2XRFA

Crystal structure of human uridine phosphorylase 2
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
293
structure length
289
Chain Sequence
RFVHVKNPYLDLMDEDILYHLDLGTKTHNLPAMFGDVKFVCVGGSPNRMKAFALFMHKELGFEDIKDICAGTDRYCMYKTGPVLAISHGMGIPSISIMLHELIKLLHHARCCDVTIIRIGTSGGIGIAPGTVVITDIAVDSFFKPRFEQVILDNIVTRSTELDKELSEELFNCSKEIPNFPTLVGHTMCTYDFYEGQGRLDGALCSFSREKKLDYLKRAFKAGVRNIEMESTVFAAMCGLCGLKAAVVCVTLLDRLDCDQINLPHDVLVEYQQRPQLLISNFIRRRLGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Uridine Phosphorylase 2
rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords URIDINE PHOSPHORYLASE 2
total genus 103
structure length 289
sequence length 293
chains with identical sequence B, C
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2010-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xrfA00
4L0MA 4X24A 5CYGA 1Z5NA 3DPSA 1OTXA 4QEZA 3FNQA 1A69A 3GGSA 4JP5A 5KB3A 2IQ5A 4FFSA 1JDZA 1K27A 2AI3A 4G41A 4WKCA 3KUKA 3OOHA 4K6OA 4MCHA 3P0FA 5CXSA 4DA0A 1RXSA 3NM5A 4R2WA 1SD1A 4F2WA 2XRFA 5IFKA 1Y1TA 1V4NA 1Z37A 3MB8A 3OOEA 1A9SA 4LKRA 4NS1A 5K1ZA 4YNBA 4OGKA 4TS3A 3O6VA 1Z5OA 4TXJA 1PR6A 4G8JA 1LX7A 1RYZA 4P54A 5FAKA 2QTGA 1RSZA 1ODIA 3P0EA 1VHJA 3DDOA 2QTTA 1YQUA 1PR5A 3LBAA 1Z36A 4RJ2A 1Y6RA 2A8YA 3ODGA 4BMXA 1V2HE 4MARA 2OC4A 1RFGE 3C74A 4QATA 3UAXA 3FUCA 4JWTA 1SQ6A 4WKBA 1T8RA 3FOWA 1RXUA 1PR4A 4OY3A 1U1EA 4F3KA 3KU4A 1JE0A 4DANA 3FB1A 1TD1A 2HSWA 4PR3A 4DARA 2PGAA 4YJKA 1A9RA 4M7WA 1Y1SA 3QPBA 4TXNA 3OF3A 3IEXA 1PR1A 1FXUA 3KVVA 3NBQA 4TTJA 3KHSA 1G2OA 3K8QA 4QAQA 4NY1A 1RCTE 1VMKA 1NC3A 4YMLA 3INYA 4JOSA 3EUEA 4L5CA 3DJFA 1VHWA 1OUMA 2H8GA 1V3QE 5B7PA 1JDTA 4TTAA 3UAVA 4DABA 4DA8A 3IOMA 4DA7A 4GMHA 1CB0A 1LVUA 1ODLA 4TXMA 4QASA 3BL6A 5EUBA 1XE3A 1RT9A 4L5YA 1OVGA 3KVYA 4GLFA 2AI2A 4F3CA 2Q7OE 3U40A 5F7XA 4M3NA 3PNSA 1TGVA 1WTAA 4I2VA 4D8YA 3OPVA 4TYMA 3OCCA 2QSUA 5CCDA 1T8YA 2P4SA 2QDKA 1Z34A 3EUFA 2ON6A 1A9OA 2I8AA 1K9SA 1I80A 5IU6A 4R31A 3O4VA 4M1EA 4WKPA 1ULBA 4TXLA 1RXYA 3EEIA 1ULAA 4D8VA 3E0QA 1JDSA 4F2PA 3T94A 3DP9A 5F7ZA 1VFNA 4D8XA 1QE5A 4QARA 4OJTA 1TCVA 3UAZA 1N3IA 1PBNA 1NW4A 4NSNA 2OXFA 1Z33A 1PW7A 1ODKA 1PR0A 1JE1A 1T8WA 4WKOA 1K3FA 3EMVA 4GLJA 4H1TA 4TTIA 3K8OE 4MCIA 3PHBE 3OZDA 5EPUA 4TS9A 1U1DA 4ECEA 1OV6A 1NC1A 1PR2A 3NM4A 1JPVA 2QPLA 5B7GA 1PF7E 1B8NA 1LV8A 5CYFA 1ZL2A 2AI1A 4TXHA 4IP0A 4UC0A 2RJ3A 3BSFA 4LNAA 3D1VA 3BGSA 2AC7A 4BMZA 4G89A 5B7NA 3MMSA 1TCUA 5C80A 1M73E 4OF4A 1RXCA 1Z35A 1CG6A 2B94A 1PKEA 2HRDA 4EB8A 2OC9A 5CXQA 1YR3A 3FAZA 3OZEA 1OTYA 1V41E 5CCEA 5F73A 5F7OA 3NM6B 4WKNA 3E9ZA 3LA8A 4U2KA 1T8SA 4LZWA 5ETJA 5F7JA 2BSXA 4E1VA 4D98A 3FWPA 3OZCA 5DK6A 2OECA 5F78A 4OEHA 4L5AA 4KN5A 1Z5PA 2I4TA 1Y1RA 2ISCA 4GKAA 1JYSA 4BN0A 3LGSA 4F1WA 3UAWA 3OZBA 1JDVA 1U1FA 1Y1QA 4DA6A 1V48A 1ZOSA 4PNPA 4EARA 4L6IA 5F77A 1TGYA 1OU4A 1B8OA 1SD2A 4QFBA 3UT6A 4DAEA 1JDUA 1YQQA 3SCZA 1PK7A 1U1GA 1Z39A 2A0XA 1PWYE 5I3CA 1Y6QA 2HWUA 3KVRA 4BMYA 3ONVA 1ODJA 1SJ9A 1A9QA 2A0WA 1V45E 1T0UA 4OGLA 3UAYA 1U1CA 1PK9A 2HN9A 4LDNA 3PHCA 5F76A 1YBFA 3GB9A 4DAOA 1A9PA 4R2XA 1Z38A 4LNHA 5JPCA 3PNPA 3ENZA 3TL6A 1RR6A 1C3XA 3BJEA 5EFOA 1YRYE 4YO8A 1Q1GA 3E9RA 1A9TA 4D9HA 1ECPA 2GUWA 5B7QA 3DF9A 1JP7A 2A0YA 3F8WA
chains in the Genus database with same CATH superfamily
1HL3A 1PWHA 3Q7EA 4RH1A 4RVSA 3WBJA 1UP7A 1KY2A 1BN7A 1J21A 5LB2A 2A2ZA 4K3VA 3C24A 2A0FA 4HDSA 3UB2A 4Y0AA 1AD2A 1U4SA 1DQSA 3WXBA 3KJHA 1K4MA 2VDJA 1I6KA 5EKTA 2QUIA 2IBTA 2AX4A 4IO0A 1ZWKA 4AYXA 4DYVA 3CLUC 5T6BA 1NVDA 4FQ7A 5IABA 2CKMA 2YRXA 3ADCA 3VGJA 1LU9A 1MQSA 4P86A 4QOEA 3ZPXA 3KM0A 1I36A 4KAAA 4HLDA 4OHBA 1XLTC 3JWPA 5ELMA 5EZQA 3SLRA 2V0NA 1NPDA 3C6XA 4RA6B 1MUUA 1Y6GA 1HDXA 2UYQA 3AT1A 3PFKA 1JEYB 3M3DA 3OA0A 2NSLA 4RCYA 1CUFA 3MTBA 1KK2A 1LVHA 4Y2PA 4NCJA 3UGTA 2HRBA 3HJGA 3OFJA 2WF6A 1DC3A 2BLNA 3UJ8A 1YR7A 3AKYA 4Y6SA 3OCJA 1QO0A 1OV4A 4K81B 4RHEA 3K94A 2WWVD 3RT9A 1DRUA 1LF0A 2AMLA 2BP7B 3AEYA 4F2WA 4JXZA 2JPDA 2WTBA 3ZBPA 3R5XA 3SEAA 4O2AF 5SYNA 1TYAE 1QHNA 3KKZA 4U7WA 3N6XA 4MVJH 1OFGA 2RHTA 2X4DA 2ZJ5A 4KB5A 3RQIA 1J8QA 1YQ9A 1SVUA 2LR0A 3UBMA 4Q3NA 2F1OA 2J3MA 2ZTVA 1O95A 1J00A 5K1ZA 3HJBA 2XVYA 4EA7A 4NR0A 1CC1S 3SC4A 5B2ZA 8AT1A 3GRAA 3KAKA 4NS4A 4OLBA 4HYYA 4J0IA 5AHRA 2RH8A 1EG7A 4RGQA 2OT3B 5T4EA 3I53A 3LG2A 3KUCA 5A71A 1U8FO 3E7FA 1N6KA 4HGPA 4FMDB 4GEKA 4C20A 1H65A 2IY7A 3JZIA 3RLFA 3WMEA 1VL6A 1FX1A 1XZCA 2EBWA 3IUSA 2O3TA 1LZKA 3M3PA 3SIWA 1Q22A 4KUHA 3QWHA 2GPSA 3STWA 5FOXA 3CM0A 4ARIA 2YWGA 4KBYA 4E31A 2CHGA 1ZX1A 3EZYA 3CURA 4J0HA 4JIMA 3UFXA 2A8YA 1G8FA 3IUNA 4LVCA 5E9QA 1HT3A 5TLSA 1Q74A 3IVRA 4X85A 4R1NA 1C8BA 2DETA 1R5OA 2JG3A 1GPLA 2X0JA 2R25B 3HACA 4GXNA 2RARA 5C32A 1SKMA 2GBCA 4FD3A 4WVFA 4AMVA 3HPRA 1RI3A 4RDIA 4IDGA 1ND5A 1SBNE 4Q34A 1ZN8A 1C8KA 1GKIA 2Q8QA 4JLSA 4NZPA 4B6JA 3H17A 3PIDA 1MB2A 1RE0A 2C07A 3FTEA 4KXFB 4EJSB 1RXUA 4OY3A 2IHJA 3AJDA 1V0JA 3BIXA 2D8MA 1BH2A 3AFNA 1XDSA 2WIJA 3FVRA 3NIWA 4RGVA 5AKZA 4FWBA 4MK4A 4Q7MB 3WNQA 4E2XA 4NFLA 3TKLA 2C96A 3MJDA 2VA9A 4KR7A 1ORWA 3A1CA 5JJKA 1V4BA 5KNCA 4LF7B 4RKWA 5EXPA 2H2WA 3NORA 5K0NA 3UC9A 3S5UA 1P7PA 