2XRDA

Structure of the n-terminal four domains of the complement regulator rat crry
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
253
structure length
248
Chain Sequence
QCPAPPLFPYAKPINPDESTFPVGTSLKYECRPGYIKRQFSITCEVNSVWTSPQDVCIRKQCETPLDPQNGIVHVNTDIRFGSSITYTCNEGYRLIGSSSAMCIISDQSVAWDAEAPICESIPCEIPPSIPNGDFFSPDFHYGMVVTYQCNTDARGKKLFNLVGEPSIHCTSIDGQVGVWSGPPPQCIELNKCTPPHVENAVIVSKNKSLFSLRDMVEFRCQDGFMMKGDSSVYCRSLNRWEPQPSCA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COMPLEMENT REGULATORY PROTEIN CRRY
publication title Structures of the Rat Complement Regulator Crry.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Immune system
total genus 41
structure length 248
sequence length 253
ec nomenclature
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2xrdA03
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2xrdA02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2xrdA01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2xrdA04
1GHQB 2KMSA 3INBC 4B2SA 2KRIA 3OEDC 1TPNA 4K12A 1QO6A 3ZD2A 3GXEA 2A55A 2IZ4A 1C1ZA 1MD8A 2UWNA 1G4FA 4DJZA 4FXGG 1GPZA 4MUCA 2B5ID 4ZH1D 2RKYA 3O8EB 1H03P 1E5GA 1E88A 2O39C 1QUBA 1HFHA 2QY0A 4PZ5A 4J38B 4JHSA 1Q3XA 2EHFA 2BZMA 1OJWA 2W80A 3EJHA 1OJVA 2RL0A 2XWJI 3RJ3D 3TVJA 2XQWC 3IX0A 1E8BA 1HFIA 2JGWA 4ONTD 4AYMA 1UOTP 2RKZA 1PPQA 2XRDA 3SW0X 1VVDA 3GOVA 4LOTA 4IGDA 1TPMA 2MCZA 1Z92B 2YBYA 3IU3I 3KXVA 4A5WB 5HZPB 1SRZA 1TPGA 1NWVA 5HYUB 3ZD1A 2XRBA 5I0QB 4AYIA 4AYEA 3ZRZA 3ERBA 1H2QP 3M7PA 2MCYA 2IZ3A 4C16A 4CSYA 4F4OC 4LOSA 1H04P 2G7IA 4AYDA 1CKLA 3KZJA 4YNXA 3R62A 2CKUA 1FBRA 3L89M 4WJG2 1SS2A 2RLQA 2V8EA 1GKGA 3MQLA 2JRAA 1HCCA 1GKNA 1OJYA 3OXUD 5FO8C 2JGXA 2YRAA 5JPMG 3CALA 1VVCA 1MD7A 1O9AA 2LOJA 5HYPA 2EC3A 2RLPA 2W81A 4KKDA 3OP8A 1G4GA 1LY2A 2ERJA 1OK1A 1QGBA 1U5MA 1OK9A 2WIIC 1OK2A 1OK3A 5HYTB 2CG7A 4B2RA 3NFPI 2XWBF 1H2PP 1ZJKA 1ELVA 2CG6A 3T5OA
chains in the Genus database with same CATH superfamily
