2XRQD

Crystal structures exploring the origins of the broader specificity of escherichia coli heat-labile enterotoxin compared to cholera toxin
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN B CHAIN
publication title Crystal Structures Exploring the Origins of the Broader Specificity of Escherichia Coli Heat-Labile Enterotoxin Compared to Cholera Toxin
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 26
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2010-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2xrqD00
1I4PA 1SBBB 3BVGA 3EA6A 4OHJA 5ELEA 1AN8A 3TSSA 1I4XA 1BCPC 1L0YB 2QEJC 3BYYB 1HQRD 1T5XD 3BVZA 5FK9C 3R2IA 1LTBD 1RD9D 2RDGA 4UDUC 1AW7A 5ELFA 1V1OA 1D6EC 1V1PA 4BWGB 1LLRD 3BZDB 1JQYD 1LTTD 1EEFD 1UNSA 1PTOH 2QILA 1KLGD 4TSSA 2TSSA 1HXYD 1TY2A 5ELBA 1TS3A 4L63B 3URYA 1FD7D 1DJRD 1LT4D 1ENFA 1GOZA 3MC0B 4RGOS 4RHSA 2AQ3B 1TS4A 1PRTF 5D3DA 1FNWA 1PTOF 3DWPA 1EU3A 3EFXD 1S5BD 1SE2A 1UUPA 2XN9C 1B1ZA 1JR0D 4RH6A 1S5DD 1BXTA 1D5XC 3BYTB 1TS5A 2WV6D 2Z8LA 1PZID 4C56C 1FGBD 4RCOA 1SE3A 1FNUA 1EEID 1PYWD 1BCPF 1ET9A 1RDPD 2R61A 5FKAC 4RFBA 4K6LA 2XNAC 4ZYSA 4RGTA 5D3IB 1LT3D 2AQ2B 1KLUD 2AQ1B 1FNVA 1EWCA 1S5FD 3R8BA 1I4GA 1JWSD 3OWEB 1V1PB 5ELCA 4RHRA 1S5ED 1L0XB 1SJHD 1LO5D 1RF2D 2G9HD 3V05A 3SEBA 1KTKA 2CHBD 3O13A 1DYQA 1G8ZD 2XRSD 4DXGA 1SXTA 1SJED 1CHQD 1TS2A 3MFGA 1D5MC 1PZJD 5TSSA 2RDHA 3R2TA 1EU4A 2O2LD 1TY0A 1CT1D 1RCVD 2J4XA 1ESFA 4RGNA 1LTID 1STEA 1LTAD 1JWMD 2NTTA 1B44D 1F77A 1HA5A 1LTRD 1LTGD 4RGMA 1PRTD 1PZKD 2SEBD 4O1NA 1PTOD 3W2DA 1JCKB 1M4VA 1QILA 3DWAA 1SE4A 4DXFA 1PRTB 1LTSD 1D5ZC 1I4RA 1CQVA 1PTOB 3BVMA 4Z9CB 2NTSA 1I4QA 1SEBD 1S5CD 1MD2D 1CK1A 1XTCD 1LT6D 3DWQA 1PRTC 1XXGA 1BCPD 1PTOC 3CHBD 2XRQD 1CHPD 5ELDA 2IJ0A 1I4HA 5I4DA 1EFID 1ET6A 2ICIA 1BCPB 1JWUD 4L6TB 3GP7A 1LT5D 3KLSX 1HTLD 2IPKD
chains in the Genus database with same CATH superfamily
3NXWA 1MI2A 1X6OA 2R7DA 2CH4W 4DV1Q 4DV4Q 3VA5A 4OL7A 1EIYB 2MP1A 2IX1A 1D1KA 3S14B 4ZAIA 1LLRD 3D4WA 2NZOA 1PH4A 3HOUB 1BQQT 1JB7A 4OX9L 5DM63 4V190 1YNJC 4B3TQ 2F0GA 3Q24A 2A68C 4QGUA 1GOZA 4MTNA 1L0WA 4DR6L 4GN4B 1J5EL 4BA2I 5J39A 4LF9Q 1IL8A 4LF8Q 3WOEA 1BR9A 1S5DD 1BXTA 1PYBA 3BZCA 3NP8A 1MHWC 4IO9A 1VQFA 3WOFA 4APVA 3H0GB 4GZYC 2NN6H 1KNEA 1N33L 2HIVA 4P74A 4QB4A 4UP7A 5D3IB 3M3YB 1G2SA 1B4OA 4JI0L 2CWPA 5GAHC 2L12A 1EYDA 3UE0A 4PZ8A 1LACA 5LMNQ 2JA7G 3J7ZC 4HIDA 2RSOA 5EBCA 1Q86C 4KY6A 2CQOA 1WTWA 1VQAA 4A3JG 1S4ZA 4DV6Q 1IYUA 4DXGA 4A3LH 4A3DH 2SOBA 2OQKA 4DAYA 4A3KG 1HNXQ 4GKJQ 1H9MA 2RKSA 1YJWA 1U9RA 2IL8A 1TQOA 4OXPA 3MVVA 1STEA 1EY4A 1JWMD 1VQ6A 5J3BA 1JOKA 4WJWA 1VQEA 4B08A 5H1SE 1M4VA 1QILA 4ZCKA 2L1BA 3I70A 1XYIA 3HS0C 3BVMA 1I4QA 2E2IH 5JPMC 1PFSA 2N55A 4YCUA 2UXDL 2F0EA 2R92B 3SK6A 4OX9Q 1TWCH 4BS9A 3CHBD 1GXDC 1L2FA 5ELDA 5C3EB 2HUGA 3SVMA 3RN5A 1I6HH 1WFQA 1TWGB 1HTLD 4LF5L 4DR6Q 2RSNA 1J5EQ 4KHVA 3PMFA 2QA4A 2QEJC 2AWOA 3ZYYX 3CCUA 3VYRA 2GA4B 2H5XA 1YHAA 4GKKL 3PIOA 4A3EG 5GADC 1V43A 4B9XA 2KBNA 1RIPA 5D65A 5CV7A 3D4RA 1N33Q 1QWYA 2TSSA 2Y0SB 1H9JA 4A3FB 1QZGA 2F0UA 2O4XA 4KKTA 4JI0Q 1KNAA 1YNND 2F3IA 1PRTF 4HAEA 4KTAA 1STGA 1LM0A 4H44C 4KY7A 3S17H 2F0LA 3PO2B 4K8IA 3HP3A 3A5UA 1SE2A 4GNXB 3D3RA 3BYTB 2F0JA 1PH2A 2AUKA 1HJPA 4GLVB 4RFBA 2UU9L 3PO3H 3I55A 1L1OA 4K5VA 5M3FB 2AUJD 1FNVA 1X3FA 4JBKA 4IUQA 1MJEA 3T13A 3GV6A 2L55A 4JOIC 2B63B 1L0XB 5EJWA 2MFIA 4FF3A 2G9HD 4KN4C 1MJCA 4DUYL 3DXJC 4NW2A 3T53B 1VQIA 2EY6A 3F2CA 2UXDQ 3D8GA 1TWFB 4C3IH 4L5SA 4XT1B 3HOYH 5IT9E 5IYDG 1KIXA 1NCVA 3N6RA 3U9OA 4PG3A 1GUOA 3LGJA 1H9SA 2BA0A 4K8JA 5IGDA 2CW0D 4KKUA 1UE1A 1PRTD 1IBML 1FJGL 4GKKQ 1HFNA 1DOMA 4HJ8A 1HQMC 4CHTB 4DAPA 1ESRA 1PTOB 1IKMA 1A2TA 2KHIA 4KD3A 3KF8B 4ODGA 4DR2L 3ULLA 1YHQA 1A15A 3HKZG 2GN5A 4R4QA 2ICIA 1BCPB 5M5WH 1XTDA 1PHJA 1PLFA 4LF6L 3UDIA 1HUMA 1SR3A 3BYYB 1HQRD 1ML0D 5M5XB 3CAMA 1RD9D 5JAVA 1SNDA 1SNOA 3CF5A 3PUYA 1O7ZA 3HKZE 4AQYQ 3D4DA 3VDYA 2UU9Q 1OO9B 3BJUA 2JA6B 2JA7H 1Y1WB 5C5MA 2VQEL 2UXBQ 1WTHA 3P7JA 4A3JH 5KNCA 4C2MH 1X3PA 1ZXTA 4P72A 4WRDA 4A3BH 5C44B 3GTOH 4A3KH 3VR4A 4HJ9A 4DUYQ 1B1ZA 3NBIA 1VQPA 1IW7C 4IPGA 4NXNL 3JAMi 5EKKA 3JAML 4AIMA 2CVRA 1GO3E 4A3MG 1C8CA 1VS0A 3I4MG 3S1QH 2FINB 3D6WA 2RCNA 5AJ3L 2BDNA 1Q7YC 3S1NB 4YWMA 5ELNA 1K73C 2Z6KA 3IFTA 2B8FA 4OIKA 3MTSA 4JW0A 3T1HL 1VQ7A 2B2WA 4MTKA 1W6JA 3CCEA 3N52A 3UDGA 1A62A 1MSHA 1RF2D 2E74C 3G6EA 4QUCA 2HQEA 2MO0A 2EDGA 4PQXA 1I50B 1SJED 3Q22A 3NWTA 1CHQD 3NTIA 2B29A 1X3EA 2BE5D 4CDEC 1D1IA 2RDFA 1MKHA 4A3EH 2YTYA 3K7UC 1A0IA 4YHHL 4LF6Q 3I7FA 3TDQA 3M4PA 3RZOH 1IZ6A 2WKCA 4NP5A 1VQ8A 4J15A 4DN4M 4NXML 3A54A 4QL5A 3I4LA 2FHTA 2PNRC 2A6ED 1H95A 3J7YW 4KY5A 3DWQA 2E5LL 2EXDA 3E9IA 1KHIA 4S3SA 5AFWA 1SYBA 4YY3Q 2B2TC 2DJGC 5KYLA 1WTPA 1DZ1A 2VQEQ 1X55A 4KD4A 2LMCB 1PV4A 3KLSX 2K7VA 3K81C 3KOJA 2L15A 1HZ9A 4MIUA 1TWHH 1L0YB 1E7ZA 1C4QA 5LL6X 3V96A 1K3BC 1ZYRC 1PH8A 2K4KA 2VY3A 4NXNQ 4CBVA 2FMMA 2VL6A 3EBEA 2M00A 3TN2A 1AW7A 4RMFA 1BKBA 1PH3A 2L9HA 4EQ5A 5COYA 1B50A 4GN5A 4QY7A 2BH2A 4XQQA 3S1RB 2EIFA 1N8RC 4ZUJA 3I91A 4GOPB 3HOWH 1EIHA 3H6MA 3I2ZA 4U68A 3T1HQ 2NVYH 2EYHA 1EIFA 1M90C 2UUBL 4UP8A 4CGYB 2F0DA 4A3DB 1B9NA 2N49A 3ONAB 1WCMH 4XYOA 5CV5A 5IYDH 1Q1EA 1OXTA 3MEHA 4DR5L 4DV7L 2YTXA 1PH6A 1TWAH 2KA7A 1HR0L 1JE5A 3DEOA 5FKAC 4R8IA 1DM0B 4CJ0B 1B70B 3CC7A 2UXCL 2VB2X 1AFPA 2PYKA 1EWCA 4YHHQ 2QKIC 1GD7A 1WTVA 1WYDA 4FP5D 2WB1B 1SFOH 4DR3L 3V05A 4A3GG 3OWFA 3X3NA 1EZ6A 3QIAA 3W1GA 1TWCB 4HR7B 2JA5H 3PUVA 4IUVA 2E5LQ 3I90A 4FF2A 1B8AA 5LMNW 3Q0AA 2DUDA 3UDFA 4X62L 1NNXA 1K28A 1Q46A 3NHHA 1NBWA 2XWBB 4I7AA 1VQGA 3WWVA 1YZ6A 2OF1A 1A2UA 4EQOA 2QCPX 1G91A 1U4LA 3MA2B 1RKNA 3W2DA 1U5KA 2F0WA 5IOCA 1PFNA 1H9KA 2CKZB 2RHQB 1DOLA 3F1ZA 2UUAL 4OGQC 3WDNA 2CWAA 3GTGB 2EYFA 1PXUA 1J9OA 4H13C 1ZKOA 4R4OA 2A69C 3QJYA 1C48A 3E3XA 5J1ZA 4CDCC 1JC7A 3TP5A 1K8AC 1EFID 2VXWA 3C2PA 4C3IG 3S17B 2BDOA 1F9PA 2ICEC 2LXJA 2SNSA 2UUBQ 4A3MH 4IPDA 3I4MH 1WTOA 4JBWA 4UHVA 5KNDA 5IWAL 1MSGA 4EX5A 1Z7TA 3W1BA 4DR5Q 4DV7Q 4XIGS 2RCFA 1HR0Q 1HFGA 2MHVA 3BDOA 2QILA 5C0XG 5ELBA 2UXCQ 1ENFA 2Q2IA 3JAMc 3TP6A 3GTLH 5FOBB 3KDFA 2PQEA 2B2VC 4CJ2C 4DR3Q 2F0NA 1K0RA 3E9HA 3HFZB 4PMBA 5EBDA 4ZKCB 4HIOA 4Y52H 3EFXD 5BN4A 3PF5A 4A3IB 3HOYB 2WV6D 3CQZH 3A0JA 4HIKA 2KENA 1XPUA 4DKAC 4X62Q 1LABA 1I3QB 4JCVE 1QVFA 2JA8G 1XNQQ 1KLUD 3OMCA 2F4IA 1BDOA 2MUYA 1V1PB 1Y1VB 1FVIA 2A69D 4RHRA 3S2DH 1GHKA 1VQCA 4IJLA 3TZUA 4A3CG 3FHWA 5C4JH 5CC4A 5F2DA 5JJIA 4LJZC 2V4DA 3S15B 1DYQA 3R3OA 2UUAQ 4Y7NB 4OWTB 2XRSD 3H3VC 3QOJA 2IX0A 3PIP3 1WVLA 4DNTB 1AH9A 3PGZA 5M5WB 2IY5B 1Q8IA 4QJFA 4FXKC 1EU4A 2GVAA 2O2LD 3OPOA 1CT1D 2L5TA 1CTMA 1EQTA 4LFCL 2ZTDA 5IT9L 4ME3A 1STYA 1VDZA 3KLRA 1E2VA 2KUMA 1SN8A 3DWAA 4HEDA 1HHVA 1AE3A 4LF9L 1FL0A 3MXNA 2NTSA 4DR4L 1V8QA 1Q90A 1CKNA 4FNFA 1LT6D 3IRBA 5IY0A 1OXUA 3I4OA 1IBLL 1QUQB 2IJ0A 1I4HA 5BN3A 4HN7A 3RLNA 4WFN3 4A3BB 1C9OA 4DK0A 3GTOB 1XPRA 3GP7A 2ZJRA 4J1MA 4CKCA 4IFDJ 5C4HA 2R7ZG 4B3ML 3OSOA 3R93A 2NB0A 2D5DA 1I4XA 1X56A 4AYBG 1CQFA 4X3SA 3BVZA 1SNQA 4HCEA 2Z0SA 5I2XA 3NELA 3S1QB 3K57A 1WOCA 4M1UB 5C6AA 3VYTA 1WJJA 5FLMG 2NUCA 1IL2A 1D6EC 1O7IA 2ZXPA 4HJ5A 1ICFB 1EOTA 1HZAA 4A3GH 5C4XB 4R4CA 2HDMA 4RCNA 1I94L 4A75A 4PMCA 1PYSB 1UE6A 2OXPA 4IUNA 1FNWA 3L9AX 4YWKA 3J81E 3GTPH 1FYCA 1S5BD 3ER0A 3G7LA 2L11A 4JVZA 4G57A 3NBHA 3A8IE 3I4NG 4IUUA 3P1HA 2PZUA 5CBAE 2Q2TA 3S1MB 4GNXC 4LNQA 1KAWA 4EQNA 5EAYA 2ZTEA 2E2HH 2ZJPA 1JJGA 4LFCQ 4H02A 2I5LX 2DGYA 2NYZD 1ICWA 2ZM6L 1G6PA 5ELCA 1S5ED 2EOTA 4WJ3M 2VQFL 3P75A 3OW2A 3T56B 5A35A 1KTKA 4UY8C 2DY8A 4DR4Q 2PMZE 4BBSG 4XQJA 1UWVA 1K8MA 3AEVA 2XSCA 5EGTA 1AP0A 1NR2A 4HSVA 1EL0A 1TS2A 3BU2A 1IBLQ 2B3GA 5IODA 3D6CA 4G7ZC 2PQAB 3NTKA 3U50C 1E1OA 1VQHA 2VUMH 1DCZA 3RNUA 2JA9A 5C0XJ 4B3MQ 2K33A 4BY7G 2NTTA 1B44D 4A93G 2RQXA 2K14A 5E4XA 3CD6A 4NDXA 5CYUA 2F0SA 1SEBD 2IHEA 2VZAA 1CSQA 2N88A 3HOWB 3Q6SA 5KYIA 1PTOC 3FKIG 4C3HG 2PI2E 1I94Q 3I56A 3PSIA 2OTJA 2Z6BA 1LUZA 4C1NK 3EA6A 1WCMB 5ELEA 5KGUA 4FXDA 4WORA 4JYAL 1BCPC 1CKOA 4OELB 1T5XD 4JOIA 1EFWA 4O42A 3BG3A 1YNJD 4RAUC 3CC4A 1D7QA 1A3UA 4BXXG 5HURA 2A68D 2HCIA 3CCJA 2JA8H 1JB3A 2WAQB 4BWGB 5FJ8G 1LTTD 3A5ZB 3CP0A 4DPGA 1NR4A 1HXYD 1J6QA 1GHJA 3J7A5 2K75A 1SNMA 4F7XA 4MN3A 2ZM6Q 2AQ3B 1G6ZA 2F0QA 3HOVG 1OTCA 2L4NA 1T5EA 2EJGC 4RKLA 2VQFQ 2JA5B 3CKIB 3U9SA 1U4PA 3HOXB 2TMPA 4B3RL 2NZHA 2F0PA 1QNUA 