2XRSD

Crystal structures exploring the origins of the broader specificity of escherichia coli heat-labile enterotoxin compared to cholera toxin
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
103
structure length
103
Chain Sequence
APQTITELCSEYRNTQIYTINDKILSYTESMAGKREMVIITFKSGETFQVEVPGSQHIDSQKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN B CHAIN
publication title Crystal Structures Exploring the Origins of the Broader Specificity of Escherichia Coli Heat-Labile Enterotoxin Compared to Cholera Toxin
pubmed doi rcsb
source organism Escherichia coli
molecule tags Toxin
total genus 27
structure length 103
sequence length 103
chains with identical sequence E, F, G, H, L, M, N, O, P
ec nomenclature
pdb deposition date 2010-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2xrsD00
2QILA 1BCPD 1CHPD 1D5ZC 1EU4A 1JWUD 1LTTD 1FNUA 2AQ2B 3EFXD 1G8ZD 3BYTB 1ET9A 1M4VA 3MFGA 1PRTF 1CK1A 2J4XA 1PTOD 1SBBB 1SE2A 1EU3A 1I4XA 4DXGA 3BZDB 1LT5D 4OHJA 2TSSA 1SEBD 1FGBD 1DYQA 1LTID 2WV6D 3R8BA 1I4HA 2R61A 1RDPD 1PTOF 5D3IB 1TS3A 1I4PA 4RGOS 3BVGA 1PTOH 5ELEA 1PZKD 1ET6A 1PRTD 1AW7A 1S5FD 2NTTA 3KLSX 1BCPC 1D6EC 3BVMA 5I4DA 3W2DA 1BCPB 1STEA 5FKAC 1FD7D 1TS2A 3R2TA 1L0YB 2RDGA 1FNWA 1JR0D 1SXTA 4Z9CB 1LTGD 1UUPA 1LTSD 4RHRA 4ZYSA 1LLRD 2XNAC 1FNVA 3BVZA 3OWEB 1SJHD 2QEJC 4RGMA 1S5ED 1UNSA 2G9HD 3SEBA 3DWAA 1D5XC 1PYWD 2ICIA 1RD9D 1EWCA 5ELBA 1BXTA 1GOZA 3O13A 5ELCA 3CHBD 1LT6D 3GP7A 2XN9C 1PZJD 1V1PB 2IJ0A 2Z8LA 4L63B 1TY0A 4RH6A 1S5CD 1F77A 1HQRD 4RGTA 1KLGD 1PRTB 1QILA 1V1PA 1SE4A 3DWQA 5ELFA 1LTBD 3DWPA 1JWSD 1S5DD 1SE3A 4O1NA 1LTAD 2XRQD 1HTLD 1TY2A 4UDUC 1EFID 4K6LA 3V05A 1PTOC 1EEFD 1PTOB 1RCVD 1SJED 1XTCD 1PZID 4RCOA 5TSSA 1S5BD 4BWGB 1T5XD 3TSSA 1LT3D 3BYYB 1RF2D 1TS5A 1B44D 4C56C 