1GHQB 2KMSA 3INBC 4B2SA 2KRIA 3ZLEA 3OEDC 1TPNA 4K12A 3K3TA 1QO6A 3ZD2A 3GXEA 2A55A 2IZ4A 1C1ZA 1MD8A 2UWNA 1G4FA 4DJZA 4PO7A 5DN5A 4FXGG 1GPZA 4MUCA 2B5ID 4ZH1D 2RKYA 3O8EB 1H03P 1E5GA 1E88A 2O39C 1QUBA 4BWCA 1HFHA 2QY0A 4PZ5A 4J38B 4JHSA 1Q3XA 3WSYA 2EHFA 2BZMA 1OJWA 2W80A 3EJHA 3CI0J 1OJVA 2RL0A 2XWJI 3RJ3D 3TVJA 2XQWC 3IX0A 4YIZA 3VWOA 2I2LA 1E8BA 1HFIA 2JGWA 3WSXA 3F6KA 4ONTD 2Y8TA 4AYMA 1UOTP 2RKZA 1PPQA 5DN4A 2XRDA 3SW0X 1VVDA 3GOVA 4LOTA 4IGDA 1TPMA 2MCZA 2Y8SA 1Z92B 2YBYA 3IU3I 3KXVA 3ZLDA 4A5WB 5HZPB 1SRZA 2X2ZA 4APLA 1TPGA 1NWVA 5HYUB 3ZD1A 2ZYCA 2XRBA 5I0QB 4AYIA 4AYEA 3ZRZA 3ERBA 1H2QP 3M7PA 2MCYA 2IZ3A 4C16A 4CSYA 4F4OC 4LOSA 1H04P 2Y8RA 2G7IA 4AYDA 1CKLA 3KZJA 4YNXA 3R62A 2CKUA 1FBRA 3L89M 4N7EA 1SS2A 2RLQA 4WJG2 2V8EA 1GKGA 1RLHA 3MQLA 2JRAA 1HCCA 1GKNA 1OJYA 3OXUD 5FO8C 2JGXA 2YRAA 5JPMG 3CALA 1VVCA 1MD7A 1O9AA 2LOJA 5HYPA 2EC3A 2RLPA 2W81A 4KKDA 3FGRA 3OP8A 3NJAA 3FGTA 1G4GA 1LY2A 2ERJA 1OK1A 1QGBA 1U5MA 1OK9A 2WIIC 1OK2A 1OK3A 5HYTB 2CG7A 4B2RA 3NFPI 2XWBF 4MSLA 1H2PP 1ZJKA 1ELVA 2CG6A 3T5OA
chains in the Genus database with same CATH topology
1GHQB 2KMSA 3INBC 4B2SA 2KRIA 3OEDC 1TPNA 4K12A 1QO6A 3ZD2A 3GXEA 2A55A 2IZ4A 1C1ZA 1MD8A 2UWNA 1G4FA 4DJZA 4FXGG 1GPZA 4MUCA 2B5ID 4ZH1D 2RKYA 3O8EB 1H03P 1E5GA 1E88A 2O39C 1QUBA 1HFHA 2QY0A 4PZ5A 4J38B 4JHSA 1Q3XA 2EHFA 2BZMA 1OJWA 2W80A 3EJHA 1OJVA 2RL0A 2XWJI 3RJ3D 3TVJA 2XQWC 3IX0A 1E8BA 1HFIA 2JGWA 4ONTD 4AYMA 1UOTP 2RKZA 1PPQA 2XRDA 3SW0X 1VVDA 3GOVA 4LOTA 4IGDA 1TPMA 2MCZA 1Z92B 2YBYA 3IU3I 3KXVA 4A5WB 5HZPB 1SRZA 1TPGA 1NWVA 5HYUB 3ZD1A 2XRBA 5I0QB 4AYIA 4AYEA 3ZRZA 3ERBA 1H2QP 3M7PA 2MCYA 2IZ3A 4C16A 4CSYA 4F4OC 4LOSA 1H04P 2G7IA 4AYDA 1CKLA 3KZJA 4YNXA 3R62A 2CKUA 1FBRA 3L89M 4WJG2 1SS2A 2RLQA 2V8EA 1GKGA 3MQLA 2JRAA 1HCCA 1GKNA 1OJYA 3OXUD 5FO8C 2JGXA 2YRAA 5JPMG 3CALA 1VVCA 1MD7A 1O9AA 2LOJA 5HYPA 2EC3A 2RLPA 2W81A 4KKDA 3OP8A 1G4GA 1LY2A 2ERJA 1OK1A 1QGBA 1U5MA 1OK9A 2WIIC 1OK2A 1OK3A 5HYTB 2CG7A 4B2RA 3NFPI 2XWBF 1H2PP 1ZJKA 1ELVA 2CG6A 3T5OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GHQ B;  2KMS A;  3INB C;  4B2S A;  2KRI A;  3OED C;  1TPN A;  4K12 A;  1QO6 A;  3ZD2 A;  3GXE A;  2A55 A;  2IZ4 A;  1C1Z A;  1MD8 A;  2UWN A;  1G4F A;  4DJZ A;  4FXG G;  1GPZ A;  4MUC A;  2B5I D;  4ZH1 D;  2RKY