1TVXA 2Q8IB 3DEPA 5ELOA 1KQSA 3A55A 1PA6A 2EE1A 4TQUS 1CA6A 1LT3D 5JVG3 1TU2B 4A76A 3HOZG 4POFA 1WTQA 5JVH3 3PCOB 1XMOL 1Y8NB 4L5QA 3HOUG 4JI5L 4X3TA 1PH9A 2XTIA 1W2BA 5I6YA 5IT9c 2E2JH 3RLFA 2K5DA 4JBMA 2R7ZH 3AB9A 3MFGA 4KMUC 1PZJD 3DM1A 1A63A 4AQYL 2A6HC 2F52A 1KDAA 3K58A 2HDLA 4OONA 5DAUA 1NY4A 1EY5A 3MFYA 1UAPA 3I4MB 4JK1C 1STBA 2QGQA 5FLMH 4O0AA 2UXBL 3A8KE 4JYAQ 5EQ0A 4DNIA 1VQ5A 4HSPA 5E7NA 2CQAA 4N9PA 3KYHC 1R4QB 1S3OA 4HMIA 3NPPA 3OOCA 1K8OA 4XT3B 4QMGA 4BBRH 1NSNS 3GTLB 2PW5A 2MJ8A 1KRTA 3W5OA 5EPLA 1JWUD 2BA1A 3MXNB 4KKSA 4DF7A 1GUTA 4G7OC 1SBBB 1V9PA 3T4AC 4OWWB 3I4NH 4CKBA 3IFDA 1X65A 2NVXH 2I5HA 1LTBD 1SRUA 2PW7A 3AFPA 4B3RQ 3EJIA 4KJOA 3RMHA 3KUPA 4N8FA 3UDXA 3RUZA 2R6GA 3JC66 2B2YC 4O2DA 1Z47A 4P73A 4LUVA 2UUCL 2Q2UA 2OQ0A 3S2DB 2H1EA 3BDLA 4F87A 2KCNA 5C4JB 1UE5A 1SYDA 5FO9B 1HR0W 2NBFA 4IUPA 3STBC 1XMOQ 4DV3L 1EQRA 4GOPC 1EYGA 3S16H 2OCEA 4JI5Q 2R92G 2A6HD 2XN9C 3RZDB 4POGA 4F8MA 1BVSA 1PMRA 3GO5A 4DUZL 2G9DA 1JMCA 1WTXA 5BN5A 3VR2A 2B2UC 4BY7H 2A1AA 4A93H 4QF4A 5GROA 3KF6A 2RVLA 4YY3L 1ASZA 2B2TA 3ICEA 1STNA 4YCVA 5IIFA 4K14A 4QUFA 2AQ1B 3L7ZC 3GTMH 2Z9HA 3OWEB 3V2TA 2DNEA 1MBYA 5IGBA 3A74A 2NVQH 4C3HH 4FYDA 2CHBD 2Y0SG 1T9HA 1G2TA 3G6JB 1NAPA 3QOLA 4A3FG 1BBWA 3K5OA 4MHEA 4HJ7A 4C1NI 1HA6A 2K05A 1M1KC 2FFKB 2K5WA 1EY6A 2SNMA 1VQMA 4XQNA 2PCFB 3PO2G 3M4OB 2K52A 4BXXH 2WKDA 2KEDA 4BY1G 3KBXA 1Y8PB 3AU7A 2LXKA 3OIPA 1U4RA 2A19A 3K7AH 5KRUA 5NUCA 4LW1A 3F2BA 1P8LA 1FGUA 2Y0SE 5M9OA 1PH1A 3PF4A 5DM73 1PRTB 1LTSD 1QG7A 4K5XA 2K6AA 3J80E 4RWSC 1S5CD 5M3FG 4K6DA 4KI0A 2B63G 2PI2A 2FXQA 3TMEA 2UUCQ 5KIXA 4IOAA 4L6TB 1ENAA 1IHZA 1LT5D 2IHFA 1GUGA 2EXZA 4OHJA 2F0VA 5M3MG 1SE8A 2AMCB 4DV3Q 4DAYB 3CCSA 1WD1A 5FK9C 4QIWB 3MAQA 5IGFA 1DONA 2WIIB 4DUZQ 2YU9H 1EY9A 1G51A 3QB3A 1V1OA 4K2KA 5C3XA 1YI2A 4PZ6A 4X64L 3HOZH 4P75A 2E2HB 4LK1C 1KLGD 1OXSC 1ZEQX 3K8AA 5I9OA 4JI4L 3TZDA 1TY2A 5CV8A 5IP7G 2F03A 3HOUH 1F2MA 3VR6A 1IW7D 2LKVA 1K9MC 1SROA 2QF7A 4RHSA 4R1JA 5JEAJ 1TXYA 3T1YL 1PFBA 5C4ZA 1CZGA 2P5ZX 5D14A 1EWHA 4A4IA 2O5JC 2F1MA 4IALA 1UUPA 4IUTA 4RH6A 3M7NA 1DOKA 4DV5L 4XXEA 3J81j 3DLLA 1YBYA 1R9TH 3FRPB 4RCOA 4C3JG 3J81i 1PYWD 3J81L 4Q0FA 2VUMB 1SYFA 1CZWA 4RGTA 5DLQE 4PV1C 3CCLA 4XYQA 1Y8OB 2OTLA 2EY5A 2ZXOA 3EROA 3AQQA 3M4QA 2K5NA 4QCLA 2JA6G 4H7BA 3ULPA 2EYPA 4J6HA 1Y1WG 2A74C 2EY2A 3A7LA 5I2YA 3MXUA 2O5IC 5CV6A 1F9SA 4ABNA 2VNUD 4IFDG 3R2TA 5C44G 1E2ZA 3S2HH 2B2WC 3PUWA 4DGZA 1HZCA 2EQSA 2L0CA 3KLSA 5JPNC 2SEBD 2B2VA 2E2IB 1GUWA 2K28A 1I4RA 2KECA 3S9WA 3C46A 1IKLA 4L5TA 1L1OB 1E24A 1I5FA 1A3TA 4X64Q 3C3LA 1I6HB 1XXGA 5K36G 1SYGA 4N8X1 4JI4Q 3LX0A 2XRQD 2R92H 1ZYRD 1KDCA 2ES2A 5CGKA 3S24A 2Q2HA 4DR1L 1XNQL 2IPKD 4RGMA 4WJ4A 3T1YQ 1GKHA 5BR8L 2K1BA 3NEMA 3MZ5A 1NTGA 1LV9A 4JG2A 2KCTA 4DV5Q 3KBGA 1H9SB 3SDZA 1TR5A 2I5MX 2HHHL 3E0JA 1BUVT 4HMJA 1N36L 4X65L 1G291 2R93G 4RKBA 4JI8L 3TQYA 1JORA 3PUZA 2RHSB 1NE3A 1HZBA 4IFDI 4UPAA 2JEBI 1AE2A 4ZK9B 4I7ZC 3H09A 2I46A 2YYZA 4DR7L 2NZ1D 2R7ZB 2KJXA 3C1FA 3F8TA 1A6XA 3I72A 3ERQA 4B9WA 3CMAA 4QQBX 4U673 4KHZA 3EQLC 4AYBB 2JQOA 2EYJA 1VQNA 2ATWA 4BY1H 3TBIB 3HKSA 3PO3B 3Q8DA 2VW9A 2XNAC 3KLWA 3B6YA 5EPKA 1AEXA 1YHBA 1RL2A 3GD7A 1O7YA 1VQJA 5M3FH 1CA5A 4OIJA 4KHPL 2PO4A 3BDCA 1GM5A 1PDQA 2B63H 4BBRB 4C3IB 1J8IA 1JE4A 1N34Q 2LY7A 4XTCS 2C35B 2MNAA 1EY0A 2EY1A 2EYMA 4HTHA 5M3MH 1V1QA 2HIXA 3UI2A 4ILWA 5E3FA 2RDHA 2Q8TA 1W6KA 2E8GA 2K5QA 2J4XA 3CCQA 4DR1Q 1EQVA 1ESFA 1Y14B 2NVXB 4FF1A 2LS01 5BR8Q 3DMUA 1TT2A 2Z4IA 1B3QA 2EZVA 5EKLA 5C3WA 1VQ9A 5IP7H 5JJLA 1EOVA 1CM9A 1WI5A 3GDEA 1CK1A 1K83H 2HHHQ 1KRSA 2NVTH 1C7YA 2HD3A 1BO0A 1N36Q 2KOLA 4X65Q 4GNXA 2WB1G 1SNCA 2LFNA 4JI8Q 1TKWB 2Q8RE 2ZXRA 1B2TA 5C0XI 2IT1A 4C3JH 2EPBA 1D2BA 3TS0A 2VB3X 2MGSA 4DR7Q 4BY7B 1E22A 2Z4HA 4UDUC 3SK5A 3FEWX 1H9RA 5M5XH 3CPWA 4JI6L 3F2UA 3OIQA 4K2LA 2JA7B 3NENA 4IN3A 1VQKA 3C1EA 2WB1E 1GUNA 1C0AA 2RA4A 3HZXA 2JN4A 5K5PA 3GTMB 4A3JB 5FLXE 4C2MB 4F88A 5IYBG 1DJRD 4DV0L 4DFAA 2JA6H 4A3KB 1F2YA 1QE6A 2R3ZA 3J81c 1JICA 4KHPQ 4X6AH 3DWPA 1EU3A 2A8VA 4G7HC 4IFDH 5C44H 1A3VA 1S40A 1FGBD 2K03A 3FPUB 2KQ3A 3MEFA 2F0OA 4FXGC 3K7AB 3SXHA 3M9BA 3PIO3 3S1NH 3KF8A 3QWNA 1W3SA 1JWSD 1BBUA 1VQOA 3CCRA 4AH6A 2I07B 1LO5D 3E5SA 5K36H 3K0YA 3SEBA 3ULJA 5GQOA 1Q12A 3O13A 5I6WA 1DGSA 5J22A 1G8ZD 1XX8A 1NUCA 1ONLA 2XVSA 1OXXK 4I65A 4GS3A 2HCCA 2KEEA 4HCSA 3L0OA 4A3EB 2K5HA 3SK4A 1QNKA 3RZOB 1CSPA 3K80C 4A3IG 1LTID 3HOYG 3OYYA 3J7AF 1F77A 1AZPA 4BA1I 4IURA 1PZKD 2YU9B 2HT1A 3MXGA 1EQQA 1SE4A 3FDTA 3HOZB 4YIJA 4JI6Q 1X32A 3CXCA 3AFQA 1N32L 3H91A 2R93H 3PQIA 4NPSA 2ZTCA 2D62A 1SSOA 1B9MA 1YIJA 1B53A 1CHPD 1Y1VG 1STHA 1RTNA 2KCMA 3CRLC 4DV0Q 3J80i 2QDBA 3J80L 3GQBA 1TWHB 4EGVA 4LUZA 1I4PA 3NE5B 1AN8A 3TSSA 1EY7A 2PZTA 2M2LA 3IL8A 2CCZA 1R9TB 2CH4A 2AWNA 5C0XH 1X54A 4KK7A 2BOSA 1EUJA 4ULLA 1XNRQ 1JJ2A 4V0BA 2KCCA 3MWYW 3AYHB 1KXLA 3K6OA 4TSSA 1KDBA 1M8AA 1TS3A 2NVYB 3TREA 3ITPA 2PZWA 3PIPA 3S1RH 2FMCA 2MO1A 5CMDA 5D3DA 2B8GA 1PTOF 4IZ8A 1ILPA 4XDXA 2D9UA 1TWAB 3OTOL 3A7AB 3HEJA 1YNNC 3NWSA 5ISRA 2N78A 4A3BG 4G4KA 3S2HB 4UP9A 1BCPF 4IJHA 4DV2L 4X66L 1RDPD 3VYUA 4NMZA 4A3CH 4CJ1B 2F0KA 2AQ2B 1X3QA 2KVMA 3CC2A 4J8QA 1SFOB 4DAVA 4OWXB 2XIWA 3ZJYC 3K5NA 2QDLA 2LSSA 3HKZB 4LAAA 5IP9G 1YJ9A 2A73B 1PH5A 2OWOA 2RBMA 1DXMA 3QG1A 4IPCA 3A56A 1EWIA 4MZ9A 1HPCA 1UE7A 1XJVA 1CI3M 4LF4L 1VMCA 1N32Q 2F3VA 5C4XG 4YCWA 3U58A 3L3OC 2WINB 3KDFB 2E2DC 4LFBL 1SAPA 3MHBA 2B2YA 1JT8A 4KJNA 1Y69U 3K5LA 1EY8A 4RGNA 1HCZA 4LFAL 1LTRD 3K5MA 2EYLA 5IYCG 4JI2L 3DM3A 3GTKH 3CU7A 1PTOD 4GOPA 5CORA 3U4VA 5IYBH 2JEAI 2BCOA 2PPBC 1CFMA 3CCVA 1X3GA 2CW0C 1XTCD 1E3PA 3NQTA 1PRTC 3FPPA 3I3CA 2B2UA 1BCPD 3GTGH 3SK8A 5I4DA 5JEAG 2FJ2A 1WD0A 4A3MB 3D31A 4PMWA 4HJAA 1EYCA 3BZKA 1P16A 1JJCB 2K32A 1SYEA 3IKJA 1GVPA 3TS2A 4HIMA 2YV5A 4KN7C 4BY1B 4ALPA 2X69A 3H0GG 2RDGA 4H0LC 3OTOQ 4P71A 3D0FA 1B7YB 4DV2Q 3BS1A 1LTLA 4X66Q 1WTRA 5T1IA 4E6IA 3URYA 1ILQA 2D2CC 1MIUA 4ZKBB 5JJKA 2EJFC 3MC0B 3PV0A 3G71A 5M5YH 4LWCA 1TS4A 5I9PA 4JI7L 1CKNB 1A8VA 2ID0A 3FMCA 3HRZC 2N8NA 1QVCA 3HOWG 3CQZB 1QVGA 5JOBA 5C5LA 1VF7A 4LF4Q 5M3MB 1KL9A 1D5XC 4Q5VA 2F0FA 3CW2C 4A3IH 1FNUA 1SLJA 1EEID 1VQDA 1XPOA 4LFBQ 1OXVA 2KHJA 1WCMG 3IAYA 2AHOB 4FVMA 4X3KA 2JSOA 1BBXC 2I0QA 4ZYSA 2EYOA 4LF5Q 1QJOA 1I3QH 4LFAQ 3R8BA 1HRJA 4JI2Q 1EZ8A 4BBSH 2WAQG 2XWJB 4TRDA 2EJMA 2DJFC 1K83B 1R4PB 1Y1VH 4PNYA 4DK1A 3E6ZX 3HGBA 2K50A 3DUZA 2NVTB 5C3EG 1SXTA 2VS1A 2X6LA 3S15H 2GVBA 4Y7NH 4R8NA 4OO1G 2JA5G 4FDBA 3SGIA 4C3JB 2WAQE 3W3AA 1BOSA 3NBHB 3HOXG 5A2QE 1HA5A 3GTQH 1BNZA 1LTGD 2F3WA 1VF5C 1TIID 2K5VA 2JK8A 4DU9A 1RODA 2KHSA 3H3VI 2BE5C 2G5DA 4DXFA 4DK6C 1I6VC 3FKIH 3GTJH 4EQPA 3J80c 2SDFA 2D0OA 4GLAC 5IGCA 1L1OC 3M85A 4ME5A 4GN3B 1ET6A 3KJPA 1Q81C 1HUNA 2A6EC 4L8JA 1YVCA 2OT2A 1QB5D 4JI7Q 2C5CA 1PH7A 5KEEA 3VYSA 5FJ8H 2F0TA 1PVOA 2QEXA 3R2IA 4IPHA 1NJIC 4JV5L 3U4ZA 1V1PA 1VQLA 1JQYD 4A3GB 3STBD 3HOVH 5IP9H 1F2ZA 1SMXA 1EIGA 4L63B 5LMUL 3SHLA 3L2PA 2J7ZA 3RD4A 3LWEA 2WFWA 5C4XH 1IBMQ 1FJGQ 3GTPB 1E0BA 1K0SA 4OO1I 3CMEA 4JC0A 5FLXL 2J0TD 4B3SL 3AMUA 3ND9A 1TS5A 4UAIA 4DR2Q 2PNHA 3RN2A 3LNNA 1VQBA 1IBKL 5IYCH 1ET9A 3PUXA 3T16A 3S14H 2M9VA 4JI3L 3S1MH 5LHY1 1DD2A 1JOQA 3LWUA 1IYJB 2RF4A 3TRZA 1QUQA 2R93B 1K8GA 3ERSX 1N9WA 1VCIA 1IYVA 4CKEA 4EVOA 5JEAH 4DA2A 2IX3A 3NUCA 1D8LA 2ASBA 1UEBA 2Z1CA 1TY0A 2N3SA 4CDFC 3H0GH 2OEOA 3FVQA 1XWEA 3K0XA 5CV9A 3T51B 1ASYA 5GAEC 5G3LF 3UE1A 1F2LA 4O1NA 3M3YH 1JCKB 3EIVA 4YWLA 3TP8A 4M8AA 4FO2A 1CQVA 4JV5Q 2A5HA 3H3VH 5EKIA 4Z9CB 2ZJQA 5AJ3Q 1S72A 1X9NA 2YTVA 4KLKA 5LMUQ 4L5RC 2Z6KC 1SDFA 4K5WA 4LF7L 2JJQA 3BVGA 1F9QA 1AZQA 1B3AA 5FO8B 3HG9A 4OEMB 4K0KL 1Q3LA 2JA8B 4R9WA 2WP8J 4B3SQ 3NSWA 1HH2P 1FR3A 1SMYC 1N34L 1HNZL 3BZDB 3VA7A 1UNSA 2JP1A 1IBKQ 4JI3Q 1U0LA 3QR8A 4IOCA 2BH8A 5HGQA 4X3UA 1LT4D 3H15A 4RGOS 1GUSA 5C3EH 4ZLTF 4DK3C 4PZ7A 2MQHA 4NXMQ 2F4VL 1TWGH 2C9OA 2PQAA 5G3LD 4OO1H 3GV3A 2Z8LA 4C56C 1QOHA 3P20A 1SE3A 3HOXH 1PFMA 2JYOA 1YEZA 4K6LA 1Z6HA 1SNPA 4DAMA 3GTKB 2ENBA 4N9TA 5E1FA 1S5FD 4A3FH 5DNFA 2X6GA 1II3A 1SJHD 4JPBW 2H4OA 4CDDC 3NK9A 2E2JB 1NMGA 1NMFA 2IWHA 2NWGA 1KC8C 1YITA 3PO2H 3EN2A 4R4IA 1D5MC 4LF7Q 1E1TA 4QIWE 5IE8A 1YJNA 1IXRA 2E75C 1XMQL 1RCVD 4FF4A 3ND8A 1SMYD 3X3MA 2E76C 4K0KQ 1RTOA 5EPJA 2NN6G 2D0PA 3FP9A 4TVAB 3DHQA 2CFMA 3OW7A 2VUMG 1U4MA 1K3RA 2QW7A 5CR3A 1D5ZC 5GAGC 3KF6B 2F0IA 4P2CB 4KV6A 4R4TA 1HNZQ 2MPMA 1O80A 1MD2D 4RG1A 4ZUIA 3G48A 4ZRZA 3NTHA 1ENCA 5M5YB 4IQZA 3I4NB 1TWFH 5CBEE 3E0EA 4A3LG 4A3DG 2PMZB 2XGTA 3RLOA 1HNWL 2DN8A 1QZHA 2F4VQ 3I8ZA 3KK7A 4LMQD 4GLXA 3QO2A 2AKWB 1EYAA 1KD1C 2ALYB 3VR5A 1BF4A 4JI1L 3TEHB 3CRKC 2JE6I 1JOOA 5ELFA 3MXPA 2EVBA 4NKLA 5HGTA 5JJZA 1EEFD 1Z9FA 1PTOH 5FLXc 1Q8KA 4BBSB 1FD7D 5HY6A 2F0HA 1KAAA 3S16B 3JAME 3SE0A 5T1GA 1MGSA 1QCBD 1CKMA 5IGGA 2JXMB 4RA8A 4DV1L 4JBJA 1KABA 4DV4L 1JR0D 1F9RA 4DNRB 2NN6I 1PZID 4A93B 3RZDH 3J7AV 1Q82C 2B39A 2R61A 3GTQB 2ZT9C 2HQLA 4TKOB 1XMQQ 5L37A 1RHPA 4B3TL 3VR3A 2V1CC 2K04A 3M7GA 3G4SA 5IGEA 1GJXA 3KJOA 1O78A 2NVQB 1I4GA 1CUKA 3FKIB 3GTJB 4MNOA 1Y1WH 2IW3A 5CV4A 4C3HB 4LUOA 5IWAQ 3EVQA 4LF8L 3M4YA 3OMGA 1E2WA 1VQ4A 2DNCA 3K59A 1XNRL 5DEHA 2WACA 1Q1BA 2R7FA 2K01A 1HTPA 2DY7A 4ZQ3A 5FO7B 5TSSA 5LL6S 1LYLA 3Q23A 3H94A 3CCMA 3TP7A 3A8JE 4ID6A 3SR1A 1LTAD 5E4WC 1HNWQ 1VMPA 1RJTA 4NB3A 3M4OH 1SYCA 1O7LA 3RR5A 5LMNL 3CPFA 3PO3G 4JI1Q 3F2DA 3HOVB 5A2QL 5KNBA 4DV6L 1STAA 1UEAB 1HNXL 3KFUA 4GKJL 1I50H 3NQIA 3OHXC 2F0MA 1YNXA 4AYBE 4BBRG 3I73A