2Q8NA 1GZ3A 4ZKDA 3L7AA 3ORSA 1IZYA 1RC0A 2POQX 2E0IA 4LN1A 3GPBA 5FQNA 1NM5C 2GAAA 2WAXA 3KQQA 1DIRA 1VSQA 2CMKA 3IP3A 5DXFA 5EXEA 1ZM7A 4ZV9A 1U28C 2C5FA 1UC9A 2PH7A 1Q0ZA 3RVOA 1T36A 1D7AA 1WPGA 4UZEA 2FPIB 1B0ZA 5BVGA 1RWOA 4QWWA 3YASA 1FU7A 4X3OA 4EYKA 2QUBA 4FZJA 5GONA 2G88A 4K2AA 3P9IA 3LLCA 4QWMA 1CZLA 1U80A 3VC1A 3WNCA 1X1BA 1RMTA 1YK1A 2QVGA 3BMCB 4AU1A 4BBJA 3BH0A 1WW2A 4QDJA 3ZD8A 4RTKA 4ZTZB 4P93A 2O2IA 2XPCA 4P3XA 2HK6A 3C6KA 3TNJA 1X7YB 4KQHA 4EFLA 3KQHA 1CWUA 1G8AA 3AHCA 2CUTA 3UMFA 5A4IS 2PRZA 4I8IA 1J1UA 2O0JA 4Q1EA 5BXYA 2GARA 2DPYA 1P4RA 3GLVA 1YZNA 2OBFA 1SC4A 2E1PA 2ZYVX 3MUOA 3X0DA 5DHQA 1SA0A 3CWCA 1CZHA 1OZGA 4TRJA 1B00A 2W83A 2HHLA 3ZQ6A 3QWBA 2RK4A 2EBFX 3TZEA 4ESOA 1Y4DE 2B4QA 3PGXA 3FNIA 1ODLA 3LW7A 4C4SA 2PRSA 1EHIA 3M6AA 5AVVA 4YUWA 5IP5A 5FNZA 4ZEXA 3ZBUA 4E5PA 3EIHA 3BL6A 4GVPA 2QB5A 2LBPA 2XMGA 4D74A 2SKDA 4N5HX 3WGQA 1HYBA 4F21A 3KLNA 1N32B 4JASB 4EDHA 2AN4A 1S3IA 2PQ6A 16PKA 1XZIA 5CLHA 5TGTA 1TAQA 1X1DA 4B4OA 3DQQA 2R8ZA 5JNUA 2X9QA 4I7EA 2QUJA 2XAAA 5CDHA 2GAOA 3MXOA 1MF7A 4D26A 3W1WA 4CKWB 1V47A 1PZXA 5K8CA 3AF3A 4I2VA 1G4UR 3DJYA 3FPSA 2Q3FA 4H08A 3X1MA 3S2GA 3CUUA 4OMFG 5KYVA 4ZK2A 2HZ7A 4QOHA 2I67A 3A05A 3QKTA 1CW2B 1VJ1A 1EPUA 1U2TA 4QPNA 1Z4MA 1OFIA 1E1CA 1HLFA 1V7CA 5J5VA 1MD9A 1P5HA 1PT9A 3RK0A 4A8HA 4BFVA 3A28A 3OEWA 5FEUA 1BWPA 2C57A 3TG8A 4PSUA 1Q95A 1JTEA 1NT2A 2C5SA 2HPZA 1EK1A 3C7DB 3ET4A 3SEQA 3M1YA 3CUTA 2VQEB 1A8HA 4GG1A 2BE9A 5I8PA 5ICGA 2PLFA 1WBDA 4JENA 2ONZA 2PWYA 4AIIA 1V8PA 1U8UA 2X2FA 3OJCA 4OHOA 4WXRA 5ALDA 4D8VA 4FDUA 4FHEA 4CYMA 1Q7GA 2XRMA 3ETCA 2EARA 4X9XA 4U0KA 1KDTA 2Q41A 3DP9A 1WMSA 3NFYA 4XWWA 1W49A 1QVVA 4DA4A 1WZEA 4AZWA 2WHQA 2MYUA 1OT5A 3K53A 4HBZA 4PZZA 4RIEA 1NR7A 2F8MA 1L4HA 5C8XA 2WU4A 3DM5A 3DVAA 5TPWB 4FBMA 1LWNA 1Q91A 2CL0X 2ID8A 2W6QA 2QT1A 2PVPA 2I7CA 4LDZA 4Q9AA 5HQTA 3LGXA 4D92A 3PEYA 3K8YA 1HE1C 4W8HA 4R1LA 2XMCA 3QWFA 2CDAA 3JYNA 4WIAA 5EVJA 1JIXA 1WDKA 1TU0A 4M89A 4HNVA 4GM1A 2F8TA 4DJTA 3GH1A 4OA5A 1ODKA 4KBFA 5D3MA 3BIFA 3OHSX 2IOYA 5BUSA 1ZMTA 4Z3DA 2I9KA 1TQ8A 1EFLA 4KWEA 3JQCA 4A6DA 3QOFA 1RRVA 4WKOA 5DYWA 1Q1AA 4EL0A 3QLJA 2Z3ZA 4IF6A 2QQFA 1M6VB 4IJ6A 3II6X 4QNNA 3RFVA 3UT5B 2AMYA 1DEKA 4BNMA 4BMOB 4GMXA 2Q9CA 3SYRA 3G2IA 3P0HA 1WKCA 5GINE 2KJQA 3TEJA 1H5UA 3KFVA 4A8PA 2ONKA 2Z2XA 1EJ6A 1LTHR 5DCLA 2IEGA 1PUXA 3WISA 2YIDA 3K6SB 4UQPA 3KAJA 4CNBA 5EJ8A 3EVFA 1D2AA 3RF7A 2EDAA 3B2QA 5C1OA 3VUFA 2FX3A 3PYMA 5KWVA 4MQFB 4OLFA 1KJWA 4PZEA 1WBJB 4F9FA 3W7VA 4QVGA 2QPLA 2HA7A 2QTVB 1BA2A 3ORQA 2D5BA 3SOPA 4OGWA 2W22A 2FN9A 1MQAA 3LP8A 4Y2VA 3RUAA 2PU5A 3V4OA 1AF7A 4M37A 4A0HA 4B45A 4V1CI 3N8HA 3BORA 1XC7A 4R1QA 1WXDA 4RA6A 6LDHA 2ZB3A 4OH1A 1CUHA 1USVA 1H69A 4ZJZA 2Q0XA 2R6R1 3JYOA 5C7IO 2AR9A 4CBVA 3GHYA 3OZ7A 1F20A 1SUWA 2WJ6A 5F9HA 1N6RA 4I1PA 1XZMA 2ZFUA 5K0SA 3Q7PA 3KSBC 1E6CA 5BYAA 2QJFA 2QTRA 2WTAA 3QXGA 2XWJI 5D84A 3GRRA 1KAGA 2I34A 4R1OA 4DQKA 4R7ZA 4HX9A 2FP4A 4Q3KA 4IXNA 3WXMA 3NYWA 1MGPA 3CXUA 3KZOA 2AVNA 3MB5A 4PZPA 2ZKLA 2PO5A 4YP5A 4LDRA 4TL8A 1E6MA 1NVBA 3FX2A 2PFSA 4KQWA 4R4JA 4C07A 2PX2A 4MHTA 4EAQA 4HH3C 3GX1A 4UASA 4F46A 4G26A 1PI3A 1WEKA 1KZ6A 1KBZA 1RPAA 2ZJAA 2H65A 3PJGA 4D1YA 3UHFA 4X93A 1X8LA 2H29A 2FN8A 2GKGA 1T9GS 4NPAA 2B3DA 3S3TA 1YR3A 3FTDA 3R9WA 3JTEA 4Y0NA 3AM1A 4OUKX 2OM2A 4GRDA 4DXAA 2Q5LA 4CM4A 5EWLB 5IUNC 3FWHA 1QHHA 4TLLB 1TVMA 3L84A 4A10A 3SHTA 4COOA 3TLJA 4ZI3A 2EGGA 3F6RA 1I1NA 4LY9A 2P2CA 5ALNA 3FOEC 1GV0A 4LGMA 3E82A 3NHSA 1JPJA 3UTCA 4FHGA 4XQ9A 3DF7A 1IIBA 3T7EA 1EWKA 3VTAA 2JLYA 1XZFA 2ZCUA 4EUHA 5AUOB 3R0IA 3WYEA 1JVSA 4JVMA 3QJGA 5FNVF 4XWOA 1PT6A 1ZUIA 4FFMA 3FBGA 1QTQA 2BTEA 4CWAA 3I8OA 3AFGA 4N0MA 4TMTA 3MMNA 3KTOA 2PU7A 4G9BA 4RYLA 2D0IA 3PC8C 1GXSA 2QXUA 3LKVA 4M1QA 4NOLA 4MVJI 1JR3D 3B9BA 3O91A 4NTZA 4BDSA 4KU4A 5LLTA 2OHOA 3ES9A 3OM1A 4MV8A 5HM6A 4KN5A 4GOJA 4W1SA 5DYIA 3W2GA 1WSBA 2QXYA 4B3SB 1L7XA 1LRJA 2XCUA 1GLVA 2I4TA 4JZYA 2QZ9A 5TQVA 3VX3A 3IQDB 3WL7A 2G9VA 2R6HA 5C37A 3P9CA 5E9WA 1SHUX 4LJSA 4YDSA 4CL2A 3FNBA 1DC8A 2ADOA 4AS1A 4A23A 4ZDWA 4R9VA 1OA1A 1NIPA 1BX1A 1NR1A 2Z98A 4WTOA 3KSAC 1PJ2A 3H6GA 3F2VA 2X0DA 3V3TA 3VR6H 2BHRA 1EIZA 3QIAA 2JLWA 1IG3A 5JV5A 3ZEAA 2EW8A 4CN8A 2J7KA 3GUVA 2JVIA 1V8BA 4R98A 2HMUA 4MKGA 2GJAA 4B85A 5E9JA 1ACLA 4Z4FA 2KB0A 2IHZA 3R3ZA 2JARA 3UJ6A 2GTPA 2OV6A 3R3JA 5F77A 2HXSA 3CA8A 1A95A 4GC5A 1J23A 2BUCA 3TZHA 4IMPA 1IQRA 3K2IA 4RV5A 1SD2A 4JWKA 4LBVA 2A9RA 1N5OX 1GDTA 1LRLA 1DP4A 3EIFA 5CJ2A 2PUDA 4Q01A 1PL6A 2AA3A 4N8SA 5EE0A 3P0RA 1QZTA 3IOCA 4HDNB 3S68A 3VKHA 4N18A 5AFSA 3VPSA 4TTSA 4AM8A 2BSQA 2CLIB 3IP6A 3QNWA 5K0EA 2XEDA 4EG1A 4Z8XA 4G0MA 4UVEA 3NATA 1JQKA 2HWUA 1PV1A 2O2HA 3RUHA 5BQ5A 2GM5A 1FUUA 2EG9A 4D99A 5A3RA 1Z6XA 1MPTA 4BMYA 3KCNA 2A9PA 3G8CA 4P4LA 4R8MA 1Q7TA 4OHVA 1CF4A 1S2GA 2ZBGA 3OAAD 1KI6B 1ULHA 1Y3CE 2CXXA 2GHTA 1JI0A 2QF7A 4KP7A 4NYJR 1CNMA 2FMIA 1W88B 4GP9A 3TZCA 1GG8A 2DU8A 2GDZA 1P19A 3CLRC 3EISA 2Q3MA 3WGNA 5DNWA 1AKVA 2QD1A 1VJRA 4WHMA 5H3LA 2FYTA 4CKBA 4Q9KA 5CDFE 1UKEA 1EINA 3NZEA 4M8LA 1NBOA 4DGQA 1YR6A 2BKXA 2P30A 2PMDA 4NFSA 1GA1A 1RVDA 2JGEA 4JMLA 1JXMA 