A;  3O8E B;  1H03 P;  1E5G A;  1E88 A;  2O39 C;  1QUB A;  1HFH A;  2QY0 A;  4PZ5 A;  4J38 B;  4JHS A;  1Q3X A;  2EHF A;  2BZM A;  1OJW A;  2W80 A;  3EJH A;  1OJV A;  2RL0 A;  2XWJ I;  3RJ3 D;  3TVJ A;  2XQW C;  3IX0 A;  1E8B A;  1HFI A;  2JGW A;  4ONT D;  4AYM A;  1UOT P;  2RKZ A;  1PPQ A;  2XRD A;  3SW0 X;  1VVD A;  3GOV A;  4LOT A;  4IGD A;  1TPM A;  2MCZ A;  1Z92 B;  2YBY A;  3IU3 I;  3KXV A;  4A5W B;  5HZP B;  1SRZ A;  1TPG A;  1NWV A;  5HYU B;  3ZD1 A;  2XRB A;  5I0Q B;  4AYI A;  4AYE A;  3ZRZ A;  3ERB A;  1H2Q P;  3M7P A;  2MCY A;  2IZ3 A;  4C16 A;  4CSY A;  4F4O C;  4LOS A;  1H04 P;  2G7I A;  4AYD A;  1CKL A;  3KZJ A;  4YNX A;  3R62 A;  2CKU A;  1FBR A;  3L89 M;  4WJG 2;  1SS2 A;  2RLQ A;  2V8E A;  1GKG A;  3MQL A;  2JRA A;  1HCC A;  1GKN A;  1OJY A;  3OXU D;  5FO8 C;  2JGX A;  2YRA A;  5JPM G;  3CAL A;  1VVC A;  1MD7 A;  1O9A A;  2LOJ A;  5HYP A;  2EC3 A;  2RLP A;  2W81 A;  4KKD A;  3OP8 A;  1G4G A;  1LY2 A;  2ERJ A;  1OK1 A;  1QGB A;  1U5M A;  1OK9 A;  2WII C;  1OK2 A;  1OK3 A;  5HYT B;  2CG7 A;  4B2R A;  3NFP I;  2XWB F;  1H2P P;  1ZJK A;  1ELV A;  2CG6 A;  3T5O A; 
#chains in the Genus database with same CATH topology
 1GHQ B;  2KMS A;  3INB C;  4B2S A;  2KRI A;  3ZLE A;  3OED C;  1TPN A;  4K12 A;  3K3T A;  1QO6 A;  3ZD2 A;  3GXE A;  2A55 A;  2IZ4 A;  1C1Z A;  1MD8 A;  2UWN A;  1G4F A;  4DJZ A;  4PO7 A;  5DN5 A;  4FXG G;  1GPZ A;  4MUC A;  2B5I D;  4ZH1 D;  2RKY A;  3O8E B;  1H03 P;  1E5G A;  1E88 A;  2O39 C;  1QUB A;  4BWC A;  1HFH A;  2QY0 A;  4PZ5 A;  4J38 B;  4JHS A;  1Q3X A;  3WSY A;  2EHF A;  2BZM A;  1OJW A;  2W80 A;  3EJH A;  3CI0 J;  1OJV A;  2RL0 A;  2XWJ I;  3RJ3 D;  3TVJ A;  2XQW C;  3IX0 A;  4YIZ A;  3VWO A;  2I2L A;  1E8B A;  1HFI A;  2JGW A;  3WSX A;  3F6K A;  4ONT D;  2Y8T A;  4AYM A;  1UOT P;  2RKZ A;  1PPQ A;  5DN4 A;  2XRD A;  3SW0 X;  1VVD A;  3GOV A;  4LOT A;  4IGD A;  1TPM A;  2MCZ A;  2Y8S A;  1Z92 B;  2YBY A;  3IU3 I;  3KXV A;  3ZLD A;  4A5W B;  5HZP B;  1SRZ A;  2X2Z A;  4APL A;  1TPG A;  1NWV A;  5HYU B;  3ZD1 A;  2ZYC A;  2XRB A;  5I0Q B;  4AYI A;  4AYE A;  3ZRZ A;  3ERB A;  