chains in the Genus database with same CATH topology
3NXWA 1MI2A 3VA5A 4OL7A 2MP1A 2IX1A 1D1KA 3S14B 4ZAIA 1LLRD 3D4WA 3HOUB 1BQQT 5DM63 4V190 1YNJC 2F0GA 3Q24A 2A68C 1GOZA 4BA2I 5J39A 1IL8A 3WOEA 1BR9A 1S5DD 1BXTA 3NP8A 3WOFA 4GZYC 3H0GB 2NN6H 1KNEA 4QB4A 5D3IB 3M3YB 1G2SA 1B4OA 2L12A 1EYDA 1LACA 2RSOA 5EBCA 4KY6A 1WTWA 1S4ZA 1IYUA 4DXGA 2SOBA 4DAYA 1H9MA 2RKSA 1U9RA 2IL8A 1TQOA 3MVVA 1STEA 1EY4A 1JWMD 1JOKA 4WJWA 4B08A 1M4VA 1QILA 1XYIA 2L1BA 3I70A 3HS0C 3BVMA 1I4QA 5JPMC 2N55A 2F0EA 2R92B 3SK6A 4BS9A 3CHBD 1GXDC 5C3EB 5ELDA 2HUGA 3SVMA 1TWGB 1HTLD 2RSNA 4KHVA 3PMFA 2QEJC 2AWOA 3ZYYX 3VYRA 2GA4B 1V43A 4B9XA 5D65A 5CV7A 3D4RA 1QWYA 2TSSA 2Y0SB 1H9JA 4A3FB 2F0UA 2O4XA 4KKTA 1KNAA 1YNND 1PRTF 4HAEA 4KTAA 1STGA 4H44C 4KY7A 2F0LA 3PO2B 4K8IA 3HP3A 1SE2A 3D3RA 3BYTB 2F0JA 2AUKA 4RFBA 4K5VA 5M3FB 2AUJD 1FNVA 4IUQA 3T13A 3GV6A 2L55A 2B63B 1L0XB 5EJWA 4FF3A 2G9HD 4KN4C 3DXJC 4NW2A 3T53B 2EY6A 3D8GA 1TWFB 4XT1B 5IT9E 1NCVA 3N6RA 3U9OA 1GUOA 1H9SA 2BA0A 4K8JA 5IGDA 2CW0D 4KKUA 1PRTD 1HFNA 1DOMA 1HQMC 4CHTB 4DAPA 1ESRA 1PTOB 1IKMA 1A2TA 4KD3A 4ODGA 1A15A 2ICIA 1BCPB 1PLFA 1HUMA 3BYYB 1HQRD 1ML0D 5M5XB 1RD9D 5JAVA 1SNDA 1SNOA 3PUYA 1O7ZA 3D4DA 1OO9B 2JA6B 1Y1WB 5C5MA 3P7JA 5KNCA 1X3PA 1ZXTA 4WRDA 5C44B 3VR4A 1B1ZA 3NBIA 1IW7C 5EKKA 3JAML 2CVRA 1C8CA 2FINB 3D6WA 2BDNA 3S1NB 3IFTA 2B8FA 4OIKA 3MTSA 2B2WA 1W6JA 3N52A 1MSHA 1RF2D 2E74C 4QUCA 2HQEA 4PQXA 2EDGA 1I50B 1SJED 3Q22A 3NWTA 1CHQD 3NTIA 2BE5D 1D1IA 2RDFA 3TDQA 4NP5A 2WKCA 4DN4M 3A54A 3I4LA 2FHTA 2PNRC 2A6ED 3J7YW 4KY5A 3DWQA 4S3SA 5AFWA 1SYBA 2B2TC 5KYLA 1WTPA 1DZ1A 4KD4A 2LMCB 3KLSX 2K7VA 4MIUA 1L0YB 1C4QA 5LL6X 3V96A 1ZYRC 4CBVA 2FMMA 3TN2A 2M00A 1AW7A 2L9HA 5COYA 1B50A 4XQQA 3S1RB 4ZUJA 3I91A 1EIHA 3H6MA 4U68A 2EYHA 4CGYB 2F0DA 4A3DB 1B9NA 4XYOA 3ONAB 5CV5A 1Q1EA 1OXTA 3MEHA 2KA7A 3DEOA 5FKAC 4R8IA 1DM0B 4CJ0B 2VB2X 1AFPA 2PYKA 1EWCA 2QKIC 1WTVA 4FP5D 2WB1B 3V05A 3OWFA 3X3NA 1EZ6A 3QIAA 1TWCB 4HR7B 3PUVA 4IUVA 3I90A 4FF2A 3Q0AA 3NHHA 2XWBB 2OF1A 1A2UA 4EQOA 2QCPX 1G91A 1U4LA 3MA2B 1RKNA 3W2DA 2F0WA 5IOCA 1PFNA 1H9KA 1DOLA 4OGQC 3WDNA 3GTGB 2EYFA 1PXUA 1J9OA 4H13C 1ZKOA 2A69C 3QJYA 1C48A 5J1ZA 1JC7A 3TP5A 1EFID 2VXWA 3C2PA 3S17B 2BDOA 1F9PA 2ICEC 2SNSA 1WTOA 4JBWA 5KNDA 1MSGA 1Z7TA 4XIGS 1HFGA 2MHVA 3BDOA 2QILA 5C0XG 5ELBA 1ENFA 3TP6A 5FOBB 2PQEA 2B2VC 4CJ2C 2F0NA 4PMBA 5EBDA 4ZKCB 3EFXD 5BN4A 4A3IB 3HOYB 2WV6D 1LABA 1I3QB 1KLUD 3OMCA 2F4IA 1BDOA 2MUYA 1V1PB 1Y1VB 2A69D 4RHRA 1GHKA 3TZUA 5CC4A 5F2DA 4LJZC 2V4DA 3S15B 1DYQA 3R3OA 3H3VC 4Y7NB 2XRSD 3QOJA 2IX0A 3PIP3 1WVLA 4DNTB 5M5WB 1Q8IA 4FXKC 1EU4A 2O2LD 3OPOA 1CT1D 2L5TA 1CTMA 1EQTA 5IT9L 1STYA 1VDZA 3KLRA 1E2VA 2KUMA 3DWAA 4HEDA 1HHVA 3MXNA 2NTSA 1V8QA 1Q90A 4FNFA 1LT6D 1OXUA 2IJ0A 1I4HA 5BN3A 4HN7A 4WFN3 4A3BB 4DK0A 3GTOB 3GP7A 4J1MA 4CKCA 4IFDJ 5C4HA 3OSOA 3R93A 2NB0A 2D5DA 1I4XA 1CQFA 4X3SA 3BVZA 1SNQA 4HCEA 5I2XA 3S1QB 3K57A 4M1UB 5C6AA 3VYTA 2NUCA 1D6EC 2ZXPA 1EOTA 5C4XB 2HDMA 4RCNA 4PMCA 2OXPA 4IUNA 1FNWA 3L9AX 3J81E 1FYCA 1S5BD 3G7LA 2L11A 4G57A 3NBHA 3A8IE 4IUUA 3P1HA 2PZUA 5CBAE 3S1MB 4EQNA 2NYZD 1ICWA 5ELCA 1S5ED 2EOTA 3P75A 3T56B 5A35A 1KTKA 2DY8A 4XQJA 1AP0A 1K8MA 2XSCA 5EGTA 1NR2A 4HSVA 1EL0A 1TS2A 5IODA 3D6CA 4G7ZC 3NTKA 1DCZA 5C0XJ 2K33A 2NTTA 1B44D 2RQXA 5E4XA 4NDXA 5CYUA 2F0SA 1SEBD 2N88A 3HOWB 3Q6SA 5KYIA 1PTOC 4C3HG 4C1NK 3EA6A 1WCMB 5ELEA 5KGUA 4FXDA 4WORA 1BCPC 1T5XD 4O42A 3BG3A 1YNJD 4RAUC 1A3UA 5HURA 2A68D 2HCIA 1JB3A 2WAQB 4BWGB 1LTTD 1NR4A 1HXYD 1GHJA 1SNMA 4F7XA 4MN3A 2AQ3B 1G6ZA 2F0QA 2L4NA 1T5EA 2EJGC 4RKLA 2JA5B 3CKIB 3U9SA 1U4PA 3HOXB 2TMPA 2F0PA 1QNUA 1TVXA 2Q8IB 3DEPA 3A55A 2EE1A 4TQUS 1CA6A 1LT3D 5JVG3 1TU2B 1WTQA 5JVH3 1Y8NB 4X3TA 5I6YA 3RLFA 2K5DA 3AB9A 3MFGA 4KMUC 1PZJD 3DM1A 2A6HC 1KDAA 3K58A 2HDLA 5DAUA 1EY5A 3MFYA 1UAPA 3I4MB 4JK1C 1STBA 3A8KE 5EQ0A 4HSPA 2CQAA 4N9PA 1R4QB 4HMIA 3NPPA 3OOCA 1K8OA 4XT3B 4QMGA 1NSNS 3GTLB 2PW5A 2MJ8A 5EPLA 1JWUD 2BA1A 4DF7A 4KKSA 1GUTA 4G7OC 1SBBB 3T4AC 4CKBA 3IFDA 1LTBD 2PW7A 3EJIA 4KJOA 3RMHA 3KUPA 3RUZA 2R6GA 2B2YC 1Z47A 3S2DB 2H1EA 3BDLA 4F87A 2KCNA 5C4JB 1SYDA 5FO9B 2NBFA 4IUPA 2A6HD 2XN9C 3RZDB 4F8MA 1PMRA 3GO5A 2G9DA 1WTXA 5BN5A 3VR2A 2B2UC 4QF4A 2RVLA 2B2TA 1STNA 5IIFA 4K14A 4QUFA 2AQ1B 3L7ZC 3OWEB 3V2TA 2DNEA 1MBYA 5IGBA 4FYDA 2CHBD 1G2TA 3G6JB 1NAPA 3QOLA 3K5OA 4MHEA 4C1NI 1HA6A 2K05A 2FFKB 2K5WA 1EY6A 2SNMA 4XQNA 2PCFB 3M4OB 2WKDA 2KEDA 3KBXA 1Y8PB 3AU7A 3OIPA 1U4RA 5KRUA 5NUCA 5M9OA 5DM73 1PRTB 1LTSD 1QG7A 4K5XA 2K6AA 3J80E 4RWSC 1S5CD 4K6DA 4KI0A 3TMEA 5KIXA 4L6TB 1ENAA 1IHZA 1LT5D 1GUGA 2EXZA 4OHJA 2F0VA 1WD1A 5FK9C 4QIWB 3MAQA 5IGFA 1DONA 2WIIB 1EY9A 3QB3A 4K2KA 1V1OA 5C3XA 2E2HB 4LK1C 1KLGD 1OXSC 1ZEQX 5I9OA 3TZDA 1TY2A 5CV8A 2F03A 1F2MA 3VR6A 1IW7D 2LKVA 2QF7A 4RHSA 5JEAJ 1PFBA 5C4ZA 1CZGA 5D14A 1EWHA 2O5JC 2F1MA 4IALA 1UUPA 4IUTA 4RH6A 3M7NA 1DOKA 4XXEA 3FRPB 4RCOA 4C3JG 1PYWD 3J81L 4Q0FA 2VUMB 1SYFA 1CZWA 4RGTA 4PV1C 4XYQA 1Y8OB 2EY5A 2ZXOA 3EROA 4QCLA 4H7BA 2EYPA 4J6HA 2A74C 2EY2A 3A7LA 5I2YA 3MXUA 2O5IC 5CV6A 1F9SA 4ABNA 2VNUD 4IFDG 3R2TA 1E2ZA 2B2WC 3PUWA 4DGZA 2L0CA 3KLSA 5JPNC 2SEBD 2B2VA 2E2IB 1GUWA 2K28A 1I4RA 2KECA 3S9WA 3C46A 1IKLA 1A3TA 3C3LA 1I6HB 1XXGA 5K36G 1SYGA 3LX0A 2XRQD 1ZYRD 1KDCA 5CGKA 3I73A 2IPKD 4RGMA 2K1BA 3MZ5A 1LV9A 3KBGA 1H9SB 3SDZA 1TR5A 3E0JA 1BUVT 4HMJA 1G291 4RKBA 1JORA 3PUZA 4IFDI 2JEBI 4ZK9B 4I7ZC 3H09A 2I46A 2YYZA 2R7ZB 2NZ1D 2KJXA 3C1FA 1A6XA 3I72A 4B9WA 3ERQA 4U673 4KHZA 3EQLC 4AYBB 2EYJA 3TBIB 3PO3B 2XNAC 5EPKA 1AEXA 3GD7A 1O7YA 1CA5A 4OIJA 2PO4A 3BDCA 1PDQA 1J8IA 4BBRB 4C3IB 1JE4A 2LY7A 4XTCS 1EY0A 2EY1A 2EYMA 4HTHA 3UI2A 4ILWA 5E3FA 2RDHA 2Q8TA 1W6KA 2K5QA 2J4XA 1EQVA 1ESFA 2NVXB 4FF1A 2LS01 3DMUA 1TT2A 2Z4IA 2EZVA 5EKLA 5C3WA 1CM9A 1CK1A 1BO0A 2KOLA 1SNCA 2LFNA 1TKWB 2Q8RE 2ZXRA 1B2TA 5C0XI 2IT1A 2EPBA 1D2BA 2VB3X 2MGSA 4BY7B 2Z4HA 4UDUC 3SK5A 3FEWX 1H9RA 3F2UA 3OIQA 4K2LA 2JA7B 4IN3A 3C1EA 1GUNA 2RA4A 3HZXA 5K5PA 3GTMB 4A3JB 5FLXE 4C2MB 4F88A 1DJRD 4DFAA 4A3KB 1F2YA 1QE6A 2R3ZA 1JICA 3DWPA 1EU3A 4G7HC 4IFDH 1A3VA 1FGBD 2K03A 3FPUB 2KQ3A 2F0OA 4FXGC 3K7AB 3SXHA 3PIO3 3KF8A 3QWNA 1JWSD 2I07B 1LO5D 3E5SA 5K36H 3K0YA 3SEBA 1Q12A 3O13A 5I6WA 5J22A 1G8ZD 1XX8A 1NUCA 1ONLA 2XVSA 1OXXK 4I65A 2HCCA 2KEEA 4HCSA 4A3EB 3SK4A 1QNKA 3RZOB 1LTID 3J7AF 1F77A 1AZPA 4BA1I 4IURA 1PZKD 2YU9B 3MXGA 1SE4A 3FDTA 3HOZB 4YIJA 1X32A 3H91A 2D62A 1SSOA 1B9MA 1B53A 1CHPD 1STHA 1RTNA 3CRLC 2QDBA 3J80L 3GQBA 1TWHB 4EGVA 1I4PA 3NE5B 1AN8A 3TSSA 1EY7A 2PZTA 2M2LA 3IL8A 1R9TB 2AWNA 5C0XH 4KK7A 2BOSA 4ULLA 4V0BA 2KCCA 3MWYW 3K6OA 4TSSA 1KDBA 1M8AA 1TS3A 2NVYB 3ITPA 2PZWA 2FMCA 5CMDA 5D3DA 2B8GA 1PTOF 4IZ8A 1ILPA 4XDXA 2D9UA 1TWAB 3A7AB 3HEJA 1YNNC 3NWSA 5ISRA 4G4KA 3S2HB 1BCPF 1RDPD 3VYUA 4NMZA 4CJ1B 2F0KA 2AQ2B 1X3QA 2KVMA 4J8QA 1SFOB 4DAVA 2XIWA 3K5NA 3HKZB 4LAAA 2A73B 2RBMA 1DXMA 3QG1A 3A56A 1HPCA 1CI3M 1VMCA 2F3VA 3L3OC 2WINB 2E2DC 1SAPA 3MHBA 2B2YA 4KJNA 1Y69U 3K5LA 1EY8A 4RGNA 1HCZA 1LTRD 3K5MA 2EYLA 3CU7A 1PTOD 5CORA 2JEAI 2BCOA 2PPBC 1CFMA 2CW0C 1XTCD 3NQTA 1PRTC 3FPPA 3I3CA 2B2UA 1BCPD 3SK8A 5I4DA 5JEAG 2FJ2A 1WD0A 4A3MB 3D31A 4PMWA 1EYCA 2K32A 1SYEA 3IKJA 4KN7C 4BY1B 2X69A 2RDGA 4H0LC 3BS1A 1WTRA 5T1IA 4E6IA 3URYA 