2XRYA 3TDKA 4P36A 1BEZA 3KR0A 5BW5A 3N8NA 2JDIA 1OH7A 4DMHA 2ZPTX 1BXRB 3PNPA 4IG4A 1JL3A 4I3GA 5CVVA 3TFQA 5FTJA 4EJ0A 1QO9A 4RVCA 1P4SA 5EIBC 4IJKA 4QULA 2ARKA 1E2MA 2IU4A 4RHFA 1VGRA 3M6MD 4O63O 1EK0A 1DBQA 1Y9DA 5LP6C 4KYVA 1A5ZA 4AKSA 5MN4A 1FJGB 4IGFA 3WG9A 3EXFB 2VJDA 2VNJA 2HX1A 4JDUA 3AVPA 5AM2A 4BZZA 2X2PA 3SHOA 3SYNA 3ON5A 3MLEA 4JC0A 2A67A 5H68A 3RHZA 1P1CA 4NH4A 2Q8PA 2FUG1 3DFFA 3CHYA 4E08A 1V7ZA 3UJ3X 5ITZB 4U2BA 1ZD4A 2BKVA 2HUNA 3N1UA 2F9LA 2EKZA 4MW9A 5JWRA 5ALKA 3GLGA 3RRZA 2QIPA 4ILEA 5SZHB 3I34X 3UMRA 3SBDA 1OGYA 1BXRA 1E1CB 4JUIA 1IEWA 4PXSA 4X8HA 1U3DA 2ZZKA 2GEJA 1JR3E 2J4DA 4UUMA 4ESEA 1UBSB 3V2IA 2XF2A 4X24A 1ZK4A 1RAIA 2IE8A 1RJGA 3VJMA 4LXYA 1D2MA 1DIHA 3H4MA 3EWNA 5BNWA 1K7FB 3M0EA 4LQ4A 2FPPA 2EW1A 4GGOA 3DP7A 1CRPA 2GOYA 2CB9A 5FJIA 3UK6A 4W6ZA 1PJQA 2E82A 2VP6A 4U1RA 2F1KA 4DNFA 3Q11A 2JBWA 4X7MA 5ADHA 2X14A 2D54A 3GJ8A 1M66A 5ALOA 4Y6LA 5G02A 3I3OA 3NYRA 1HSZA 1RJDA 4B3CA 1VKNA 1C29B 3DULA 2DR2A 1H2AS 3Q3IA 1V4VA 1XN4A 3N76A 2LZ0A 4G4JA 2GZAA 2YH2A 1GKUB 3LFTA 3W5HA 4OV6B 3THYB 2GFQA 3V1KA 1R66A 3C3KA 3PG5A 4OHFA 1ZGCA 3EW7A 3R3VA 2H9YA 4M38A 5JAPA 3B1VA 2XHZA 4IKEA 3VPGA 3GJYA 2G09A 2RGYA 4HMOA 2QE7A 3FLEA 3MOGA 3TQFA 3ZCQA 821PA 2VWQA 2WP0A 4J4BA 5G1OA 4MRAA 4P7GA 2YQ5A 3EIQA 4CTJA 2AYYA 2HCRA 3ANYB 4U7HA 1T4DA 4UPDA 1HBJA 3KS9A 4NCNA 1UEIA 3F8TA 4GX1A 4TWRA 8ADHA 4W5TA 5LN1A 2BFMA 2GRJA 2PGIA 4DR3B 5JDCC 4PX5A 4K7JA 2VDRB 3KSMA 1JHDA 1VRWA 1IZ9A 1O2DA 1Y8RA 2H0RA 3FGOA 3O26A 3AEQA 3F5DA 3MYYA 4P34A 4G07A 1TTPB 4JEIA 3OO0A 4WY8A 1XO1A 5B3JA 4EUEA 1E7WA 5JLJA 1QZZA 3JQBA 3WL8A 4WY5A 5A3VA 3G2QA 4JB8A 4QYMA 4EUNA 3UICA 3OFKA 2W2XA 4FMPA 1U2DA 3LIPA 4RM2A 5BR4A 3FKJA 1NYRA 2IITA 1YCDA 4BP1A 1AGYA 4YP9A 3WRXC 1PR5A 4DM4A 1NJ1A 3AHDA 4MYUA 1SC1A 3U9SA 1JQJC 2VQ6A 2CHUA 3KLBA 3LLVA 3QTTA 5A9SB 3DEFA 1TC1A 1E32A 1V2HE 1ZITA 3EQ7A 3JQPA 4LYGA 4UCWA 4XXHA 2Z6AA 3KZMA 3W5JA 1YDHA 1CZKA 4RZ3A 2ZSUA 3OLZA 4NZNA 2VKQA 1GU7A 1IB6A 2R3SA 2QTLA 1D4FA 3H1PA 1T3LA 1ZPDA 1O94A 4KOEC 1NW6A 3C15C 1CTQA 2AOUB 2I4MA 3NIGB 2OAQ1 4FWIB 3RS3A 1NUHA 2IUTA 3LZCA 2GVZC 3AI2A 2C4UA 2P3QA 2FVYA 3OLWA 3SJ7A 1Z6PA 3OVMA 4QVIA 2Y93A 2DKFA 2GTIA 3AK4A 3ZI7A 1LUAA 6YASA 4LJAA 3OF5A 4Q4JA 3FOWA 1ZI8A 3IDAA 2C2BA 4RX1A 5AJWA 3RABA 2IYOA 3PS9A 3KPJA 2GESA 3MXTA 1EQ2A 4QXPA 3EPLA 1IMOA 3SQDA 2RHLA 3A10A 3HWWA 4PLZA 1W9MA 1UH5A 2EDCA 4R9SA 3ZYCA 5JZMA 2RDMA 1Q1BA 2XX3A 2YXLA 4R83A 1FDTA 1ZQ1A 2FTKE 2W6ID 1G42A 2VZ9A 2AD5A 2CWDA 1NJFA 3P32A 4NZMA 4DYDA 1KEEA 1I94B 1UJ2A 1SC3A 3DLIA 3FPHA 1LD3A 1A9RA 2YYYA 5EHIA 1ZESA 4RSHA 3HFGA 1T5BA 1PEDA 2ZU0C 4R40A 4KSCA 1KA9H 1XZJA 1TVCA 5BW4A 4PTZA 2FMKA 4M22A 1H4TA 2WILA 4Y6RA 5JCJD 4L50A 3ZJUA 2WA1A 4MR9A 3KVVA 4IGEA 3K4PA 1ZZEA 4MWZA 1ZH8A 2WWWA 4J4HA 5DHFA 3LVQE 2QG9A 3SX2A 5M29A 1BO6A 3PDJA 2QL6A 1QX3A 3NO4A 2W90A 2CHVA 3NTVA 4QAQA 2ZI5A 1TEHA 1F4LA 3ZIUA 4BHTA 1WB9A 1VMKA 1WX1A 3CEAA 4E13A 4RLHA 2C2XA 4H0FA 3HL4A 4WUTA 2H1HA 4PEVA 3TM5A 1Y4SA 3RUFA 2BW0A 3NONA 3V2GA 3QU7A 3R4CA 4YAIA 4FHFA 4OHKA 1W5AA 2YKGA 3C7TA 1C3JA 1J2JA 2A6PA 1KGDA 2I1VB 4F9EA 2CNWD 10MHA 1HGXA 1II0A 4MCJA 3ONFA 2CNLA 4HL6A 2QRKA 5JECA 5EUCA 4EQZA 3DL7A 5CFPA 3AVYA 2JJQA 3JRNA 1K7EB 2PV0A 3EZ2A 3WQRA 3AUSA 2GXSA 2CD7A 2IEDA 2IODA 3CWZA 4XX1A 4UBLA 3ZU2A 2QL7A 2F4NA 3SP1A 3HKCA 3MAJA 5CAEB 3G5UA 1CZOA 5EKXA 1CB0A 1U0SY 3KUDA 4ZU6X 1IZ7A 2C5AA 2HKIA 4QASA 1O4WA 2B2XA 3D3QA 1KSGA 3WIUA 2P6OA 3NXSA 4B87A 3E70C 4NJEA 1TTTA 1W1IA 1GQQA 1XEXB 2DSTA 3RV3A 1DJMA 1MJFA 2OVFA 2SCUB 3CR7A 3F7TA 3PX3A 4C7VA 5AVWA 4EUFA 5HQ3B 3ZGVA 1J2RA 4BCDA 4KI7A 4EMSA 1WUIS 2VDOB 3PEEA 4NV0A 2X9GA 4GLFA 3NG1A 1ZLYA 1OX6A 2RAFA 4KQGA 2H59A 4OFZA 4JJ8A 1K88A 4AD8A 3HBJA 4IZ6A 3K70B 1SZDA 1G8MA 3SOZA 5F7XA 1M8GA 1NRXA 3CJRA 3ET5A 1AXEA 4QE3A 4NU0A 4RNCA 1WD7A 4C6TB 3DE5X 3GBSA 2HO4A 3BXXA 4FR5A 3MWFA 3TCKA 1IB0A 2OD7A 4EWLA 3CNOA 5CB4F 2NU8A 1PG5A 2Q4EA 1J0DA 4O4LA 1C0LA 4A6EA 4XKJA 1L3IA 5JAUA 2VHVA 4X62B 1JMYA 3EXIB 3HI4A 4BJHB 4CV2A 5ITVA 5FTNA 4KRFA 1BJTA 4NBRA 5C1IA 4UNNA 3GMIA 1CLEA 1SXJA 1XL1A 2QLBA 3OX1A 3PXCX 3ZGOA 4U4AA 4CQLA 1CV2A 3FKSD 3RS2A 4AULA 2YX1A 4ZALA 4MMYB 4HUTA 4NJOA 1A97A 2BTOA 1FQWA 4LZOA 1FFSA 1R5NA 3GRZA 2XUZA 3EEIA 3HDTA 3N87A 4FYYA 4HEHA 4RNDB 5I51A 2Z8YA 2PCLA 1PGJA 2V1UA 2OMKA 3R20A 4R05A 4PCLA 1NNLA 4KQMA 3W5DA 3B60A 4BVFA 5DBOA 3BE4A 4X6UA 5F4ZA 1IM5A 4UM9B 2J5XA 5K0BA 4ZCLA 3UJBA 1RBZA 1ZVVA 3WLNA 1LK5A 1YD7A 4MUEA 3DZDA 2GLXA 5G0UA 1XTTA 2AJTA 4Y9DA 4XGKA 4QLAA 4J7CA 2V5UA 2AB0A 1V1RB 3P96A 2NZ2A 1X8KA 4ZAXA 2L18A 4BX8A 4F3YA 3E48A 3OE7D 3PJEA 3W3AA 1BEUB 1ZH6A 2O2DA 1TAUA 1V26A 3G85A 2RGAA 1NAIA 2UXDB 4N5LA 3LWBA 4I1RA 5ALEA 4OIMA 1SIWA 4GR9A 1WTCA 4G5FA 5DCWA 2PPLA 3QQ5A 3RT1A 3CTPA 2WRZA 1RPZA 1ZSNA 1PJ8A 3A1VA 4BKQA 4LXXA 2DT8A 1PJAA 2BFFA 4DTCA 4Z0HO 4HO1X 2NU6A 4WOJA 4MP8A 1LVGA 4G4SO 4XSVA 1WKBA 2LVBA 2A1TS 3LKZA 4DWOA 4FNAA 4B73A 5CT8A 1OT3A 3CLSC 3PDWA 4FEYA 4L75A 2COUA 5KWJA 4MCIA 2A5YB 1P81A 1O03A 5CVJA 1NUTA 4L8WB 1U8AA 2NG1A 3GJ4A 5A03A 4ANFA 3PKJA 1ZM9A 2O8BB 3MPUA 3LPLA 1NMEA 1X15A 4CKEA 1OV6A 4B2YA 4PHTA 5KQSA 2QP9X 3OBBA 1MG5A 