1H2Q P;  3M7P A;  2MCY A;  2IZ3 A;  4C16 A;  4CSY A;  4F4O C;  4LOS A;  1H04 P;  2Y8R A;  2G7I A;  4AYD A;  1CKL A;  3KZJ A;  4YNX A;  3R62 A;  2CKU A;  1FBR A;  3L89 M;  4N7E A;  1SS2 A;  2RLQ A;  4WJG 2;  2V8E A;  1GKG A;  1RLH A;  3MQL A;  2JRA A;  1HCC A;  1GKN A;  1OJY A;  3OXU D;  5FO8 C;  2JGX A;  2YRA A;  5JPM G;  3CAL A;  1VVC A;  1MD7 A;  1O9A A;  2LOJ A;  5HYP A;  2EC3 A;  2RLP A;  2W81 A;  4KKD A;  3FGR A;  3OP8 A;  3NJA A;  3FGT A;  1G4G A;  1LY2 A;  2ERJ A;  1OK1 A;  1QGB A;  1U5M A;  1OK9 A;  2WII C;  1OK2 A;  1OK3 A;  5HYT B;  2CG7 A;  4B2R A;  3NFP I;  2XWB F;  4MSL A;  1H2P P;  1ZJK A;  1ELV A;  2CG6 A;  3T5O A; 
#chains in the Genus database with same CATH homology
 1GHQ B;  2KMS A;  3INB C;  4B2S A;  2KRI A;  3OED C;  1TPN A;  4K12 A;  1QO6 A;  3ZD2 A;  3GXE A;  2A55 A;  2IZ4 A;  1C1Z A;  1MD8 A;  2UWN A;  1G4F A;  4DJZ A;  4FXG G;  1GPZ A;  4MUC A;  2B5I D;  4ZH1 D;  2RKY A;  3O8E B;  1H03 P;  1E5G A;  1E88 A;  2O39 C;  1QUB A;  1HFH A;  2QY0 A;  4PZ5 A;  4J38 B;  4JHS A;  1Q3X A;  2EHF A;  2BZM A;  1OJW A;  2W80 A;  3EJH A;  1OJV A;  2RL0 A;  2XWJ I;  3RJ3 D;  3TVJ A;  2XQW C;  3IX0 A;  1E8B A;  1HFI A;  2JGW A;  4ONT D;  4AYM A;  1UOT P;  2RKZ A;  1PPQ A;  2XRD A;  3SW0 X;  1VVD A;  3GOV A;  4LOT A;  4IGD A;  1TPM A;  2MCZ A;  1Z92 B;  2YBY A;  3IU3 I;  3KXV A;  4A5W B;  5HZP B;  1SRZ A;  1TPG A;  1NWV A;  5HYU B;  3ZD1 A;  2XRB A;  5I0Q B;  4AYI A;  4AYE A;  3ZRZ A;  3ERB A;  1H2Q P;  3M7P A;  2MCY A;  2IZ3 A;  4C16 A;  4CSY A;  4F4O C;  4LOS A;  1H04 P;  2G7I A;  4AYD A;  1CKL A;  3KZJ A;  4YNX A;  3R62 A;  2CKU A;  1FBR A;  3L89 M;  4WJG 2;  1SS2 A;  2RLQ A;  2V8E A;  1GKG A;  3MQL A;  2JRA A;  1HCC A;  1GKN A;  1OJY A;  3OXU D;  5FO8 C;  2JGX A;  2YRA A;  5JPM G;  3CAL A;  1VVC A;  1MD7 A;  1O9A A;  2LOJ A;  5HYP A;  2EC3 A;  2RLP A;  2W81 A;  4KKD A;  3OP8 A;  1G4G A;  1LY2 A;  2ERJ A;  1OK1 A;  1QGB A;  1U5M A;  1OK9 A;  2WII C;  1OK2 A;  1OK3 A;  5HYT B;  2CG7 A;  4B2R A;  3NFP I;  2XWB F;  1H2P P;  1ZJK A;  1ELV A;  2CG6 A;  3T5O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...