3URYA 1KTKA 1KLUD 1D5MC 1HA5A 2AQ1B 2RDHA 1ESFA 4RFBA 1AN8A 5ELDA 1PRTC 2AQ3B 3EA6A 1LO5D 3R2IA 4RGNA 2CHBD 1LTRD 1JQYD 1JWMD 1ENFA 2NTSA 1I4QA 1BCPF 1CT1D 1V1OA 1CHQD 1TS4A 1MD2D 2O2LD 3MC0B 4DXFA 1I4RA 4L6TB 4RHSA 1CQVA 1I4GA 2XRSD 5D3DA 4TSSA 1EEID 1DJRD 5FK9C 1B1ZA 2SEBD 1HXYD 1L0XB 1XXGA 1JCKB 1LT4D 2IPKD
chains in the Genus database with same CATH superfamily
1CHPD 2VQEQ 4EX5A 5ELNA 5GAHC 1Y69U 4FXDA 1NBWA 2OF1A 1A3UA 3MFGA 1Y1VH 1EQTA 5HURA 1UE5A 4FVMA 1UE7A 4XYQA 5FLXL 2VXWA 4NXNQ 3MZ5A 5HY6A 3S1QH 2KENA 4OO1H 4JBWA 1TQOA 2MP1A 3HKZE 4IALA 2Z6BA 4DUZL 3HKSA 2Q2TA 4MN3A 1JJGA 3BVGA 1ET6A 4K2KA 2ASBA 4B3MQ 1K83B 3HOYG 2EIFA 1BCPB 2MFIA 4HSVA 3QWNA 3A56A 3HOYB 5LL6X 4POGA 4FDBA 4H02A 5JVH3 1I50H 2OQKA 2VS1A 2XNAC 2ZTEA 3EJIA 2QDBA 1VQKA 1J5EQ 1HHVA 2K33A 4R4IA 2X6GA 3EIVA 1D5XC 5JJZA 1GVPA 1J8IA 3F2BA 4CKCA 3RLNA 4JVZA 1F9QA 3EROA 4RA8A 3RZOH 3J81L 1KLGD 2R7ZH 2WIIB 2K52A 3EQLC 1N36Q 3M4PA 5BR8L 1DOKA 4CDDC 4ZK9B 2UXBL 4DR5Q 3KBXA 5TSSA 1TWFB 3P20A 4GNXC 3S1NH 1EQQA 1EUJA 1RHPA 3RMHA 5JJKA 3M9BA 4CGYB 1KLUD 1Q1EA 3TEHB 3DXJC 5ELDA 4IOAA 1H9SA 3H15A 4DR3Q 3CCRA 2NTSA 1Y1WH 1LM0A 1I3QB 4GOPB 4L6TB 3EBEA 1JJCB 4NXMQ 3TP8A 1I94L 4JG2A 4YY3Q 1B1ZA 3B6YA 2VL6A 2F0JA 3CXCA 4LF5L 1LT4D 1YNNC 1O7IA 1EY4A 1EU4A 4DV7Q 2Y0SG 1F9SA 4LFAQ 2HQLA 2F3WA 3SE0A 2Y0SB 3U4VA 5I6WA 1SBBB 3VR4A 4AQYQ 1PHJA 1G291 3U50C 3R8BA 1A0IA 2TMPA 4GS3A 4PNYA 4HJAA 1IYJB 1PTOF 5D14A 1SMXA 1EY8A 2I5HA 4DK0A 3G71A 1IBML 5JEAJ 5GAEC 2KOLA 1PRTD 1K8MA 4OO1I 2F0VA 2RBMA 3KLSX 3SR1A 1YI2A 5I4DA 3GTQH 3K5MA 1STEA 3EVQA 2HUGA 4LUVA 3J7YW 3S1RB 2VZAA 2E8GA 2L9HA 4RHRA 1YHAA 3HOWG 3H0GH 1X9NA 4A3LH 3N6RA 1A2UA 1PXUA 2F0FA 3ZYYX 5C4ZA 3HOWB 4HIKA 3K5LA 4JI3Q 2ID0A 4ILWA 1EWCA 1NMGA 1RIPA 1GOZA 1QUQB 4APVA 2UXCQ 1PZJD 1TWHH 