1ILQA 2D2CC 4ZKBB 2EJFC 3MC0B 3PV0A 1TS4A 5I9PA 2ID0A 3FMCA 3HRZC 3CQZB 5JOBA 5C5LA 1VF7A 5M3MB 1D5XC 4Q5VA 2F0FA 1FNUA 1EEID 1OXVA 3IAYA 4FVMA 4X3KA 2JSOA 1BBXC 4ZYSA 2EYOA 1QJOA 3R8BA 1HRJA 1EZ8A 2XWJB 4TRDA 2EJMA 1K83B 1R4PB 4PNYA 4DK1A 3E6ZX 3HGBA 3DUZA 2NVTB 1SXTA 2X6LA 4R8NA 4OO1G 4C3JB 3W3AA 1BOSA 5A2QE 1HA5A 1BNZA 1LTGD 2F3WA 1VF5C 1TIID 4DU9A 1RODA 2KHSA 2BE5C 4DXFA 1I6VC 4EQPA 2SDFA 5IGCA 3M85A 4ME5A 1ET6A 1HUNA 2A6EC 4L8JA 2OT2A 1QB5D 2C5CA 5KEEA 3VYSA 2F0TA 3R2IA 1V1PA 1JQYD 4A3GB 1F2ZA 1EIGA 4L63B 3SHLA 2J7ZA 3RD4A 3LWEA 3GTPB 1E0BA 4OO1I 5FLXL 2J0TD 3AMUA 3ND9A 1TS5A 4UAIA 3LNNA 1ET9A 3PUXA 3T16A 2M9VA 5LHY1 1DD2A 1JOQA 3LWUA 2R93B 1IYVA 1VCIA 4CKEA 4EVOA 5JEAH 4DA2A 2IX3A 3NUCA 2Z1CA 1TY0A 2OEOA 3FVQA 1XWEA 5CV9A 3T51B 5G3LF 1F2LA 4O1NA 1JCKB 3TP8A 4M8AA 4FO2A 1CQVA 2A5HA 5EKIA 4Z9CB 1SDFA 4K5WA 3BVGA 1F9QA 1AZQA 1B3AA 5FO8B 3HG9A 1Q3LA 2JA8B 4R9WA 2WP8J 3NSWA 1FR3A 1SMYC 3BZDB 3VA7A 1UNSA 2JP1A 4X3UA 1LT4D 4RGOS 1GUSA 4ZLTF 5G3LD 2C9OA 4OO1H 3GV3A 2Z8LA 4C56C 1QOHA 3P20A 1SE3A 1PFMA 2JYOA 4K6LA 1Z6HA 1SNPA 3GTKB 2ENBA 4N9TA 5E1FA 1S5FD 5DNFA 2X6GA 1II3A 1SJHD 2H4OA 3NK9A 2E2JB 2IWHA 2NWGA 1D5MC 2E75C 1RCVD 4FF4A 3ND8A 1SMYD 3X3MA 2E76C 1RTOA 5EPJA 2NN6G 3DHQA 3OW7A 1U4MA 5CR3A 1D5ZC 2F0IA 4P2CB 4KV6A 2MPMA 1O80A 1MD2D 4ZUIA 4ZRZA 3NTHA 1ENCA 5M5YB 4IQZA 3I4NB 5CBEE 2PMZB 2DN8A 3I8ZA 3KK7A 4LMQD 3QO2A 1EYAA 3VR5A 1BF4A 3CRKC 2JE6I 1JOOA 5ELFA 3MXPA 2EVBA 4NKLA 5HGTA 5JJZA 1EEFD 1PTOH 4BBSB 1FD7D 2F0HA 1KAAA 3S16B 3JAME 3SE0A 5T1GA 1MGSA 1QCBD 5IGGA 2JXMB 4RA8A 1KABA 1JR0D 1F9RA 4DNRB 2NN6I 1PZID 4A93B 3J7AV 2B39A 2R61A 3GTQB 2ZT9C 4TKOB 1RHPA 3VR3A 3M7GA 2K04A 5IGEA 1GJXA 1O78A 2NVQB 1I4GA 3FKIB 3GTJB 2IW3A 5CV4A 4C3HB 3EVQA 3M4YA 3OMGA 1E2WA 2DNCA 3K59A 5DEHA 2WACA 1Q1BA 2K01A 1HTPA 2DY7A 4ZQ3A 5FO7B 5TSSA 5LL6S 3Q23A 3H94A 3TP7A 3A8JE 3SR1A 4ID6A 1LTAD 5E4WC 1VMPA 1RJTA 1SYCA 1O7LA 3HOVB 5A2QL 5KNBA 1STAA 1UEAB 3NQIA 3OHXC 2F0MA 4C3IG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I4P A;  1SBB B;  3BVG A;  3EA6 A;  4OHJ A;  5ELE A;  1AN8 A;  3TSS A;  1I4X A;  1BCP C;  1L0Y B;  2QEJ C;  3BYY B;  1HQR D;  1T5X D;  3BVZ A;  5FK9 C;  3R2I A;  1LTB D;  1RD9 D;  2RDG A;  4UDU C;  1AW7 A;  5ELF A;  1V1O A;  1D6E C;  1V1P A;  4BWG B;  1LLR D;  3BZD B;  1JQY D;  1LTT D;  1EEF D;  1UNS A;  1PTO H;  2QIL A;  1KLG D;  4TSS A;  2TSS A;  1HXY D;  1TY2 A;  5ELB A;  1TS3 A;  4L63 B;  3URY A;  1FD7 D;  1DJR D;  1LT4 D;  1ENF A;  1GOZ A;  3MC0 B;  4RGO S;  4RHS A;  2AQ3 B;  1TS4 A;  1PRT F;  5D3D A;  1FNW A;  1PTO F;  3DWP A;  1EU3 A;  3EFX D;  1S5B D;  1SE2 A;  1UUP A;  2XN9 C;  1B1Z A;  1JR0 D;  4RH6 A;  1S5D D;  1BXT A;  1D5X C;  3BYT B;  1TS5 A;  2WV6 D;  2Z8L A;  1PZI D;  4C56 C;  1FGB D;  4RCO A;  1SE3 A;  1FNU A;  1EEI D;  1PYW D;  1BCP F;  1ET9 A;  1RDP D;  2R61 A;  5FKA C;  4RFB A;  4K6L A;  2XNA C;  4ZYS A;  4RGT A;  5D3I B;  1LT3 D;  2AQ2 B;  1KLU D;  2AQ1 B;  1FNV A;  1EWC A;  1S5F D;  3R8B A;  1I4G A;  1JWS D;  3OWE B;  1V1P B;  5ELC A;  4RHR A;  1S5E D;  1L0X B;  1SJH D;  1LO5 D;  1RF2 D;  2G9H D;  3V05 A;  3SEB A;  1KTK A;  2CHB D;  3O13 A;  1DYQ A;  1G8Z D;  2XRS D;  4DXG A;  1SXT A;  1SJE D;  1CHQ D;  1TS2 A;  3MFG A;  1D5M C;  1PZJ D;  5TSS A;  2RDH A;  3R2T A;  1EU4 A;  2O2L D;  1TY0 A;  1CT1 D;  1RCV D;  2J4X A;  1ESF A;  4RGN A;  1LTI D;  1STE A;  1LTA D;  1JWM D;  2NTT A;  1B44 D;  1F77 A;  1HA5 A;  1LTR D;  1LTG D;  4RGM A;  1PRT D;  1PZK D;  2SEB D;  4O1N A;  1PTO D;  3W2D A;  1JCK B;  1M4V A;  1QIL A;  3DWA A;  1SE4 A;  4DXF A;  1PRT B;  1LTS D;  1D5Z C;  1I4R A;  1CQV A;  1PTO B;  3BVM A;  4Z9C B;  2NTS A;  1I4Q A;  1SEB D;  1S5C D;  1MD2 D;  1CK1 A;  1XTC D;  1LT6 D;  3DWQ A;  1PRT C;  1XXG A;  1BCP D;  1PTO C;  3CHB D;  2XRQ D;  1CHP D;  5ELD A;  2IJ0 A;  1I4H A;  5I4D A;  1EFI D;  1ET6 A;  2ICI A;  1BCP B;  1JWU D;  4L6T B;  3GP7 A;  1LT5 D;  3KLS X;  1HTL D;  2IPK D; 
#chains in the Genus database with same CATH topology
 3NXW A;  1MI2 A;  1X6O A;  2R7D A;  2CH4 W;  4DV1 Q;  4DV4 Q;  3VA5 A;  4OL7 A;  1EIY B;  2MP1 A;  2IX1 A;  1D1K A;  3S14 B;  4ZAI A;  1LLR D;  3D4W A;  2NZO A;  1PH4 A;  3HOU B;  1BQQ T;  1JB7 A;  4OX9 L;  5DM6 3;  4V19 0;  1YNJ C;  4B3T Q;  2F0G A;  3Q24 A;  2A68 C;  4QGU A;  1GOZ A;  4MTN A;  1L0W A;  4DR6 L;  4GN4 B;  1J5E L;  4BA2 I;  5J39 A;  4LF9 Q;  1IL8 A;  4LF8 Q;  3WOE A;  1BR9 A;  1S5D D;  1BXT A;  1PYB A;  3BZC A;  3NP8 A;  1MHW C;  4IO9 A;  1VQF A;  3WOF A;  4APV A;  3H0G B;  4GZY C;  2NN6 H;  1KNE A;  1N33 L;  2HIV A;  4P74 A;  4QB4 A;  4UP7 A;  5D3I B;  3M3Y B;  1G2S A;  1B4O A;  4JI0 L;  2CWP A;  5GAH C;  2L12 A;  1EYD A;  3UE0 A;  4PZ8 A;  1LAC A;  5LMN Q;  2JA7 G;  3J7Z C;  4HID A;  2RSO A;  5EBC A;  1Q86 C;  4KY6 A;  2CQO A;  1WTW A;  1VQA A;  4A3J G;  1S4Z A;  4DV6 Q;  1IYU A;  4DXG A;  4A3L H;  4A3D H;  2SOB A;  2OQK A;  4DAY A;  4A3K G;  1HNX Q;  4GKJ Q;  1H9M A;  2RKS A;  1YJW A;  1U9R A;  2IL8 A;  1TQO A;  4OXP A;  3MVV A;  1STE A;  1EY4 A;  1JWM D;  1VQ6 A;  5J3B A;  1JOK A;  4WJW A;  1VQE A;  4B08 A;  5H1S E;  1M4V A;  1QIL A;  4ZCK A;  2L1B A;  3I70 A;  1XYI A;  3HS0 C;  3BVM A;  1I4Q A;  2E2I H;  5JPM C;  1PFS A;  2N55 A;  4YCU A;  2UXD L;  2F0E A;  2R92 B;  3SK6 A;  4OX9 Q;  1TWC H;  4BS9 A;  3CHB D;  1GXD C;  1L2F A;  5ELD A;  5C3E B;  2HUG A;  3SVM A;  3RN5 A;  1I6H H;  1WFQ A;  1TWG B;  1HTL D;  4LF5 L;  4DR6 Q;  2RSN A;  1J5E Q;  4KHV A;  3PMF A;  2QA4 A;  2QEJ C;  2AWO A;  3ZYY X;  3CCU A;  3VYR A;  2GA4 B;  2H5X A;  1YHA A;  4GKK L;  3PIO A;  4A3E G;  5GAD C;  1V43 A;  4B9X A;  2KBN A;  1RIP A;  5D65 A;  5CV7 A;  3D4R A;  1N33 Q;  1QWY A;  2TSS A;  2Y0S B;  1H9J A;  4A3F B;  1QZG A;  2F0U A;  2O4X A;  4KKT A;  4JI0 Q;  1KNA A;  1YNN D;  2F3I A;  1PRT F;  4HAE A;  4KTA A;  1STG A;  1LM0 A;  4H44 C;  4KY7 A;  3S17 H;  2F0L A;  3PO2 B;  4K8I A;  3HP3 A;  3A5U A;  1SE2 A;  4GNX B;  3D3R A;  3BYT B;  2F0J A;  1PH2 A;  2AUK A;  1HJP A;  4GLV B;  4RFB A;  2UU9 L;  3PO3 H;  3I55 A;  1L1O A;  4K5V A;  5M3F B;  2AUJ D;  1FNV A;  1X3F A;  4JBK A;  4IUQ A;  1MJE A;  3T13 A;  3GV6 A;  2L55 A;  4JOI C;  2B63 B;  1L0X B;  5EJW A;  2MFI A;  4FF3 A;  2G9H D;  4KN4 C;  1MJC A;  4DUY L;  3DXJ C;  4NW2 A;  3T53 B;  1VQI A;  2EY6 A;  3F2C A;  2UXD Q;  3D8G A;  1TWF B;  4C3I H;  4L5S A;  4XT1 B;  3HOY H;  5IT9 E;  5IYD G;  1KIX A;  1NCV A;  3N6R A;  3U9O A;  4PG3 A;  1GUO A;  3LGJ A;  1H9S A;  2BA0 A;  4K8J A;  5IGD A;  2CW0 D;  4KKU A;  1UE1 A;  1PRT D;  1IBM L;  1FJG L;  4GKK Q;  1HFN A;  1DOM A;  4HJ8 A;  1HQM C;  4CHT B;  4DAP A;  1ESR A;  1PTO B;  1IKM A;  1A2T A;  2KHI A;  4KD3 A;  3KF8 B;  4ODG A;  4DR2 L;  3ULL A;  1YHQ A;  1A15 A;  3HKZ G;  2GN5 A;  4R4Q A;  2ICI A;  1BCP B;  5M5W H;  1XTD A;  1PHJ A;  1PLF A;  4LF6 L;  3UDI A;  1HUM A;  1SR3 A;  3BYY B;  1HQR D;  1ML0 D;  5M5X B;  3CAM A;  1RD9 D;  5JAV A;  1SND A;  1SNO A;  3CF5 A;  3PUY A;  1O7Z A;  3HKZ E;  4AQY Q;  3D4D A;  3VDY A;  2UU9 Q;  1OO9 B;  3BJU A;  2JA6 B;  2JA7 H;  1Y1W B;  5C5M A;  2VQE L;  2UXB Q;  1WTH A;  3P7J A;  4A3J H;  5KNC A;  4C2M H;  1X3P A;  1ZXT A;  4P72 A;  4WRD A;  4A3B H;  5C44 B;  3GTO H;  4A3K H;  3VR4 A;  4HJ9 A;  4DUY Q;  1B1Z A;  3NBI A;  1VQP A;  1IW7 C;  4IPG A;  4NXN L;  3JAM i;  5EKK A;  3JAM L;  4AIM A;  2CVR A;  1GO3 E;  4A3M G;  1C8C A;  1VS0 A;  3I4M G;  3S1Q H;  2FIN B;  3D6W A;  2RCN A;  5AJ3 L;  2BDN A;  1Q7Y C;  3S1N B;  4YWM A;  5ELN A;  1K73 C;  2Z6K A;  3IFT A;  2B8F A;  4OIK A;  3MTS A;  4JW0 A;  3T1H L;  1VQ7 A;  2B2W A;  4MTK A;  1W6J A;  3CCE A;  3N52 A;  3UDG A;  1A62 A;  1MSH A;  1RF2 D;  2E74 C;  3G6E A;  4QUC A;  2HQE A;  2MO0 A;  2EDG A;  4PQX A;  1I50 B;  1SJE D;  3Q22 A;  3NWT A;  1CHQ D;  3NTI A;  2B29 A;  1X3E A;  2BE5 D;  4CDE C;  1D1I A;  2RDF A;  1MKH A;  4A3E H;  2YTY A;  3K7U C;  1A0I A;  4YHH L;  4LF6 Q;  3I7F A;  3TDQ A;  3M4P A;  3RZO H;  1IZ6 A;  2WKC A;  4NP5 A;  1VQ8 A;  4J15 A;  4DN4 M;  4NXM L;  3A54 A;  4QL5 A;  3I4L A;  2FHT A;  2PNR C;  2A6E D;  1H95 A;  3J7Y W;  4KY5 A;  3DWQ A;  2E5L L;  2EXD A;  3E9I A;  1KHI A;  4S3S A;  5AFW A;  1SYB A;  4YY3 Q;  2B2T C;  2DJG C;  5KYL A;  1WTP A;  1DZ1 A;  2VQE Q;  1X55 A;  4KD4 A;  2LMC B;  1PV4 A;  