2XR8A

Crystal structure of biphenyl dioxygenase from burkholderia xenovorans lb400
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
442
structure length
433
Chain Sequence
NWTPEAIRGLVDQEKGLLDPRIYADQSLYELELERVFGRSWLLLGHESHVPETGDFLATYMGEDPVVMVRQKDKSIKVFLNQCRHRGMRICRSDAGNAKAFTCSYHGWAYDIAGKLVNVPFEKEAFFDKAEWGPLQARVATYKGLVFANWDVQAPDLETYLGDARPYMDVMLDRTPAGTVAIGGMQKWVIPCNWKFAAEQFCSDMYHAGTTTHLSGILAGIPPEMDLSQAQIPTKGNQFRAAWGGHGSGWYVDEPGSLLAVMGPKVTQYWTEGPAAELAEQRLGHTGMPVRRMVGQHMTIFPTCSFLPTFNNIRIWHPRGPNEIEVWAFTLVDADAPAEIKEEYRRHNIRNFSAGGVFEQDDGENWVEIQKGLRGYKAKSQPLNAQMGLGRSQTGHPDFPGNVGYVYAEEAARGMYHHWMRMMSEPSWATLKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insight Into the Expanded Pcb-Degrading Abilities of a Biphenyl Dioxygenase Obtained by Directed Evolution.
pubmed doi rcsb
source organism Burkholderia xenovorans
molecule tags Oxidoreductase
molecule keywords BIPHENYL DIOXYGENASE SUBUNIT ALPHA
total genus 136
structure length 433
sequence length 442
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature ec 1.14.12.18: Biphenyl 2,3-dioxygenase.
pdb deposition date 2010-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2xr8A02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 2xr8A01
3TGUE 2BMQA 1NDOA 2DE6D 2YFJA 2XSOA 3VMGA 4HM5A 2I7FA 3AZCA 2A06E 1VF5D 4NBEA 1EG9A 4HM1A 2GBXA 4NBAA 2BCCE 2HMOA 3H1KE 2QJKC 4OGQD 1VCKA 2NVGA 1P84E 5KLIC 4PD4E 4EMJB 3DQYA 1WW9A 4QCKA 1ZRTE 3GZXA 4NBAD 3VMIA 2ZYLA 3GTEA 4HM0A 5CXMA 3L70E 4NBGD 1PPJE 3GCEA 4AIVA 1O7NA 2YFIA 3D89A 3CXHE 1SJGA 3GL2A 2D2CD 5BOKA 3H1JE 4QUQA 2FYUE 2ZT9D 4HJLA 2NUKA 4NBHA 2QPZA 2NVEA 3CX5E 4NBFD 1NTKE 3GZYA 4QDFA 3GKQA 4H0LD 4NBBD 1G8KB 2E76D 2XRXA 3GOBA 1Z02A 2BMRA 4QURA 3GCFA 2NWFA 1WQLA 2HMJA 1BCCE 4AAYB 4NBDA 3GTSA 1SQPE 3L72E 2XR8A 4HM7A 1SQVE 4P1CH 3CWBE 2E74D 5AEUA 3C0DA 3L73E 4NBBA 1O7MA 2NVFA 1L0LE 1O7WA 2NUMA 3VMHD 1BE3E 1G8JB 4H13D 1ULIA 2E75D 2HMMA 4NBCA 4NBDD 1Z01A 4NB9D 2Q3WA 2FYNC 3GB4A 1SQBE 2JO6A 4HM3A 4HM4A 3N0QA 2XSHA 3BCCE 2B24A 2JZAA 1Q90C 1UUVA 2BMOA 4HM8A 1ULJA 4QDDA 1NYKA 1KB9E 2YVJB 3VMHA 5KKZC 3L74E 2DE5A 1FQTA 1SQQE 1Z03A 4NB9A 2DE7D 1NTME 2QJPC 3FOUA 5HL4A 3VMID 4H44D 1NU1E 2HMKA 2B1XA 3GKEA 4QUPA 4HM6A 1L0NE 4NB8D 4QDCA 3H1LE 1O7HA 3EN1A 4HM2A 2IBZE 4NBCD 4U3FE 2DE5D 1PP9E 4NBHD 1EZVE 1NTZE 2DE7A 3H1HE 4NBFA 4PV1D 1KYOE 2CKFA 1JM1A 2GBWA 1RFSA 1VM9A 2HMNA 4NB8A 5AEWA 3VMGD 2DE6A 2HMLA 1RIEA 2YIUC 3VCPA 1UUWA 4P1BH 4QDFB 1O7GA 4NBED 1SQXE 3EQQA 2QJYC 2E4QA 4HKVA 3VCAA 1O7PA 4NBGA 3H1IE 2E4PA 3GL0A 3L75E 2YFLA 5KLVE 3L71E