2JN4A 1EYGA 3CCUA 3QB3A 2MGSA 4IFDI 3J80E 1OTCA 5I2XA 5FO8B 3SHLA 1QZHA 1PV4A 3HOZH 2JA7H 4CJ2C 1IBKL 4LAAA 1K3BC 3CQZH 4A3EG 4DR2Q 1S5BD 4JOIA 4A3EB 4GLVB 4J6HA 1TWGB 2IHFA 1OXXK 3PUWA 1E1OA 3NBIA 4C1NK 3J80c 2L55A 3VYRA 1LO5D 2ALYB 1C7YA 1CT1D 3C1FA 3TZUA 5BN3A 5HGQA 5IGCA 3I4NG 3OPOA 5IP7H 4G4KA 2Q2IA 5AJ3Q 1AEXA 1I4GA 3I4NB 2F03A 4JI8L 2A68D 1H95A 1PLFA 4ZUIA 3TMEA 4QL5A 4QIWE 4XIGS 3DHQA 5D65A 1WCMG 2PO4A 2B8FA 1Q3LA 1VQ5A 4R8IA 3S14H 1WCMB 4JI6L 1K3RA 2M9VA 2Q2HA 3GV3A 1A3VA 4A3GG 3MEHA 4KD4A 2IX1A 2F0GA 1Y14B 1TXYA 4LWCA 3CCMA 2GVBA 3KF8B 4A3GB 1WYDA 1LT5D 4A3DG 2PW7A 5C5LA 5A2QL 4G7OC 2A68C 4U673 2B2UC 1CM9A 4A3DB 2XSCA 3BDLA 4BBSG 1QUQA 1SNDA 5EBCA 2ZJPA 2HHHL 5M5YB 1D1IA 1MBYA 4P72A 4BBSB 3OSOA 1YIJA 4KN7C 4G7ZC 1A3TA 2JEAI 4CBVA 2SNSA 3PUVA 1V43A 4KHPL 5C6AA 3ULLA 3BVZA 1PYSB 3NBHA 4MTNA 4RAUC 4HIDA 4DGZA 3NWTA 3HGBA 1Y1VG 2I5MX 4R9WA 1UE1A 2Z6KA 1SNPA 5IYCG 1DZ1A 5CGKA 1Y1VB 1D7QA 2AKWB 1GKHA 1B9MA 3TZDA 4X65L 4OO1G 3NEMA 1QVCA 1HQRD 5IT9E 1QILA 3NTIA 3MXNB 1DD2A 3FRPB 4I7AA 2OXPA 5I6YA 2B2WA 2UUAL 2WFWA 1SJED 3D4DA 3M85A 4BWGB 4GKKQ 4LF6Q 2K5DA 1C48A 4EGVA 4LFBQ 1N34L 1OO9B 2F3VA 3I8ZA 4GNXA 4QY7A 4CKEA 4YWMA 5IT9c 1I50B 3HOVH 1KAWA 3J80L 2L4NA 1KD1C 3OW7A 2FJ2A 1LTRD 3NWSA 1ENFA 3Q24A 4ZAIA 3A7LA 4JC0A 5FO7B 1XMOQ 4GZYC 5K5PA 2WB1E 3BZKA 5FOBB 2R7ZG 5EKIA 2XRSD 3U9SA 3NHHA 2E2JH 3RZOB 2R92H 3STBD 3L3OC 4LF8L 2R7ZB 4GLXA 1OXSC 3GQBA 4JI2L 2AUJD 4PMCA 1TWAH 2D62A 1G8ZD 1JC7A 2EVBA 3PV0A 3S1NB 5EAYA 1XNRQ 1GHJA 4EQOA 1VQ9A 1KIXA 5GADC 2F52A 3Q22A 1STGA 2K03A 4DR1L 1Y1WG 1TS3A 5LMNL 5EBDA 4DPGA 1TWCB 3K5NA 2UUCQ 3TS0A 2RSOA 5IIFA 1Y1WB 2O5JC 2NVTH 2C5CA 1GUNA 4NPSA 4A93G 3MXNA 3AB9A 3PO3H 1L0YB 4DNIA 2MPMA 4A93B 1BUVT 2UXDL 5F2DA 2K50A 2K6AA 2A6HC 4KJNA 3T56B 4JI5L 4GN5A 2YTYA 