1T5OA 1NJ6A 2ZJZA 1ZGAA 4JFRA 4QPZA 4TRNA 1S9DA 3SZGA 5TY0A 4UMFA 4D9MA 3MGKA 3MTAA 1A9XB 2HRCA 2JBAB 4W7IA 3FPLA 3OT1B 4HS9A 1XWIA 2D4HA 4LUCA 1N34B 4LF5B 1PR3A 3HBFA 1NXWA 2C61A 4U6QA 1ACMA 3IIJA 4MDEA 5LUAA 2D00A 2XDQB 4MB0A 2W71A 1T1EA 4L3WA 4YCBA 5EJ9A 1T10A 2B4TO 2F1JA 3IP9A 3NWPA 2X5NA 5KYYA 5JU6A 4LF4B 3CLTD 3PI7A 2O5CA 2PR7A 4LSZA 3FPKA 3L7DA 4TRRA 4BZXA 1ZK3A 1Q6ZA 2E87A 2RGCA 2PEYA 1L5RA 2Q4DA 5FA5A 4HRAA 1XJCA 4GMGA 3B20A 5U4XA 2JGFA 1KS2A 2EXXA 3EBPA 3JV7A 4CT5A 4CHGA 2G9ZA 2G1UA 2PMWB 4KQ1A 1M1YE 2HRDA 4V0ME 1FSSA 1D8AA 4FHDA 1ANKA 3AR6A 2WSBA 3W9YA 2AN3A 4FX2A 4RU1A 1KI1A 5CR9A 2IYSA 3M4NA 3BK7A 3E05A 3KELA 5CGZA 1B14A 2D06A 2QLJA 3PNQA 2PLRA 2OBXA 3EGDB 2VJOA 2X9LA 4QJIA 4YBRA 2REXB 1IPHA 3EVCA 1Q7CA 3N2ZB 3PQCA 1HDOA 4UJ5A 3AJAA 4WNAA 3ORHA 4RVFA 3JWGA 5HHTA 3VHRA 4HNSA 3ADDA 2M2IA 3RAEC 5REQA 3IMCA 3SM3A 3DQZA 1I5OA 3TO5A 2CVHA 3VZSA 3GP8A 2WYOA 3X1XA 1J70A 3I9OA 4R6XA 1ITZA 3AJ8A 1YR8A 5JVDB 5A9RA 1DXQA 4JOCA 2GRAA 3F3KA 4F86A 1TADA 4Q5IA 2N1MA 2ZSIA 5IT9A 3FSRA 3AHFA 3H2GA 4FIZA 4HG2A 4ARBA 3RIEA 4JSRA 2GFIA 1GEEA 4XB6B 3EIEA 1WPXA 4B7ZA 3LM8A 1K3TA 3OFVA 1KY5A 2H3HA 4NX2A 3ZHCA 3LP6A 3PT5A 1K92A 2X8JA 4K1LA 1B93A 1MBZA 1RWKA 2ZS8A 2OCBA 2HXYA 3JVEA 4J7XA 2NO5A 4R1PA 4WK2B 1FFHA 1KC1A 1I4WA 2F3RA 2Y99A 2VPYA 3NTOA 3O3CA 3ZG6A 1CIPA 1SIOA 5DK4A 1R0XA 4HTFB 3WK7A 4WEOA 2I3BA 3UAWA 4YUXA 1RXWA 1UJNA 4URZR 4ZVQA 5H82A 1JHOA 3ZLJA 4D3SA 2F3PA 4Q03A 2IPOA 4RV9A 3DEKA 1M33A 2Y1OA 1MENA 1BFKA 2FWPA 4H4EA 1U1FA 4CU2A 2P67A 5J2UF 3IUPA 3X1YA 2J3EA 3QMWA 4W1PA 3N0WA 4WZAA 2HCBA 4CLHA 3OQNA 4U7PB 1KZ1A 3ROXA 3HB7A 2VJMB 4LOAA 4KPYA 3LY5A 2DFNA 4C30A 2RE8A 1C9KA 1RJEA 5HA5A 3TG2A 2YUTA 3CKYA 3BBPA 4JYZA 3LUFA 3ZHSA 5HBGA 2FK8A 3V32A 1OU4A 2Q07A 5FUXA 4ASUD 1ORTA 1XDUA 4REQA 3ZLUA 5JALA 4WI1A 3C6ZA 4AF7A 2VYVA 1JAYA 4XCQA 2R0QC 4M87A 5DT9A 1Z13A 1YJAA 2W4IA 3AYXB 5EGNA 2G72A 1S8AA 1T4CB 2GKOA 1AV6A 4AO7A 1AUXA 4PZCA 5A3SA 3G0OA 1G6Q1 1WCV1 1XLVA 1P3JA 1S02A 1XTRA 2AHOA 1M6NA 2PGDA 2YXEA 1CKEA 4JR1A 4KWTA 5EHZA 4INJA 4BMVA 4JROA 2DHQA 2XUGA 3F7OA 2JCXA 2ZUVA 3HVJA 4M46A 4F4IA 4CIBA 4X8MA 3ANXA 5DYNA 4N6NA 3ZHBA 1SZCA 1OE0A 2OGSA 1CT9A 1V8OA 3BFVA 1W4BA 3TFWA 1GNPA 4WOBA 5EIXA 2LPMA 1G8PA 4TLEA 3T9BA 1M7GA 2WF5A 4XYBA 1W94A 9ATCA 4NBSA 5AW0A 2VPTA 1RC1A 1YBVA 2FQWA 3EXG2 4JL5A 4JAVC 1I13A 3IESA 3RU2A 2OCGA 3ESAA 2X9VA 5LQNA 1SZJG 4NZZA 5HRCA 2HIGA 4ZRDA 3R7AA 5DNUA 4UU1A 1EXWA 2AW5A 2HPHA 4FFDA 4G0OA 1PZFA 1LBHA 4I2NA 1EVJA 3X3HA 1YRWA 3DHEA 1Z38A 4FILA 3ZI4A 5F64A 2JLXA 3UMGA 3QQPA 2ZZMA 1TDJA 3C3PA 1PJZA 1MHPA 2JANA 2H16A 4CU5A 2SCUA 5HQ3A 4MYHA 4Y2JA 3U60B 3D6HA 5LZ5A 5ELXA 3GUHA 3QJYA 3MRTA 1RR6A 3E9DA 3UENA 2I1QA 1EB8A 4BNLA 4F60A 4UEJA 5HRAA 4GFDA 5EFOA 1YNSA 1YRYE 3AIMA 3KJGA 1GA6A 4KO3S 1WY7A 3RVMA 2H4XA 1P2DA 4G56A 1U2ZA 4JH0A 5H02A 4DV6B 2FPWA 2W6JA 1K68A 4U7GA 1QIJA 2HLPA 4ZTUB 3DTYA 1C41A 4IDBA 1GV1A 2Q5JA 3NEYA 4JIGA 4B6FA 4BXOA 3ENWA 1S2NA 2C8KA 4FGWA 3S1AA 3FR7A 4RJTA 5K51A 2QLMA 3CEMA 4E03A 2PA0A 4MKXA 5MFZA 2BFEB 2OGUA 1P2FA 2R1UA 1HTTA 3D6FA 5G4KB 1RMQA 1F8XA 3N2GB 3W2IA 4DW8A 1SG9A 2W0SA 2XIJA 5LYJF 3O9ZA 1WNTA 4UPVA 4RY2A 4ZAVA 3V1LA 1E3DA 3WGLA 4L15A 1IXYA 2V9PA 4ZA2A 3DTVB 2AR7A 2O5EA 1MA3A 3LQ1A 3N0RA 4ZC1A 2QM8A 1PK8A 1U11A 2AFIE 4FFBB 1KNQA 1K2VN 3TR0A 3WL6A 2IK8A 4KITB 3C87A 2FFHA 1OAKA 1CJSA 1K2WA 3R8XA 3I2GA 1ZMOA 1XX6A 4C0SA 1XVLA 3V3KA 1FF9A 2H1RA 1KO4A 5FPHA 1ZOLA 3H4VA 2LKCA 2A9JA 2QT9A 2ZOSA 3HB1A 2I2CA 3MT8A 2R7LA 1R8XA 3DT6A 3QFHA 2FETA 3HA2A 1AUQA 2HQRA 2P7IA 3LRPA 3U1TA 5HIKA 4DR5B 1GDHA 3MZ0A 2IH5A 1IN1A 5CDUA 4MUMA 2W6IA 4GOKA 4MCHA 3W2EA 4ENTA 4GE3A 4IH4A 5SYAA 4LMRA 3GJ5A 4DNQA 1SD5A 2WIDA 1PGPA 2AEFA 3GOQA 1QR6A 4PLTA 1RWVA 5CFLA 3G0DA 2B8WA 3VR0A 4C87A 2J3DA 1P77A 2OM6A 2Q6IA 3EVTA 2VP5A 3OZSA 2P1RA 5DN6A 4REOA 4IZOA 3O4FA 1Q0QA 5JH7B 3MJSA 1IN7A 1PJTA 2PZFA 5JCJA 4Z4HA 4NXNB 3G5LA 1CQZA 3ABRB 1CUYA 1NA5A 1FUKA 1Y5IA 2REQA 4ZRNA 5HM8A 2YN0A 3K9CA 1XMIA 1ZUWA 1YZLA 5GP1A 2C0QA 4TYQA 5F1KA 1FSZA 5DBFA 5DNEA 1EGMB 2YFKA 3L01A 1PS9A 3MG9A 1RYZA 4ZO4A 2YV1A 5LDDC 1SBIA 4KCGA 2PXAA 3I1JA 2A14A 1NNI1 5I47A 4G0UA 3V1MA 4HSEA 1ZM4A 6AT1A 3ER9A 5EJEA 1T5DX 3HCOA 3L8YA 3HR7A 1BYUA 2HF9A 2UYGA 3DDOA 1RQGA 3GLSA 13PKA 1DG1G 1DBPA 2G04A 2V5VA 3L1JA 3ZHUA 2QN3A 2MWMA 3CNLA 2SKCA 3OM9A 4CF4A 1H8HA 4EELA 5K0ZA 3DGFC 2ZJ7A 4MARA 2H7YA 4TN1A 3D0KA 1JIQA 1S2IA 1JKIA 4PFJA 4BNUA 2ZUDA 2HGSA 3VDNB 1ZYUA 2ACWA 1FMLA 3V7YA 4DPKA 2XWSA 2O8EB 3OP1A 4GD3Q 4PXAA 3QH4A 1ZFNA 4H3HB 3BC1A 4DUGA 3RROA 4AY6A 3VV3A 4FBLA 2DHRA 2OQ2A 3EFEA 3L49A 3AG6A 3T1NA 3VSDA 2WB2A 4OSEA 1QQBA 2ZUCA 4P81A 3KBBA 3QKRA 1GPAA 3UB4A 3WE7A 3FB1A 3GLKA 1GZSA 4FN4A 3VVLA 4LF6B 1IOVA 4OJNA 3T9FA 2BWJA 3JSAA 4DBVO 2P8JA 3ZVRA 1ECGA 1HDRA 2OCDA 3B9QA 4LX0A 4BBZA 1NPTO 1A71A 1Z5GA 2PGAA 1NX6A 1OLXB 1X9GA 1SCJA 2IKSA 1CSEE 4YJKA 2IU0A 4K6KA 2Q27A 4TVKA 1COZA 1UJ4A 5A1TA 1WBBA 5LC1A 4LY3A 2IYPA 2NYAA 4E15A 2A84A 1K89A 3ASUA 2FOXA 3EUWA 4KLNA 4GPAA 3V97A 4BLRA 4BO2A 5BMVB 2B69A 5BN5A 1NURA 3RGGA 1PR1A 2HU8A 3FKSA 3K5IA 1B42A 1RQPA 1T43A 1N1MA 2JGDA 3N6RA 2ANBA 2GJ8A 3VR5H 1P9LA 