chains in the Genus database with same CATH superfamily
3TGUE 2BMQA 1NDOA 2DE6D 2YFJA 2XSOA 3VMGA 4HM5A 2I7FA 3AZCA 2A06E 1VF5D 4NBEA 1EG9A 4HM1A 2GBXA 4NBAA 2BCCE 2HMOA 3H1KE 2QJKC 4OGQD 1VCKA 2NVGA 1P84E 5KLIC 4PD4E 4EMJB 3DQYA 1WW9A 4QCKA 1ZRTE 3GZXA 4NBAD 3VMIA 2ZYLA 3GTEA 4HM0A 5CXMA 3L70E 4NBGD 1PPJE 3GCEA 4AIVA 1O7NA 2YFIA 3D89A 3CXHE 1SJGA 3GL2A 2D2CD 5BOKA 3H1JE 4QUQA 2FYUE 2ZT9D 4HJLA 2NUKA 4NBHA 2QPZA 2NVEA 3CX5E 4NBFD 1NTKE 3GZYA 4QDFA 3GKQA 4H0LD 4NBBD 1G8KB 2E76D 2XRXA 3GOBA 1Z02A 2BMRA 4QURA 3GCFA 2NWFA 1WQLA 2HMJA 1BCCE 4AAYB 4NBDA 3GTSA 1SQPE 3L72E 2XR8A 4HM7A 1SQVE 4P1CH 3CWBE 2E74D 5AEUA 3C0DA 3L73E 4NBBA 1O7MA 2NVFA 1L0LE 1O7WA 2NUMA 3VMHD 1BE3E 1G8JB 4H13D 1ULIA 2E75D 2HMMA 4NBCA 4NBDD 1Z01A 4NB9D 2Q3WA 2FYNC 3GB4A 1SQBE 2JO6A 4HM3A 4HM4A 3N0QA 2XSHA 3BCCE 2B24A 2JZAA 1Q90C 1UUVA 2BMOA 4HM8A 1ULJA 4QDDA 1NYKA 1KB9E 2YVJB 3VMHA 5KKZC 3L74E 2DE5A 1FQTA 1SQQE 1Z03A 4NB9A 2DE7D 1NTME 2QJPC 3FOUA 5HL4A 3VMID 4H44D 1NU1E 2HMKA 2B1XA 3GKEA 4QUPA 4HM6A 1L0NE 4NB8D 4QDCA 3H1LE 1O7HA 3EN1A 4HM2A 2IBZE 4NBCD 4U3FE 2DE5D 1PP9E 4NBHD 1EZVE 1NTZE 2DE7A 3H1HE 4NBFA 4PV1D 1KYOE 2CKFA 1JM1A 2GBWA 1RFSA 1VM9A 2HMNA 4NB8A 5AEWA 3VMGD 2DE6A 2HMLA 1RIEA 2YIUC 3VCPA 1UUWA 4P1BH 4QDFB 1O7GA 4NBED 1SQXE 3EQQA 2QJYC 2E4QA 4HKVA 3VCAA 1O7PA 4NBGA 3H1IE 2E4PA 3GL0A 3L75E 2YFLA 5KLVE 3L71E
chains in the Genus database with same CATH topology
3TGUE 2BMQA 1NDOA 2DE6D 2YFJA 2XSOA 3VMGA 4HM5A 2I7FA 3AZCA 2A06E 1VF5D 4NBEA 1EG9A 4HM1A 2GBXA 4NBAA 2BCCE 2HMOA 3H1KE 2QJKC 4OGQD 1VCKA 2NVGA 1P84E 5KLIC 4PD4E 4EMJB 3DQYA 1WW9A 4QCKA 1ZRTE 3GZXA 4NBAD 3VMIA 2ZYLA 3GTEA 4HM0A 5CXMA 3L70E 4NBGD 1PPJE 3GCEA 4AIVA 1O7NA 2YFIA 3D89A 3CXHE 1SJGA 3GL2A 2D2CD 5BOKA 3H1JE 4QUQA 2FYUE 2ZT9D 4HJLA 2NUKA 4NBHA 2QPZA 2NVEA 3CX5E 4NBFD 1NTKE 3GZYA 4QDFA 3GKQA 4H0LD 4NBBD 1G8KB 2E76D 2XRXA 3GOBA 1Z02A 2BMRA 4QURA 3GCFA 2NWFA 1WQLA 2HMJA 1BCCE 4AAYB 4NBDA 3GTSA 1SQPE 3L72E 2XR8A 4HM7A 1SQVE 4P1CH 