2UU9Q 1UNSA 3KOJA 1HZBA 2KEDA 1B70B 4HJ9A 4X3KA 1STBA 5ELCA 2EPBA 5LMNW 2RCFA 3TQYA 1L1OA 2WINB 5FJ8H 3N52A 1FJGL 5ELFA 1YVCA 3DWPA 3SXHA 4AH6A 1QE6A 3CMAA 3KF6B 2FINB 2JA9A 4UDUC 2VQEL 5JJIA 1IKMA 2V1CC 3L2PA 1XWEA 2EYMA 5CMDA 3RZDH 1NY4A 4AYBG 3ITPA 1VQ4A 4NXNL 3GTQB 1BBXC 3AFQA 4AYBB 4M8AA 2PQAA 3UDXA 3H0GG 5EKKA 4A3LG 4LUOA 5IT9L 3VYSA 4JI4Q 3H0GB 3AEVA 2F4IA 3OW2A 1BKBA 4C1NI 4DAYB 1CHQD 1NSNS 2PYKA 4FNFA 1ASZA 4IO9A 3HS0C 5CV9A 1TWHB 4PZ7A 1NR2A 2J7ZA 3QG1A 4TVAB 1KRSA 4R8NA 2JA7G 1VQGA 1IHZA 4JBMA 4CDCC 3PF5A 1J5EL 3T16A 3GTPH 2K01A 4RKBA 2JA7B 2A19A 1BCPD 2K32A 3A5UA 3CQZB 4K5XA 5CC4A 3GTOH 4JI7Q 4IUPA 2ZM6L 4LJZC 4J1MA 1CA6A 1YJ9A 1KABA 4HJ7A 4YHHL 1I4HA 1PVOA 2IY5B 4ZCKA 4WJ3M 4DR5L 4CKBA 5IP7G 1PTOH 4NKLA 5FLMH 2JA6H 3DEPA 1YJNA 1BCPC 1B2TA 3J81i 5LMUQ 3S1MH 4JI0Q 2R6GA 3IKJA 4IURA 3CMEA 4K5WA 2RDGA 4F7XA 5C4JH 1LTSD 3KF6A 4IN3A 4R4CA 1FNVA 3OWEB 4JBKA 4CDEC 4BY1H 1VCIA 3S14B 4Q0FA 1GXDC 2F3IA 4N9PA 3UI2A 3J81j 2BE5D 2L11A 4NXML 4OIJA 1QCBD 1QJOA 4X3SA 1S5CD 1VMPA 1O78A 1J9OA 2K4KA 3MVVA 4YY3L 1JWSD 1Q90A 5KIXA 1YHBA 2E74C 3BDOA 3GDEA 4DAYA 1CI3M 1UAPA 1H9RA 4LF7Q 2DY8A 1SYCA 1KDBA 1MKHA 2K5VA 2ZT9C 1ENAA 1XNQL 5J3BA 4TQUS 4FXGC 4AQYL 3KK7A 4L5RC 1EZ8A 3UE0A 1D5MC 2BH8A 4DFAA 1YBYA 1SRUA 1KDAA 1I6VC 2XIWA 1F2ZA 2C9OA 2MJ8A 1PFSA 3MAQA 1SMYC 4JOIC 2LXKA 4KV6A 1UE6A 3CCLA 3NQIA 4XQQA 3V96A 2SEBD 1SNCA 1WTPA 1W2BA 4HJ5A 2VB3X 1HNWQ 4MHEA 1D5ZC 1E24A 3EFXD 5GAGC 5KRUA 4GKJQ 2JXMB 1HUNA 3VR3A 2DY7A 3FP9A 2UXCL 2NZ1D 2YU9H 2FHTA 3CPFA 4UP8A 1PTOD 3H6MA 3PSIA 3HOVG 3BZDB 2XVSA 3M7NA 3D8GA 4A3IH 3OTOQ 2NB0A 4KMUC 1SEBD 4CHTB 3HOVB 4QQBX 3NELA 4DR2L 2B29A 2MHVA 1OXUA 3OMCA 4R4QA 4JYAQ 1EL0A 2R92G 1KDCA 3CW2C 1CKNB 2E2JB 3NENA 3P7JA 2K1BA 4GLAC 3R2TA 3RLOA 2R92B 1KNEA 1WTOA 2RA4A 