2XR8A

Crystal structure of biphenyl dioxygenase from burkholderia xenovorans lb400
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
442
structure length
433
Chain Sequence
NWTPEAIRGLVDQEKGLLDPRIYADQSLYELELERVFGRSWLLLGHESHVPETGDFLATYMGEDPVVMVRQKDKSIKVFLNQCRHRGMRICRSDAGNAKAFTCSYHGWAYDIAGKLVNVPFEKEAFFDKAEWGPLQARVATYKGLVFANWDVQAPDLETYLGDARPYMDVMLDRTPAGTVAIGGMQKWVIPCNWKFAAEQFCSDMYHAGTTTHLSGILAGIPPEMDLSQAQIPTKGNQFRAAWGGHGSGWYVDEPGSLLAVMGPKVTQYWTEGPAAELAEQRLGHTGMPVRRMVGQHMTIFPTCSFLPTFNNIRIWHPRGPNEIEVWAFTLVDADAPAEIKEEYRRHNIRNFSAGGVFEQDDGENWVEIQKGLRGYKAKSQPLNAQMGLGRSQTGHPDFPGNVGYVYAEEAARGMYHHWMRMMSEPSWATLKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords BIPHENYL DIOXYGENASE SUBUNIT ALPHA
publication title Structural Insight Into the Expanded Pcb-Degrading Abilities of a Biphenyl Dioxygenase Obtained by Directed Evolution.
pubmed doi rcsb
source organism Burkholderia xenovorans
molecule tags Oxidoreductase
total genus 136
structure length 433
sequence length 442
chains with identical sequence C, E, G, I, K, M, O, Q, S, U, W
ec nomenclature ec 1.14.12.18: Biphenyl 2,3-dioxygenase.
pdb deposition date 2010-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00355 Rieske Rieske [2Fe-2S] domain
A PF00848 Ring_hydroxyl_A Ring hydroxylating alpha subunit (catalytic domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.102.10.10 Mainly Beta 3-layer Sandwich Rieske Iron-sulfur Protein Rieske [2Fe-2S] iron-sulphur domain 2xr8A02
3.90.380.10 Alpha Beta Alpha-Beta Complex Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 Naphthalene 1,2-dioxygenase Alpha Subunit; Chain A, domain 1 2xr8A01