1DPGA 3NI2A 4R8KA 5EJ6A 4J9VA 5JNTA 1OH5A 4E46A 1K97A 1T5IA 3CSUA 4JL6A 3JY6A 3AJRA 3ESXA 3I0NA 3B36A 5C7YA 4YMLA 4HHEA 4M98A 3RSHA 1BW9A 5AHXA 1N9ZA 2Q2QA 1E2PA 1E9SA 4EHFA 4LJ5A 1QH1B 3AETA 1CUAA 3ZE0B 2W2LA 4DKXA 1VHWA 1BD4A 5B30A 1E77A 4D7AA 3IRVA 4BNDA 5I48A 3NALA 2IYXA 4IVQA 1TKCA 2PT5A 4L9RA 4MIEA 3S2EA 3DBRB 1GR0A 1U2GC 2UZ1B 3QUSA 3TMAA 3WLTA 2PGXA 3NOVA 1KJYA 3CX8A 4L0DA 3GROA 3LZ6A 4MVCA 5CH8A 2G67A 4IVRA 1NF9A 2Z5VA 5P8WA 3W3AD 4DA7A 2WHEA 2QTVA 3DMFA 1QYCA 5FKJA 2NYUA 3CKKA 3FFBA 4I9UA 4MVJG 1VBKA 1JA1A 4LHXA 4W9NC 3GLTA 2YXDA 2F1HA 2Y0PA 1SUCA 2OD9A 3JYPA 1PD1A 4MR7A 1JG7A 2KQUA 2VTVA 2WC1A 4K9NA 4ID3A 2M1XA 5A4KA 1CY1A 4EJ2A 3CNEA 1IXSB 2ZTUA 1RT9A 4UOQA 4JYBA 1BHQ1 1ISRA 2TMYA 4G36A 4US0R 2ZDQA 4WBNA 4JXXA 3ZCUA 3KK0A 1RMYA 3KXPA 4H4CA 3MWKA 1W48A 4Y1EA 2BDTA 4F8JA 4K6CA 3ESCA 3TB6A 2IZ6A 2BFNA 4S1TA 4E5SA 3RSQA 1N6LA 3DOIA 3PWTA 3O8CA 1L4BA 5ERGB 3S1LA 3OPVA 4TYMA 2C94A 3J80A 4RS4A 3H2YA 1N2JA 5FT9A 1CEYA 3L04A 1U7ZA 4OLJA 3AY7A 3GD5A 4ZVVA 3INGA 4FNGA 3QX9A 1HQDA 2PWBA 4MB2A 4CM9D 4Y9RA 4CEIB 1XXHE 3FPEA 1BEEA 3G1UA 1G5FA 4FGKA 5H4HA 1SFRA 5B64A 4Q15A 2EQAA 2REBA 1KRHA 3H11B 3RC3A 4TLCA 1EGAA 2EOAA 4ODIA 4LJRA 1K7XB 2BFWA 3BZUA 4WKPA 3CZMA 3C6BA 4AN0A 1U5BB 3JQBC 1TW3A 5M2QA 2VJBA 3EYWA 1Z6AA 2IV7A 1ZUHA 3C8MA 3JPYA 3D3WA 1TPZA 4WD3A 1L7VC 2QQEA 2ZQ5A 2G0NA 1F8UA 3P2IA 4IV5A 1CVIA 4LJ7A 5DBGA 5AXBA 4YJGA 4FPXA 1QANA 4HMQA 4NF2A 2IUYA 1YMUA 2YINC 1RHRA 4MV7A 1RW4A 4YDRA 5A9SA 4YRMA 5LQCA 4R2IA 3AFMA 2X0IA 2OFWA 2YYAA 1M8KA 2C29D 2FQ1A 2ZRAA 4BWYA 3OZVA 1PTJA 1GN9A 1TJ3A 2POCA 2Z2JA 4OHYA 4YGYA 5TNXA 1V1RA 3JZAA 1TCVA 1XK7A 2A3RA 4CCYA 4Q66C 1ZVJA 2R00A 5GIPE 4HSGA 3NKVA 3QITA 1KQFA 1XNGA 3QUCA 4FLEA 3WV5A 1F2DA 5EL0A 1M1XB 3EUAA 1XZ8A 4G63A 3VAAA 3E8MA 3LRXA 4QYXA 5CRIA 4US2R 2APJA 1CBUA 1ZIXA 1JEEA 2B3TA 4IIBA 1M2NA 2V7GA 3L8MA 1DTWA 1RRFA 3SN6A 4IOMA 5JARA 2YBEA 1LJ8A 2D1RA 4WY2A 5LP6B 2HZBA 2ZJ3A 1WMAA 3UJNA 3MW8A 2YZ2A 2HSDA 4GLJA 1AMNA 2XITA 4MS4A 4WDRA 1YFKA 4NBLA 4H7JA 4L4XA 4NK4A 3BIWA 3RFCA 1GAQA 2HM7A 3CBQA 3EZNA 3V6LA 3VZRA 3ND5A 2UUCB 5EZSA 5JXIA 3JQQA 4A36A 3F78A 3U31A 1QX4A 5FBVB 1G19A 5EPUA 3K4HA 3GVCA 3RKUA 3OIDA 1GNLA 1U1DA 1U04A 4PLWA 5DASA 4DLPA 4EPYA 1ZHOA 4L85A 1RWQA 1GRQA 5CU7A 3RS7A 1Q0SA 3VGPA 1LGYA 1MC8A 3QTLA 1UBCA 2ROQA 5G0SA 3LF2A 3W78A 1FJ2A 1SVKA 2R47A 3P9PA 4OOFA 1UJ5A 1G21E 3MQ2A 3DB2A 3THRA 1QV7A 1X2BA 2R8RA 2BMFA 2RGNC 3ZIDA 2BFBB 1VE3A 4AECA 2J67A 3KQTA 4P4GA 1M54A 4RQTA 5DLQC 4D42A 2DKNA 4H7FA 4WZAB 5KSWB 1A9YA 3SC2B 4OLAA 2B4KA 4J3JA 1XEXA 1Z5ZA 4KN6A 3TXXA 3KOUA 1K98A 1WPQA 3OP4A 3D3EA 4BQRA 1U0TA 4S1NA 4F45A 5HKKD 2OKCA 1YK0A 1SCBA 2ZRQA 5LD2C 3FROA 3GARA 1JW9B 2NVOA 3OFNA 1KETA 1MQ8B 4REQB 1PBTA 3Q88A 1XJWA 3X1DA 1XRQA 4K03A 4BFLA 4Z7QB 5JH7A 2Q4BA 4JNKA 1IXRC 1E64A 5H1YA 4ZGBA 2RCYA 3VOBA 2ERYA 3HSKA 3RSOA 3IO3A 5JY6A 3AX6A 3BGOS 1WDLA 1VCOA 2QQGA 4FFLA 2HI0A 3HCRA 2WZBA 2JS7A 3P9SA 3C0KA 3HJNA 4IRXA 3QVVA 4C78A 1F3OA 1E3MA 1ODSA 3A14A 3ZWMA 3DWEX 1FDSA 3SE7A 3S1SA 1KZYC 1KY3A 1V9CA 3WLRA 3VNQA 3KYJB 5LQSA 5KU7A 4LTNA 1EM8A 3I6IA 3UNXA 6ABPA 3F3MA 2Z3VA 5E0KB 1N9GA 2FPGA 3JATA 4H6VA 2WUWE 1P3Y1 3OPYI 6CHYA 1JAXA 2PBRA 4YJFA 4E1VA 1IQUA 3BB4A 1M76A 1VJGA 2J9GA 2WD7B 3FWPA 5D86A 4PCUA 2DBQA 2G82A 3R9XA 5F1YA 3PLAE 2HIMA 3HZRA 3FDXA 1L2TA 4HJRA 4NCHA 4MKFA 3J7TA 4U0JA 5CBPB 4NBUA 4HBGA 1DWQA 4EY6A 4HDKB 2XYPA 2J85A 3DXZA 3HYCA 1DUSA 3U7QB 3DNMA 3DC7A 3TPZA 4EIWA 5A7FA 5INTA 4RJJA 1UT8A 4FYMA 3DZIA 2EERA 3M4ZA 4PCAA 4Z49A 5FWAA 1EM8B 3O73A 4HB4A 2F64A 1L6RA 2FPKA 1ZCBA 5GJWC 3ZLBA 5JFOA 3S2UA 3L0PA 4YIKA 1JQ5A 2EFJA 3AHEA 1D6SA 2X5KO 3UANA 5IKXA 1OH8A 2JGIA 1NJSA 2RB5A 1LZLA 3HO8A 4XJXA 1XZDA 1DX9A 1LSOA 3S1AB 5LCXA 2DULA 1IHPA 4E88A 1E66A 4BO9A 4MO2A 3GEHA 5IHPA 4RF5A 1KNXA 1UC4B 1PHRA 1NLFA 5GM1A 5CNJA 1YU6A 4K87A 2P9BA 2VUSA 5KJEA 4PO8A 2A57A 3N58A 3PNMA 5AJTA 4KE9A 2V7UA 4IQ4A 3AUFA 1H2YA 3MNFA 3IQZA 3MA0A 4C5BA 2PUTA 2HNKA 5U9CA 1JDUA 1O4VA 3Q40A 1WF6A 2BRUA 3OF2A 1CJUC 4IIGA 2J0QA 3RKRA 3QVKA 2XNSA 3ZLVA 3PWSA 4LQLA 4PPNA 3UUEA 2YV3A 4HVTA 4NG4A 4ZCPA 4DOMA 3VHLB 2NPIA 3OU6A 1WKVA 5DOZA 3KOMA 5AUQA 1GZ6A 2JIMA 2VH5R 2FXVA 3ZHYA 1GZ7A 1ENPA 1X94A 3F47A 4P7BA 3VH1A 3ZWAA 2ZB8A 2R8EA 1WZCA 2F1RA 2ZBFA 3I9V1 4I1IA 1UK6A 1Q77A 1NYQA 2I78A 2QI9C 4XI9A 5C4MA 1ATIA 1LI5A 1PW5A 2HA3A 3R3UA 4OJKA 4MPRA 5DTEA 3IOYA 3OBIA 4D9JA 3OLXA 5T7BA 1FRQA 4FGLA 1T0UA 2HBYA 1V37A 4KSYA 4YEDA 3WL3A 3ZWCA 1C4XA 3U3OA 4D0RA 4FR2A 3Q8MA 2PL1A 3DZJA 3DNFA 4LYYA 1NN3A 1GRRA 5JNVA 5JPIA 5A7HA 2YNMC 3LO5A 3MBOA 4MGKR 4R69A 5E7JA 4W63A 5HUQA 5HFJA 3Q3HA 1FDWA 3EAFA 1R9JA 2MTBA 2QMUA 4YMUA 5ELLA 3ROZA 5JS2A 3CPHA 1A5TA 1IL0A 1CS0B 3KAPA 2IPLA 4B48A 4BE7B 4R71A 5KYNA 4XYGA 2REOA 2CE7A 1TRKA 2PTGA 3LXXA 3R0ZA 2XDWA 4F0JA 3WYNA 4N9QA 4AY5A 1O54A 5DX1A 2O2ZA 5F33A 1L1FA 3P2MA 4WVLA 5TGZA 2RGRA 4FINA 4ZQHA 3WK8A 1I01A 2AOUA 3TSCA 3BKXA 2GLUA 2WJPA 4A5SA 4D81A 4F4JA 4X7PA 4CETA 4JI8B 4BRUA 2NU7B 4OKIA 1L4MA 1VSBA 3OCWA 4QDKA 4KIJA 5LOVB 2PZEA 4TUYA 5J5AA 4O2LA 3DE4X 1A9TA 4ZCIA 3KKPA 4QRHA 1W1UA 4YCCA 5BYKA 2UUAB 4E7OA 3GLIB 4BBPA 2HSEA 5JSUA 