2XRHA

Crystal structure of the truncated form of hp0721
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
100
structure length
100
Chain Sequence
AIDPFTMAKDFSKTSDEDLAKMAGVVAPQDIVDYTKELKKRMEKMPEDKRKAFHKQLHEYATKNTDKMTVADFEARQKAVKEALKKGNMEDMDDDFGLRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN HP0721
publication title Crystal Structure of Hp0721, a Novel Secreted Protein from Helicobacter Pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Unknown function
total genus 35
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2010-09-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06518 DUF1104 Protein of unknown function (DUF1104)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.1430 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 2xrhA00
2XRHA
chains in the Genus database with same CATH superfamily
1OCOC 1LPEA 4O6NA 5L0DA 4JC7A 2E87A 2OEVA 2YL1A 4MTGA 4O7GA 1FNTc 1NZEA 3AQCA 4LACB 4LDKA 4YL0A 3S28A 3GWLA 5L0HA 2B0JA 4H4KC 2R7SA 1J8MF 4MW3A 5L0GA 1ORYA 1ZHTA 2IBFA 2H7VC 3TOMA 4G7HF 2Z15A 4OINF 2HKVA 2J0XA 1EA8A 5IY5C 2XM0A 4AX2A 3EGXA 3SZRA 1WOLA 1D0ZA 1LKXA 1RKCA 5JP7A 3SXYA 3T6JA 1DOVA 2ZXPA 1CPQA 5DQZA 2FGYA 3EHNA 4CIHA 3LJBA 4U5HA 3VRCA 1TKNA 4XQ1A 2OJQA 3FVYA 2A1DD 1RJ9B 1VMAA 1Z3IX 4MVQA 3LAYA 4JJFA 4ONSA 2H8AA 4MTOA 4EKWA 4JCZA 2LCHA 4LERA 4YT4A 2V3CC 1A7VA 3WAQA 3KYIA 2MYSA 5D92A 1LS1A 2Q4FA 3MYIA 1JRAA 5FCLA 4XPWA 2XLMA 4IWBA 3HNLA 2UUIA 3NKDA 1C17M 3DD7A 3U8VA 1VLSA 5DVWA 4YT8A 2P1AA 4U9EA 2KW3C 3DZAA 1FTSA 3E9VA 3JSZA 2A6HF 5JLIA 2J0WA 2KQ9A 4BEJA 4I3MA 3O6XA 1CPRA 1HMDA 2PBEA 4I44A 1VOMA 2Q9AA 3M4CA 1Q0MA 1QQ3A 3ITFA 1E86A 4MVSA 1Q0GA 2QY9A 3IQCA 3EG9A 2JD3A 2EIMC 2XLVA 1VTMP 1K40A 1KTMA 1ZW3A 2A0UA 3O55A 3ECSA 3AG4C 3JRMO 4CS8A 1BDJB 1TFKB 1NFNA 1ST6A 5F28E 5EK0A 5KYNA 3W8HA 2CNWD 4RDAA 4YN0B 4AL0A 2R7RA 2LSEA 3DXJF 3VM6A 1V55C 2L6GA 1QKRA 4NQFA 5A6JA 5JVEA 3GEIA 5DS6A 1W2WA 3A11A 4LDQA 3AGUA 2MHRA 3S9OA 3Q6NA 4G78A 3TK0A 5A6KA 2FFHA 2I8BA 2RD9A 2C03A 3BRJA 4MQ9F 3G4ZA 4NTAA 3TOLA 3NYLA 5AC4A 4HFKB 1ZW2A 3U9JA 2CNWA 1CGNA 2ZPAA 5B3SC 1YZCA 1C02A 2I15A 1J8YF 2LK4A 2YZSA 4MVMA 2LD6A 3IQTA 3N2ZB 2PFDA 4NY3A 4CIPA 5HV9A 3AG3C 3ASNC 3ABLC 1OCZC 1YAUO 5COMA 5L0JA 2LFDA 1E84A 2BE5F 2G62A 2LP4A 2WZLA 3EJNA 2ZXOA 3FXHA 3IEEA 3LEVA 2GFHA 2R7QA 4XPXA 2W9YA 2HSQA 3V7OA 4N06A 3A9CA 3ATPA 3QW1A 4HEAJ 2NPUA 3Q6MA 3SXZA 1ORJA 1T01A 3N0TA 3RH3A 1ZZPA 3UGOA 1ZHXA 3ZDLA 2ETSA 1Q0DA 2EPNA 1N1CA 2L6HA 4CS8C 5EGYA 4K0DA 4XTKA 4J7TA 3AGTA 3RF3A 3VAYA 2J45A 2R7WA 5BQHA 2HUJA 3HNJA 3EGDB 3GEEA 3MBGA 5A69A 2HMZA 4CSAA 2IXOA 2J7PD 3HJCA 3NMIA 2Y3HA 3G50A 3HLZA 2HSBA 3LLIA 1LE4A 3PDMP 3Q7LA 1IZMA 2JPUA 1M2VB 4IGGA 4MVOA 4QI0A 1D0YA 1V4AA 1M56C 3B29A 1OR2A 3NKEA 5E33A 2YLDA 1H6GA 1WASA 2X51A 4PR9A 4OIRF 4E0IA 3FHDA 1O3UA 3U8PA 1YZAA 4CJOA 1OW8A 4K7BA 3T6GB 4U5FE 1YYJA 4A4AA 4CX9A 4JTDB 1YJGA 2JX0A 4WABA 3EPVA 2J7PA 1YVIA 3EGDA 3GM3A 4XEVA 1LS4A 3JRTA 3CZ6A 2EINC 3IHUA 4EIYA 1HE9A 5JT4A 4P6IC 1VK5A 4M63A 3RQGA 4C3BA 1M2VA 2XM4A 4JJGA 1ZU5A 1HE1A 3RVYA 3AG2C 4KBLA 1A7DA 3TD7A 3I5PA 1BR2A 2ZD9A 3IPMO 3L1MA 2UUHA 2OU6A 3TQOA 1GGQA 2OQMA 3ZQYA 2O9XA 3IQ5A 2NUPA 2DI3A 2J9WA 2R7XA 3NMKA 3QVZA 1OXBA 2D4UA 4E17A 4ANJA 4JURI 2NUTB 5F5FA 4GYTA 1NBBA 2KGOA 1Q0FA 1LI5A 3I5QA 1S7ZA 1MMNA 2CGEA 4JZAA 5F5HA 1Q0KA 2AVKA 3QW0A 2R02A 1XWJA 1JPNA 4I1MA 4DOZA 4CSAC 2IXNA 5KYYB 1FMVA 4C7OB 3DJUB 1OQCA 2Q7RA 3U2LA 2R7UA 3ZG1A 4PACA 3QMKA 1E2XA 5A6AA 1G8XA 4DJ9A 4E7SA 3EZHA 3FOOA 4NC3A 