3KLS X;  2K7V A;  3K81 C;  3KOJ A;  2L15 A;  1HZ9 A;  4MIU A;  1TWH H;  1L0Y B;  1E7Z A;  1C4Q A;  5LL6 X;  3V96 A;  1K3B C;  1ZYR C;  1PH8 A;  2K4K A;  2VY3 A;  4NXN Q;  4CBV A;  2FMM A;  2VL6 A;  3EBE A;  2M00 A;  3TN2 A;  1AW7 A;  4RMF A;  1BKB A;  1PH3 A;  2L9H A;  4EQ5 A;  5COY A;  1B50 A;  4GN5 A;  4QY7 A;  2BH2 A;  4XQQ A;  3S1R B;  2EIF A;  1N8R C;  4ZUJ A;  3I91 A;  4GOP B;  3HOW H;  1EIH A;  3H6M A;  3I2Z A;  4U68 A;  3T1H Q;  2NVY H;  2EYH A;  1EIF A;  1M90 C;  2UUB L;  4UP8 A;  4CGY B;  2F0D A;  4A3D B;  1B9N A;  2N49 A;  3ONA B;  1WCM H;  4XYO A;  5CV5 A;  5IYD H;  1Q1E A;  1OXT A;  3MEH A;  4DR5 L;  4DV7 L;  2YTX A;  1PH6 A;  1TWA H;  2KA7 A;  1HR0 L;  1JE5 A;  3DEO A;  5FKA C;  4R8I A;  1DM0 B;  4CJ0 B;  1B70 B;  3CC7 A;  2UXC L;  2VB2 X;  1AFP A;  2PYK A;  1EWC A;  4YHH Q;  2QKI C;  1GD7 A;  1WTV A;  1WYD A;  4FP5 D;  2WB1 B;  1SFO H;  4DR3 L;  3V05 A;  4A3G G;  3OWF A;  3X3N A;  1EZ6 A;  3QIA A;  3W1G A;  1TWC B;  4HR7 B;  2JA5 H;  3PUV A;  4IUV A;  2E5L Q;  3I90 A;  4FF2 A;  1B8A A;  5LMN W;  3Q0A A;  2DUD A;  3UDF A;  4X62 L;  1NNX A;  1K28 A;  1Q46 A;  3NHH A;  1NBW A;  2XWB B;  4I7A A;  1VQG A;  3WWV A;  1YZ6 A;  2OF1 A;  1A2U A;  4EQO A;  2QCP X;  1G91 A;  1U4L A;  3MA2 B;  1RKN A;  3W2D A;  1U5K A;  2F0W A;  5IOC A;  1PFN A;  1H9K A;  2CKZ B;  2RHQ B;  1DOL A;  3F1Z A;  2UUA L;  4OGQ C;  3WDN A;  2CWA A;  3GTG B;  2EYF A;  1PXU A;  1J9O A;  4H13 C;  1ZKO A;  4R4O A;  2A69 C;  3QJY A;  1C48 A;  3E3X A;  5J1Z A;  4CDC C;  1JC7 A;  3TP5 A;  1K8A C;  1EFI D;  2VXW A;  3C2P A;  4C3I G;  3S17 B;  2BDO A;  1F9P A;  2ICE C;  2LXJ A;  2SNS A;  2UUB Q;  4A3M H;  4IPD A;  3I4M H;  1WTO A;  4JBW A;  4UHV A;  5KND A;  5IWA L;  1MSG A;  4EX5 A;  1Z7T A;  3W1B A;  4DR5 Q;  4DV7 Q;  4XIG S;  2RCF A;  1HR0 Q;  1HFG A;  2MHV A;  3BDO A;  2QIL A;  5C0X G;  5ELB A;  2UXC Q;  1ENF A;  2Q2I A;  3JAM c;  3TP6 A;  3GTL H;  5FOB B;  3KDF A;  2PQE A;  2B2V C;  4CJ2 C;  4DR3 Q;  2F0N A;  1K0R A;  3E9H A;  3HFZ B;  4PMB A;  5EBD A;  4ZKC B;  4HIO A;  4Y52 H;  3EFX D;  5BN4 A;  3PF5 A;  4A3I B;  3HOY B;  2WV6 D;  3CQZ H;  3A0J A;  4HIK A;  2KEN A;  1XPU A;  4DKA C;  4X62 Q;  1LAB A;  1I3Q B;  4JCV E;  1QVF A;  2JA8 G;  1XNQ Q;  1KLU D;  3OMC A;  2F4I A;  1BDO A;  2MUY A;  1V1P B;  1Y1V B;  1FVI A;  2A69 D;  4RHR A;  3S2D H;  1GHK A;  1VQC A;  4IJL A;  3TZU A;  4A3C G;  3FHW A;  5C4J H;  5CC4 A;  5F2D A;  5JJI A;  4LJZ C;  2V4D A;  3S15 B;  1DYQ A;  3R3O A;  2UUA Q;  4Y7N B;  4OWT B;  2XRS D;  3H3V C;  3QOJ A;  2IX0 A;  3PIP 3;  1WVL A;  4DNT B;  1AH9 A;  3PGZ A;  5M5W B;  2IY5 B;  1Q8I A;  4QJF A;  4FXK C;  1EU4 A;  2GVA A;  2O2L D;  3OPO A;  1CT1 D;  2L5T A;  1CTM A;  1EQT A;  4LFC L;  2ZTD A;  5IT9 L;  4ME3 A;  1STY A;  1VDZ A;  3KLR A;  1E2V A;  2KUM A;  1SN8 A;  3DWA A;  4HED A;  1HHV A;  1AE3 A;  4LF9 L;  1FL0 A;  3MXN A;  2NTS A;  4DR4 L;  1V8Q A;  1Q90 A;  1CKN A;  4FNF A;  1LT6 D;  3IRB A;  5IY0 A;  1OXU A;  3I4O A;  1IBL L;  1QUQ B;  2IJ0 A;  1I4H A;  5BN3 A;  4HN7 A;  3RLN A;  4WFN 3;  4A3B B;  1C9O A;  4DK0 A;  3GTO B;  1XPR A;  3GP7 A;  2ZJR A;  4J1M A;  4CKC A;  4IFD J;  5C4H A;  2R7Z G;  4B3M L;  3OSO A;  3R93 A;  2NB0 A;  2D5D A;  1I4X A;  1X56 A;  4AYB G;  1CQF A;  4X3S A;  3BVZ A;  1SNQ A;  4HCE A;  2Z0S A;  5I2X A;  3NEL A;  3S1Q B;  3K57 A;  1WOC A;  4M1U B;  5C6A A;  3VYT A;  1WJJ A;  5FLM G;  2NUC A;  1IL2 A;  1D6E C;  1O7I A;  2ZXP A;  4HJ5 A;  1ICF B;  1EOT A;  1HZA A;  4A3G H;  5C4X B;  4R4C A;  2HDM A;  4RCN A;  1I94 L;  4A75 A;  4PMC A;  1PYS B;  1UE6 A;  2OXP A;  4IUN A;  1FNW A;  3L9A X;  4YWK A;  3J81 E;  3GTP H;  1FYC A;  1S5B D;  3ER0 A;  3G7L A;  2L11 A;  4JVZ A;  4G57 A;  3NBH A;  3A8I E;  3I4N G;  4IUU A;  3P1H A;  2PZU A;  5CBA E;  2Q2T A;  3S1M B;  4GNX C;  4LNQ A;  1KAW A;  4EQN A;  5EAY A;  2ZTE A;  2E2H H;  2ZJP A;  1JJG A;  4LFC Q;  4H02 A;  2I5L X;  2DGY A;  2NYZ D;  1ICW A;  2ZM6 L;  1G6P A;  5ELC A;  1S5E D;  2EOT A;  4WJ3 M;  2VQF L;  3P75 A;  3OW2 A;  3T56 B;  5A35 A;  1KTK A;  4UY8 C;  2DY8 A;  4DR4 Q;  2PMZ E;  4BBS G;  4XQJ A;  1UWV A;  1K8M A;  3AEV A;  2XSC A;  5EGT A;  1AP0 A;  1NR2 A;  4HSV A;  1EL0 A;  1TS2 A;  3BU2 A;  1IBL Q;  2B3G A;  5IOD A;  3D6C A;  4G7Z C;  2PQA B;  3NTK A;  3U50 C;  1E1O A;  1VQH A;  2VUM H;  1DCZ A;  3RNU A;  2JA9 A;  5C0X J;  4B3M Q;  2K33 A;  4BY7 G;  2NTT A;  1B44 D;  4A93 G;  2RQX A;  2K14 A;  5E4X A;  3CD6 A;  4NDX A;  5CYU A;  2F0S A;  1SEB D;  2IHE A;  2VZA A;  1CSQ A;  2N88 A;  3HOW B;  3Q6S A;  5KYI A;  1PTO C;  3FKI G;  4C3H G;  2PI2 E;  1I94 Q;  3I56 A;  3PSI A;  2OTJ A;  2Z6B A;  1LUZ A;  4C1N K;  3EA6 A;  1WCM B;  5ELE A;  5KGU A;  4FXD A;  4WOR A;  4JYA L;  1BCP C;  1CKO A;  4OEL B;  1T5X D;  4JOI A;  1EFW A;  4O42 A;  3BG3 A;  1YNJ D;  4RAU C;  3CC4 A;  1D7Q A;  1A3U A;  4BXX G;  5HUR A;  2A68 D;  2HCI A;  3CCJ A;  2JA8 H;  1JB3 A;  2WAQ B;  4BWG B;  5FJ8 G;  1LTT D;  3A5Z B;  3CP0 A;  4DPG A;  1NR4 A;  1HXY D;  1J6Q A;  1GHJ A;  3J7A 5;  2K75 A;  1SNM A;  4F7X A;  4MN3 A;  2ZM6 Q;  2AQ3 B;  1G6Z A;  2F0Q A;  3HOV G;  1OTC A;  2L4N A;  1T5E A;  2EJG C;  4RKL A;  2VQF Q;  2JA5 B;  3CKI B;  3U9S A;  1U4P A;  3HOX B;  2TMP A;  4B3R L;  2NZH A;  2F0P A;  1QNU A;  1TVX A;  2Q8I B;  3DEP A;  5ELO A;  1KQS A;  3A55 A;  1PA6 A;  2EE1 A;  4TQU S;  1CA6 A;  1LT3 D;  5JVG 3;  1TU2 B;  4A76 A;  3HOZ G;  4POF A;  1WTQ A;  5JVH 3;  3PCO B;  1XMO L;  1Y8N B;  4L5Q A;  3HOU G;  4JI5 L;  4X3T A;  1PH9 A;  2XTI A;  1W2B A;  5I6Y A;  5IT9 c;  2E2J H;  3RLF A;  2K5D A;  4JBM A;  2R7Z H;  3AB9 A;  3MFG A;  4KMU C;  1PZJ D;  3DM1 A;  1A63 A;  4AQY L;  2A6H C;  2F52 A;  1KDA A;  3K58 A;  2HDL A;  4OON A;  5DAU A;  1NY4 A;  1EY5 A;  3MFY A;  1UAP A;  3I4M B;  4JK1 C;  1STB A;  2QGQ A;  5FLM H;  4O0A A;  2UXB L;  3A8K E;  4JYA Q;  5EQ0 A;  4DNI A;  1VQ5 A;  4HSP A;  5E7N A;  2CQA A;  4N9P A;  3KYH C;  1R4Q B;  1S3O A;  4HMI A;  3NPP A;  3OOC A;  1K8O A;  4XT3 B;  4QMG A;  4BBR H;  1NSN S;  3GTL B;  2PW5 A;  2MJ8 A;  1KRT A;  3W5O A;  5EPL A;  1JWU D;  2BA1 A;  3MXN B;  4KKS A;  4DF7 A;  1GUT A;  4G7O C;  1SBB B;  1V9P A;  3T4A C;  4OWW B;  3I4N H;  4CKB A;  3IFD A;  1X65 A;  2NVX H;  2I5H A;  1LTB D;  1SRU A;  2PW7 A;  3AFP A;  4B3R Q;  3EJI A;  4KJO A;  3RMH A;  3KUP A;  4N8F A;  3UDX A;  3RUZ A;  2R6G A;  3JC6 6;  2B2Y C;  4O2D A;  1Z47 A;  4P73 A;  4LUV A;  2UUC L;  2Q2U A;  2OQ0 A;  3S2D B;  2H1E A;  3BDL A;  4F87 A;  2KCN A;  5C4J B;  1UE5 A;  1SYD A;  5FO9 B;  1HR0 W;  2NBF A;  4IUP A;  3STB C;  1XMO Q;  4DV3 L;  1EQR A;  4GOP C;  1EYG A;  3S16 H;  2OCE A;  4JI5 Q;  2R92 G;  2A6H D;  2XN9 C;  3RZD B;  4POG A;  4F8M A;  1BVS A;  1PMR A;  3GO5 A;  4DUZ L;  2G9D A;  1JMC A;  1WTX A;  5BN5 A;  3VR2 A;  2B2U C;  4BY7 H;  2A1A A;  4A93 H;  4QF4 A;  5GRO A;  3KF6 A;  2RVL A;  4YY3 L;  1ASZ A;  2B2T A;  3ICE A;  1STN A;  4YCV A;  5IIF A;  4K14 A;  4QUF A;  2AQ1 B;  3L7Z C;  3GTM H;  2Z9H A;  3OWE B;  3V2T A;  2DNE A;  1MBY A;  5IGB A;  3A74 A;  2NVQ H;  4C3H H;  4FYD A;  2CHB D;  2Y0S G;  1T9H A;  1G2T A;  3G6J B;  1NAP A;  3QOL A;  4A3F G;  1BBW A;  3K5O A;  4MHE A;  4HJ7 A;  4C1N I;  1HA6 A;  2K05 A;  1M1K C;  2FFK B;  2K5W A;  1EY6 A;  2SNM A;  1VQM A;  4XQN A;  2PCF B;  3PO2 G;  3M4O B;  2K52 A;  4BXX H;  2WKD A;  2KED A;  4BY1 G;  3KBX A;  1Y8P B;  3AU7 A;  2LXK A;  3OIP A;  1U4R A;  2A19 A;  3K7A H;  5KRU A;  5NUC A;  4LW1 A;  3F2B A;  1P8L A;  1FGU A;  2Y0S E;  5M9O A;  1PH1 A;  3PF4 A;  5DM7 3;  1PRT B;  1LTS D;  1QG7 A;  4K5X A;  2K6A A;  3J80 E;  4RWS C;  1S5C D;  5M3F G;  4K6D A;  4KI0 A;  2B63 G;  2PI2 A;  2FXQ A;  3TME A;  2UUC Q;  5KIX A;  4IOA A;  4L6T B;  1ENA A;  1IHZ A;  1LT5 D;  2IHF A;  1GUG A;  2EXZ A;  4OHJ A;  2F0V A;  5M3M G;  1SE8 A;  2AMC B;  4DV3 Q;  4DAY B;  3CCS A;  1WD1 A;  5FK9 C;  4QIW B;  3MAQ A;  5IGF A;  1DON A;  2WII B;  4DUZ Q;  2YU9 H;  1EY9 A;  1G51 A;  3QB3 A;  1V1O A;  4K2K A;  5C3X A;  1YI2 A;  4PZ6 A;  4X64 L;  3HOZ H;  4P75 A;  2E2H B;  4LK1 C;  1KLG D;  1OXS C;  1ZEQ X;  3K8A A;  5I9O A;  4JI4 L;  3TZD A;  1TY2 A;  5CV8 A;  5IP7 G;  2F03 A;  3HOU H;  1F2M A;  3VR6 A;  1IW7 D;  2LKV A;  1K9M C;  1SRO A;  2QF7 A;  4RHS A;  4R1J A;  5JEA