1HFGA 1LTGD 3E9HA 2RKSA 1HFNA 4B3TQ 1SJHD 5IGDA 5M5XH 2QEJC 2EYJA 4F87A 4LNQA 3J7ZC 4XDXA 1TWAB 1SDFA 1XTDA 1PYWD 1ZXTA 3CAMA 2ICIA 1K8GA 2BA0A 2CFMA 2OQ0A 2IJ0A 5CV8A 4L63B 1VQLA 5T1IA 4DAMA 1Y8NB 4DR6Q 4HAEA 1V1PA 4A3CH 2RF4A 3MXGA 2ZXOA 1LTBD 4C2MH 5C0XG 4YWKA 5C44H 3UE1A 1N33Q 2BOSA 1B3AA 3KLWA 2LKVA 4IUVA 1A15A 2ZTCA 2L5TA 2Z6KC 4X3TA 4PMBA 4IFDH 4POFA 4DAVA 3PO3G 2NVTB 3NSWA 3PO3B 2A5HA 1STNA 2QKIC 1TVXA 4OELB 4ZLTF 4DUYL 1A63A 1HRJA 1HA5A 2XGTA 4OEMB 5IYDH 1QB5D 4QIWB 3R2IA 2B2WC 1R9TH 4YCUA 5M3MH 1JWMD 2KUMA 2KHIA 1VQPA 2O5IC 1SR3A 3OYYA 5FJ8G 4LF9Q 1UEAB 3U58A 1QG7A 4TSSA 1M90C 1ZEQX 1FGUA 5KGUA 2NYZD 2UUBQ 3GTGH 2K5NA 3KYHC 2RDFA 4BXXH 5E7NA 1PFMA 4A3BH 3K5OA 4J8QA 1SAPA 1NAPA 1II3A 2N8NA 3KDFA 5BN4A 4EQ5A 2E5LL 1E22A 1OXTA 3OIPA 1KNAA 3FDTA 1CKNA 3RZDB 4DV2Q 3G6EA 2NVQH 4O2DA 4YIJA 4KKSA 4K2LA 1JMCA 3T53B 1JOQA 1BOSA 3ERQA 1K9MC 3MTSA 2EY1A 3RNUA 5JVG3 4A75A 2ZXPA 1GUGA 2A73B 2EJFC 1ICFB 5A2QE 1EQVA 4K6DA 1GUWA 3FPUB 1F2LA 3RLFA 4DV4Q 2VQFQ 3CP0A 2JSOA 4DA2A 4L5QA 3UDGA 1D6EC 1XPUA 1TS2A 4MIUA 2X6LA 5DAUA 1N32L 3CD6A 4IPDA 4FF1A 1Q46A 1SXTA 1A2TA 2PNRC 4WJ4A 2L15A 1CSPA 4RMFA 1NJIC 4RWSC 4ZKBB 4A3MH 3CCSA 2BA1A 4XYOA 1WTQA 3GTLH 3GTPB 2F0PA 4X66Q 1C9OA 3PUYA 1BXTA 3GTOB 3P75A 3C46A 4UY8C 3FKIH 5G3LF 1EOTA 1WFQA 3G48A 4QMGA 4PQXA 3DM3A 3CC7A 4IUQA 3CRKC 2J0TD 5KEEA 3L7ZC 5FLMG 2OCEA 4FF3A 2JA6G 4DR4Q 1PTOB 1RCVD 3QOLA 1HZAA 2JA6B 3A8IE 3X3NA 1XNRL 1QWYA 4C3JH 4B3RQ 5M3FH 4ABNA 1KC8C 5CORA 3URYA 1WJJA 1EIFA 1KTKA 1L1OC 2IW3A 3S1MB 4PMWA 5C4JB 4RFBA 4BY1G 1SSOA 1PRTC 1HUMA 2BH2A 3W5OA 1VQ6A 5I9PA 3NTKA 1JQYD 5E4XA 1FVIA 2UUCL 4BY1B 2JA5H 1K0SA 2O4XA 3X3MA 5IYBH 1BO0A 4L5SA 3CCJA 1XMQQ 1I4RA 3TS2A 2Q8IB 3F2DA 2F0MA 1NUCA 1I6HH 4GOPA 1O7YA 2I07B 2FXQA 4P75A 1PH6A 1PH1A 1X65A 2VUMH 