3CWBE 4EMJB 3BCCE 2B1XA 2JZAA 2JO6A 2XRXA 4HM8A 4NBHD 4NB8A 3H1HE 4NBGA 1ZRTE 3L72E 2I7FA 3GCEA 1Q90C 1SQBE 3D89A 5KKZC 1UUVA 4HM1A 2E4QA 3L74E 1PPJE 2HMNA 3GZXA 1G8JB 1UUWA 1L0NE 1NTKE 3H1KE 2D2CD 3GTSA 2E4PA 2NUMA 3TGUE 2YIUC 2A06E 1JM1A 3VMIA 2DE6D 1O7GA 3L70E 2NWFA 5AEUA 3GCFA 3L71E 1WW9A 3CXHE 4H0LD 4HM7A 2XSHA 2XR8A 2HMOA 4NBCA 3AZCA 1SJGA 2HMLA 2B24A 2YFIA 5BOKA 4HM6A 1Z03A 2CKFA 5CXMA 3L75E 1KYOE 1Z02A 4NBDA 1O7PA 3GKEA 3H1LE 1G8KB 4P1BH 2BMOA 4QURA 5KLVE 3C0DA 1P84E 2GBXA 2NVGA 4NB8D 3VMHD 3GOBA 1ULIA 4NBGD 2DE7D 4QDDA 4NBEA 1NDOA 3VMGA 4PV1D 1O7HA 2DE5D 1BCCE 5KLIC 1VM9A 4QDCA 4NBHA 4QDFA 2BCCE 4NB9A 2E76D 2E75D 4AIVA 4HJLA 5HL4A 2Q3WA 3GZYA 4NBAD 3L73E 2ZT9D 2BMQA 3FOUA 1WQLA 4HM4A 2E74D 1VCKA 2FYNC 3VMID 1SQPE 4AAYB 3EQQA 2NUKA 4HM0A 4H44D 4HM5A 1NTZE 4OGQD 2FYUE 2HMJA 2DE6A 2HMMA 2HMKA 1O7MA 2XSOA 1PP9E 5AEWA 4NBBA 3H1JE 1L0LE 1RFSA 3GTEA 4PD4E 1SQXE 1ULJA 4NBFA 4QDFB 1EG9A 1FQTA 4NBDD 2YFJA 4QUQA 3GL0A 1SQQE 4P1CH 2BMRA 1NYKA 4QCKA 1O7WA 2QJYC 1NTME 4HM2A 3VMHA 4NB9D 1KB9E 3GL2A 2DE7A 1RIEA 3H1IE 2DE5A 4U3FE 2QJPC 1NU1E 3VCPA 4NBCD 1O7NA 2ZYLA 3GB4A 4NBAA 2QJKC 2NVEA 3GKQA 3N0QA 1SQVE 2IBZE 4QUPA 4HKVA 3CX5E 3EN1A 2YFLA 4HM3A 2YVJB 3VCAA 2GBWA 2NVFA 1Z01A 4H13D 4NBBD 3DQYA 1VF5D 1EZVE 4NBED 3VMGD 1BE3E 2QPZA 4NBFD
chains in the Genus database with same CATH superfamily
3CWBE 4EMJB 3BCCE 2B1XA 2JZAA 2JO6A 2XRXA 4HM8A 4NBHD 4NB8A 3H1HE 4NBGA 1ZRTE 3L72E 2I7FA 3GCEA 1Q90C 1SQBE 3D89A 5KKZC 1UUVA 4HM1A 2E4QA 3L74E 1PPJE 2HMNA 3GZXA 1G8JB 1UUWA 1L0NE 1NTKE 3H1KE 2D2CD 3GTSA 2E4PA 2NUMA 3TGUE 2YIUC 2A06E 1JM1A 3VMIA 2DE6D 1O7GA 3L70E 2NWFA 5AEUA 3GCFA 3L71E 1WW9A 3CXHE 4H0LD 4HM7A 2XSHA 2XR8A 2HMOA 4NBCA 3AZCA 1SJGA 2HMLA 2B24A 2YFIA 5BOKA 4HM6A 1Z03A 2CKFA 5CXMA 3L75E 1KYOE 1Z02A 4NBDA 1O7PA 3GKEA 3H1LE 1G8KB 4P1BH 2BMOA 4QURA 5KLVE 3C0DA 1P84E 2GBXA 2NVGA 4NB8D 3VMHD 3GOBA 1ULIA 4NBGD 2DE7D 4QDDA 4NBEA 1NDOA 3VMGA 4PV1D 1O7HA 2DE5D 1BCCE 5KLIC 1VM9A 4QDCA 4NBHA 4QDFA 2BCCE 4NB9A 2E76D 2E75D 4AIVA 4HJLA 5HL4A 2Q3WA 3GZYA 4NBAD 3L73E 2ZT9D 2BMQA 3FOUA 1WQLA 4HM4A 2E74D 1VCKA 2FYNC 3VMID 1SQPE 4AAYB 3EQQA 2NUKA 4HM0A 4H44D 4HM5A 1NTZE 4OGQD 2FYUE 2HMJA 2DE6A 2HMMA 2HMKA 1O7MA 2XSOA 1PP9E 5AEWA 4NBBA 3H1JE 