4R1MA 4CFZA 1W52X 1NWCA 3IR7A 1ECPA 4LI0A 4MA5A 1NQVA 3V8QA 4E3WA 1L5KA 2CFTA 2G8NA 2DAPA 3FYCA 2WFLB 4TZ0A 4B4DA 4YAOA 1V39A 1JALA 3OTGA 3DF9A 4QDTA 3QZUA 3SC3A 1QORA 2M6LA 3VR4H 4DUPA 1Z3IX 4HATA 4RM3A 1QFYA 5BT8A 2GPYA 5DI3A 2A9VA 4IJQA 4BP8A 1FNMA 2CXNA 3AGPA 1JHMA 3E3OA 1J56A 2IYEA 4KYIB 2HSGA 3VPAA 4EZBA 4KOAA 1H2HA 2BM9A 2QW0X 2WA2A 3ELUA 4RXTA 1Z5UA 5DWQA 1MQ9A 3K0KA 2J31A 2VUTA 3I6ZA 2CZCA 1URPA 2OK7A 3W6ZA 5I45A 5JS6A 1DO2A 3R6DA 4MTLA 4JJ7A 4DIFA 1SHKA 4NMHA 1E6KA 3MELA 4JCCA 1KI3A 2CV1A 3GFFA 3VPFA 4K9KA 3VI3B 2I4NA 4NNOA 4FS3A 4MULA 4JB0A 1U0GA 1WQ4A 2RGUA 5A7GA 3TZBA 4DA0A 1U0HC 4Q02A 1MO6A 3BWYA 4N3NA 1JR3A 1M0TA 3LYHA 4KIWA 1I4DD 2PKQP 4LXQA 4R2WA 5EJGA 3SVTA 3EXAA 3SZMA 3WHLA 3UCEA 4R54A 1WLYA 4XFDA 4C4PA 4ZCQA 4RKFA 5LJIA 4Q4HB 5A4MS 4WH0A 4X1KB 1Y9ZA 3DMHA 1SKBA 2HU7A 2ZS7A 3B70A 4UHJA 4D56A 1K66A 1U8CB 2CEKA 5CH3A 4RF4A 4BIMA 3P2KA 1XV5A 4K86A 4RTQA 3CR8A 2C2WA 3AP1A 3ANTA 2P6PA 2V4UA 3KXIA 3ZGXA 1MZPA 1AS0A 4OGKA 1GTSA 1G20E 1Z5OA 3U80A 4WCDA 1C2TA 2GBLA 3A31A 3N0XA 3AR7A 3SS8A 1AGNA 4HZIA 1VTKA 1DXOA 2O06A 4ER3A 3OC0A 4R8SA 4HEQA 3FPJA 2W2LD 3AEQB 3HSSA 3KXLA 4MROA 1SBZA 2X40A 1WSDA 1NLUA 4BVHA 4F2HA 1XHFA 3AC0A 5FUQA 4MWEA 5KREA 2UXCB 5CT4A 3EGWA 1G6KA 1U2GA 4MR8A 3NTRA 2CL7X 2I9PA 1XDBA 3A7DA 3HMQA 1RJFA 4UNRA 3LL7A 1EXDA 1WWKA 1G4AE 2R6GA 2PX6A 2RG7A 3PVZA 4XVHA 4Z7NB 2E5WA 3RSLA 1NQWA 1PJBA 3W6OA 1DU4A 1VC2A 2JZNA 2F59A 1WU8A 2LV8A 2WWTA 4N01A 2PGLA 5MDHA 4TN5A 2PTHA 1P9NA 1Q7EA 1SQSA 5F5LA 1NUAA 2QRVB 1X1AA 4AROA 5IXJA 3WGJA 4WJZA 3RO7A 5LSAA 1TEVA 4D9FA 4LBWA 2AUNA 2FRDC 2PZGA 4DIDA 1FTYA 2DF8A 4QATA 3PGVA 4J0GA 3IE2A 1M2WA 5FWDA 1UBFA 1A88A 1KSHA 1VLQA 4W7HA 1TO1E 1YZHA 1M1UA 2R751 1XUOA 1SQ6A 3AQ4A 1TM1E 2P9FA 3PQ6A 5GMOA 1SCUA 5HR5A 2R97A 3DZ8A 4LWQA 2E9SA 1XRNA 1FTWA 3F9RA 4PU0A 4JR0A 4RK5A 1AC5A 1NI3A 3CZCA 3JU3A 3PEVA 4FOPA 1MH1A 2X5JO 1KK1A 5G1PA 5AHWA 1U6IA 2BJHA 2E85A 3V4SA 2HJVA 3IBFA 4MYSA 5EXSA 3W5VA 3ZDQA 1RKUA 2OHGA 2VYQA 4NKRA 4YWJA 5DM4A 3VU3A 2Q5IA 3I8XA 2G3YA 3ONWA 4GZLA 1INLA 1IOLA 2EL9A 1DG9A 2ID9A 1GZVA 2JLSA 3DBVO 4KLAA 4NV3A 3I92A 2YJ5A 3UMSA 2FPUA 4LJ6A 2DLNA 3VZQA 4NE2A 3K0HA 4UD6A 4W5RA 4O8CA 3M83A 3NNDA 1ZVQA 1V5IA 3BH6A 1HEIA 3D5TA 1NMYA 3E4CA 3JPWA 3L7IA 2HQ1A 1QHFA 1DCTA 2DR3A 4MEJA 4GP7A 1X92A 2NVWA 2YJZA 3I2KA 4OQLA 4Z4CA 2DP4E 4TKUA 4BGUA 2NU9A 3FIJA 4MOWA 5J2TA 5ISMA 3DBLB 1DZIA 1W96A 3HDGA 2DPHA 3FG9A 4GPBA 2F3TA 3RSSA 3EY4A 4CM8A 1PX2A 1TCCA 5CH5A 1GAWA 1AJEA 1I6LA 1TJ4A 2KLBA 3CRNA 4E33A 3INYA 3I1FA 3A04A 3IJEB 4JOSA 3PQDA 3DOUA 4UEKA 1KRXA 3T3EA 4NBNA 2YOFA 2IGBA 1YS1X 4OK6A 4EAAA 2LE0A 2B8TA 4DLLA 1FW8A 4XA8A 1JJIA 1N75A 3AMVA 1FCJA 1QIKA 1TYDE 3IEPA 4HH4A 4GMDA 3LC2O 3SF0A 1R0RE 1EGQA 2G9QA 3UKJA 1FYXA 2YZGA 3BDAA 2WYVA 1JDJA 3P2OA 2IYTA 1HI9A 2NSJA 2OXRA 1YVRA 4IILA 5JQGF 5MN5A 2CMHA 2P68A 3A6EA 3B1YA 3E81A 3ELWA 3NHRA 4PGFA 2BYTA 1YVUA 1UFRA 2CUKA 3A1DA 3HXTA 3NHAA 1L7QA 1P61B 2IPNA 3PFWO 4TMVA 3W2HA 4BNVA 1YZQA 5AW3A 2Y67A 1HZZA 3UMYA 4XPIA 4MINA 1EBBA 2FPMA 3ZD9A 1FJXA 1EBFA 3G5MA 2AZDA 3DVRX 3PR2B 1JA0A 1IRXA 1JFLA 4OMCA 1O6CA 2VSXA 2P11A 2IPMA 5IMSA 2XD9A 4S3MA 5DEOA 2P75A 3E3LA 1L9KA 2ORYA 4D41A 4QSHA 1JZTA 1PZHA 2JAWA 1UZAA 4P35A 4E22A 5AK6A 2E4AA 2EP5A 1HL7A 4M9SA 5FB3A 1MABB 3B1WA 3Q2IA 4MGYR 2VNIA 3GQVA 2EJUA 4MDYA 5ER9A 2HW8A 3A37A 4KG7A 2Z4SA 1II8A 2QE7D 2H5IA 2VNHA 3N0VA 3OCCA 5ED0A 4KGZA 2RBKA 1YR9A 4W4TA 3W6UA 4ARUA 3UMMA 5TC4A 4C7OA 3N70A 3HBMA 1KP2A 4FDLA 3AVXA 3HP7A 4OKSA 3TDMA 4CTNA 2C04A 1GKYA 2CLHB 1K9SA 1M9NA 3B2NA 2QRNA 4EK9A 4R31A 3IVGA 5D3KA 5LQMA 2WAOA 5FH9A 1AK2A 2CXQA 3DW3X 2VQFB 1MT3A 1RYNA 4AP6A 1OIWA 1Y3AA 5LXTF 2OHHA 2YC4C 3BN3A 1BMDA 5K0JA 2CBZA 1BDHA 2BZSA 1F8FA 1WY5A 2UV8A 3KWJA 2FEKA 3AUKA 1DELA 1KMHA 1BE6A 1E5TA 2PJUA 1M34A 4EQ6B 1ULAA 1GHTA 2CE2X 2GK7A 4YP0A 2VZEA 2VQDA 4FMDF 1KYWA 3AFOA 3EOBI 5F3DA 1NOKA 2QDXA 3NT4A 5C31A 1QH0A 4ZT6A 3VTFA 5EIEA 5JJBA 4KLRA 1JRLA 4FYHA 1E2JA 1BCRB 1RKVA 3HNPA 4RULA 1L5HB 2BMDA 4X66B 3K5PA 2FPRA 4TROA 2PVSA 1NG9A 1NBHA 3HY4A 3NP7A 4OHCA 5GM2A 2PFKA 1SOAA 4GU5A 1QZ3A 4LVOA 5BWBA 2QX8A 3DL4A 1QFJA 5EXDA 1KTVA 1V6CA 3RS0A 4FMBB 3RFXA 5KNDD 3ZNOA 2NTYC 2WLTA 4D0GA 1TECE 1VLJA 3TK1A 1Z73A 2X4GA 4JUBA 2UU9B 2ZRLA 3FZYA 3ZZ0A 3IV9A 3QKRB 1HQKA 4C0AC 4PQFA 3C8ZA 5L8VA 3L7JA 3HYNA 4J76A 4F96A 3A3KA 3SC6A 1X7WB 3V8NA 1CRQA 4LRYA 1SHJA 2FEAA 4CL0A 3D81A 2HLDD 4XJSA 3NJRA 4FEAA 4I6GA 2AXNA 1P1FA 4H6XA 2P9ZA 3O93A 1I3NA 4DQUA 2BY4A 2XW6A 1D1SA 3R5KA 2GJKA 2QRMA 3I04M 1PJRA 4MWCA 4A7PA 5JC1A 4QREA 3K5WA 2WTMA 3PLNA 4F8YA 2I66A 1LSUA 1TUBA 2BKEA 2OB1A 3I64A 3LP5A 3PCRB 4NFHA 3QEJA 3UMBA 3ANNA 2NTEA 3ZHOA 5LP6F 2FG6C 4JI4B 1MIOA 4DGSA 2YMQA 3RC7A 3ULKA 4N5DA 1H2WA 4F92B 5BPHA 2WJAA 1HEUA 1JDBB 1U0EA 1JPVA 3PA8A 4EEZA 1FB5A 1PF7E 5J9FA 2ZSDA 4BTEA 1SOUA 2ZRFA 4KLZA 1J7KA 1F2UA 3F9IA 3R9IA 4RVUA 4KIUA 3LX8A 4U9HS 3TTTA 2F55A 1ZL2A 5E1BA 4YRGA 1C0EA 1QFMA 3L8DA 4F93B 4IXDA 1C30B 4IIJA 3EPJA 1AKNA 2NSDA 4L4RA 4C01A 1DE0A 1QH1A 3AETB 1T2UA 4IJ5A 3SQLA 4QUKA 1KZHA 1D8TA 1GDDA 3WGHA 1TFRA 2JLQA 1KAMA 1WB4A 1Z8DA 3FDIA 1Z25A 4ND8B 4XX0A 4Q9JA 