2XLEA 2Y3GA 2YLGA 4XLPF 4U5CE 2NUTA 5JUAA 3MLGA 4BJ6A 4PFPA 2VCCA 2WVQA 3JYHA 1LI7A 4YL3A 4O6MA 4XEKA 2XL4A 1L3PA 3W2VA 4KNVA 3KMIA 4J32B 1G4WR 3E70C 4BJTA 1D1BA 2Y69C 3EH1A 1VLTA 3ZTZA 4KC9A 3T6BA 2LIGA 3S84A 4B6IA 2ICWG 3F46A 4JTAB 2YLIA 3UMKA 2XLWA 3C8GB 1RJ9A 2KC3A 3U5SA 4Z9IA 4C3DA 3T4RA 3GORA 1Z5ZA 4WGZA 1NG1A 3EH2A 4LLEA 4EBBA 2J46A 5KYUB 4P9FA 1OR3A 3H2UA 2L9JA 2QNLA 3HTKC 4C3EA 3NRHA 4PJNA 1YARO 2J8WA 4ER9A 1BR1A 2HMQA 2OEXA 2Q00A 2QLAA 3AOUA 3DM5A 4OIPF 3SP1A 3CSKA 4IRUA 4F4BA 1UFBA 2HFIA 256BA 3CEXA 1PD0A 1T5OA 3HKKA 3PMRA 4LDRA 4U5DE 3U0CA 4N6CA 2EPMX 1ZHWA 4IAQA 5K0IA 2P0NA 4IARA 3NMJA 3UMIA 2OJED 4J30B 4AK9A 2V26A 1GS9A 2YQYA 2IOQA 4PFOA 2H7OA 2R9RB 3V5XA 4ZLCA 1I5NA 1Z23A 1EQ1A 4BG0A 1SMYF 4BJ6C 4MW8A 4YT2A 2W4BA 2PNOA 3S29A 2VCBA 2RSEB 4DRJB 1QZXA 4P9TA 3NG1A 1L7CA 1WTYA 3B9QA 3NYMA 4IAOA 3TJ5A 1ZHZA 4N4WA 1NU7D 1HMOA 1T6QA 3LNRA 2Y3DA 1BR4A 1Z6AA 3DAGA 3B71A 3LEOA 4PK4A 2VH3A 5CI8A 3X2QC 4EWCA 3O39A 3KPHA 1MMAA 3KKBA 2B0HA 4WJ0A 2D5RB 1RXQA 1RCPA 3K66A 3DI5A 3U3FA 2X0CA 4JVSA 1WATA 2YEVA 1M2OA 1JPJA 2BC5A 1B68A 2LQGA 2YKZA 2YL3A 3Q7GA 1GM5A 2Q9CA 3VF0A 4AE4B 2W45A 3WHNA 2YVKA 1EKYA 3K7DA 4FESA 3FAPB 2VASA 4FWVA 3JZ0A 2OKUA 2G3VA 5GPGB 3UNGC 3JYYA 3W8IA 3BEHA 2YL7A 3EFOB 4RD9A 1O87A 3RQFA 3ZC4A 4BPMA 1FFTC 4XEFA 4OIOF 1SZIA 3AG1C 3MX3A 2Q9BA 4DXWA 2P61A 2YHSA 1OW6A 3GANA 4MVZA 3RQEA 2NSFA 3C18A 1UG7A 4O79A 4D4NA 5BUOA 1A0BA 4WGYA 3RW0A 5JS5A 5L0FA 2XSEA 3H65A 3RFYA 2VB6A 3LNMB 1SF8A 2NSGA 4JEBA 4MTFA 4QDLA 1O5HA 2IM8A 2VC9A 5BQIA 2R03A 1WWPA 1M6TA 3JT1A 1XZPA 4JRZA 3DJNB 4JKVA 1APCA 1AVOB 4YT5A 1V74B 2QE9A 3EFOA 3L0IA 4ULVA 3IQ6A 5L0CA 3V5ZA 1TWCA 5TJ5E 4ULWA 5JRAA 4RBNA 5JSLA 1RKEB 1NFOA 1PV3A 4LLCA 5KYXB 3JCUQ 3M79A 2WB7A 4JE9A 1A7EA 2W4MA 2AU5A 4PJJA 4CDVA 1VYKA 4XLNF 2AP3A 1MMDA 1JR8A 3U2MA 1TWAA 4K1OA 3C7JA 5B1AC 3OWTA 3U3BA 1MNEA 4CJGA 5EHHA 4W8PA 1U0BB 3WG7C 4MNDA 3ZIBA 4IB4A 4E7ZA 1NU9C 1BZ4A 3KH2A 1KNYA 5E3AA 1R4TA 1AEPA 3ABKC 1F1MA 2EPOA 5CI9A 2XXAB 3GEHA 2XS8A 2OOCA 3EGXB 4YL1A 1G5ZA 3ZQVA 4MVRA 5DS5A 1FFHA 3HNKA 3OA1A 3L8IA 2IYLD 2XLDA 3TJ6A 3UR3C 3W2WA 3ZSUA 1QSPA 5CIVA 1LE2A 4Q5SF 2M4EA 3PCVA 2KYHA 3AQBA 2WL8A 3CQZA 5E3CA 1I4ZA 1QVXA 3H2VA 3QTHA 3GODA 4BJ1A 1TWGA 2PX0A 3B0UX 1EI7A 3VYWA 4CS9A 2XL6A 3ZVRA 5L0IA 3CAXA 1YA9A 3L8JA 5FZTA 4OD4A 2CDQA 2L7AA 3S90A 4NTBA 2P7VA 2KSFA 1OCCC 1OKKA 1ZYRF 4BEMJ 1CGME 2XXAA 2PP4A 5KYYA 1R5ID 4C7OA 2ZXRA 1U6HA 4GQHA 3C8ZA 3PHF2 1HW1A 1YA7O 1T6UA 2QTVA 1LM3B 4PJLA 4XWJA 2XLOA 2XRHA 2YL0A 2OG2A 4X0RA 1E83A 1K05A 1Y4CA 2L81A 2Y39A 1PCXA 1ZU4A 1A41A 2KNHA 2QUPA 3EZIA 5L3QA 3K1IA 3S27A 2VCAA 4BJ5A 4DBQA 1TFOB 2M64A 1MQVA 3C8GD 4NCQA 5T3TA 3QVYA 4YK5A 2GWWA 1WN0A 2EPLX 4J7YA 3EG9B 1FAPB 4L6RA 4D4XA 1V54C 3SXKA 3B0VC 2IXPA 3M15A 2HV6A 4JCHA 2HJMA 3OEOA 3SEOA 4NTFA 3UMHA 4MVUA 2YWAA 2EIJC 2KK1A 4E0HA 1DOWA 3I4UA 3EHMA 2MWQA 4U9DA 1GQAA 3DE9A 1KU2A 3N24A 4I1OB 2PX3A 4JTCB 4Z9JA 4EHPA 3C8GA 2PF4E 4DRIB 4YJWA 5HSWA 4O6YA 3KL4A 5BQGA 2ASRA 1JAFA 2EPKX 2GA0A 2WVNA 4IJJA 3GWNA 3KYJA 5T3WA 3O10A 1HW2A 5KYUA 1TWHA 2LFFA 4CDAA 4KNWA 2XLHA 3MFNA 4UDVA 3G4XA 1PD1A 2HV7A 1JOGA 5DQTA 5A6BD 5B3IA 3R7CA 4CS9C 1ZVZA 1H7IA 5DLJA 2J9UA 2ZXWC 3EQLF 1OXKA 4OIQF 3GM1A 1E85A 1T9KA 2WVOA 2WZFA 1FR0A 2KJGA 4R32A 3GM2A 2XL8A 3LUTB 2AWYA 3DKAA 5KYWB 2EIKC 2XS1A 1HY5A 1MMGA 2DGJA 4CDYA 3FDQA 1H9TA 2C04A 5DS4A 1CGOA 1JMWA 5B1BC 3S0XA 1LVKA 2H7BA 2G3KA 2YRFA 3RIPA 5COFA 4H54A 1QLEC 3LLKA 3LS0A 5A6BA 1ORSC 3L34A 1FMWA 1NSGB 3AJMA 2Y3BA 3K1IC 