2H4OA 2NZHA 2OTLA 4ME5A 1W6JA 4CJ0B 1WD0A 4KI0A 2K28A 1GJXA 2JJQA 4BBRH 1SE8A 1VDZA 5COYA 2UU9L 5KYLA 1BDOA 4LFCL 3PO2H 4DV0Q 1R4PB 1SFOH 1JT8A 4MNOA 2AMCB 5IWAQ 2EY2A 1RODA 1CK1A 3GTKH 4ULLA 1TKWB 3NTHA 1A6XA 1LTID 2WV6D 3QJYA 2KECA 1HCZA 1IZ6A 4NDXA 2JEBI 3F8TA 4ZQ3A 1PZKD 3CCQA 2FMMA 4DNRB 3MXPA 1T9HA 2NTTA 3K81C 4IPCA 3FPPA 4DUZQ 5T1GA 3JAMi 2M00A 2XWBB 3T4AC 1HZCA 2PW5A 1IW7D 3T1HQ 3A7AB 2IHEA 1VF5C 3ONAB 1Q82C 1LTLA 1RD9D 3ND9A 1EY5A 2EXDA 1KXLA 1E2ZA 2YU9B 2B2YA 1PFNA 4A3IG 1RTOA 3KJPA 1MSGA 5EPLA 4A3IB 2D0OA 1HTLD 3GTJH 1JB7A 1YHQA 1AP0A 2CQAA 4IUUA 3KBGA 5DNFA 4JI7L 1IW7C 2JK8A 3S15H 1T5XD 3BYYB 1TS5A 1KRTA 2F0IA 5BR8Q 1EY7A 4C3IH 2AWNA 1EIGA 4GN4B 2A6ED 3S1QB 5IGEA 5M5XB 2K7VA 3I56A 5C3XA 4UAIA 1G6ZA 1JB3A 2DJGC 4UP7A 1ML0D 3KUPA 2B2VA 5GQOA 3MC0B 3C3LA 3Q0AA 1MI2A 5LMUL 4A3CG 2D9UA 1VQBA 4JI0L 4HTHA 1KHIA 1YNJD 1EEID 1DJRD 4K0KQ 5C44G 1A8VA 1W3SA 3J7A5 1K8OA 2HCCA 3RUZA 3M3YH 2F0OA 2R7FA 1L0XB 4C2MB 2RHSB 3VA5A 1GM5A 5C44B 2F0UA 3ND8A 3M4OH 1RL2A 2JQOA 1CSQA 1L0WA 3D31A 4DK1A 2Y0SE 3W1BA 1JWUD 3MXUA 4IFDG 3GTMH 2R3ZA 1I94Q 2HDMA 1U4RA 1PRTF 5C3WA 4IJHA 1HH2P 1IBLL 2OEOA 2Z4HA 2GVAA 5IYDG 1X56A 1DCZA 4LF5Q 4OHJA 3KF8A 3A54A 5M3MG 3M4YA 4LF7L 2KHSA 4ALPA 1R9TB 3S16H 5M3MB 5CV6A 4P71A 2WAQE 1Z7TA 3TREA 5IGGA 1XPOA 1NCVA 1S40A 5M9OA 4BXXG 2I5LX 4IQZA 1FNWA 1X32A 4Z9CB 3VR5A 4A3BG 3GTGB 4TKOB 1E7ZA 1IBMQ 3BU2A 3I70A 3T51B 1D8LA 5C0XJ 3HP3A 2K5QA 2CWPA 1H9MA 3OWFA 4A3BB 2Z0SA 5FO9B 3AYHB 2PZTA 1SYDA 1GHKA 5JPMC 2K14A 1FR3A 3STBC 4BY7H 4OL7A 3NUCA 1HNXL 4OWTB 1B9NA 2B63H 4HR7B 4P2CB 3F1ZA 3IFTA 2PZWA 3HRZC 4HCSA 2NVQB 2L0CA 1CKMA 4ODGA 3QOJA 1GUTA 1G2TA 3HZXA 1HNZQ 3K6OA 4X62L 4NB3A 1HNWL 2BDNA 1EFID 3LWEA 2Q8TA 3VR6A 4DV1Q 5I9OA 1AFPA 1EWIA 1JE5A 1XTCD 2A69D 5EGTA 2WP8J 1SNQA 2K5WA 