1L0LE 1RFSA 3GTEA 4PD4E 1SQXE 1ULJA 4NBFA 4QDFB 1EG9A 1FQTA 4NBDD 2YFJA 4QUQA 3GL0A 1SQQE 4P1CH 2BMRA 1NYKA 4QCKA 1O7WA 2QJYC 1NTME 4HM2A 3VMHA 4NB9D 1KB9E 3GL2A 2DE7A 1RIEA 3H1IE 2DE5A 4U3FE 2QJPC 1NU1E 3VCPA 4NBCD 1O7NA 2ZYLA 3GB4A 4NBAA 2QJKC 2NVEA 3GKQA 3N0QA 1SQVE 2IBZE 4QUPA 4HKVA 3CX5E 3EN1A 2YFLA 4HM3A 2YVJB 3VCAA 2GBWA 2NVFA 1Z01A 4H13D 4NBBD 3DQYA 1VF5D 1EZVE 4NBED 3VMGD 1BE3E 2QPZA 4NBFD
chains in the Genus database with same CATH topology
3CWBE 4EMJB 3BCCE 2B1XA 2JZAA 2JO6A 2XRXA 4HM8A 4NBHD 4NB8A 3H1HE 4NBGA 1ZRTE 3L72E 2I7FA 3GCEA 1Q90C 1SQBE 3D89A 5KKZC 1UUVA 4HM1A 2E4QA 3L74E 1PPJE 2HMNA 3GZXA 1G8JB 1UUWA 1L0NE 1NTKE 3H1KE 2D2CD 3GTSA 2E4PA 2NUMA 3TGUE 2YIUC 2A06E 1JM1A 3VMIA 2DE6D 1O7GA 3L70E 2NWFA 5AEUA 3GCFA 3L71E 1WW9A 3CXHE 4H0LD 4HM7A 2XSHA 2XR8A 2HMOA 4NBCA 3AZCA 1SJGA 2HMLA 2B24A 2YFIA 5BOKA 4HM6A 1Z03A 2CKFA 5CXMA 3L75E 1KYOE 1Z02A 4NBDA 1O7PA 3GKEA 3H1LE 1G8KB 4P1BH 2BMOA 4QURA 5KLVE 3C0DA 1P84E 2GBXA 2NVGA 4NB8D 3VMHD 3GOBA 1ULIA 4NBGD 2DE7D 4QDDA 4NBEA 1NDOA 3VMGA 4PV1D 1O7HA 2DE5D 1BCCE 5KLIC 1VM9A 4QDCA 4NBHA 4QDFA 2BCCE 4NB9A 2E76D 2E75D 4AIVA 4HJLA 5HL4A 2Q3WA 3GZYA 4NBAD 3L73E 2ZT9D 2BMQA 3FOUA 1WQLA 4HM4A 2E74D 1VCKA 2FYNC 3VMID 1SQPE 4AAYB 3EQQA 2NUKA 4HM0A 4H44D 4HM5A 1NTZE 4OGQD 2FYUE 2HMJA 2DE6A 2HMMA 2HMKA 1O7MA 2XSOA 1PP9E 5AEWA 4NBBA 3H1JE 1L0LE 1RFSA 3GTEA 4PD4E 1SQXE 1ULJA 4NBFA 4QDFB 1EG9A 1FQTA 4NBDD 2YFJA 4QUQA 3GL0A 1SQQE 4P1CH 2BMRA 1NYKA 4QCKA 1O7WA 2QJYC 1NTME 4HM2A 3VMHA 4NB9D 1KB9E 3GL2A 2DE7A 1RIEA 3H1IE 2DE5A 4U3FE 2QJPC 1NU1E 3VCPA 4NBCD 1O7NA 2ZYLA 3GB4A 4NBAA 2QJKC 2NVEA 3GKQA 3N0QA 1SQVE 2IBZE 4QUPA 4HKVA 3CX5E 3EN1A 2YFLA 4HM3A 2YVJB 3VCAA 2GBWA 2NVFA 1Z01A 4H13D 4NBBD 3DQYA 1VF5D 1EZVE 4NBED 3VMGD 1BE3E 2QPZA 4NBFD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWB E;  4EMJ B;  3BCC E;  2B1X A;  2JZA A;  2JO6 A;  2XRX A;  4HM8 A;  4NBH D;  4NB8 A;  3H1H E;  4NBG A;  1ZRT E;  3L72 E;  2I7F