4U5EE 3SNHA 4BJ5C 1RMVA 2IXMA 4EBKA 2TMVP 1G4US 5D91A 4Q4ZF 3ZTMA 4E18A 1XZQA 3LS1A 4DVYP 3LESA 3ASOC 3V5YA 2BL2A 3DWWA 1OW7A 3K6BA 1Z7Qc 1D0XA 3M4BA 1U89A 1VB5A 4FAPB 1D1CA 4DVZA 5KYWA 3JSEO 2F22A 5E2QA 4CBEA 2R7OA 1D1AA 4KI2A 4OD5A 3RKOF 2DB4A 2DYSC 3C62A 1IW7F 4AL1A 3WODF 2HJ3A 3X1OA 1OCRC 4N6HA 3TULA 1YYXA 4DBRA 1H9GA 2A0BA 1I4YA 3ABMC 3FMSA 3US6A 4ZLDA 1MNDA 1T6IA 1QPUA 2A6EF 3MYFA 4JW1A 3JTLO 5AGFA 1NLXA 3ZWIA 4HE8D 4EUKB 1LIHA 2DYRC 3K33A 4GEHA 4AE4A 4G7OF 1TQGA 3DMDA 4EBJA 1AUEA 1SYQA 3F47A 1S05A 4FX5A 4W8KA 4CS7A 1TR2A 3DE8A 3K1HA 2OCCC 4DRHB 3R2PA 1VYIA 2A69F 2FAPB 1Y6DA 2R7TA 1ZHYA 2P6VA 3DAFA 2NG1A 4JIOA 4Z9HA 4YWQA 4G7ZF 3POVA 3NDBB 2AWCA 2CW0F 3FAJA 2GAQA 3B0PA 1Z63A 2GDCA 4A2NB 3DM9B 2R05A 4Q7CA 3W4YA 3RYLA 1C03A 3J06A 2WZGA 1K04A 5T1DB 4U5GA 3U9MA 3SXMA 2R25A 1WGWA 2NUPB 1SR2A 2Q3TA 1YLMA 2EILC 4G0HA 4JEAA 5L3VA 4MS2A 4U5BE 1M57C 2A68F 2HZ8A 3FOPA 3SYNA 3QZCA 3T9OA 4QI2A 3HNIA 1RKEA 4HFFB 5COGA 2R7VA 4XPYA 2L6FA 3NYJA 4PJMA 5AC5A 5KYXA 3UGPA 2HS5A 3RVZA 1BBHA 1OKKD 2CCYA 3C63A 2J9BA 2CYDA 3M1CB 2J9VA 1YDIA
chains in the Genus database with same CATH topology
1OCOC 4O6NA 4O7GA 2E87A 1NZEA 3AQCA 4LACB 3S28A 2B0JA 4H4KC 2R7SA 1J8MF 1ZHTA 2H7VC 4G7HF 2Z15A 4OINF 2J0XA 5IY5C 4AX2A 3EGXA 3SZRA 1D0ZA 1LKXA 3T6JA 2ZXPA 5DQZA 2FGYA 3EHNA 4CIHA 3LJBA 4U5HA 1TKNA 3FVYA 2A1DD 1RJ9B 1VMAA 1Z3IX 3LAYA 4JJFA 4YT4A 2V3CC 4LERA 2MYSA 5D92A 1LS1A 5FCLA 4IWBA 3NKDA 3DD7A 5DVWA 4YT8A 3DZAA 3JSZA 1FTSA 3E9VA 2A6HF 2J0WA 2KQ9A 4BEJA 4I3MA 3O6XA 4I44A 1VOMA 2Q9AA 3ITFA 2QY9A 3EG9A 2JD3A 2EIMC 3ECSA 3AG4C 4CS8A 1ST6A 5KYNA 3W8HA 2CNWD 4RDAA 4YN0B 2R7RA 2LSEA 3DXJF 1V55C 5DS6A 1W2WA 3Q6NA 2FFHA 2I8BA 2C03A 4MQ9F 3NYLA 4HFKB 2CNWA 2ZPAA 5B3SC 2YZSA 1J8YF 4NY3A 3N2ZB 2PFDA 3AG3C 3ASNC 3ABLC 1OCZC 2BE5F 2G62A 2WZLA 3EJNA 3IEEA 2ZXOA 3LEVA 3PHF2 2GFHA 2R7QA 2W9YA 3V7OA 4N06A 4HEAJ 3Q6MA 3N0TA 3RH3A 3UGOA 1ZHXA 1N1CA 4CS8C 5EGYA 4K0DA 4XTKA 3VAYA 2J45A 2R7WA 3EGDB 4CSAA 2IXOA 2J7PD 3HJCA 2Y3HA 3HLZA 3LLIA 3Q7LA 1IZMA 1M2VB 4QI0A 1D0YA 1M56C 3NKEA 5E33A 4OIRF 2X51A 3FHDA 4K7BA 4U5FE 3EPVA 2J7PA 3EGDA 3JRTA 3CZ6A 2EINC 4P6IC 1VK5A 4M63A 4C3BA 1M2VA 4JJGA 1ZU5A 3AG2C 4KBLA 3TD7A 3I5PA 1BR2A 2O9XA 2NUPA 2J9WA 2R7XA 4ANJA 4JURI 2NUTB 5F5FA 4GYTA 2KGOA 3I5QA 1S7ZA 1MMNA 2CGEA 4JZAA 5F5HA 4DOZA 1JPNA 4I1MA 4CSAC 2IXNA 5KYYB 1FMVA 4C7OB 3DJUB 2R7UA 3ZG1A 3QMKA 1G8XA 4E7SA 3EZHA 2Y3GA 4XLPF 4U5CE 2NUTA 3MLGA 4BJ6A 4PFPA 2WVQA 3JYHA 4O6MA 2XL4A 3W2VA 4KNVA 3KMIA 4J32B 3E70C 4BJTA 1D1BA 2Y69C 3EH1A 4KC9A 3T6BA 4B6IA 3F46A 3UMKA 1RJ9A 4C3DA 3T4RA 1Z5ZA 1NG1A 3EH2A 4LLEA 2J46A 5KYUB 2L9JA 3HTKC 4C3EA 3NRHA 4PJNA 1BR1A 4OIPF 3DM5A 3SP1A 3CSKA 4IRUA 4F4BA 1PD0A 3PMRA 4U5DE 1ZHWA 3UMIA 4J30B 4AK9A 2V26A 2IOQA 4PFOA 2H7OA 4ZLCA 1Z23A 4BG0A 1SMYF 4BJ6C 4YT2A 2W4BA 3S29A 1QZXA 3NG1A 3B9QA 3NYMA 4IAOA 1ZHZA 1NU7D 4PK4A 3LNRA 2Y3DA 1BR4A 1Z6AA 3DAGA 5CI8A 3X2QC 2VH3A 4EWCA 3O39A 1MMAA 3KKBA 4WJ0A 2D5RB 3K66A 4JVSA 2YEVA 1M2OA 1JPJA 3Q7GA 2Q9CA 4AE4B 2W45A 3K7DA 2VASA 4FWVA 2G3VA 3UNGC 3W8IA 3ZC4A 4RD9A 4EBBA 3EFOB 1O87A 1FFTC 4OIOF 1SZIA 3AG1C 3MX3A 2Q9BA 2YHSA 3GANA 4O79A 5BUOA 2XSEA 2J9VA 3H65A 3RFYA 2VB6A 1SF8A 4QDLA 1O5HA 3JT1A 3DJNB 4YT5A 3EFOA 3L0IA 1TWCA 4ULWA 4RBNA 4LLCA 5KYXB 3JCUQ 2WB7A 2W4MA 4PJJA 1VYKA 4XLNF 1MMDA 1TWAA 5B1AC 5EHHA 3OWTA 1MNEA 3WG7C 4MNDA 3ZIBA 4E7ZA 1NU9C 3KH2A 5E3AA 3ABKC 2XXAB 5CI9A 3EGXB 5DS5A 1FFHA 3OA1A 2IYLD 3UR3C 3W2WA 3ZSUA 4Q5SF 2M4EA 3AQBA 2WL8A 3CQZA 5E3CA 3GODA 4BJ1A 