1P2SA 2X0EA 3H3JA 5IZCA 2GHQA 2I76A 4TX1A 2ZULA 3AY0A 3ICCA 1UPTA 2WF7A 3GPIA 1WCIA 3MMSA 3ZI0A 4CG1A 2F48A 2FWIA 3H5AA 3KLMX 2YJGA 1B15A 2R60A 1NXTA 1ZICA 1NQOA 5CB6A 3T4XA 3TLBA 1ZD9A 3CF4A 4RMJA 1L1RA 4H16A 2XKBA 1H0KA 4LC1A 4MS1B 5EP4A 5TEVA 1C80A 3MCZA 4B4VA 1CQJA 1GJRA 1YZTA 1E2IA 2UZ0A 4HEJA 3F7MA 4ZMRA 2BEVB 1F2VA 1MC4A 4R2LA 4EW1A 1IN6A 4HJXA 3JQEA 4B2LA 1TA4A 2WKRA 3G89A 3JYHA 2DH6A 5KWEA 1L1EA 1USWA 2BSAA 2HV8A 2ZYGA 4Y98A 1F6DA 4FBGA 1XSEA 3CNHA 3OLYA 4R16A 4X84A 5E95A 1WV1A 4FE7A 3OZEA 4R9NA 2KM1A 3SFTA 3TRJA 5AM3A 2X1LA 1VDZA 3T4PA 3LX6A 3V4VB 4YRKA 2CNNA 1Y3BE 3EJ6A 4POAA 2YVAA 1QYVA 3EGDA 5F7OA 3VU1A 3NTXA 5KU1A 2VTEA 4HKTA 1CR0A 3LBYA 1NSYA 4I36A 9LDTA 3O3OB 5JCZA 3MMZA 3V1TC 1Y4UA 1MTZA 2FXIA 2NXCA 1C1HA 4JODA 3WIBA 5IVHA 1TU4A 3K3PA 5DRYA 3DKKA 5AK0A 1W2GA 5I3ZA 2FOLA 1CK4A 3QV1A 4KR2A 4N6GA 3LPAA 4O2BA 2HK7A 1QNFA 2OCXA 3NC0C 3BTOA 2GS9A 5EZYB 1YS4A 2IS1A 5HF5A 3EXHA 4MUFA 4A2QA 1TT5A 2EFYA 4XGQA 2CLDX 2QSZA 2ATCA 1HNWB 3AY3A 3NOQA 4B35A 1P1RA 4F7WA 5B53A 3DTVA 2FWBA 2BUAA 3M2TA 1JWLA 2V65A 5JXJA 1JU4A 1Y1RA 4MYDA 2J0UA 9ABPA 1D1TA 2ISCA 2FRXA 3LT0A 3I76A 3O4GA 5E38A 4D3FA 1D2EA 4DV0B 1HE8B 3G5TA 1N5JA 3D3WB 3QHQA 1TOAA 3K0CA 3LGSA 1D5WA 4PG4A 4ME6A 3ZEIA 3IP8A 3MWGA 1JH9A 1SHTX 1SCQA 3Q9NA 4LQCA 5ER6A 5LZ9A 4C7MA 2NO1A 5CP8A 5L9AA 3PE3A 2X5XA 3G59A 4G09A 3DMPA 5ENZA 3N2KA 1OYYA 3I5AA 1T5SA 2ZQZA 1JQBA 4G0VA 3ITDA 3TI7A 4DA6A 3GRCA 3ERCA 4MRMB 2Q4TA 2EWVA 4PNPA 3FFWA 4QODA 3SNKA 1PTKA 1WA5A 5GOZA 3FZGA 4FFRA 3PFHA 4V0LA 3TRIA 4NE7A 4E70A 5K5EA 3OTOB 1DEXA 4RJLA 2J0UB 3L79A 2ONJA 2Q50A 3K72B 3ZV3A 3F6BX 2A0XA 1L5VA 1VB5A 3ME5A 3SSMA 5FV7A 4BNTA 4FE4A 3W1VA 4XIIA 4R8LA 4LXTA 1RAGA 1WXGA 3ZCXA 3KKOA 3IR5A 1ZGGA 1VE9A 1QHEA 4BNWA 2LXNA 1P7YA 1XALA 3R0QA 4M54A 1KP3A 2H0AA 4MGIR 4ALMA 3H04A 1D6MA 2G08A 2Z09A 4YV1A 5E4TA 1R27A 1N2EA 1WU7A 1SIBE 4RSMA 3UAYA 1TIPA 3DCNA 2NOAA 3KB6A 4OK5A 3H75A 1VBFA 1W0CA 4ZJYA 2G1JA 1IWOA 5I9NA 1TKRA 3AR9A 1TYEB 3KJQA 1LDMA 1T3HA 5HGXA 3SCZA 5BWNA 3ZKWB 2BR5A 4B83A 3SHFA 2OV2A 3PGLA 4QGBA 4B09A 3OG9A 3DHYA 1EFPA 3IQHX 4YDHB 2H9AA 1V5GA 3KQUA 4N48A 2C77A 5EQTA 4WFIA 5D5PA 3U09A 2VT2A 1DAHA 1EEXB 2JNWA 5KC9A 4H2DA 1Q11A 1VE6A 4UZFA 1NJ2A 5BV8A 3TL6A 3MLAA 3LQ4A 2P4UA 4G0NA 2E4WA 2A5GA 4ZV7A 4PFKA 1C3XA 1RXIA 1ZAKA 4P82A 3IVCA 3BAZA 4YPOA 2WJIA 1S2MA 3VBCA 3IIMA 4G81A 2QQ5A 4KXQA 4NAVA 1U8XX 4QXAA 2PDAA 2O8FB 4YP1A 2XLBA 4RLSA 3K0SA 3MCVA 3HHPA 4JNCA 5E8RA 3FYUA 1EFRD 1YACA 2NZWA 4G2NA 4HUJA 1GPJA 4JLPA 2R7KA 5IUJC 4YXFA 2QX7A 3BD7A 2CWWA 2ZJOA 4HAVA 4PIVA 5DHPA 3MUNA 2FVXA 5B4UA 2XXAB 3WLOA 1F5SA 1E5VA 2Z1MA 4BQIA 5CDTA 1LPAB 5JQGB 1UPAA 1MT0A 1KI4A 4RESA 3GIWA 3WLEA 2V9CA 2XHEA 2YFQA 1OFTA 1E62A 1J0BA 3FMVA 2TMKA 2V7XA 5AKYA 1JT9A 5FO0A 1P7VA 2OSVA 1M7BA 3HL0A 1O0BA 4O2AA 4G0YA 3KT0A 2KMLA 2O7QA 4DMGA 1ZR2A 5HFNA 2ZYAA 3GG9A 1M10A 4EGCB 4OL9A 4E4YA 3OX3A 2MT9A 4WK6A 1NDHA 4RPHA 5U4QA 4IIUA 2FPSA 3K0BA 4KRXA 4RL4A 5GPBA 4ZODA 2P9EA 2YW2A 3PYXA 2CCKA 3H97A 2GCNA 1CQIA 2QTNA 2VJCA 4D97A 3HR8A 4FXOA 4B3RB 2RFLA 5FD8A 1GG5A 3CIFA 4XLTA 1M6YA 3B8HA 3BWMA 3OOHA 2IX9A 1L5QA 1XZAA 4BO7A 1AO0A 4CR6A 3NM5A 1XHEA 5LMUB 3ORRA 3TIVA 4G97A 5KCZA 3EC2A 3AUAA 1H22A 3IPLA 5DM70 3NDBB 4TT8A 1P17A 1VKHA 4YR9A 2UXBB 2ZJ6A 3BXFA 4CTOA 8ATCA 2FQYA 3KQNA 3N2IA 4X8LA 2QX6A 2WQ7A 2I3DA 2ETVA 1W93A 3ESRA 2GB4A 2OCYC 1D1PA 3BSWA 3DDSA 2B37A 3REGA 1KSJA 2M32A 3M6LA 2AGVA 3D54D 1SBTA 3SJCA 2RKWA 1K1EA 1OXBB 3CUSA 3NV7A 4E07A 3ZOZA 1KR5A 1DBSA 1QIDA 1O5IA 1ZG3A 3V7UA 1Z7YA 4TXJA 1T6BY 4EG6A 4LEIA 3A4NA 3ZJ4A 3FCOA 1J24A 4G0XA 1KU0A 3I5XA 1E3TA 2BFOA 1X80A 2JJ2D 3GJZA 1FVFA 1TQDA 1IEQA 1SKYB 2JFVA 4NAHA 5KNCH 3D9QX 4QBHA 3KXKA 4UU7A 5DM0A 3QYPA 4BQPA 3C43A 4PZAA 4BLSA 4RTPA 1ECBA 1KJJA 3GCDA 3AZOA 3CLUD 4NPHA 5JHGB 1RSZA 1WNFA 4JA0A 4J9UE 4XQ0A 2Q7DA 5NULA 3WDLA 4DV1B 2WZDA 2H4JA 1BHO1 3ZVKA 1EU1A 4AUEA 2JAHA 4LS3A 3KX2A 3W3ZB 4TKVA 3FI9A 2WFMA 3NHLA 1F8YA 1N7GA 2VYVD 4RJ2A 3WWEA 4KPGA 3ZJYA 1BOFA 1QFZA 3B3FA 4UAGA 4KSBA 1VIVA 2MSNA 3AESB 4Q18A 2ZJ0A 3L2OB 4DLKA 3OZIA 3UJDA 1DDIA 1E6UA 4CQNA 4MW1A 4RE5A 1BDBA 1VIDA 2R1ZA 2WHPA 4LTMA 3ETJA 3OIFA 1SBCA 4Y7DA 4ZT4A 5EKUA 5HTOA 1WMDA 1U2DC 3ISTA 3VAYA 1J4AA 2O7RA 3EQ9A 1FPQA 3IUYA 4HZUB 4AY4A 3D7KA 3QVWA 1T4BA 1HUQA 4PV7A 1N36B 3CB4A 1Q3KA 3TOXA 3HWSA 5EE5B 2COKA 2GEDA 3B82A 2PRJA 1M8PA 4O4IA 4RDXA 1NUSA 4AZ0B 1ESEA 1AHPA 5FTMA 3GLIA 1EH5A 1FYDA 1S7CA 3QTBA 4IEFB 1QG6A 1T15A 4A26A 4N0PA 2Z1DA 3SJAA 5BUZA 2A88A 1TM2A 1OZFA 4PYMA 4MPJA 5JCOA 2EGHA 1HFEL 2WLSA 4U00A 3GGOA 1MAHA 4EENA 1Y1SA 1OBVA 2JF0A 3DAHA 4F4CA 4HGZA 2YQZA 3AEXA 4LNUB 1PLLA 3T0FA 1N2HA 1ZRHA 3U0VA 2FOIA 2DHEA 1BMFA 3ADPA 2C4NA 4MQFA 4AJEA 2EZ4A 4W8GA 2J30A 3NBQA 4X63A 5C9ZA 1XFAA 2QRHA 3CX3A 3O03A 2GYUA 3IKTA 1N9KA 1TO2E 3TLKA 2LCIA 3I42A 1R9MA 3CLTC 5LBTA 4RFVA 1NC3A 1IN4A 1DL5A 4BNXA 2GCOA 1DKPA 1L4LA 4QFDA 5JUWA 3BM5A 2VLBA 4PYQA 5BY2A 2VSOA 2OFOA 4M6WB 1K63A 4LJ9A 4ZQBA 2C0PA 3I32A 2D6FA 3JQAD 1E1KA 4AAYA 1FC0A 2C8LA 3GGCA 4EGFA 5JJLA 3BWEA 2XT6A 2GD2A 5AKJA 1XKXA 2FFQA 2GI4A 2MYPA 2PAAA 2R6FA 2YWBA 4PX3A 5K3SA 1XZGA 3RAJA 5JTUA 2OAGA 