3CWBE 2E74D 5AEUA 3C0DA 3L73E 4NBBA 1O7MA 2NVFA 1L0LE 1O7WA 2NUMA 3VMHD 1BE3E 1G8JB 4H13D 1ULIA 2E75D 2HMMA 4NBCA 4NBDD 1Z01A 4NB9D 2Q3WA 2FYNC 3GB4A 1SQBE 2JO6A 4HM3A 4HM4A 3N0QA 2XSHA 3BCCE 2B24A 2JZAA 1Q90C 1UUVA 2BMOA 4HM8A 1ULJA 4QDDA 1NYKA 1KB9E 2YVJB 3VMHA 5KKZC 3L74E 2DE5A 1FQTA 1SQQE 1Z03A 4NB9A 2DE7D 1NTME 2QJPC 3FOUA 5HL4A 3VMID 4H44D 1NU1E 2HMKA 2B1XA 3GKEA 4QUPA 4HM6A 1L0NE 4NB8D 4QDCA 3H1LE 1O7HA 3EN1A 4HM2A 2IBZE 4NBCD 4U3FE 2DE5D 1PP9E 4NBHD 1EZVE 1NTZE 2DE7A 3H1HE 4NBFA 4PV1D 1KYOE 2CKFA 1JM1A 2GBWA 1RFSA 1VM9A 2HMNA 4NB8A 5AEWA 3VMGD 2DE6A 2HMLA 1RIEA 2YIUC 3VCPA 1UUWA 4P1BH 4QDFB 1O7GA 4NBED 1SQXE 3EQQA 2QJYC 2E4QA 4HKVA 3VCAA 1O7PA 4NBGA 3H1IE 2E4PA 3GL0A 3L75E 2YFLA 5KLVE 3L71E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TGU E;  2BMQ A;  1NDO A;  2DE6 D;  2YFJ A;  2XSO A;  3VMG A;  4HM5 A;  2I7F A;  3AZC A;  2A06 E;  1VF5 D;  4NBE A;  1EG9 A;  4HM1 A;  2GBX A;  4NBA A;  2BCC E;  2HMO A;  3H1K E;  2QJK C;  4OGQ D;  1VCK A;  2NVG A;  1P84 E;  5KLI C;  4PD4 E;  4EMJ B;  3DQY A;  1WW9 A;  4QCK A;  1ZRT E;  3GZX A;  4NBA D;  3VMI A;  2ZYL A;  3GTE A;  4HM0 A;  5CXM A;  3L70 E;  4NBG D;  1PPJ E;  3GCE A;  4AIV A;  1O7N A;  2YFI A;  3D89 A;  3CXH E;  1SJG A;  3GL2 A;  2D2C D;  5BOK A;  3H1J E;  4QUQ A;  2FYU E;  2ZT9 D;  4HJL A;  2NUK A;  4NBH A;  2QPZ A;  2NVE A;  3CX5 E;  4NBF D;  1NTK E;  3GZY A;  4QDF A;  3GKQ A;  4H0L D;  4NBB D;  1G8K B;  2E76 D;  2XRX A;  3GOB A;  1Z02 A;  2BMR A;  4QUR A;  3GCF A;  2NWF A;  1WQL A;  2HMJ A;  1BCC E;  4AAY B;  4NBD A;  3GTS A;  1SQP E;  3L72 E;  2XR8 A;  4HM7 A;  1SQV E;  4P1C H;  3CWB E;  2E74 D;  5AEU A;  3C0D A;  3L73 E;  4NBB A;  1O7M A;  2NVF A;  1L0L E;  1O7W A;  2NUM A;  3VMH D;  1BE3 E;  1G8J B;  4H13 D;  1ULI A;  2E75 D;  2HMM A;  4NBC A;  4NBD D;  1Z01 A;  4NB9 D;  2Q3W A;  2FYN C;  3GB4 A;  1SQB E;  2JO6 A;  4HM3 A;  4HM4 A;  3N0Q A;  2XSH A;  3BCC E;  2B24 A;  2JZA A;  1Q90 C;  1UUV A;  2BMO A;  4HM8 A;  1ULJ A;  4QDD A;  1NYK A;  1KB9 E;  2YVJ B;  3VMH A;  5KKZ C;  3L74 E;  2DE5 A;  1FQT A;  1SQQ E;  1Z03 A;  4NB9 A;  2DE7 D;  1NTM E;  2QJP C;  3FOU A;  5HL4 A;  3VMI D;  4H44 D;  1NU1 E;  2HMK A;  2B1X A;  3GKE A;  4QUP A;  4HM6 A;  1L0N E;  4NB8 D;  4QDC A;  3H1L