1TWGA 2PX0A 3B0UX 3VYWA 4CS9A 3ZVRA 4OD4A 2CDQA 2P7VA 1OCCC 1OKKA 1ZYRF 2XXAA 2PP4A 5KYYA 4C7OA 2ZXRA 2QTVA 4PJLA 4XWJA 2XRHA 4X0RA 2OG2A 2L81A 2Y39A 4ZLDA 1PCXA 1ZU4A 2KNHA 3EZIA 5L3QA 3S27A 4BJ5A 4DBQA 5T3TA 3B0VC 3EG9B 1V54C 2IXPA 2HV6A 4JCHA 3OEOA 3SEOA 3UMHA 2EIJC 3I4UA 3EHMA 2MWQA 1KU2A 3N24A 4I1OB 2PX3A 2PF4E 4YJWA 5HSWA 4O6YA 3KL4A 4IJJA 2WVNA 5T3WA 5KYUA 1TWHA 4KNWA 1PD1A 2HV7A 5DQTA 4CS9C 5DLJA 2J9UA 3EQLF 4OIQF 2WVOA 2WZFA 2KJGA 5KYWB 2EIKC 3FDQA 1MMGA 2DGJA 2C04A 5DS4A 5B1BC 3S0XA 1LVKA 2H7BA 2G3KA 3RIPA 1QLEC 3LLKA 3LS0A 3L34A 1FMWA 2Y3BA 3K1IC 4U5EE 3SNHA 4BJ5C 2IXMA 5D91A 4Q4ZF 3LS1A 4DVYP 3LESA 3ASOC 3K6BA 1D0XA 1D1CA 4DVZA 5KYWA 5E2QA 4CBEA 2R7OA 1D1AA 4KI2A 4OD5A 3RKOF 2DYSC 1IW7F 3WODF 3X1OA 1OCRC 4DBRA 3ABMC 1MNDA 2A6EF 4JW1A 4HE8D 4AE4A 2DYRC 3K33A 4GEHA 4G7OF 3DMDA 3F47A 4FX5A 4W8KA 4CS7A 1TR2A 3K1HA 2OCCC 1VYIA 2A69F 2R7TA 1ZHYA 2P6VA 3DAFA 2NG1A 4YWQA 4G7ZF 3POVA 3NDBB 2CW0F 3FAJA 3B0PA 1Z63A 4A2NB 3DM9B 4Q7CA 3RYLA 2WZGA 5T1DB 4U5GA 1WGWA 2NUPB 2Q3TA 5L3VA 2EILC 4G0HA 4U5BE 1M57C 2A68F 3SYNA 3QZCA 4QI2A 4HFFB 2R7VA 3NYJA 4PJMA 5KYXA 3UGPA 1OKKD 4FESA 3M1CB 2KW3C 2ZXWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XRH A; 
#chains in the Genus database with same CATH topology
 1OCO C;  1LPE A;  4O6N A;  5L0D A;  4JC7 A;  2E87 A;  2OEV A;  2YL1 A;  4MTG A;  4O7G A;  1FNT c;  1NZE A;  3AQC A;  4LAC B;  4LDK A;  4YL0 A;  3S28 A;  3GWL A;  5L0H A;  2B0J A;  4H4K C;  2R7S A;  1J8M F;  4MW3 A;  5L0G A;  1ORY A;  1ZHT A;  2IBF A;  2H7V C;  3TOM A;  4G7H F;  2Z15 A;  4OIN F;  2HKV A;  2J0X A;  1EA8 A;  5IY5 C;  2XM0 A;  4AX2 A;  3EGX A;  3SZR A;  1WOL A;  1D0Z A;  1LKX A;  1RKC A;  5JP7 A;  3SXY A;  3T6J A;  1DOV A;  2ZXP A;  1CPQ A;  5DQZ A;  2FGY A;  3EHN A;  4CIH A;  3LJB A;  4U5H A;  3VRC A;  1TKN A;  4XQ1 A;  2OJQ A;  3FVY A;  2A1D D;  1RJ9 B;  1VMA A;  1Z3I X;  4MVQ A;  3LAY A;  4JJF A;  4ONS A;  2H8A A;  4MTO A;  4EKW A;  4JCZ A;  2LCH A;  4LER A;  4YT4 A;  2V3C C;  1A7V A;  3WAQ A;  3KYI A;  2MYS A;  5D92 A;  1LS1 A;  2Q4F A;  3MYI A;  1JRA A;  5FCL A;  4XPW A;  2XLM A;  4IWB A;  3HNL A;  2UUI A;  3NKD A;  1C17 M;  3DD7 A;  3U8V A;  1VLS A;  5DVW A;  4YT8 A;  2P1A A;  4U9E A;  2KW3 C;  3DZA A;  1FTS A;  3E9V A;  3JSZ A;  2A6H F;  5JLI A;  2J0W A;  2KQ9 A;  4BEJ A;  4I3M A;  3O6X A;  1CPR A;  1HMD A;  2PBE A;  4I44 A;  1VOM A;  2Q9A A;  3M4C A;  1Q0M A;  1QQ3 A;  3ITF A;  1E86 A;  4MVS A;  1Q0G A;  2QY9 A;  3IQC A;  3EG9 A;  2JD3 A;  2EIM C;  2XLV A;  1VTM P;  1K40 A;  1KTM A;  1ZW3 A;  2A0U A;  3O55 A;  3ECS A;  3AG4 C;  3JRM O;  4CS8 A;  1BDJ B;  1TFK B;  1NFN A;  1ST6 A;  5F28 E;  5EK0 A;  5KYN A;  3W8H A;  2CNW D;  4RDA A;  4YN0 B;  4AL0 A;  2R7R A;  2LSE A;  3DXJ F;  3VM6 A;  1V55 C;  2L6G A;  1QKR A;  4NQF A;  5A6J A;  5JVE A;  3GEI A;  5DS6 A;  1W2W A;  3A11 A;  4LDQ A;  3AGU A;  2MHR A;  3S9O A;  3Q6N A;  4G78 A;  3TK0 A;  5A6K A;  2FFH A;  2I8B A;  2RD9 A;  2C03 A;  3BRJ A;  4MQ9 F;  3G4Z A;  4NTA A;  3TOL A;  3NYL A;  5AC4 A;  4HFK B;  1ZW2 A;  3U9J A;  2CNW A;  1CGN A;  2ZPA A;  5B3S C;  1YZC A;  1C02 A;  2I15 A;  1J8Y F;  2LK4 A;  2YZS A;  4MVM A;  2LD6 A;  3IQT A;  3N2Z B;  2PFD A;  4NY3 A;  4CIP A;  5HV9 A;  3AG3 C;  3ASN C;  3ABL C;  1OCZ C;  1YAU O;  5COM A;  5L0J A;  2LFD A;  1E84 A;  2BE5 F;  2G62 A;  2LP4 A;  2WZL A;  3EJN A;  2ZXO A;  3FXH A;  3IEE A;  3LEV A;  2GFH A;  2R7Q A;  4XPX A;  2W9Y A;  2HSQ A;  3V7O A;  4N06 A;  