3CC2A 5IOCA 1RF2D 1B44D 5C4HA 3BZCA 3G7LA 4WJWA 4C56C 1F2MA 3CRLC 3T1YQ 4KHZA 4N8X1 1F2YA 4A3MG 1F9PA 2NBFA 1CA5A 1IBKQ 1Z9FA 1MJEA 2NZOA 3EA6A 2F0KA 4A3MB 3GTLB 2F0NA 2EJGC 2FFKB 1TS4A 3FKIG 3PGZA 2O2LD 3PUXA 1B4OA 4DXFA 4DR7Q 2PNHA 2LFNA 4JI1Q 1AE2A 3FKIB 3UDIA 1WD1A 2NVYH 3I73A 1CZWA 5BN5A 3PCOB 3WWVA 4B3TL 4Y7NH 4B9WA 3IFDA 1XXGA 2HD3A 4QGUA 3U9OA 4FYDA 4YCVA 1DM0B 3NP8A 3SDZA 1S72A 2IWHA 3MFYA 1AZPA 4C3JG 5M3FG 3WDNA 2CH4A 4JI8Q 4QUFA 1LACA 3C2PA 2J4XA 4DR6L 3H09A 4C3JB 4B3ML 5M3FB 2TSSA 4KKTA 1M1KC 2QGQA 2Z1CA 3TDQA 1VQMA 1DYQA 2G9DA 2KHJA 2R61A 3LGJA 1FL0A 2JA5G 4JI6Q 1I3QH 3FVQA 3HOZG 1Q81C 5IYBG 3HKZG 2PCFB 4I7ZC 4RGOS 2JA5B 2N88A 4L8JA 3HOZB 3OMGA 1X3EA 3HKZB 3I90A 3P1HA 1VQEA 3KJOA 1I6HB 1Z47A 4DU9A 4JCVE 2L1BA 3S2DH 5CV4A 1E3PA 4FO2A 1KL9A 4BBRG 2ZJQA 4B08A 3PO2G 3TN2A 1ENCA 4BBRB 2VW9A 1N36L 3PIPA 1EIYB 2HHHQ 2VNUD 1KAAA 3DWAA 3PO2B 2JE6I 1SFOB 4KN4C 1AH9A 3A5ZB 4IOCA 2HCIA 2YV5A 3IL8A 1TY0A 4RH6A 2E2IH 2UUBL 1NE3A 3GTKB 4H7BA 4OWWB 4KKUA 3RN2A 2HQEA 1EY9A 1ILPA 1BF4A 4G57A 1DOLA 2PQEA 2PMZE 4K6LA 1P8LA 5L37A 2CW0D 1G91A 4FP5D 1EEFD 3DLLA 4X65Q 2VB2X 3HEJA 4DR3L 1B50A 4DV2L 2IX0A 2NUCA 1E0BA 2KCTA 1XJVA 1E1TA 2F1MA 5GROA 3D3RA 2SOBA 2UUAQ 3A8KE 3QR8A 1T5EA 4R4OA 4RGNA 1A62A 1S4ZA 1WOCA 1R4QB 2F4VQ 3DEOA 4X64Q 3SK6A 3HOXH 1V1OA 4DF7A 4FF2A 4DV7L 3H94A 4IJLA 1F9RA 1PH4A 1CQVA 1K28A 2XTIA 2EYLA 1VQJA 1Q12A 4LFAL 1DONA 3DMUA 1MSHA 2LS01 2ZTDA 3K0XA 4XXEA 1U4MA 3VDYA 1ICWA 5CV7A 1X3QA 2BE5C 1JCKB 3GTJB 1EY6A 3K80C 1GD7A 2AQ2B 3A55A 2R93H 1ESRA 1ET9A 5JPNC 3S15B 4C3IG 3TP6A 2BDOA 4GOPC 1ILQA 1EU3A 4DXGA 4C3IB 2CVRA 2E76C 1RDPD 2MO0A 1TR5A 4JW0A 3VYTA 3I2ZA 2IT1A 2EE1A 3H3VC 1LABA 2A74C 4DV3Q 2NVXH 3BVMA 4JI3L 2KBNA 1VF7A 5IODA 1E2WA 5JAVA 4PZ6A 4EVOA 1JR0D 1CFMA 3TP5A 4ZYSA 