E;  1O7H A;  3EN1 A;  4HM2 A;  2IBZ E;  4NBC D;  4U3F E;  2DE5 D;  1PP9 E;  4NBH D;  1EZV E;  1NTZ E;  2DE7 A;  3H1H E;  4NBF A;  4PV1 D;  1KYO E;  2CKF A;  1JM1 A;  2GBW A;  1RFS A;  1VM9 A;  2HMN A;  4NB8 A;  5AEW A;  3VMG D;  2DE6 A;  2HML A;  1RIE A;  2YIU C;  3VCP A;  1UUW A;  4P1B H;  4QDF B;  1O7G A;  4NBE D;  1SQX E;  3EQQ A;  2QJY C;  2E4Q A;  4HKV A;  3VCA A;  1O7P A;  4NBG A;  3H1I E;  2E4P A;  3GL0 A;  3L75 E;  2YFL A;  5KLV E;  3L71 E; 
#chains in the Genus database with same CATH topology
 3TGU E;  2BMQ A;  1NDO A;  2DE6 D;  2YFJ A;  2XSO A;  3VMG A;  4HM5 A;  2I7F A;  3AZC A;  2A06 E;  1VF5 D;  4NBE A;  1EG9 A;  4HM1 A;  2GBX A;  4NBA A;  2BCC E;  2HMO A;  3H1K E;  2QJK C;  4OGQ D;  1VCK A;  2NVG A;  1P84 E;  5KLI C;  4PD4 E;  4EMJ B;  3DQY A;  1WW9 A;  4QCK A;  1ZRT E;  3GZX A;  4NBA D;  3VMI A;  2ZYL A;  3GTE A;  4HM0 A;  5CXM A;  3L70 E;  4NBG D;  1PPJ E;  3GCE A;  4AIV A;  1O7N A;  2YFI A;  3D89 A;  3CXH E;  1SJG A;  3GL2 A;  2D2C D;  5BOK A;  3H1J E;  4QUQ A;  2FYU E;  2ZT9 D;  4HJL A;  2NUK A;  4NBH A;  2QPZ A;  2NVE A;  3CX5 E;  4NBF D;  1NTK E;  3GZY A;  4QDF A;  3GKQ A;  4H0L D;  4NBB D;  1G8K B;  2E76 D;  2XRX A;  3GOB A;  1Z02 A;  2BMR A;  4QUR A;  3GCF A;  2NWF A;  1WQL A;  2HMJ A;  1BCC E;  4AAY B;  4NBD A;  3GTS A;  1SQP E;  3L72 E;  2XR8 A;  4HM7 A;  1SQV E;  4P1C H;  3CWB E;  2E74 D;  5AEU A;  3C0D A;  3L73 E;  4NBB A;  1O7M A;  2NVF A;  1L0L E;  1O7W A;  2NUM A;  3VMH D;  1BE3 E;  1G8J B;  4H13 D;  1ULI A;  2E75 D;  2HMM A;  4NBC A;  4NBD D;  1Z01 A;  4NB9 D;  2Q3W A;  2FYN C;  3GB4 A;  1SQB E;  2JO6 A;  4HM3 A;  4HM4 A;  3N0Q A;  2XSH A;  3BCC E;  2B24 A;  2JZA A;  1Q90 C;  1UUV A;  2BMO A;  4HM8 A;  1ULJ A;  4QDD A;  1NYK A;  1KB9 E;  2YVJ B;  3VMH A;  5KKZ C;  3L74 E;  2DE5 A;  1FQT A;  1SQQ E;  1Z03 A;  4NB9 A;  2DE7 D;  1NTM E;  2QJP C;  3FOU A;  5HL4 A;  3VMI D;  4H44 D;  1NU1 E;  2HMK A;  2B1X A;  3GKE A;  4QUP A;  4HM6 A;  1L0N E;  4NB8 D;  4QDC A;  3H1L E;  1O7H A;  3EN1 A;  4HM2 A;  2IBZ E;  4NBC D;  4U3F E;  2DE5 D;  1PP9 E;  4NBH D;  1EZV E;  1NTZ E;  2DE7 A;  3H1H E;  4NBF A;  4PV1 D;  1KYO E;  2CKF A;  1JM1 A;  2GBW A;  1RFS A;  1VM9 A;  2HMN A;  4NB8 A;  5AEW A;  3VMG D;  2DE6 A;  2HML A;  1RIE A;  2YIU C;  3VCP A;  1UUW A;  4P1B H;  4QDF B;  1O7G A;  4NBE D;  1SQX E;  3EQQ A;  2QJY C;  2E4Q A;  4HKV A;  3VCA A;  1O7P A;  4NBG A;  3H1I E;  2E4P A;  3GL0 A;  3L75 E;  2YFL A;  5KLV E;  3L71 E; 