3A9C A;  3ATP A;  3QW1 A;  4HEA J;  2NPU A;  3Q6M A;  3SXZ A;  1ORJ A;  1T01 A;  3N0T A;  3RH3 A;  1ZZP A;  3UGO A;  1ZHX A;  3ZDL A;  2ETS A;  1Q0D A;  2EPN A;  1N1C A;  2L6H A;  4CS8 C;  5EGY A;  4K0D A;  4XTK A;  4J7T A;  3AGT A;  3RF3 A;  3VAY A;  2J45 A;  2R7W A;  5BQH A;  2HUJ A;  3HNJ A;  3EGD B;  3GEE A;  3MBG A;  5A69 A;  2HMZ A;  4CSA A;  2IXO A;  2J7P D;  3HJC A;  3NMI A;  2Y3H A;  3G50 A;  3HLZ A;  2HSB A;  3LLI A;  1LE4 A;  3PDM P;  3Q7L A;  1IZM A;  2JPU A;  1M2V B;  4IGG A;  4MVO A;  4QI0 A;  1D0Y A;  1V4A A;  1M56 C;  3B29 A;  1OR2 A;  3NKE A;  5E33 A;  2YLD A;  1H6G A;  1WAS A;  2X51 A;  4PR9 A;  4OIR F;  4E0I A;  3FHD A;  1O3U A;  3U8P A;  1YZA A;  4CJO A;  1OW8 A;  4K7B A;  3T6G B;  4U5F E;  1YYJ A;  4A4A A;  4CX9 A;  4JTD B;  1YJG A;  2JX0 A;  4WAB A;  3EPV A;  2J7P A;  1YVI A;  3EGD A;  3GM3 A;  4XEV A;  1LS4 A;  3JRT A;  3CZ6 A;  2EIN C;  3IHU A;  4EIY A;  1HE9 A;  5JT4 A;  4P6I C;  1VK5 A;  4M63 A;  3RQG A;  4C3B A;  1M2V A;  2XM4 A;  4JJG A;  1ZU5 A;  1HE1 A;  3RVY A;  3AG2 C;  4KBL A;  1A7D A;  3TD7 A;  3I5P A;  1BR2 A;  2ZD9 A;  3IPM O;  3L1M A;  2UUH A;  2OU6 A;  3TQO A;  1GGQ A;  2OQM A;  3ZQY A;  2O9X A;  3IQ5 A;  2NUP A;  2DI3 A;  2J9W A;  2R7X A;  3NMK A;  3QVZ A;  1OXB A;  2D4U A;  4E17 A;  4ANJ A;  4JUR I;  2NUT B;  5F5F A;  4GYT A;  1NBB A;  2KGO A;  1Q0F A;  1LI5 A;  3I5Q A;  1S7Z A;  1MMN A;  2CGE A;  4JZA A;  5F5H A;  1Q0K A;  2AVK A;  3QW0 A;  2R02 A;  1XWJ A;  1JPN A;  4I1M A;  4DOZ A;  4CSA C;  2IXN A;  5KYY B;  1FMV A;  4C7O B;  3DJU B;  1OQC A;  2Q7R A;  3U2L A;  2R7U A;  3ZG1 A;  4PAC A;  3QMK A;  1E2X A;  5A6A A;  1G8X A;  4DJ9 A;  4E7S A;  3EZH A;  3FOO A;  4NC3 A;  2XLE A;  2Y3G A;  2YLG A;  4XLP F;  4U5C E;  2NUT A;  5JUA A;  3MLG A;  4BJ6 A;  4PFP A;  2VCC A;  2WVQ A;  3JYH A;  1LI7 A;  4YL3 A;  4O6M A;  4XEK A;  2XL4 A;  1L3P A;  3W2V A;  4KNV A;  3KMI A;  4J32 B;  1G4W R;  3E70 C;  4BJT A;  1D1B A;  2Y69 C;  3EH1 A;  1VLT A;  3ZTZ A;  4KC9 A;  3T6B A;  2LIG A;  3S84 A;  4B6I A;  2ICW G;  3F46 A;  4JTA B;  2YLI A;  3UMK A;  2XLW A;  3C8G B;  1RJ9 A;  2KC3 A;  3U5S A;  4Z9I A;  4C3D A;  3T4R A;  3GOR A;  1Z5Z A;  4WGZ A;  1NG1 A;  3EH2 A;  4LLE A;  4EBB A;  2J46 A;  5KYU B;  4P9F A;  1OR3 A;  3H2U A;  2L9J A;  2QNL A;  3HTK C;  4C3E A;  3NRH A;  4PJN A;  1YAR O;  2J8W A;  4ER9 A;  1BR1 A;  2HMQ A;  2OEX A;  2Q00 A;  2QLA A;  3AOU A;  3DM5 A;  4OIP F;  3SP1 A;  3CSK A;  4IRU A;  4F4B A;  1UFB A;  2HFI A;  256B A;  3CEX A;  1PD0 A;  1T5O A;  3HKK A;  3PMR A;  4LDR A;  4U5D E;  3U0C A;  4N6C A;  2EPM X;  1ZHW A;  4IAQ A;  5K0I A;  2P0N A;  4IAR A;  3NMJ A;  3UMI A;  2OJE D;  4J30 B;  4AK9 A;  2V26 A;  1GS9 A;  2YQY A;  2IOQ A;  4PFO A;  2H7O A;  2R9R B;  3V5X A;  4ZLC A;  1I5N A;  1Z23 A;  1EQ1 A;  4BG0 A;  1SMY F;  4BJ6 C;  4MW8 A;  4YT2 A;  2W4B A;  2PNO A;  3S29 A;  2VCB A;  2RSE B;  4DRJ B;  1QZX A;  4P9T A;  3NG1 A;  1L7C A;  1WTY A;  3B9Q A;  3NYM A;  4IAO A;  3TJ5 A;  1ZHZ A;  4N4W A;  1NU7 D;  1HMO A;  1T6Q A;  3LNR A;  2Y3D A;  1BR4 A;  1Z6A A;  3DAG A;  3B71 A;  3LEO A;  4PK4 A;  2VH3 A;  5CI8 A;  3X2Q C;  4EWC A;  3O39 A;  3KPH A;  1MMA A;  3KKB A;  2B0H A;  4WJ0 A;  2D5R B;  1RXQ A;  1RCP A;  3K66 A;  3DI5 A;  3U3F A;  2X0C A;  4JVS A;  1WAT A;  2YEV A;  1M2O A;  1JPJ A;  2BC5 A;  1B68 A;  2LQG A;  2YKZ A;  2YL3 A;  3Q7G A;  1GM5 A;  2Q9C A;  3VF0 A;  4AE4 B;  2W45 A;  3WHN A;  2YVK A;  1EKY A;  3K7D A;  4FES A;  