J;  1TXY A;  3T1Y L;  1PFB A;  5C4Z A;  1CZG A;  2P5Z X;  5D14 A;  1EWH A;  4A4I A;  2O5J C;  2F1M A;  4IAL A;  1UUP A;  4IUT A;  4RH6 A;  3M7N A;  1DOK A;  4DV5 L;  4XXE A;  3J81 j;  3DLL A;  1YBY A;  1R9T H;  3FRP B;  4RCO A;  4C3J G;  3J81 i;  1PYW D;  3J81 L;  4Q0F A;  2VUM B;  1SYF A;  1CZW A;  4RGT A;  5DLQ E;  4PV1 C;  3CCL A;  4XYQ A;  1Y8O B;  2OTL A;  2EY5 A;  2ZXO A;  3ERO A;  3AQQ A;  3M4Q A;  2K5N A;  4QCL A;  2JA6 G;  4H7B A;  3ULP A;  2EYP A;  4J6H A;  1Y1W G;  2A74 C;  2EY2 A;  3A7L A;  5I2Y A;  3MXU A;  2O5I C;  5CV6 A;  1F9S A;  4ABN A;  2VNU D;  4IFD G;  3R2T A;  5C44 G;  1E2Z A;  3S2H H;  2B2W C;  3PUW A;  4DGZ A;  1HZC A;  2EQS A;  2L0C A;  3KLS A;  5JPN C;  2SEB D;  2B2V A;  2E2I B;  1GUW A;  2K28 A;  1I4R A;  2KEC A;  3S9W A;  3C46 A;  1IKL A;  4L5T A;  1L1O B;  1E24 A;  1I5F A;  1A3T A;  4X64 Q;  3C3L A;  1I6H B;  1XXG A;  5K36 G;  1SYG A;  4N8X 1;  4JI4 Q;  3LX0 A;  2XRQ D;  2R92 H;  1ZYR D;  1KDC A;  2ES2 A;  5CGK A;  3S24 A;  2Q2H A;  4DR1 L;  1XNQ L;  2IPK D;  4RGM A;  4WJ4 A;  3T1Y Q;  1GKH A;  5BR8 L;  2K1B A;  3NEM A;  3MZ5 A;  1NTG A;  1LV9 A;  4JG2 A;  2KCT A;  4DV5 Q;  3KBG A;  1H9S B;  3SDZ A;  1TR5 A;  2I5M X;  2HHH L;  3E0J A;  1BUV T;  4HMJ A;  1N36 L;  4X65 L;  1G29 1;  2R93 G;  4RKB A;  4JI8 L;  3TQY A;  1JOR A;  3PUZ A;  2RHS B;  1NE3 A;  1HZB A;  4IFD I;  4UPA A;  2JEB I;  1AE2 A;  4ZK9 B;  4I7Z C;  3H09 A;  2I46 A;  2YYZ A;  4DR7 L;  2NZ1 D;  2R7Z B;  2KJX A;  3C1F A;  3F8T A;  1A6X A;  3I72 A;  3ERQ A;  4B9W A;  3CMA A;  4QQB X;  4U67 3;  4KHZ A;  3EQL C;  4AYB B;  2JQO A;  2EYJ A;  1VQN A;  2ATW A;  4BY1 H;  3TBI B;  3HKS A;  3PO3 B;  3Q8D A;  2VW9 A;  2XNA C;  3KLW A;  3B6Y A;  5EPK A;  1AEX A;  1YHB A;  1RL2 A;  3GD7 A;  1O7Y A;  1VQJ A;  5M3F H;  1CA5 A;  4OIJ A;  4KHP L;  2PO4 A;  3BDC A;  1GM5 A;  1PDQ A;  2B63 H;  4BBR B;  4C3I B;  1J8I A;  1JE4 A;  1N34 Q;  2LY7 A;  4XTC S;  2C35 B;  2MNA A;  1EY0 A;  2EY1 A;  2EYM A;  4HTH A;  5M3M H;  1V1Q A;  2HIX A;  3UI2 A;  4ILW A;  5E3F A;  2RDH A;  2Q8T A;  1W6K A;  2E8G A;  2K5Q A;  2J4X A;  3CCQ A;  4DR1 Q;  1EQV A;  1ESF A;  1Y14 B;  2NVX B;  4FF1 A;  2LS0 1;  5BR8 Q;  3DMU A;  1TT2 A;  2Z4I A;  1B3Q A;  2EZV A;  5EKL A;  5C3W A;  1VQ9 A;  5IP7 H;  5JJL A;  1EOV A;  1CM9 A;  1WI5 A;  3GDE A;  1CK1 A;  1K83 H;  2HHH Q;  1KRS A;  2NVT H;  1C7Y A;  2HD3 A;  1BO0 A;  1N36 Q;  2KOL A;  4X65 Q;  4GNX A;  2WB1 G;  1SNC A;  2LFN A;  4JI8 Q;  1TKW B;  2Q8R E;  2ZXR A;  1B2T A;  5C0X I;  2IT1 A;  4C3J H;  2EPB A;  1D2B A;  3TS0 A;  2VB3 X;  2MGS A;  4DR7 Q;  4BY7 B;  1E22 A;  2Z4H A;  4UDU C;  3SK5 A;  3FEW X;  1H9R A;  5M5X H;  3CPW A;  4JI6 L;  3F2U A;  3OIQ A;  4K2L A;  2JA7 B;  3NEN A;  4IN3 A;  1VQK A;  3C1E A;  2WB1 E;  1GUN A;  1C0A A;  2RA4 A;  3HZX A;  2JN4 A;  5K5P A;  3GTM B;  4A3J B;  5FLX E;  4C2M B;  4F88 A;  5IYB G;  1DJR D;  4DV0 L;  4DFA A;  2JA6 H;  4A3K B;  1F2Y A;  1QE6 A;  2R3Z A;  3J81 c;  1JIC A;  4KHP Q;  4X6A H;  3DWP A;  1EU3 A;  2A8V A;  4G7H C;  4IFD H;  5C44 H;  1A3V A;  1S40 A;  1FGB D;  2K03 A;  3FPU B;  2KQ3 A;  3MEF A;  2F0O A;  4FXG C;  3K7A B;  3SXH A;  3M9B A;  3PIO 3;  3S1N H;  3KF8 A;  3QWN A;  1W3S A;  1JWS D;  1BBU A;  1VQO A;  3CCR A;  4AH6 A;  2I07 B;  1LO5 D;  3E5S A;  5K36 H;  3K0Y A;  3SEB A;  3ULJ A;  5GQO A;  1Q12 A;  3O13 A;  5I6W A;  1DGS A;  5J22 A;  1G8Z D;  1XX8 A;  1NUC A;  1ONL A;  2XVS A;  1OXX K;  4I65 A;  4GS3 A;  2HCC A;  2KEE A;  4HCS A;  3L0O A;  4A3E B;  2K5H A;  3SK4 A;  1QNK A;  3RZO B;  1CSP A;  3K80 C;  4A3I G;  1LTI D;  3HOY G;  3OYY A;  3J7A F;  1F77 A;  1AZP A;  4BA1 I;  4IUR A;  1PZK D;  2YU9 B;  2HT1 A;  3MXG A;  1EQQ A;  1SE4 A;  3FDT A;  3HOZ B;  4YIJ A;  4JI6 Q;  1X32 A;  3CXC A;  3AFQ A;  1N32 L;  3H91 A;  2R93 H;  3PQI A;  4NPS A;  2ZTC A;  2D62 A;  1SSO A;  1B9M A;  1YIJ A;  1B53 A;  1CHP D;  1Y1V G;  1STH A;  1RTN A;  2KCM A;  3CRL C;  4DV0 Q;  3J80 i;  2QDB A;  3J80 L;  3GQB A;  1TWH B;  4EGV A;  4LUZ A;  1I4P A;  3NE5 B;  1AN8 A;  3TSS A;  1EY7 A;  2PZT A;  2M2L A;  3IL8 A;  2CCZ A;  1R9T B;  2CH4 A;  2AWN A;  5C0X H;  1X54 A;  4KK7 A;  2BOS A;  1EUJ A;  4ULL A;  1XNR Q;  1JJ2 A;  4V0B A;  2KCC A;  3MWY W;  3AYH B;  1KXL A;  3K6O A;  4TSS A;  1KDB A;  1M8A A;  1TS3 A;  2NVY B;  3TRE A;  3ITP A;  2PZW A;  3PIP A;  3S1R H;  2FMC A;  2MO1 A;  5CMD A;  5D3D A;  2B8G A;  1PTO F;  4IZ8 A;  1ILP A;  4XDX A;  2D9U A;  1TWA B;  3OTO L;  3A7A B;  3HEJ A;  1YNN C;  3NWS A;  5ISR A;  2N78 A;  4A3B G;  4G4K A;  3S2H B;  4UP9 A;  1BCP F;  4IJH A;  4DV2 L;  4X66 L;  1RDP D;  3VYU A;  4NMZ A;  4A3C H;  4CJ1 B;  2F0K A;  2AQ2 B;  1X3Q A;  2KVM A;  3CC2 A;  4J8Q A;  1SFO B;  4DAV A;  4OWX B;  2XIW A;  3ZJY C;  3K5N A;  2QDL A;  2LSS A;  3HKZ B;  4LAA A;  5IP9 G;  1YJ9 A;  2A73 B;  1PH5 A;  2OWO A;  2RBM A;  1DXM A;  3QG1 A;  4IPC A;  3A56 A;  1EWI A;  4MZ9 A;  1HPC A;  1UE7 A;  1XJV A;  1CI3 M;  4LF4 L;  1VMC A;  1N32 Q;  2F3V A;  5C4X G;  4YCW A;  3U58 A;  3L3O C;  2WIN B;  3KDF B;  2E2D C;  4LFB L;  1SAP A;  3MHB A;  2B2Y A;  1JT8 A;  4KJN A;  1Y69 U;  3K5L A;  1EY8 A;  4RGN A;  1HCZ A;  4LFA L;  1LTR D;  3K5M A;  2EYL A;  5IYC G;  4JI2 L;  3DM3 A;  3GTK H;  3CU7 A;  1PTO D;  4GOP A;  5COR A;  3U4V A;  5IYB H;  2JEA I;  2BCO A;  2PPB C;  1CFM A;  3CCV A;  1X3G A;  2CW0 C;  1XTC D;  1E3P A;  3NQT A;  1PRT C;  3FPP A;  3I3C A;  2B2U A;  1BCP D;  3GTG H;  3SK8 A;  5I4D A;  5JEA G;  2FJ2 A;  1WD0 A;  4A3M B;  3D31 A;  4PMW A;  4HJA A;  1EYC A;  3BZK A;  1P16 A;  1JJC B;  2K32 A;  1SYE A;  3IKJ A;  1GVP A;  3TS2 A;  4HIM A;  2YV5 A;  4KN7 C;  4BY1 B;  4ALP A;  2X69 A;  3H0G G;  2RDG A;  4H0L C;  3OTO Q;  4P71 A;  3D0F A;  1B7Y B;  4DV2 Q;  3BS1 A;  1LTL A;  4X66 Q;  1WTR A;  5T1I A;  4E6I A;  3URY A;  1ILQ A;  2D2C C;  1MIU A;  4ZKB B;  5JJK A;  2EJF C;  3MC0 B;  3PV0 A;  3G71 A;  5M5Y H;  4LWC A;  1TS4 A;  5I9P A;  4JI7 L;  1CKN B;  1A8V A;  2ID0 A;  3FMC A;  3HRZ C;  2N8N A;  1QVC A;  3HOW G;  3CQZ B;  1QVG A;  5JOB A;  5C5L A;  1VF7 A;  4LF4 Q;  5M3M B;  1KL9 A;  1D5X C;  4Q5V A;  2F0F A;  3CW2 C;  4A3I H;  1FNU A;  1SLJ A;  1EEI D;  1VQD A;  1XPO A;  4LFB Q;  1OXV A;  2KHJ A;  1WCM G;  3IAY A;  2AHO B;  4FVM A;  4X3K A;  2JSO A;  1BBX C;  2I0Q A;  4ZYS A;  2EYO A;  4LF5 Q;  1QJO A;  1I3Q H;  4LFA Q;  3R8B A;  1HRJ A;  4JI2 Q;  1EZ8 A;  4BBS H;  2WAQ G;  2XWJ B;  4TRD A;  2EJM A;  2DJF C;  1K83 B;  1R4P B;  1Y1V H;  4PNY A;  4DK1 A;  3E6Z X;  3HGB A;  2K50 A;  3DUZ A;  2NVT B;  5C3E G;  1SXT A;  2VS1 A;  2X6L A;  3S15 H;  2GVB A;  4Y7N H;  4R8N A;  4OO1 G;  2JA5 G;  4FDB A;  3SGI A;  4C3J B;  2WAQ E;  3W3A A;  1BOS A;  3NBH B;  3HOX G;  5A2Q E;  1HA5 A;  3GTQ H;  1BNZ A;  1LTG D;  2F3W A;  1VF5 C;  1TII D;  2K5V A;  2JK8 A;  4DU9 A;  1ROD A;  2KHS A;  3H3V I;  2BE5 C;  2G5D A;  4DXF A;  4DK6 C;  1I6V C;  3FKI H;  3GTJ H;  4EQP A;  3J80 c;  2SDF A;  2D0O A;  4GLA C;  5IGC A;  1L1O C;  3M85 A;  4ME5 A;  4GN3 B;  1ET6 A;  3KJP A;  1Q81 C;  1HUN A;  2A6E C;  4L8J A;  1YVC A;  2OT2 A;  1QB5 D;  4JI7 Q;  2C5C A;  1PH7 A;  5KEE A;  3VYS A;  5FJ8 H;  2F0T A;  1PVO A;  2QEX A;  3R2I A;  4IPH A;  1NJI C;  4JV5 L;  3U4Z A;  1V1P A;  1VQL A;  1JQY D;  4A3G B;  3STB D;  3HOV H;  5IP9 H;  1F2Z A;  1SMX A;  1EIG A;  4L63 B;  5LMU L;  3SHL A;  3L2P A;  2J7Z A;  3RD4 A;  3LWE A;  2WFW A;  5C4X H;  1IBM Q;  1FJG Q;  3GTP B;  1E0B A;  1K0S A;  4OO1 I;  3CME A;  4JC0 A;  5FLX L;  2J0T D;  4B3S L;  3AMU A;  3ND9 A;  1TS5 A;  4UAI A;  4DR2 Q;  2PNH A;  3RN2 A;  3LNN A;  1VQB A;  1IBK L;  5IYC H;  1ET9 A;  3PUX A;  3T16 A;  3S14 H;  2M9V A;  4JI3 L;  3S1M H;  5LHY 1;  1DD2 A;  1JOQ A;  3LWU A;  1IYJ B;  2RF4 A;  3TRZ A;  1QUQ A;  2R93 B;  1K8G A;  3ERS X;  1N9W A;  1VCI A;  1IYV A;  4CKE A;  4EVO A;  5JEA H;  4DA2 A;  2IX3 A;  3NUC A;  1D8L A;  2ASB A;  1UEB A;  2Z1C A;  1TY0 A;  2N3S A;  4CDF C;  3H0G H;  2OEO A;  3FVQ A;  1XWE A;  3K0X A;  5CV9 A;  3T51 B;  1ASY A;  5GAE C;  5G3L F;  3UE1 A;  1F2L A;  4O1N A;  3M3Y H;  1JCK B;  3EIV A;  4YWL A;  3TP8 A;  4M8A A;  4FO2 A;  1CQV A;  4JV5 Q;  2A5H A;  3H3V H;  5EKI A;  4Z9C B;  2ZJQ A;  5AJ3 Q;  1S72 A;  1X9N A;  2YTV A;  4KLK A;  5LMU Q;  4L5R C;  2Z6K C;  1SDF A;  4K5W