A;  3GCE A;  1Q90 C;  1SQB E;  3D89 A;  5KKZ C;  1UUV A;  4HM1 A;  2E4Q A;  3L74 E;  1PPJ E;  2HMN A;  3GZX A;  1G8J B;  1UUW A;  1L0N E;  1NTK E;  3H1K E;  2D2C D;  3GTS A;  2E4P A;  2NUM A;  3TGU E;  2YIU C;  2A06 E;  1JM1 A;  3VMI A;  2DE6 D;  1O7G A;  3L70 E;  2NWF A;  5AEU A;  3GCF A;  3L71 E;  1WW9 A;  3CXH E;  4H0L D;  4HM7 A;  2XSH A;  2XR8 A;  2HMO A;  4NBC A;  3AZC A;  1SJG A;  2HML A;  2B24 A;  2YFI A;  5BOK A;  4HM6 A;  1Z03 A;  2CKF A;  5CXM A;  3L75 E;  1KYO E;  1Z02 A;  4NBD A;  1O7P A;  3GKE A;  3H1L E;  1G8K B;  4P1B H;  2BMO A;  4QUR A;  5KLV E;  3C0D A;  1P84 E;  2GBX A;  2NVG A;  4NB8 D;  3VMH D;  3GOB A;  1ULI A;  4NBG D;  2DE7 D;  4QDD A;  4NBE A;  1NDO A;  3VMG A;  4PV1 D;  1O7H A;  2DE5 D;  1BCC E;  5KLI C;  1VM9 A;  4QDC A;  4NBH A;  4QDF A;  2BCC E;  4NB9 A;  2E76 D;  2E75 D;  4AIV A;  4HJL A;  5HL4 A;  2Q3W A;  3GZY A;  4NBA D;  3L73 E;  2ZT9 D;  2BMQ A;  3FOU A;  1WQL A;  4HM4 A;  2E74 D;  1VCK A;  2FYN C;  3VMI D;  1SQP E;  4AAY B;  3EQQ A;  2NUK A;  4HM0 A;  4H44 D;  4HM5 A;  1NTZ E;  4OGQ D;  2FYU E;  2HMJ A;  2DE6 A;  2HMM A;  2HMK A;  1O7M A;  2XSO A;  1PP9 E;  5AEW A;  4NBB A;  3H1J E;  1L0L E;  1RFS A;  3GTE A;  4PD4 E;  1SQX E;  1ULJ A;  4NBF A;  4QDF B;  1EG9 A;  1FQT A;  4NBD D;  2YFJ A;  4QUQ A;  3GL0 A;  1SQQ E;  4P1C H;  2BMR A;  1NYK A;  4QCK A;  1O7W A;  2QJY C;  1NTM E;  4HM2 A;  3VMH A;  4NB9 D;  1KB9 E;  3GL2 A;  2DE7 A;  1RIE A;  3H1I E;  2DE5 A;  4U3F E;  2QJP C;  1NU1 E;  3VCP A;  4NBC D;  1O7N A;  2ZYL A;  3GB4 A;  4NBA A;  2QJK C;  2NVE A;  3GKQ A;  3N0Q A;  1SQV E;  2IBZ E;  4QUP A;  4HKV A;  3CX5 E;  3EN1 A;  2YFL A;  4HM3 A;  2YVJ B;  3VCA A;  2GBW A;  2NVF A;  1Z01 A;  4H13 D;  4NBB D;  3DQY A;  1VF5 D;  1EZV E;  4NBE D;  3VMG D;  1BE3 E;  2QPZ A;  4NBF D; 
#chains in the Genus database with same CATH topology
