4AQ2 A;  1LR5 A;  2ARA A;  1ZBA 2;  5LEK A;  4B4R A;  3ZFE C;  1S0F A;  4JTO A;  3N9M A;  1W2T A;  4JGZ B;  3OPZ A;  2BPA 2;  5FYC A;  1AR8 1;  1GMM A;  1W39 A;  2YDE A;  4P9G A;  1MVE A;  2BQP A;  3ZSK A;  4BH9 A;  5CFD B;  4JVA A;  5FWJ A;  2XJS A;  4BJ0 A;  1DZQ A;  3OOX A;  5HPO A;  4LIT A;  1RUI 1;  2ZZJ A;  3W5M A;  3H7Y A;  1UY3 A;  3S5A A;  4EN0 A;  1DQ4 A;  3SCG A;  2XBO 2;  5FDB A;  5CG9 A;  4C91 A;  1AZD A;  3DKW A;  4D7Y A;  3I2H A;  4YG0 A;  1MEC 1;  1QF3 A;  1UMI A;  1I3H A;  3RSJ A;  5LA1 A;  1F8V A;  3LSD A;  4PIX A;  3R0R A;  3BOD A;  4NVP A;  3GAL A;  3NRU A;  3DKQ A;  3OUJ A;  2Q30 A;  1W9Y A;  2J1S A;  4PHZ A;  1QXJ A;  3WP3 A;  5IHR A;  1FT9 A;  4BK5 A;  3HMY A;  4RGK A;  3E6C C;  3MDP A;  3VDD A;  4URA A;  4N53 C;  4WBB A;  1HXS 3;  3K4Z A;  5L19 A;  2Y6L A;  4HN0 A;  2UWC A;  3VDA A;  2D6L X;  5D8A C;  1Z7S 2;  1WCD J;  2QQW A;  1BVP 1;  4XF3 A;  4UF0 B;  4JGZ C;  3OD4 A;  2B7Y A;  4QWN A;  2Q8O A;  4AOC A;  4BLJ A;  1W8Z A;  3ITQ A;  3BGA A;  4CP9 B;  3CZJ A;  4AE2 A;  4DEV A;  1WA6 X;  4COW A;  4DOU A;  2XLG A;  2IVJ A;  1L7R A;  4IV3 C;  3W20 A;  5CAZ A;  2Q5T A;  4IDZ A;  3N7M A;  5C4W C;  5FQ0 B;  3N7J A;  4AZZ A;  2QDN A;  2GH2 A;  3LQC A;  1O3T A;  4MO3 M;  5A3W A;  5FMD A;  1KRI A;  4H55 A;  3BPZ A;  2W91 A;  2PHU A;  3CEW A;  3PMS A;  3KLS A;  5H9S A;  2WS9 3;  5C4W B;  3ZKU A;  1OA2 A;  5K0U B;  1TG7 A;  1JHJ A;  2R1B A;  1PHM A;  1UXX X;  1RUC 3;  1JU4 A;  1C1L A;  1UYP A;  1PNF A;  2QBX A;  2VUJ A;  4Y4R A;  4XYX A;  1AL0 G;  4CE8 A;  1QJU 2;  5FYT A;  1H9W A;  4XOG A;  4CRQ A;  5K0U C;  1RUG 2;  3D3A A;  2VBB A;  1W9S A;  3N4M A;  2F17 A;  3I2O A;  2G1M A;  3U11 A;  4AFC A;  3KQR A;  1GNY A;  2J1V A;  5B2G B;  3VD3 A;  2SBA A;  4NMI A;  3KT1 A;  5A3U A;  1W8U A;  1W6N A;  3ZFE B;  2RM2 1;  2QQM A;  2IXI A;  2BRT A;  1R09 1;  3WDV A;  2HWB 1;  3WEZ A;  3PDQ A;  4QT6 A;  2W94 A;  2WZR 3;  2WWJ A;  4OFG A;  4Q4W 2;  4Y33 A;  2ADD A;  2ZAA A;  1L3J A;  1J84 A;  1POV 1;  4EZ4 A;  1SLC A;  1TNR A;  4P9X A;  2VU9 A;  4K40 A;  1JZ6 A;  2XQX A;  1TNF A;  3RG0 A;  5BY5 A;  2ATF A;  5KXC A;  4LK6 A;  1W90 A;  5K7P A;  1ZYB A;  4KBB A; 
#chains in the Genus database with same CATH homology