3DL2A 2JAOA 2QRJA 3HDQA 3GEGA 4B3DA 1TJNA 3N3AC 1WLSA 1YXMA 1G8YA 2HDNB 4ILKA 5H70A 3RK1A 3ZQUA 1TD9A 2J6CA 1QSGA 3UYLA 4URWR 4A8JA 4OMDA 2QENA 4KMRA 2R6JA 4CQMB 1JT2A 1LVUA 1UM9A 2PGJA 3FHOA 5L3ZA 3G2NA 4FQ5A 1Y42X 1QQTA 5KQGA 1DQPA 3R7SA 1C8VB 1DCKA 1XE3A 3BMOB 3FDZA 4R01A 3NKFA 5IMBA 1E2NA 4L5YA 5CTJA 2C4MA 3BHMA 2XZPA 4Q48A 2LIPA 4XD2A 2DMRA 3ACBA 3IP1A 2GASA 4QTXA 1P2TA 3PXDA 4FZ3A 3H1BA 1BDIA 3A1TA 5E4FA 3E9MA 1UKCA 1YFJA 2AN9A 3HJUA 2IYNA 2QTWB 3NOXA 3FYTA 2BGLA 3IPCA 1YKGA 3QK7A 4QYSA 1IJKA 4UTOA 2BP7A 4I6JA 5EZYF 3AM3A 2NPFA 3ZTWA 1NFFA 2V6BA 2XTZA 2EF0A 1YHYA 2CFIA 3DAPA 3C3JA 5D2CA 2D1YA 2GXQA 2V6IA 2NXJA 2D7DA 4JI7B 1H1LA 3HJAA 5H59A 4YAKA 4LF9B 2PS1A 1U6JA 4JD5A 4C7OB 2XZTA 2OPHA 1XMJA 3PIIA 4KI0A 5IJZA 3ZVMA 2C7BA 1YVPA 2P2NA 4BUJA 4CDNA 4G85A 4RENA 2PUHA 2ZBRA 3LYUA 4JELA 4J0JA 4PGHA 5IBPA 3WGZA 4IQ8A 4IG9A 3CV3A 1RAAA 1CIJA 2NYRA 1T25A 4QOSA 5KQMA 4UEQA 1L8QA 3U7FB 2XOEA 1KDRA 2ECQA 3PA6A 1A04A 3MVEA 2HK9A 3S70A 4C3UA 3WK5A 4GKBA 4Q4LA 4KE6A 1SVLA 5BR1A 2IEZA 5FOVA 4KFCA 1OREA 1IAVA 3R0VA 2VZ8A 1MAWA 5GV7A 2C59A 3DKPA 4QO8A 3O74A 4JQOA 4BVAA 3B78A 1VZ2A 5KPJA 5ALIA 3PPVA 1SXPA 1E6EA 1U28A 2ZBUA 3GVPA 1ECFA 2RHOA 3F5MA 1L4EA 4UTZA 1THTA 2Z83A 2UVPB 1NN1A 3F6EX 4U7FA 5KNDH 2H0QA 5JAQA 1HOTA 1PNRA 1EX7A 4MUKA 1SGWA 2BGNA 4FD2A 1ZL0A 4U8GA 2Y1EA 4RTMA 5KMGA 2NQ8A 1Q12A 2A9KA 2JFYA 2FKNA 3UAZA 5EMKA 5KNDA 1X7XA 1CD5A 1YHZA 2HH9A 1RZRD 3D8RA 1T8PA 1LDNA 2PJRA 1SHZA 2OAEA 3T3HA 1XF1A 1LPSA 3BSYA 2FSIA 2DUUA 4O0MA 1QF7A 3QG5A 5SYMA 1J06A 1BQEA 4GPEA 4IFTA 4LJYA 5I7EA 1PR0A 3W34A 3BL5A 3V4LA 5HJEA 1OXSC 2CMGA 2UYHA 4ZAFA 3S55A 1C3LA 3GLUA 2QL9A 4EBFA 5A3JA 2QGZA 1GZUA 1K3FA 2BTQB 4LSMA 4CM8B 2ZIFA 1G2PA 4FDVA 1MLDA 1DRKA 1SC9A 1ZZGA 3AOEA 4Z7JA 4ZICA 1EFHA 1FRNA 1O95D 1PWZA 2BVNA 2QX4A 1Y81A 2Z9BA 4LDPA 1G7RA 1E7SA 3R7DA 5BRJA 2WBLC 1PN3A 4EI2A 2W6CX 3NANA 5CT9A 1WMEA 2HV9A 1J25A 2V9ZA 4XOIA 4RH3A 2PKEA 3IDZA 4I9NA 5E1MA 3PRHA 4DG9A 5ECWA 5GIOE 1BS2A 1W47A 4OQEA 3RBZA 3ZDYB 2X0FA 5C1PA 4QM7A 5LZ4A 4PFQA 1DKMA 3HXLA 4X1YA 4CEJA 1QMPA 2LP4Y 1T9ZA 3SX0A 3UMCA 1LV8A 1UKVY 4OXXA 4OH7A 2W2KB 3WFIA 3P5SA 4TXHA 3S2ZA 3A0RB 1XIVA 2D4AA 2KLHA 5EWJB 1CYEA 2I33A 2EG5A 2NU6B 3O9MA 4UM5A 3FBWA 3C3YA 4AWBA 1UFOA 2D0DA 4RY9A 4JI0B 3NWEA 4M83A 3TNYA 1P1HA 3QY0A 1NV9A 2QROA 1IPFA 2IUSA 3CO5A 3CIOA 1TPYA 3H7AA 1F8GA 3H5NA 3U48A 1XRJA 1LBTA 3FMOB 4FZVA 2Z4RA 1R88A 5A5VA 3V1NA 4Z4GA 1NSTA 1WMFA 2VDQB 3L6EA 3N5KA 4LW8A 4MJXA 2XT0A 3AUJB 3GYBA 1P6UA 1N25A 3PGA1 3CX4A 1B8VA 3NT5A 4YRCA 4BLQA 2QU8A 1RXCA 1V9LA 3WGGA 1ULTA 4JX9A 4EKDA 2AYZA 2YVUA 1SUIA 3G2JA 2Q45A 1QS0B 3A2NA 1NF8A 3LVBA 4QHSA 5B2FA 5L7TA 2P9HA 2MCFA 2RHWA 3I5UA 4JQZA 5GJCA 3P45A 4K3UA 3TIGA 1N57A 3AGQA 5IYZA 2FEXA 1QDLB 4W5QA 3AW8A 1WVMA 3R6TA 4HDMB 5CLLA 3SLKA 4R51A 1FL9A 1OXKB 3SS9X 1MJNA 4G5HA 1BVYF 4RKEA 4DQVA 3M6XA 4EF6A 5CNKA 2PRYA 4MZDA 1TTQB 3KOOA 1FUYB 4OXIA 4YQYA 4AW9A 2PKCA 1PSWA 3KJFA 5FPQA 5K7SA 4MQEB 2RGXA 3ANSA 3M9WA 1Z68A 2C2OA 4L3OA 4GR5A 2MSDB 4UHCA 3MJTA 4A16A 5AKGA 4Q47A 2GN9A 3AEZA 5CG2A 5DNCA 4QBTA 2C7PA 3K2BA 2PSJA 3M8KA 3EA5A 4UU0A 4OYYA 3BL8A 1A5SB 4J2TA 2NPOA 3TH5A 2YWXA 3GCWA 2RI1A 2H7CA 1F4VA 1E63A 4BIIA 4K6HA 1G5TA 2OV1A 3L3BA 3TOVA 5IX8A 3GQBB 1XDDA 3AESA 4UREA 4X8OA 2AVDA 3DKRA 2ZRKA 3VHQA 1U2QA 3G3EA 3Q1KA 1N2CE 4QOJA 2Q1UA 3E03A 1J20A 3KJZA 4LMBA 5DNDA 1Z88A 2N42A 2PX4A 1YJXA 3TEMA 3BCRA 4Q3DA 1EZZA 1IG0A 3HB5X 5E3HA 3TE6A 5J2UA 1NNSA 3L06A 4ZEWA 1J97A 4WNAB 4ZYXA 3CX6A 4JLOA 3EVZA 4MAFA 2PXHA 1ML4A 4YN3A 4HPJB 5COAA 1C1DB 1UL1X 2WHRA 2Q4RA 1G5HA 3R09A 4H1HA 2IZ1A 1D07A 3RU7A 1DINA 1A0OA 1JTVA 2I7TA 5HXAA 2R9VA 2X19A 1GNTA 1XFDA 1NGSA 2OUIA 3C1TA 4J94A 4LBZA 4NP6A 4BO3A 4E12A 5HKBA 1W0JD 3WICA 3H5OA 4B3BA 1SVWA 3LHFA 2P69A 4M60A 1MW9X 2VSNA 3C1UA 4HAXA 1EFCA 2GAJA 3N7TA 3V42A 1GQOA 1LBIA 1NE7A 3TR6A 5C1DA 1NASA 4Y1RB 4N5MA 3ZCSA 3C41J 3PF9A 1B8OA 3QKWA 2DBVO 4NPCA 2E6UX 2IDJA 1I6MA 1P1JA 1DAOA 3IAXA 3H6HA 3OM0A 4OMUA 2WHXA 4HC4A 5IAKA 1LH0A 5KNBH 2F8SA 1TIKA 1K5DA 2O20A 3R4VA 4XUCA 1EAMA 1RACA 2BEWB 2IF0A 5JVDA 1U02A 2PJDA 2UZ4A 4IHQA 1ZK0A 4OHZA 4FDAA 3CONA 3A6HA 5AVKA 2GEBA 3BQ9A 1C9MA 4I55A 3CKMA 1NW5A 3IBGA 2UDPA 1W4CA 3C85A 3BKWA 1A9QA 3B9PA 4JYPA 1R37A 2B9VA 4PAQA 3WRYC 4CUJA 1IU9A 1XD2B 3AEKB 1CEQA 1CUZA 4NJMA 2DPXA 4OGGA 3WIVA 1PYDA 3ZW9A 3CYFA 5JMOA 1EK6A 4OQXA 4G0PA 3P94A 1VSTA 2W98A 1ZR4A 4B8ZA 1YT5A 1DWUA 4JT9A 4P83A 2A0KA 4MV3A 1PX0A 1TM5E 2B20A 2H08A 3GRYA 3PHCA 1ZCZA 4NBVA 4PAGA 4DAOA 3QEMB 2W6NA 3RRYA 3O8QB 3LLUA 2CMDA 2E4UA 1DDGA 3R3WA 2GBLC 2BEWA 1JA9A 3QW4B 4MQBA 4RMGA 5EWMA 5G40A 5KOHB 1CS0A 2BGRA 1EA7A 3SAJA 4O6VA 4ZYYA 3WLIA 2ZI3A 4L78A 4DB2A 2G7ZA 3CJTA 4PC1A 3PSHA 4HXYA 4NK5A 1FNCA 4IDPA 4D46A 4AF6A 1NFQA 3HCCA 3PDIA 1UXJA 4KTTE 4LJLA 1TAGA 1FS5A 2PIDA 1QPGA 1KJZA 4IBOA 4FLFA 3REOA 1Z8NA 3HYRA 1WCIB 4V0NA 4REMA 4BX0A 2C5GA 3Q6MA 2VRCD 1KJ9A 3T1HB 1AA9A 3TE7A 3A3NA 5KQRA 1R10A 1XAIA 2HMTA 1S89A 2HAEA 4L08A 3E22A 5JAZA 3CCFA 4TZKA 5KNBD 4JX8A 1AQNA 4D9HA 3QWAA 4ZARA 4DF3A 4ZAGA 4MQ5A 4WCVA 3NBKA 3RVBA 1QLJA 4JDPA 5CEJA 1KVSA 3NBUA 1HG0A 5BQXA 3ML1A 4LRXA 1PUJA