3FAP B;  2VAS A;  4FWV A;  3JZ0 A;  2OKU A;  2G3V A;  5GPG B;  3UNG C;  3JYY A;  3W8I A;  3BEH A;  2YL7 A;  3EFO B;  4RD9 A;  1O87 A;  3RQF A;  3ZC4 A;  4BPM A;  1FFT C;  4XEF A;  4OIO F;  1SZI A;  3AG1 C;  3MX3 A;  2Q9B A;  4DXW A;  2P61 A;  2YHS A;  1OW6 A;  3GAN A;  4MVZ A;  3RQE A;  2NSF A;  3C18 A;  1UG7 A;  4O79 A;  4D4N A;  5BUO A;  1A0B A;  4WGY A;  3RW0 A;  5JS5 A;  5L0F A;  2XSE A;  3H65 A;  3RFY A;  2VB6 A;  3LNM B;  1SF8 A;  2NSG A;  4JEB A;  4MTF A;  4QDL A;  1O5H A;  2IM8 A;  2VC9 A;  5BQI A;  2R03 A;  1WWP A;  1M6T A;  3JT1 A;  1XZP A;  4JRZ A;  3DJN B;  4JKV A;  1APC A;  1AVO B;  4YT5 A;  1V74 B;  2QE9 A;  3EFO A;  3L0I A;  4ULV A;  3IQ6 A;  5L0C A;  3V5Z A;  1TWC A;  5TJ5 E;  4ULW A;  5JRA A;  4RBN A;  5JSL A;  1RKE B;  1NFO A;  1PV3 A;  4LLC A;  5KYX B;  3JCU Q;  3M79 A;  2WB7 A;  4JE9 A;  1A7E A;  2W4M A;  2AU5 A;  4PJJ A;  4CDV A;  1VYK A;  4XLN F;  2AP3 A;  1MMD A;  1JR8 A;  3U2M A;  1TWA A;  4K1O A;  3C7J A;  5B1A C;  3OWT A;  3U3B A;  1MNE A;  4CJG A;  5EHH A;  4W8P A;  1U0B B;  3WG7 C;  4MND A;  3ZIB A;  4IB4 A;  4E7Z A;  1NU9 C;  1BZ4 A;  3KH2 A;  1KNY A;  5E3A A;  1R4T A;  1AEP A;  3ABK C;  1F1M A;  2EPO A;  5CI9 A;  2XXA B;  3GEH A;  2XS8 A;  2OOC A;  3EGX B;  4YL1 A;  1G5Z A;  3ZQV A;  4MVR A;  5DS5 A;  1FFH A;  3HNK A;  3OA1 A;  3L8I A;  2IYL D;  2XLD A;  3TJ6 A;  3UR3 C;  3W2W A;  3ZSU A;  1QSP A;  5CIV A;  1LE2 A;  4Q5S F;  2M4E A;  3PCV A;  2KYH A;  3AQB A;  2WL8 A;  3CQZ A;  5E3C A;  1I4Z A;  1QVX A;  3H2V A;  3QTH A;  3GOD A;  4BJ1 A;  1TWG A;  2PX0 A;  3B0U X;  1EI7 A;  3VYW A;  4CS9 A;  2XL6 A;  3ZVR A;  5L0I A;  3CAX A;  1YA9 A;  3L8J A;  5FZT A;  4OD4 A;  2CDQ A;  2L7A A;  3S90 A;  4NTB A;  2P7V A;  2KSF A;  1OCC C;  1OKK A;  1ZYR F;  4BEM J;  1CGM E;  2XXA A;  2PP4 A;  5KYY A;  1R5I D;  4C7O A;  2ZXR A;  1U6H A;  4GQH A;  3C8Z A;  3PHF 2;  1HW1 A;  1YA7 O;  1T6U A;  2QTV A;  1LM3 B;  4PJL A;  4XWJ A;  2XLO A;  2XRH A;  2YL0 A;  2OG2 A;  4X0R A;  1E83 A;  1K05 A;  1Y4C A;  2L81 A;  2Y39 A;  1PCX A;  1ZU4 A;  1A41 A;  2KNH A;  2QUP A;  3EZI A;  5L3Q A;  3K1I A;  3S27 A;  2VCA A;  4BJ5 A;  4DBQ A;  1TFO B;  2M64 A;  1MQV A;  3C8G D;  4NCQ A;  5T3T A;  3QVY A;  4YK5 A;  2GWW A;  1WN0 A;  2EPL X;  4J7Y A;  3EG9 B;  1FAP B;  4L6R A;  4D4X A;  1V54 C;  3SXK A;  3B0V C;  2IXP A;  3M15 A;  2HV6 A;  4JCH A;  2HJM A;  3OEO A;  3SEO A;  4NTF A;  3UMH A;  4MVU A;  2YWA A;  2EIJ C;  2KK1 A;  4E0H A;  1DOW A;  3I4U A;  3EHM A;  2MWQ A;  4U9D A;  1GQA A;  3DE9 A;  1KU2 A;  3N24 A;  4I1O B;  2PX3 A;  4JTC B;  4Z9J A;  4EHP A;  3C8G A;  2PF4 E;  4DRI B;  4YJW A;  5HSW A;  4O6Y A;  3KL4 A;  5BQG A;  2ASR A;  1JAF A;  2EPK X;  2GA0 A;  2WVN A;  4IJJ A;  3GWN A;  3KYJ A;  5T3W A;  3O10 A;  1HW2 A;  5KYU A;  1TWH A;  2LFF A;  4CDA A;  4KNW A;  2XLH A;  3MFN A;  4UDV A;  3G4X A;  1PD1 A;  2HV7 A;  1JOG A;  5DQT A;  5A6B D;  5B3I A;  3R7C A;  4CS9 C;  1ZVZ A;  1H7I A;  5DLJ A;  2J9U A;  2ZXW C;  3EQL F;  1OXK A;  4OIQ F;  3GM1 A;  1E85 A;  1T9K A;  2WVO A;  2WZF A;  1FR0 A;  2KJG A;  4R32 A;  3GM2 A;  2XL8 A;  3LUT B;  2AWY A;  3DKA A;  5KYW B;  2EIK C;  2XS1 A;  1HY5 A;  1MMG A;  2DGJ A;  4CDY A;  3FDQ A;  1H9T A;  2C04 A;  5DS4 A;  1CGO A;  1JMW A;  5B1B C;  3S0X A;  1LVK A;  2H7B A;  2G3K A;  2YRF A;  3RIP A;  5COF A;  4H54 A;  1QLE C;  3LLK A;  3LS0 A;  5A6B A;  1ORS C;  3L34 A;  1FMW A;  1NSG B;  3AJM A;  2Y3B A;  3K1I C;  4U5E E;  3SNH A;  4BJ5 C;  1RMV