 3CWB E;  4EMJ B;  3BCC E;  2B1X A;  2JZA A;  2JO6 A;  2XRX A;  4HM8 A;  4NBH D;  4NB8 A;  3H1H E;  4NBG A;  1ZRT E;  3L72 E;  2I7F A;  3GCE A;  1Q90 C;  1SQB E;  3D89 A;  5KKZ C;  1UUV A;  4HM1 A;  2E4Q A;  3L74 E;  1PPJ E;  2HMN A;  3GZX A;  1G8J B;  1UUW A;  1L0N E;  1NTK E;  3H1K E;  2D2C D;  3GTS A;  2E4P A;  2NUM A;  3TGU E;  2YIU C;  2A06 E;  1JM1 A;  3VMI A;  2DE6 D;  1O7G A;  3L70 E;  2NWF A;  5AEU A;  3GCF A;  3L71 E;  1WW9 A;  3CXH E;  4H0L D;  4HM7 A;  2XSH A;  2XR8 A;  2HMO A;  4NBC A;  3AZC A;  1SJG A;  2HML A;  2B24 A;  2YFI A;  5BOK A;  4HM6 A;  1Z03 A;  2CKF A;  5CXM A;  3L75 E;  1KYO E;  1Z02 A;  4NBD A;  1O7P A;  3GKE A;  3H1L E;  1G8K B;  4P1B H;  2BMO A;  4QUR A;  5KLV E;  3C0D A;  1P84 E;  2GBX A;  2NVG A;  4NB8 D;  3VMH D;  3GOB A;  1ULI A;  4NBG D;  2DE7 D;  4QDD A;  4NBE A;  1NDO A;  3VMG A;  4PV1 D;  1O7H A;  2DE5 D;  1BCC E;  5KLI C;  1VM9 A;  4QDC A;  4NBH A;  4QDF A;  2BCC E;  4NB9 A;  2E76 D;  2E75 D;  4AIV A;  4HJL A;  5HL4 A;  2Q3W A;  3GZY A;  4NBA D;  3L73 E;  2ZT9 D;  2BMQ A;  3FOU A;  1WQL A;  4HM4 A;  2E74 D;  1VCK A;  2FYN C;  3VMI D;  1SQP E;  4AAY B;  3EQQ A;  2NUK A;  4HM0 A;  4H44 D;  4HM5 A;  1NTZ E;  4OGQ D;  2FYU E;  2HMJ A;  2DE6 A;  2HMM A;  2HMK A;  1O7M A;  2XSO A;  1PP9 E;  5AEW A;  4NBB A;  3H1J E;  1L0L E;  1RFS A;  3GTE A;  4PD4 E;  1SQX E;  1ULJ A;  4NBF A;  4QDF B;  1EG9 A;  1FQT A;  4NBD D;  2YFJ A;  4QUQ A;  3GL0 A;  1SQQ E;  4P1C H;  2BMR A;  1NYK A;  4QCK A;  1O7W A;  2QJY C;  1NTM E;  4HM2 A;  3VMH A;  4NB9 D;  1KB9 E;  3GL2 A;  2DE7 A;  1RIE A;  3H1I E;  2DE5 A;  4U3F E;  2QJP C;  1NU1 E;  3VCP A;  4NBC D;  1O7N A;  2ZYL A;  3GB4 A;  4NBA A;  2QJK C;  2NVE A;  3GKQ A;  3N0Q A;  1SQV E;  2IBZ E;  4QUP A;  4HKV A;  3CX5 E;  3EN1 A;  2YFL A;  4HM3 A;  2YVJ B;  3VCA A;  2GBW A;  2NVF A;  1Z01 A;  4H13 D;  4NBB D;  3DQY A;  1VF5 D;  1EZV E;  4NBE D;  3VMG D;  1BE3 E;  2QPZ A;  4NBF D; 
#chains in the Genus database with same CATH homology