A;  4LF7 L;  2JJQ A;  3BVG A;  1F9Q A;  1AZQ A;  1B3A A;  5FO8 B;  3HG9 A;  4OEM B;  4K0K L;  1Q3L A;  2JA8 B;  4R9W A;  2WP8 J;  4B3S Q;  3NSW A;  1HH2 P;  1FR3 A;  1SMY C;  1N34 L;  1HNZ L;  3BZD B;  3VA7 A;  1UNS A;  2JP1 A;  1IBK Q;  4JI3 Q;  1U0L A;  3QR8 A;  4IOC A;  2BH8 A;  5HGQ A;  4X3U A;  1LT4 D;  3H15 A;  4RGO S;  1GUS A;  5C3E H;  4ZLT F;  4DK3 C;  4PZ7 A;  2MQH A;  4NXM Q;  2F4V L;  1TWG H;  2C9O A;  2PQA A;  5G3L D;  4OO1 H;  3GV3 A;  2Z8L A;  4C56 C;  1QOH A;  3P20 A;  1SE3 A;  3HOX H;  1PFM A;  2JYO A;  1YEZ A;  4K6L A;  1Z6H A;  1SNP A;  4DAM A;  3GTK B;  2ENB A;  4N9T A;  5E1F A;  1S5F D;  4A3F H;  5DNF A;  2X6G A;  1II3 A;  1SJH D;  4JPB W;  2H4O A;  4CDD C;  3NK9 A;  2E2J B;  1NMG A;  1NMF A;  2IWH A;  2NWG A;  1KC8 C;  1YIT A;  3PO2 H;  3EN2 A;  4R4I A;  1D5M C;  4LF7 Q;  1E1T A;  4QIW E;  5IE8 A;  1YJN A;  1IXR A;  2E75 C;  1XMQ L;  1RCV D;  4FF4 A;  3ND8 A;  1SMY D;  3X3M A;  2E76 C;  4K0K Q;  1RTO A;  5EPJ A;  2NN6 G;  2D0P A;  3FP9 A;  4TVA B;  3DHQ A;  2CFM A;  3OW7 A;  2VUM G;  1U4M A;  1K3R A;  2QW7 A;  5CR3 A;  1D5Z C;  5GAG C;  3KF6 B;  2F0I A;  4P2C B;  4KV6 A;  4R4T A;  1HNZ Q;  2MPM A;  1O80 A;  1MD2 D;  4RG1 A;  4ZUI A;  3G48 A;  4ZRZ A;  3NTH A;  1ENC A;  5M5Y B;  4IQZ A;  3I4N B;  1TWF H;  5CBE E;  3E0E A;  4A3L G;  4A3D G;  2PMZ B;  2XGT A;  3RLO A;  1HNW L;  2DN8 A;  1QZH A;  2F4V Q;  3I8Z A;  3KK7 A;  4LMQ D;  4GLX A;  3QO2 A;  2AKW B;  1EYA A;  1KD1 C;  2ALY B;  3VR5 A;  1BF4 A;  4JI1 L;  3TEH B;  3CRK C;  2JE6 I;  1JOO A;  5ELF A;  3MXP A;  2EVB A;  4NKL A;  5HGT A;  5JJZ A;  1EEF D;  1Z9F A;  1PTO H;  5FLX c;  1Q8K A;  4BBS B;  1FD7 D;  5HY6 A;  2F0H A;  1KAA A;  3S16 B;  3JAM E;  3SE0 A;  5T1G A;  1MGS A;  1QCB D;  1CKM A;  5IGG A;  2JXM B;  4RA8 A;  4DV1 L;  4JBJ A;  1KAB A;  4DV4 L;  1JR0 D;  1F9R A;  4DNR B;  2NN6 I;  1PZI D;  4A93 B;  3RZD H;  3J7A V;  1Q82 C;  2B39 A;  2R61 A;  3GTQ B;  2ZT9 C;  2HQL A;  4TKO B;  1XMQ Q;  5L37 A;  1RHP A;  4B3T L;  3VR3 A;  2V1C C;  2K04 A;  3M7G A;  3G4S A;  5IGE A;  1GJX A;  3KJO A;  1O78 A;  2NVQ B;  1I4G A;  1CUK A;  3FKI B;  3GTJ B;  4MNO A;  1Y1W H;  2IW3 A;  5CV4 A;  4C3H B;  4LUO A;  5IWA Q;  3EVQ A;  4LF8 L;  3M4Y A;  3OMG A;  1E2W A;  1VQ4 A;  2DNC A;  3K59 A;  1XNR L;  5DEH A;  2WAC A;  1Q1B A;  2R7F A;  2K01 A;  1HTP A;  2DY7 A;  4ZQ3 A;  5FO7 B;  5TSS A;  5LL6 S;  1LYL A;  3Q23 A;  3H94 A;  3CCM A;  3TP7 A;  3A8J E;  4ID6 A;  3SR1 A;  1LTA D;  5E4W C;  1HNW Q;  1VMP A;  1RJT A;  4NB3 A;  3M4O H;  1SYC A;  1O7L A;  3RR5 A;  5LMN L;  3CPF A;  3PO3 G;  4JI1 Q;  3F2D A;  3HOV B;  5A2Q L;  5KNB A;  4DV6 L;  1STA A;  1UEA B;  1HNX L;  3KFU A;  4GKJ L;  1I50 H;  3NQI A;  3OHX C;  2F0M A;  1YNX A;  4AYB E;  4BBR G;  3I73 A; 
#chains in the Genus database with same CATH homology
 3NXW A;  1MI2 A;  3VA5 A;  4OL7 A;  2MP1 A;  2IX1 A;  1D1K A;  3S14 B;  4ZAI A;  1LLR D;  3D4W A;  3HOU B;  1BQQ T;  5DM6 3;  4V19 0;  1YNJ C;  2F0G A;  3Q24 A;  2A68 C;  1GOZ A;  4BA2 I;  5J39 A;  1IL8 A;  3WOE A;  1BR9 A;  1S5D D;  1BXT A;  3NP8 A;  3WOF A;  4GZY C;  3H0G B;  2NN6 H;  1KNE A;  4QB4 A;  5D3I B;  3M3Y B;  1G2S A;  1B4O A;  2L12 A;  1EYD A;  1LAC A;  2RSO A;  5EBC A;  4KY6 A;  1WTW A;  1S4Z A;  1IYU A;  4DXG A;  2SOB A;  4DAY A;  1H9M A;  2RKS A;  1U9R A;  2IL8 A;  1TQO A;  3MVV A;  1STE A;  1EY4 A;  1JWM D;  1JOK A;  4WJW A;  4B08 A;  1M4V A;  1QIL A;  1XYI A;  2L1B A;  3I70 A;  3HS0 C;  3BVM A;  1I4Q A;  5JPM C;  2N55 A;  2F0E A;  2R92 B;  3SK6 A;  4BS9 A;  3CHB D;  1GXD C;  5C3E B;  5ELD A;  2HUG A;  3SVM A;  1TWG B;  1HTL D;  2RSN A;  4KHV A;  3PMF A;  2QEJ C;  2AWO A;  3ZYY X;  3VYR A;  2GA4 B;  1V43 A;  4B9X A;  5D65 A;  5CV7 A;  3D4R A;  1QWY A;  2TSS A;  2Y0S B;  1H9J A;  4A3F B;  2F0U A;  2O4X A;  4KKT A;  1KNA A;  1YNN D;  1PRT F;  4HAE A;  4KTA A;  1STG A;  4H44 C;  4KY7 A;  2F0L A;  3PO2 B;  4K8I A;  3HP3 A;  1SE2 A;  3D3R A;  3BYT B;  2F0J A;  2AUK A;  4RFB A;  4K5V A;  5M3F B;  2AUJ D;  1FNV A;  4IUQ A;  3T13 A;  3GV6 A;  2L55 A;  2B63 B;  1L0X B;  5EJW A;  4FF3 A;  2G9H D;  4KN4 C;  3DXJ C;  4NW2 A;  3T53 B;  2EY6 A;  3D8G A;  1TWF B;  4XT1 B;  5IT9 E;  1NCV A;  3N6R A;  3U9O A;  1GUO A;  1H9S A;  2BA0 A;  4K8J A;  5IGD A;  2CW0 D;  4KKU A;  1PRT D;  1HFN A;  1DOM A;  1HQM C;  4CHT B;  4DAP A;  1ESR A;  1PTO B;  1IKM A;  1A2T A;  4KD3 A;  4ODG A;  1A15 A;  2ICI A;  1BCP B;  1PLF A;  1HUM A;  3BYY B;  1HQR D;  1ML0 D;  5M5X B;  1RD9 D;  5JAV A;  1SND A;  1SNO A;  3PUY A;  1O7Z A;  3D4D A;  1OO9 B;  2JA6 B;  1Y1W B;  5C5M A;  3P7J A;  5KNC A;  1X3P A;  1ZXT A;  4WRD A;  5C44 B;  3VR4 A;  1B1Z A;  3NBI A;  1IW7 C;  5EKK A;  3JAM L;  2CVR A;  1C8C A;  2FIN B;  3D6W A;  2BDN A;  3S1N B;  3IFT A;  2B8F A;  4OIK A;  3MTS A;  2B2W A;  1W6J A;  3N52 A;  1MSH A;  1RF2 D;  2E74 C;  4QUC A;  2HQE A;  4PQX A;  2EDG A;  1I50 B;  1SJE D;  3Q22 A;  3NWT A;  1CHQ D;  3NTI A;  2BE5 D;  1D1I A;  2RDF A;  3TDQ A;  4NP5 A;  2WKC A;  4DN4 M;  3A54 A;  3I4L A;  2FHT A;  2PNR C;  2A6E D;  3J7Y W;  4KY5 A;  3DWQ A;  4S3S A;  5AFW A;  1SYB A;  2B2T C;  5KYL A;  1WTP A;  1DZ1 A;  4KD4 A;  2LMC B;  3KLS X;  2K7V A;  4MIU A;  1L0Y B;  1C4Q A;  5LL6 X;  3V96 A;  1ZYR C;  4CBV A;  2FMM A;  3TN2 A;  2M00 A;  1AW7 A;  2L9H A;  5COY A;  1B50 A;  4XQQ A;  3S1R B;  4ZUJ A;  3I91 A;  1EIH A;  3H6M A;  4U68 A;  2EYH A;  4CGY B;  2F0D A;  4A3D B;  1B9N A;  4XYO A;  3ONA B;  5CV5 A;  1Q1E A;  1OXT A;  3MEH A;  2KA7 A;  3DEO A;  5FKA C;  4R8I A;  1DM0 B;  4CJ0 B;  2VB2 X;  1AFP A;  2PYK A;  1EWC A;  2QKI C;  1WTV A;  4FP5 D;  2WB1 B;  3V05 A;  3OWF A;  3X3N A;  1EZ6 A;  3QIA A;  1TWC B;  4HR7 B;  3PUV A;  4IUV A;  3I90 A;  4FF2 A;  3Q0A A;  3NHH A;  2XWB B;  2OF1 A;  1A2U A;  4EQO A;  2QCP X;  1G91 A;  1U4L A;  3MA2 B;  1RKN A;  3W2D A;  2F0W A;  5IOC A;  1PFN A;  1H9K A;  1DOL A;  4OGQ C;  3WDN A;  3GTG B;  2EYF A;  1PXU A;  1J9O A;  4H13 C;  1ZKO A;  2A69 C;  3QJY A;  1C48 A;  5J1Z A;  1JC7 A;  3TP5 A;  1EFI D;  2VXW A;  3C2P A;  3S17 B;  2BDO A;  1F9P A;  2ICE C;  2SNS A;  1WTO A;  4JBW A;  5KND A;  1MSG A;  1Z7T A;  4XIG S;  1HFG A;  2MHV A;  3BDO A;  2QIL A;  5C0X G;  5ELB A;  1ENF A;  3TP6 A;  5FOB B;  2PQE A;  2B2V C;  4CJ2 C;  2F0N A;  4PMB A;  5EBD A;  4ZKC B;  3EFX D;  5BN4 A;  4A3I B;  3HOY B;  2WV6 D;  1LAB A;  1I3Q B;  1KLU D;  3OMC A;  2F4I A;  1BDO A;  2MUY A;  1V1P B;  1Y1V B;  2A69 D;  4RHR A;  1GHK A;  3TZU A;  5CC4 A;  5F2D A;  4LJZ C;  2V4D A;  3S15 B;  1DYQ A;  3R3O A;  3H3V C;  4Y7N B;  2XRS D;  3QOJ A;  2IX0 A;  3PIP 3;  1WVL A;  4DNT B;  5M5W B;  1Q8I A;  4FXK C;  1EU4 A;  2O2L D;  3OPO A;  1CT1 D;  2L5T A;  1CTM A;  1EQT A;  5IT9 L;  1STY A;  1VDZ A;  3KLR A;  1E2V A;  2KUM A;  3DWA A;  4HED A;  1HHV A;  3MXN A;  2NTS A;  1V8Q A;  1Q90 A;  4FNF A;  1LT6 D;  1OXU A;  2IJ0 A;  1I4H A;  5BN3 A;  4HN7 A;  4WFN 3;  4A3B B;  4DK0 A;  3GTO B;  3GP7 A;  4J1M A;  4CKC A;  4IFD J;  5C4H A;  3OSO A;  3R93 A;  2NB0 A;  2D5D A;  1I4X A;  1CQF A;  4X3S A;  3BVZ A;  1SNQ A;  4HCE A;  5I2X A;  3S1Q B;  3K57 A;  4M1U B;  5C6A A;  3VYT A;  2NUC A;  1D6E C;  2ZXP A;  1EOT A;  5C4X B;  2HDM A;  4RCN A;  4PMC A;  2OXP A;  4IUN A;  1FNW A;  3L9A X;  3J81 E;  1FYC A;  1S5B D;  3G7L A;  2L11 A;  4G57 A;  3NBH A;  3A8I E;  4IUU A;  3P1H A;  2PZU A;  5CBA E;  3S1M B;  4EQN A;  2NYZ D;  1ICW A;  5ELC A;  1S5E D;  2EOT A;  3P75 A;  3T56 B;  5A35 A;  1KTK A;  2DY8 A;  4XQJ A;  1AP0 A;  1K8M A;  2XSC A;  5EGT A;  1NR2 A;  4HSV A;  1EL0 A;  1TS2 A;  5IOD A;  3D6C A;  4G7Z C;  3NTK A;  1DCZ A;  5C0X J;  2K33 A;  2NTT A;  1B44 D;  2RQX A;  5E4X A;  4NDX A;  5CYU A;  2F0S A;  1SEB D;  2N88 A;  3HOW B;  3Q6S A;  5KYI A;  1PTO C;  4C3H G;  4C1N K;  3EA6 A;  1WCM B;  5ELE A;  5KGU A;  4FXD A;  4WOR A;  1BCP C;  1T5X D;  4O42 A;  3BG3 A;  1YNJ D;  4RAU C;  1A3U A;  5HUR A;  2A68 D;  2HCI A;  1JB3 A;  2WAQ B;  4BWG B;  1LTT D;  1NR4 A;  1HXY D;  1GHJ A;  1SNM A;  4F7X A;  4MN3 A;  2AQ3 B;  1G6Z A;  2F0Q A;  2L4N A;  1T5E A;  2EJG C;  4RKL A;  2JA5 B;  3CKI B;  3U9S A;  1U4P A;  3HOX B;  2TMP A;  2F0P A;  1QNU A;  1TVX A;  2Q8I B;  3DEP A;  3A55 A;  2EE1 A;  4TQU S;  1CA6 A;  1LT3 D;  5JVG 3;  1TU2 B;  