A;  2IXM A;  4EBK A;  2TMV P;  1G4U S;  5D91 A;  4Q4Z F;  3ZTM A;  4E18 A;  1XZQ A;  3LS1 A;  4DVY P;  3LES A;  3ASO C;  3V5Y A;  2BL2 A;  3DWW A;  1OW7 A;  3K6B A;  1Z7Q c;  1D0X A;  3M4B A;  1U89 A;  1VB5 A;  4FAP B;  1D1C A;  4DVZ A;  5KYW A;  3JSE O;  2F22 A;  5E2Q A;  4CBE A;  2R7O A;  1D1A A;  4KI2 A;  4OD5 A;  3RKO F;  2DB4 A;  2DYS C;  3C62 A;  1IW7 F;  4AL1 A;  3WOD F;  2HJ3 A;  3X1O A;  1OCR C;  4N6H A;  3TUL A;  1YYX A;  4DBR A;  1H9G A;  2A0B A;  1I4Y A;  3ABM C;  3FMS A;  3US6 A;  4ZLD A;  1MND A;  1T6I A;  1QPU A;  2A6E F;  3MYF A;  4JW1 A;  3JTL O;  5AGF A;  1NLX A;  3ZWI A;  4HE8 D;  4EUK B;  1LIH A;  2DYR C;  3K33 A;  4GEH A;  4AE4 A;  4G7O F;  1TQG A;  3DMD A;  4EBJ A;  1AUE A;  1SYQ A;  3F47 A;  1S05 A;  4FX5 A;  4W8K A;  4CS7 A;  1TR2 A;  3DE8 A;  3K1H A;  2OCC C;  4DRH B;  3R2P A;  1VYI A;  2A69 F;  2FAP B;  1Y6D A;  2R7T A;  1ZHY A;  2P6V A;  3DAF A;  2NG1 A;  4JIO A;  4Z9H A;  4YWQ A;  4G7Z F;  3POV A;  3NDB B;  2AWC A;  2CW0 F;  3FAJ A;  2GAQ A;  3B0P A;  1Z63 A;  2GDC A;  4A2N B;  3DM9 B;  2R05 A;  4Q7C A;  3W4Y A;  3RYL A;  1C03 A;  3J06 A;  2WZG A;  1K04 A;  5T1D B;  4U5G A;  3U9M A;  3SXM A;  2R25 A;  1WGW A;  2NUP B;  1SR2 A;  2Q3T A;  1YLM A;  2EIL C;  4G0H A;  4JEA A;  5L3V A;  4MS2 A;  4U5B E;  1M57 C;  2A68 F;  2HZ8 A;  3FOP A;  3SYN A;  3QZC A;  3T9O A;  4QI2 A;  3HNI A;  1RKE A;  4HFF B;  5COG A;  2R7V A;  4XPY A;  2L6F A;  3NYJ A;  4PJM A;  5AC5 A;  5KYX A;  3UGP A;  2HS5 A;  3RVZ A;  1BBH A;  1OKK D;  2CCY A;  3C63 A;  2J9B A;  2CYD A;  3M1C B;  2J9V A;  1YDI A; 
#chains in the Genus database with same CATH homology
 1OCO C;  4O6N A;  4O7G A;  2E87 A;  1NZE A;  3AQC A;  4LAC B;  3S28 A;  2B0J A;  4H4K C;  2R7S A;  1J8M F;  1ZHT A;  2H7V C;  4G7H F;  2Z15 A;  4OIN F;  2J0X A;  5IY5 C;  4AX2 A;  3EGX A;  3SZR A;  1D0Z A;  1LKX A;  3T6J A;  2ZXP A;  5DQZ A;  2FGY A;  3EHN A;  4CIH A;  3LJB A;  4U5H A;  1TKN A;  3FVY A;  2A1D D;  1RJ9 B;  1VMA A;  1Z3I X;  3LAY A;  4JJF A;  4YT4 A;  2V3C C;  4LER A;  2MYS A;  5D92 A;  1LS1 A;  5FCL A;  4IWB A;  3NKD A;  3DD7 A;  5DVW A;  4YT8 A;  3DZA A;  3JSZ A;  1FTS A;  3E9V A;  2A6H F;  2J0W A;  2KQ9 A;  4BEJ A;  4I3M A;  3O6X A;  4I44 A;  1VOM A;  2Q9A A;  3ITF A;  2QY9 A;  3EG9 A;  2JD3 A;  2EIM C;  3ECS A;  3AG4 C;  4CS8 A;  1ST6 A;  5KYN A;  3W8H A;  2CNW D;  4RDA A;  4YN0 B;  2R7R A;  2LSE A;  3DXJ F;  1V55 C;  5DS6 A;  1W2W A;  3Q6N A;  2FFH A;  2I8B A;  2C03 A;  4MQ9 F;  3NYL A;  4HFK B;  2CNW A;  2ZPA A;  5B3S C;  2YZS A;  1J8Y F;  4NY3 A;  3N2Z B;  2PFD A;  3AG3 C;  3ASN C;  3ABL C;  1OCZ C;  2BE5 F;  2G62 A;  2WZL A;  3EJN A;  3IEE A;  2ZXO A;  3LEV A;  3PHF 2;  2GFH A;  2R7Q A;  2W9Y A;  3V7O A;  4N06 A;  4HEA J;  3Q6M A;  3N0T A;  3RH3 A;  3UGO A;  1ZHX A;  1N1C A;  4CS8 C;  5EGY A;  4K0D A;  4XTK A;  3VAY A;  2J45 A;  2R7W A;  3EGD B;  4CSA A;  2IXO A;  2J7P D;  3HJC A;  2Y3H A;  3HLZ A;  3LLI A;  3Q7L A;  1IZM A;  1M2V B;  4QI0 A;  1D0Y A;  1M56 C;  3NKE A;  5E33 A;  4OIR F;  2X51 A;  3FHD A;  4K7B A;  4U5F E;  3EPV A;  2J7P A;  3EGD A;  3JRT A;  3CZ6 A;  2EIN C;  4P6I C;  1VK5 A;  4M63 A;  4C3B A;  1M2V A;  4JJG A;  1ZU5 A;  3AG2 C;  4KBL A;  3TD7 A;  3I5P A;  1BR2 A;  2O9X A;  2NUP A;  2J9W A;  2R7X A;  4ANJ A;  4JUR I;  2NUT B;  5F5F A;  4GYT A;  2KGO A;  3I5Q A;  1S7Z A;  1MMN A;  2CGE A;  4JZA A;  5F5H A;  4DOZ A;  1JPN A;  4I1M A;  4CSA C;  2IXN A;  5KYY B;  1FMV A;  4C7O B;  3DJU