#chains in the Genus database with same CATH homology
 3TGU E;  2BMQ A;  1NDO A;  2DE6 D;  2YFJ A;  2XSO A;  3VMG A;  4HM5 A;  2I7F A;  3AZC A;  2A06 E;  1VF5 D;  4NBE A;  1EG9 A;  4HM1 A;  2GBX A;  4NBA A;  2BCC E;  2HMO A;  3H1K E;  2QJK C;  4OGQ D;  1VCK A;  2NVG A;  1P84 E;  5KLI C;  4PD4 E;  4EMJ B;  3DQY A;  1WW9 A;  4QCK A;  1ZRT E;  3GZX A;  4NBA D;  3VMI A;  2ZYL A;  3GTE A;  4HM0 A;  5CXM A;  3L70 E;  4NBG D;  1PPJ E;  3GCE A;  4AIV A;  1O7N A;  2YFI A;  3D89 A;  3CXH E;  1SJG A;  3GL2 A;  2D2C D;  5BOK A;  3H1J E;  4QUQ A;  2FYU E;  2ZT9 D;  4HJL A;  2NUK A;  4NBH A;  2QPZ A;  2NVE A;  3CX5 E;  4NBF D;  1NTK E;  3GZY A;  4QDF A;  3GKQ A;  4H0L D;  4NBB D;  1G8K B;  2E76 D;  2XRX A;  3GOB A;  1Z02 A;  2BMR A;  4QUR A;  3GCF A;  2NWF A;  1WQL A;  2HMJ A;  1BCC E;  4AAY B;  4NBD A;  3GTS A;  1SQP E;  3L72 E;  2XR8 A;  4HM7 A;  1SQV E;  4P1C H;  3CWB E;  2E74 D;  5AEU A;  3C0D A;  3L73 E;  4NBB A;  1O7M A;  2NVF A;  1L0L E;  1O7W A;  2NUM A;  3VMH D;  1BE3 E;  1G8J B;  4H13 D;  1ULI A;  2E75 D;  2HMM A;  4NBC A;  4NBD D;  1Z01 A;  4NB9 D;  2Q3W A;  2FYN C;  3GB4 A;  1SQB E;  2JO6 A;  4HM3 A;  4HM4 A;  3N0Q A;  2XSH A;  3BCC E;  2B24 A;  2JZA A;  1Q90 C;  1UUV A;  2BMO A;  4HM8 A;  1ULJ A;  4QDD A;  1NYK A;  1KB9 E;  2YVJ B;  3VMH A;  5KKZ C;  3L74 E;  2DE5 A;  1FQT A;  1SQQ E;  1Z03 A;  4NB9 A;  2DE7 D;  1NTM E;  2QJP C;  3FOU A;  5HL4 A;  3VMI D;  4H44 D;  1NU1 E;  2HMK A;  2B1X A;  3GKE A;  4QUP A;  4HM6 A;  1L0N E;  4NB8 D;  4QDC A;  3H1L E;  1O7H A;  3EN1 A;  4HM2 A;  2IBZ E;  4NBC D;  4U3F E;  2DE5 D;  1PP9 E;  4NBH D;  1EZV E;  1NTZ E;  2DE7 A;  3H1H E;  4NBF A;  4PV1 D;  1KYO E;  2CKF A;  1JM1 A;  2GBW A;  1RFS A;  1VM9 A;  2HMN A;  4NB8 A;  5AEW A;  3VMG D;  2DE6 A;  2HML A;  1RIE A;  2YIU C;  3VCP A;  1UUW A;  4P1B H;  4QDF B;  1O7G A;  4NBE D;  1SQX E;  3EQQ A;  2QJY C;  2E4Q A;  4HKV A;  3VCA A;  1O7P A;  4NBG A;  3H1I E;  2E4P A;  3GL0 A;  3L75 E;  2YFL A;  5KLV E;  3L71 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...