 3CWB E;  4EMJ B;  3BCC E;  2B1X A;  2JZA A;  2JO6 A;  2XRX A;  4HM8 A;  4NBH D;  4NB8 A;  3H1H E;  4NBG A;  1ZRT E;  3L72 E;  2I7F A;  3GCE A;  1Q90 C;  1SQB E;  3D89 A;  5KKZ C;  1UUV A;  4HM1 A;  2E4Q A;  3L74 E;  1PPJ E;  2HMN A;  3GZX A;  1G8J B;  1UUW A;  1L0N E;  1NTK E;  3H1K E;  2D2C D;  3GTS A;  2E4P A;  2NUM A;  3TGU E;  2YIU C;  2A06 E;  1JM1 A;  3VMI A;  2DE6 D;  1O7G A;  3L70 E;  2NWF A;  5AEU A;  3GCF A;  3L71 E;  1WW9 A;  3CXH E;  4H0L D;  4HM7 A;  2XSH A;  2XR8 A;  2HMO A;  4NBC A;  3AZC A;  1SJG A;  2HML A;  2B24 A;  2YFI A;  5BOK A;  4HM6 A;  1Z03 A;  2CKF A;  5CXM A;  3L75 E;  1KYO E;  1Z02 A;  4NBD A;  1O7P A;  3GKE A;  3H1L E;  1G8K B;  4P1B H;  2BMO A;  4QUR A;  5KLV E;  3C0D A;  1P84 E;  2GBX A;  2NVG A;  4NB8 D;  3VMH D;  3GOB A;  1ULI A;  4NBG D;  2DE7 D;  4QDD A;  4NBE A;  1NDO A;  3VMG A;  4PV1 D;  1O7H A;  2DE5 D;  1BCC E;  5KLI C;  1VM9 A;  4QDC A;  4NBH A;  4QDF A;  2BCC E;  4NB9 A;  2E76 D;  2E75 D;  4AIV A;  4HJL A;  5HL4 A;  2Q3W A;  3GZY A;  4NBA D;  3L73 E;  2ZT9 D;  2BMQ A;  3FOU A;  1WQL A;  4HM4 A;  2E74 D;  1VCK A;  2FYN C;  3VMI D;  1SQP E;  4AAY B;  3EQQ A;  2NUK A;  4HM0 A;  4H44 D;  4HM5 A;  1NTZ E;  4OGQ D;  2FYU E;  2HMJ A;  2DE6 A;  2HMM A;  2HMK A;  1O7M A;  2XSO A;  1PP9 E;  5AEW A;  4NBB A;  3H1J E;  1L0L E;  1RFS A;  3GTE A;  4PD4 E;  1SQX E;  1ULJ A;  4NBF A;  4QDF B;  1EG9 A;  1FQT A;  4NBD D;  2YFJ A;  4QUQ A;  3GL0 A;  1SQQ E;  4P1C H;  2BMR A;  1NYK A;  4QCK A;  1O7W A;  2QJY C;  1NTM E;  4HM2 A;  3VMH A;  4NB9 D;  1KB9 E;  3GL2 A;  2DE7 A;  1RIE A;  3H1I E;  2DE5 A;  4U3F E;  2QJP C;  1NU1 E;  3VCP A;  4NBC D;  1O7N A;  2ZYL A;  3GB4 A;  4NBA A;  2QJK C;  2NVE A;  3GKQ A;  3N0Q A;  1SQV E;  2IBZ E;  4QUP A;  4HKV A;  3CX5 E;  3EN1 A;  2YFL A;  4HM3 A;  2YVJ B;  3VCA A;  2GBW A;  2NVF A;  1Z01 A;  4H13 D;  4NBB D;  3DQY A;  1VF5 D;  1EZV E;  4NBE D;  3VMG D;  1BE3 E;  2QPZ A;  4NBF D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...