 2W1U A;  3GM8 A;  1JZ4 A;  1XC6 A;  4A6O A;  4D0Q A;  3MBW A;  3P6B A;  2BGO A;  2Y6G A;  3A7Q A;  3ETP A;  1CZT A;  4Z2A A;  3III A;  5DMY A;  1BHG A;  3ACI A;  2VL4 A;  2VC9 A;  2LW8 A;  3I3B A;  4CUB A;  1UX7 A;  1US2 A;  2W87 A;  3J7H A;  3A21 A;  3WQB A;  5C70 A;  1JYW A;  4KWU A;  4ARY A;  1UZ0 A;  1W8O A;  2KD7 A;  3DYP A;  1UMH A;  2W47 A;  3C7F A;  3HNY M;  3WF1 A;  3OBA A;  5LA2 A;  1DLC A;  2ZEZ A;  4JKK A;  4QX1 A;  4RYD A;  3IDA A;  1P8J A;  2WUH A;  4PF1 A;  3F2Z A;  2VZS A;  2DDU A;  4DUV A;  3FL7 A;  1SDD B;  1JYX A;  4TTG A;  2VCA A;  3THD A;  4MAD A;  2JDA A;  2Y6H A;  3WNK A;  3OGR A;  2VQU A;  3CDZ B;  2ZEW A;  4LQR A;  4A45 A;  2Y6J A;  2DCK A;  2QQI A;  3PUI A;  1JZ3 A;  2E26 A;  2E32 A;  2RVA A;  4DEQ A;  5F7U A;  3U37 A;  3WNO A;  3WNN A;  1TVG A;  2WYS A;  3WNL A;  2ZEY A;  4LPL A;  5EJ1 B;  4QB1 A;  5IJR A;  3VD5 A;  3C7H A;  4BDV B;  1EUU A;  5LCW L;  3ZM8 A;  4JKL A;  1XNT A;  2E31 A;  2ORX A;  1NX9 A;  3I3E A;  3C7O A;  2HLE A;  2L9L A;  4XVH A;  1PMH X;  2VZR A;  2XOM A;  2W1W A;  2Z4F A;  4XUO A;  4A41 A;  1JYN A;  4PT6 A;  2VMD A;  1UYZ A;  2VM9 A;  3NNG A;  3T2Q A;  4JHZ A;  2WN3 A;  2ID4 A;  3T0A A;  3DEC A;  1OF4 A;  2EIC A;  2WAA A;  3SKV A;  2YFZ A;  1XNA A;  2V4V A;  3P1I A;  4P08 A;  1H6Y A;  4M4R A;  2W9X A;  1NUK A;  1UYY A;  2V72 A;  4GWI A;  2EID A;  2W95 A;  1O8S A;  4A4A A;  3ACF A;  3MV0 1;  3K4D A;  1IQD C;  2W1Q A;  5HXM A;  1OD3 A;  2YC4 A;  3THC A;  5IFT A;  3CQO A;  2EIB A;  3IAQ A;  2VZO A;  3C7G A;  5EIY B;  5DPN A;  1SG3 A;  5C71 A;  4OZO A;  1NKG A;  4GZ9 A;  1JI6 A;  1UYX A;  1JZ7 A;  4XZU G;  3I2J A;  3HOB A;  4DXT A;  4CUA A;  2QQJ A;  3WNP A;  2J22 A;  3IB3 A;  2J1R A;  5DN2 A;  2VMC A;  3MUZ 1;  3UES A;  2WO1 A;  4AAX A;  3NQH A;  1NAE A;  1ULO A;  1HN1 A;  3HNB M;  4P5Y A;  2J1U A;  3OGS A;  2BZD A;  5JXI A;  5B4X A;  5IYY A;  4E8C A;  2YB7 A;  4P00 B;  4QDR A;  3AC0 A;  3WF0 A;  4UOJ A;  3CKH A;  3ACH A;  4CVU A;  2WO3 A;  1GUI A;  1PX3 A;  3I3D A;  4D8M A;  2BGP A;  2VZV A;  1K42 A;  2XHN A;  2JKX A;  1MPX A;  1XPW A;  4QDQ A;  4OMD A;  4A42 A;  2PQS A;  5JXG A;  2J7M A;  3VD4 A;  5I0D A;  5LA0 A;  3LEK A;  1CZS A;  2JE8 A;  2BBA A;  2XON A;  2WBK A;  3A22 A;  3WNM A;  3T2P A;  4CU7 A;  2QQK A;  4ET7 A;  3VDB A;  4QX2 A;  4W8J A;  2VR4 A;  4AG4 A;  2VZT A;  3WF3 A;  3OGV A;  3WF2 A;  2VZQ A;  3A23 A;  3EYP A;  3MO4 A;  4QB6 A;  2J1T A;  1OF3 A;  1UWW A;  4DXR A;  3C8X A;  2VZ1 A;  1GOH A;  3LPG A;  1JZ5 A;  2ZEX A;  3FHQ A;  3HJR A;  4GWJ A;  3VDC A;  2C9K A;  3I2I A;  1W99 A;  1T2X A;  3SEE A;  1F4A A;  3K75 B;  2QQO A;  2VQT A;  5JXJ A;  1LNS A;  3MV1 1;  4MGS A;  4QB2 A;  1W8N A;  2WN2 A;  1GQP A;  1O8P A;  4CU8 A;  4A3Z A;  1JYV