1WTQ A;  5JVH 3;  1Y8N B;  4X3T A;  5I6Y A;  3RLF A;  2K5D A;  3AB9 A;  3MFG A;  4KMU C;  1PZJ D;  3DM1 A;  2A6H C;  1KDA A;  3K58 A;  2HDL A;  5DAU A;  1EY5 A;  3MFY A;  1UAP A;  3I4M B;  4JK1 C;  1STB A;  3A8K E;  5EQ0 A;  4HSP A;  2CQA A;  4N9P A;  1R4Q B;  4HMI A;  3NPP A;  3OOC A;  1K8O A;  4XT3 B;  4QMG A;  1NSN S;  3GTL B;  2PW5 A;  2MJ8 A;  5EPL A;  1JWU D;  2BA1 A;  4DF7 A;  4KKS A;  1GUT A;  4G7O C;  1SBB B;  3T4A C;  4CKB A;  3IFD A;  1LTB D;  2PW7 A;  3EJI A;  4KJO A;  3RMH A;  3KUP A;  3RUZ A;  2R6G A;  2B2Y C;  1Z47 A;  3S2D B;  2H1E A;  3BDL A;  4F87 A;  2KCN A;  5C4J B;  1SYD A;  5FO9 B;  2NBF A;  4IUP A;  2A6H D;  2XN9 C;  3RZD B;  4F8M A;  1PMR A;  3GO5 A;  2G9D A;  1WTX A;  5BN5 A;  3VR2 A;  2B2U C;  4QF4 A;  2RVL A;  2B2T A;  1STN A;  5IIF A;  4K14 A;  4QUF A;  2AQ1 B;  3L7Z C;  3OWE B;  3V2T A;  2DNE A;  1MBY A;  5IGB A;  4FYD A;  2CHB D;  1G2T A;  3G6J B;  1NAP A;  3QOL A;  3K5O A;  4MHE A;  4C1N I;  1HA6 A;  2K05 A;  2FFK B;  2K5W A;  1EY6 A;  2SNM A;  4XQN A;  2PCF B;  3M4O B;  2WKD A;  2KED A;  3KBX A;  1Y8P B;  3AU7 A;  3OIP A;  1U4R A;  5KRU A;  5NUC A;  5M9O A;  5DM7 3;  1PRT B;  1LTS D;  1QG7 A;  4K5X A;  2K6A A;  3J80 E;  4RWS C;  1S5C D;  4K6D A;  4KI0 A;  3TME A;  5KIX A;  4L6T B;  1ENA A;  1IHZ A;  1LT5 D;  1GUG A;  2EXZ A;  4OHJ A;  2F0V A;  1WD1 A;  5FK9 C;  4QIW B;  3MAQ A;  5IGF A;  1DON A;  2WII B;  1EY9 A;  3QB3 A;  4K2K A;  1V1O A;  5C3X A;  2E2H B;  4LK1 C;  1KLG D;  1OXS C;  1ZEQ X;  5I9O A;  3TZD A;  1TY2 A;  5CV8 A;  2F03 A;  1F2M A;  3VR6 A;  1IW7 D;  2LKV A;  2QF7 A;  4RHS A;  5JEA J;  1PFB A;  5C4Z A;  1CZG A;  5D14 A;  1EWH A;  2O5J C;  2F1M A;  4IAL A;  1UUP A;  4IUT A;  4RH6 A;  3M7N A;  1DOK A;  4XXE A;  3FRP B;  4RCO A;  4C3J G;  1PYW D;  3J81 L;  4Q0F A;  2VUM B;  1SYF A;  1CZW A;  4RGT A;  4PV1 C;  4XYQ A;  1Y8O B;  2EY5 A;  2ZXO A;  3ERO A;  4QCL A;  4H7B A;  2EYP A;  4J6H A;  2A74 C;  2EY2 A;  3A7L A;  5I2Y A;  3MXU A;  2O5I C;  5CV6 A;  1F9S A;  4ABN A;  2VNU D;  4IFD G;  3R2T A;  1E2Z A;  2B2W C;  3PUW A;  4DGZ A;  2L0C A;  3KLS A;  5JPN C;  2SEB D;  2B2V A;  2E2I B;  1GUW A;  2K28 A;  1I4R A;  2KEC A;  3S9W A;  3C46 A;  1IKL A;  1A3T A;  3C3L A;  1I6H B;  1XXG A;  5K36 G;  1SYG A;  3LX0 A;  2XRQ D;  1ZYR D;  1KDC A;  5CGK A;  3I73 A;  2IPK D;  4RGM A;  2K1B A;  3MZ5 A;  1LV9 A;  3KBG A;  1H9S B;  3SDZ A;  1TR5 A;  3E0J A;  1BUV T;  4HMJ A;  1G29 1;  4RKB A;  1JOR A;  3PUZ A;  4IFD I;  2JEB I;  4ZK9 B;  4I7Z C;  3H09 A;  2I46 A;  2YYZ A;  2R7Z B;  2NZ1 D;  2KJX A;  3C1F A;  1A6X A;  3I72 A;  4B9W A;  3ERQ A;  4U67 3;  4KHZ A;  3EQL C;  4AYB B;  2EYJ A;  3TBI B;  3PO3 B;  2XNA C;  5EPK A;  1AEX A;  3GD7 A;  1O7Y A;  1CA5 A;  4OIJ A;  2PO4 A;  3BDC A;  1PDQ A;  1J8I A;  4BBR B;  4C3I B;  1JE4 A;  2LY7 A;  4XTC S;  1EY0 A;  2EY1 A;  2EYM A;  4HTH A;  3UI2 A;  4ILW A;  5E3F A;  2RDH A;  2Q8T A;  1W6K A;  2K5Q A;  2J4X A;  1EQV A;  1ESF A;  2NVX B;  4FF1 A;  2LS0 1;  3DMU A;  1TT2 A;  2Z4I A;  2EZV A;  5EKL A;  5C3W A;  1CM9 A;  1CK1 A;  1BO0 A;  2KOL A;  1SNC A;  2LFN A;  1TKW B;  2Q8R E;  2ZXR A;  1B2T A;  5C0X I;  2IT1 A;  2EPB A;  1D2B A;  2VB3 X;  2MGS A;  4BY7 B;  2Z4H A;  4UDU C;  3SK5 A;  3FEW X;  1H9R A;  3F2U A;  3OIQ A;  4K2L A;  2JA7 B;  4IN3 A;  3C1E A;  1GUN A;  2RA4 A;  3HZX A;  5K5P A;  3GTM B;  4A3J B;  5FLX E;  4C2M B;  4F88 A;  1DJR D;  4DFA A;  4A3K B;  1F2Y A;  1QE6 A;  2R3Z A;  1JIC A;  3DWP A;  1EU3 A;  4G7H C;  4IFD H;  1A3V A;  1FGB D;  2K03 A;  3FPU B;  2KQ3 A;  2F0O A;  4FXG C;  3K7A B;  3SXH A;  3PIO 3;  3KF8 A;  3QWN A;  1JWS D;  2I07 B;  1LO5 D;  3E5S A;  5K36 H;  3K0Y A;  3SEB A;  1Q12 A;  3O13 A;  5I6W A;  5J22 A;  1G8Z D;  1XX8 A;  1NUC A;  1ONL A;  2XVS A;  1OXX K;  4I65 A;  2HCC A;  2KEE A;  4HCS A;  4A3E B;  3SK4 A;  1QNK A;  3RZO B;  1LTI D;  3J7A F;  1F77 A;  1AZP A;  4BA1 I;  4IUR A;  1PZK D;  2YU9 B;  3MXG A;  1SE4 A;  3FDT A;  3HOZ B;  4YIJ A;  1X32 A;  3H91 A;  2D62 A;  1SSO A;  1B9M A;  1B53 A;  1CHP D;  1STH A;  1RTN A;  3CRL C;  2QDB A;  3J80 L;  3GQB A;  1TWH B;  4EGV A;  1I4P A;  3NE5 B;  1AN8 A;  3TSS A;  1EY7 A;  2PZT A;  2M2L A;  3IL8 A;  1R9T B;  2AWN A;  5C0X H;  4KK7 A;  2BOS A;  4ULL A;  4V0B A;  2KCC A;  3MWY W;  3K6O A;  4TSS A;  1KDB A;  1M8A A;  1TS3 A;  2NVY B;  3ITP A;  2PZW A;  2FMC A;  5CMD A;  5D3D A;  2B8G A;  1PTO F;  4IZ8 A;  1ILP A;  4XDX A;  2D9U A;  1TWA B;  3A7A B;  3HEJ A;  1YNN C;  3NWS A;  5ISR A;  4G4K A;  3S2H B;  1BCP F;  1RDP D;  3VYU A;  4NMZ A;  4CJ1 B;  2F0K A;  2AQ2 B;  1X3Q A;  2KVM A;  4J8Q A;  1SFO B;  4DAV A;  2XIW A;  3K5N A;  3HKZ B;  4LAA A;  2A73 B;  2RBM A;  1DXM A;  3QG1 A;  3A56 A;  1HPC A;  1CI3 M;  1VMC A;  2F3V A;  3L3O C;  2WIN B;  2E2D C;  1SAP A;  3MHB A;  2B2Y A;  4KJN A;  1Y69 U;  3K5L A;  1EY8 A;  4RGN A;  1HCZ A;  1LTR D;  3K5M A;  2EYL A;  3CU7 A;  1PTO D;  5COR A;  2JEA I;  2BCO A;  2PPB C;  1CFM A;  2CW0 C;  1XTC D;  3NQT A;  1PRT C;  3FPP A;  3I3C A;  2B2U A;  1BCP D;  3SK8 A;  5I4D A;  5JEA G;  2FJ2 A;  1WD0 A;  4A3M B;  3D31 A;  4PMW A;  1EYC A;  2K32 A;  1SYE A;  3IKJ A;  4KN7 C;  4BY1 B;  2X69 A;  2RDG A;  4H0L C;  3BS1 A;  1WTR A;  5T1I A;  4E6I A;  3URY A;  1ILQ A;  2D2C C;  4ZKB B;  2EJF C;  3MC0 B;  3PV0 A;  1TS4 A;  5I9P A;  2ID0 A;  3FMC A;  3HRZ C;  3CQZ B;  5JOB A;  5C5L A;  1VF7 A;  5M3M B;  1D5X C;  4Q5V A;  2F0F A;  1FNU A;  1EEI D;  1OXV A;  3IAY A;  4FVM A;  4X3K A;  2JSO A;  1BBX C;  4ZYS A;  2EYO A;  1QJO A;  3R8B A;  1HRJ A;  1EZ8 A;  2XWJ B;  4TRD A;  2EJM A;  1K83 B;  1R4P B;  4PNY A;  4DK1 A;  3E6Z X;  3HGB A;  3DUZ A;  2NVT B;  1SXT A;  2X6L A;  4R8N A;  4OO1 G;  4C3J B;  3W3A A;  1BOS A;  5A2Q E;  1HA5 A;  1BNZ A;  1LTG D;  2F3W A;  1VF5 C;  1TII D;  4DU9 A;  1ROD A;  2KHS A;  2BE5 C;  4DXF A;  1I6V C;  4EQP A;  2SDF A;  5IGC A;  3M85 A;  4ME5 A;  1ET6 A;  1HUN A;  2A6E C;  4L8J A;  2OT2 A;  1QB5 D;  2C5C A;  5KEE A;  3VYS A;  2F0T A;  3R2I A;  1V1P A;  1JQY D;  4A3G B;  1F2Z A;  1EIG A;  4L63 B;  3SHL A;  2J7Z A;  3RD4 A;  3LWE A;  3GTP B;  1E0B A;  4OO1 I;  5FLX L;  2J0T D;  3AMU A;  3ND9 A;  1TS5 A;  4UAI A;  3LNN A;  1ET9 A;  3PUX A;  3T16 A;  2M9V A;  5LHY 1;  1DD2 A;  1JOQ A;  3LWU A;  2R93 B;  1IYV A;  1VCI A;  4CKE A;  4EVO A;  5JEA H;  4DA2 A;  2IX3 A;  3NUC A;  2Z1C A;  1TY0 A;  2OEO A;  3FVQ A;  1XWE A;  5CV9 A;  3T51 B;  5G3L F;  1F2L A;  4O1N A;  1JCK B;  3TP8 A;  4M8A A;  4FO2 A;  1CQV A;  2A5H A;  5EKI A;  4Z9C B;  1SDF A;  4K5W A;  3BVG A;  1F9Q A;  1AZQ A;  1B3A A;  5FO8 B;  3HG9 A;  1Q3L A;  2JA8 B;  4R9W A;  2WP8 J;  3NSW A;  1FR3 A;  1SMY C;  3BZD B;  3VA7 A;  1UNS A;  2JP1 A;  4X3U A;  1LT4 D;  4RGO S;  1GUS A;  4ZLT F;  5G3L D;  2C9O A;  4OO1 H;  3GV3 A;  2Z8L A;  4C56 C;  1QOH A;  3P20 A;  1SE3 A;  1PFM A;  2JYO A;  4K6L A;  1Z6H A;  1SNP A;  3GTK B;  2ENB A;  4N9T A;  5E1F A;  1S5F D;  5DNF A;  2X6G A;  1II3 A;  1SJH D;  2H4O A;  3NK9 A;  2E2J B;  2IWH A;  2NWG A;  1D5M C;  2E75 C;  1RCV D;  4FF4 A;  3ND8 A;  1SMY D;  3X3M A;  2E76 C;  1RTO A;  5EPJ A;  2NN6 G;  3DHQ A;  3OW7 A;  1U4M A;  5CR3 A;  1D5Z C;  2F0I A;  4P2C B;  4KV6 A;  2MPM A;  1O80 A;  1MD2 D;  4ZUI A;  4ZRZ A;  3NTH A;  1ENC A;  5M5Y B;  4IQZ A;  3I4N B;  5CBE E;  2PMZ B;  2DN8 A;  3I8Z A;  3KK7 A;  4LMQ D;  3QO2 A;  1EYA A;  3VR5 A;  1BF4 A;  3CRK C;  2JE6 I;  1JOO A;  5ELF A;  3MXP A;  2EVB A;  4NKL A;  5HGT A;  5JJZ A;  1EEF D;  1PTO H;  4BBS B;  1FD7 D;  2F0H A;  1KAA A;  3S16 B;  3JAM E;  3SE0 A;  5T1G A;  1MGS A;  1QCB D;  5IGG A;  2JXM B;  4RA8 A;  1KAB A;  1JR0 D;  1F9R A;  4DNR B;  2NN6 I;  1PZI D;  4A93 B;  3J7A V;  2B39 A;  2R61 A;  3GTQ B;  2ZT9 C;  4TKO B;  1RHP A;  3VR3 A;  3M7G A;  2K04 A;  5IGE A;  1GJX A;  1O78 A;  2NVQ B;  1I4G A;  3FKI B;  3GTJ B;  2IW3 A;  5CV4 A;  4C3H B;  3EVQ A;  3M4Y A;  3OMG A;  1E2W A;  2DNC A;  3K59 A;  5DEH A;  2WAC A;  1Q1B A;  2K01 A;  1HTP A;  2DY7 A;  4ZQ3 A;  5FO7 B;  5TSS A;  5LL6 S;  3Q23 A;  3H94 A;  3TP7 A;  3A8J E;  3SR1 A;  4ID6 A;  1LTA D;  5E4W C;  1VMP A;  1RJT A;  1SYC A;  1O7L A;  3HOV B;  5A2Q L;  5KNB A;  1STA A;  1UEA B;  3NQI A;  3OHX C;  2F0M A;  4C3I G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...