B;  2R7U A;  3ZG1 A;  3QMK A;  1G8X A;  4E7S A;  3EZH A;  2Y3G A;  4XLP F;  4U5C E;  2NUT A;  3MLG A;  4BJ6 A;  4PFP A;  2WVQ A;  3JYH A;  4O6M A;  2XL4 A;  3W2V A;  4KNV A;  3KMI A;  4J32 B;  3E70 C;  4BJT A;  1D1B A;  2Y69 C;  3EH1 A;  4KC9 A;  3T6B A;  4B6I A;  3F46 A;  3UMK A;  1RJ9 A;  4C3D A;  3T4R A;  1Z5Z A;  1NG1 A;  3EH2 A;  4LLE A;  2J46 A;  5KYU B;  2L9J A;  3HTK C;  4C3E A;  3NRH A;  4PJN A;  1BR1 A;  4OIP F;  3DM5 A;  3SP1 A;  3CSK A;  4IRU A;  4F4B A;  1PD0 A;  3PMR A;  4U5D E;  1ZHW A;  3UMI A;  4J30 B;  4AK9 A;  2V26 A;  2IOQ A;  4PFO A;  2H7O A;  4ZLC A;  1Z23 A;  4BG0 A;  1SMY F;  4BJ6 C;  4YT2 A;  2W4B A;  3S29 A;  1QZX A;  3NG1 A;  3B9Q A;  3NYM A;  4IAO A;  1ZHZ A;  1NU7 D;  4PK4 A;  3LNR A;  2Y3D A;  1BR4 A;  1Z6A A;  3DAG A;  5CI8 A;  3X2Q C;  2VH3 A;  4EWC A;  3O39 A;  1MMA A;  3KKB A;  4WJ0 A;  2D5R B;  3K66 A;  4JVS A;  2YEV A;  1M2O A;  1JPJ A;  3Q7G A;  2Q9C A;  4AE4 B;  2W45 A;  3K7D A;  2VAS A;  4FWV A;  2G3V A;  3UNG C;  3W8I A;  3ZC4 A;  4RD9 A;  4EBB A;  3EFO B;  1O87 A;  1FFT C;  4OIO F;  1SZI A;  3AG1 C;  3MX3 A;  2Q9B A;  2YHS A;  3GAN A;  4O79 A;  5BUO A;  2XSE A;  2J9V A;  3H65 A;  3RFY A;  2VB6 A;  1SF8 A;  4QDL A;  1O5H A;  3JT1 A;  3DJN B;  4YT5 A;  3EFO A;  3L0I A;  1TWC A;  4ULW A;  4RBN A;  4LLC A;  5KYX B;  3JCU Q;  2WB7 A;  2W4M A;  4PJJ A;  1VYK A;  4XLN F;  1MMD A;  1TWA A;  5B1A C;  5EHH A;  3OWT A;  1MNE A;  3WG7 C;  4MND A;  3ZIB A;  4E7Z A;  1NU9 C;  3KH2 A;  5E3A A;  3ABK C;  2XXA B;  5CI9 A;  3EGX B;  5DS5 A;  1FFH A;  3OA1 A;  2IYL D;  3UR3 C;  3W2W A;  3ZSU A;  4Q5S F;  2M4E A;  3AQB A;  2WL8 A;  3CQZ A;  5E3C A;  3GOD A;  4BJ1 A;  1TWG A;  2PX0 A;  3B0U X;  3VYW A;  4CS9 A;  3ZVR A;  4OD4 A;  2CDQ A;  2P7V A;  1OCC C;  1OKK A;  1ZYR F;  2XXA A;  2PP4 A;  5KYY A;  4C7O A;  2ZXR A;  2QTV A;  4PJL A;  4XWJ A;  2XRH A;  4X0R A;  2OG2 A;  2L81 A;  2Y39 A;  4ZLD A;  1PCX A;  1ZU4 A;  2KNH A;  3EZI A;  5L3Q A;  3S27 A;  4BJ5 A;  4DBQ A;  5T3T A;  3B0V C;  3EG9 B;  1V54 C;  2IXP A;  2HV6 A;  4JCH A;  3OEO A;  3SEO A;  3UMH A;  2EIJ C;  3I4U A;  3EHM A;  2MWQ A;  1KU2 A;  3N24 A;  4I1O B;  2PX3 A;  2PF4 E;  4YJW A;  5HSW A;  4O6Y A;  3KL4 A;  4IJJ A;  2WVN A;  5T3W A;  5KYU A;  1TWH A;  4KNW A;  1PD1 A;  2HV7 A;  5DQT A;  4CS9 C;  5DLJ A;  2J9U A;  3EQL F;  4OIQ F;  2WVO A;  2WZF A;  2KJG A;  5KYW B;  2EIK C;  3FDQ A;  1MMG A;  2DGJ A;  2C04 A;  5DS4 A;  5B1B C;  3S0X A;  1LVK A;  2H7B A;  2G3K A;  3RIP A;  1QLE C;  3LLK A;  3LS0 A;  3L34 A;  1FMW A;  2Y3B A;  3K1I C;  4U5E E;  3SNH A;  4BJ5 C;  2IXM A;  5D91 A;  4Q4Z F;  3LS1 A;  4DVY P;  3LES A;  3ASO C;  3K6B A;  1D0X A;  1D1C A;  4DVZ A;  5KYW A;  5E2Q A;  4CBE A;  2R7O A;  1D1A A;  4KI2 A;  4OD5 A;  3RKO F;  2DYS C;  1IW7 F;  3WOD F;  3X1O A;  1OCR C;  4DBR A;  3ABM C;  1MND A;  2A6E F;  4JW1 A;  4HE8 D;  4AE4 A;  2DYR C;  3K33 A;  4GEH A;  4G7O F;  3DMD A;  3F47 A;  4FX5 A;  4W8K A;  4CS7 A;  1TR2 A;  3K1H A;  2OCC C;  1VYI A;  2A69 F;  2R7T A;  1ZHY A;  2P6V A;  3DAF A;  2NG1 A;  4YWQ A;  4G7Z F;  3POV A;  3NDB B;  2CW0 F;  3FAJ A;  3B0P A;  1Z63 A;  4A2N B;  3DM9 B;  4Q7C A;  3RYL A;  2WZG A;  5T1D B;  4U5G A;  1WGW A;  2NUP B;  2Q3T A;  5L3V A;  2EIL C;  4G0H A;  4U5B E;  1M57 C;  2A68 F;  3SYN A;  3QZC A;  4QI2 A;  4HFF B;  2R7V A;  3NYJ A;  4PJM A;  5KYX A;  3UGP A;  1OKK D;  4FES A;  3M1C B;  2KW3 C;  2ZXW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...