A;  2HYX A;  4M4P A;  3DYM A;  2QQL A;  2YFU A;  1JZ2 A;  3JXS A;  4TXW A;  2C26 A;  3C7E A;  4DUW A;  2Y8K A;  1OH4 A;  2X09 A;  3CZU A;  2WO2 A;  2LS6 A;  1L7Q A;  1GOF A;  1UY4 A;  1D7P M;  2VCB A;  1UY2 A;  2CDO A;  2VZP A;  3T0B A;  3I2K A;  2R7E B;  3WF4 A;  2VCC A;  3T0D A;  3ACG A;  5CZK A;  3VD7 A;  4OUE A;  1K12 A;  2EIE A;  2ORZ A;  4BK4 A;  1YQ2 A;  3OB8 A;  2VJX A;  4E8D A;  3NJX A;  2CDP A;  3PUH A;  1UY0 A;  2Y64 A;  1W9W A;  1WKY A;  5G04 L;  4QX3 A;  4ZY9 A;  4ZXE A;  1PMJ X;  5JMO A;  4UAP A;  4CU9 A;  3FHA A;  2QQN A;  4QPW A;  2VMF A;  4JX0 A;  1US3 A;  2VOT A;  1JU3 A;  4JKM A;  2B9V A;  1PX4 A;  3T2O A;  1KEX A;  2C4X A;  1K3I A;  3W5N A;  5JR2 A;  1K45 A;  3K4A A;  5FUI A;  2W3J A;  4QAW A;  2V5D A;  4KI5 M;  4OYU A;  2WAB A;  5JXH A;  1O59 A;  2Y6K A;  4QDS A;  5B4N A;  3CIH A;  4ARX A;  3HNM A;  2X05 A;  3T09 A;  2BER A;  2J1A A;  4CUC A;  5IFP A;  2YC2 A;  3UET A;  1JZ8 A;  3I2F A;  3I97 A;  4RN5 A;  3UNP A;  2WZ8 A;  3K46 A;  2W1S A;  3VD9 A;  5DQ0 A;  3T08 A;  4XUT A;  2WQ8 A;  2WDB A;  4HG6 B;  3SKJ E;  3CMG A;  4UI9 L;  1GOG A;  4BXS V;  5J1X A;  4W4Z A;  1DYO A;  1SHW B;  4DXS A;  3HPN A;  2W5F A;  4XUQ A;  3GXU A;  4LHS A;  2RJ2 A;  2X10 A;  4LKS A;  3OEA A;  5EJZ B;  1GMM A;  2J1E A;  2DCJ A;  4BJ0 A;  3HN3 A;  5HPO A;  4MGQ A;  4OMC A;  3W5M A;  4W50 A;  1UY3 A;  4L0P A;  1CX1 A;  2YG0 A;  3I2H A;  1RYY A;  1UMI A;  5LA1 A;  4IUG A;  4MOA A;  5C7G A;  2JD9 A;  1W0N A;  3NRU A;  3WSO A;  2J1S A;  2VZ3 A;  5A1A A;  3LPF A;  5IHR A;  3OG2 A;  4BK5 A;  2E33 A;  1KGY A;  1F4H A;  1ULP A;  3IAP A;  3K4Z A;  1H6X A;  2Y6L A;  4DUX A;  4FI9 A;  1EUT A;  3BN6 A;  3MUY 1;  3VDA A;  2W46 A;  1CIY A;  1OT5 A;  3GGL A;  4XUR A;  2VTF A;  3LEI A;  2OKX A;  3BGA A;  3CZJ A;  4DEV A;  3ECQ A;  4QX0 A;  1W9T A;  2WZE A;  4PQQ A;  4CU6 A;  1L7R A;  3GDB A;  1I5P A;  4KMQ A;  3FN9 A;  3LEG A;  1GU3 A;  3LQC A;  5CYY A;  4MO3 M;  3LE0 A;  3SEP A;  2W91 A;  4ZZ8 A;  4P02 B;  1DP0 A;  4A44 A;  3K77 A;  2VME A;  1TG7 A;  1JHJ A;  1UY1 A;  1WCQ A;  1UXX X;  4YPJ A;  1JU4 A;  2QBX A;  2W92 A;  2ZXQ A;  3NJV A;  4XUP A;  1R64 A;  1J83 A;  3D3A A;  3I2G A;  1W9S A;  3OEB A;  1GNY A;  2J1V A;  3E1F 1;  3VD3 A;  5JUV A;  1UXZ A;  1CZV A;  2QQM A;  3EB7 A;  3HEI A;  4XUN A;  3WEZ A;  2W94 A;  3DYO A;  1J84 A;  2VZU A;  2B4K A;  1JZ6 A;  2XQX A;  2WAO A;  4ZZ5 A;  3ABZ A;  2RV9 A;  2VO5 A;  5G05 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...