3M3YB 2LXJA 3M4OB 4K8IA 2NN6H 3D4WA 3SK8A 2H1EA 3LX0A 4FF4A 3GTMB 1DOMA 4KY6A 4QCLA 2MUYA 3T13A 3CCEA 1LT6D 1NMFA 2UXDQ 1SYGA 2NWGA 1F77A 3E6ZX 4WORA 3I4MH 1SE4A 4JI5Q 3K7UC 3E9IA 1WTVA 1S5DD 4XT1B 5DM63 2K5HA 3S16B 4GN3B 1PH5A 2CWAA 4DV0L 1QVGA 1G51A 1PTOC 4BBSH 5IWAL 4DK3C 4AYBE 2RCNA 2GA4B 5J1ZA 1LUZA 2Q2UA 1GUSA 1SLJA 5IGBA 2B2YC 4H44C 5AJ3L 4CJ1B 2EY6A 1H9SB 1SNMA 3SGIA 3D6CA 4RKLA 3BS1A 2CHBD 3QO2A 5M5WH 1E2VA 4F8MA 1K0RA 4BY7G 1C8CA 1BR9A 1BCPF 1QVFA 5IYCH 3SK4A 2B63G 1PMRA 4IFDJ 3ERSX 2YYZA 1YITA 4BY7B 3K59A 4RHSA 2B63B 2ZJRA 3W1GA 5J39A 2KVMA 1NTGA 1CUKA 5FK9C 1HXYD 4MTKA 2F0QA 4LMQD 2OTJA 1LYLA 1VQCA 3T1HL 4OX9Q 1PA6A 4UP9A 4A3KH 1D1KA 2C35B 4UHVA 1M4VA 2EYFA 4JV5Q 2B2VC 1UWVA 2PI2A 2QF7A 4J15A 4NMZA 3AQQA 3PF4A 4V0BA 1PH8A 4B3SQ 3NQTA 2HIXA 2A1AA 1I4PA 1Z6HA 2QDLA 3SVMA 3Q8DA 2ZM6Q 2H5XA 3C1EA 1S5FD 3OHXC 4ZRZA 3S2HH 1B8AA 3W2DA 2DNCA 2RVLA 1EQRA 2NVYB 4YHHQ 1ASYA 5A35A 1UUPA 1VQIA 1IKLA 3PIO3 4Y7NB 1HR0Q 2B2TC 1BBUA 1WTWA 2X69A 2AHOB 2EDGA 4R4TA 4P74A 3G6JB 2G9HD 3FEWX 4QJFA 3D4RA 5J22A 1FYCA 1BQQT 1YNND 3GP7A 2CH4W 1SROA 4K0KL 1NR4A 2NN6I 4GKKL 1X3FA 4LF6L 2D5DA 4LFBL 3DWQA 3H91A 1TWCH 4OIKA 1SE3A 2XRQD 2N49A 3CU7A 4A3JH 2ATWA 3I4OA 2FMCA 2EQSA 3R3OA 3V05A 2BCOA 3I7FA 4JPBW 4KY5A 3K57A 4A93H 1XMOL 1WVLA 3A74A 3S2DB 3GV6A 4IUNA 3PIOA 1BNZA 2RDHA 2RSNA 1RJTA 4N8FA 4OONA 1BBWA 3NK9A 2MQHA 3VR2A 1XNQQ 3J80i 2Q8RE 4ZUJA 5K36H 1EIHA 2HT1A 4DV5Q 2EXZA 5DM73 3RR5A 2WB1G 3ULJA 2B39A 4KJOA 2E2IB 5ISRA 1MJCA 1O7LA 2WB1B 3R93A 1PDQA 3SK5A 3D6WA 2PI2E 3LWUA 1VMCA 2WAQG 2F0EA 5CYUA 1XPRA 3HFZB 2QILA 3U4ZA 4G7HC 1EY0A 5JEAH 3BJUA 2WAQB 4QUCA 3I55A 4X6AH 1HPCA 4Y52H 2Z4IA 2CCZA 4HIMA 3JC66 1SE2A 4LUZA 2CKZB 1HNZL 3IRBA 3K58A 1YNXA 4EQPA 1EYCA 3RN5A 4U68A 4DV1L 2EYPA 3HOXG 4DV6Q 1EYDA 4LF4Q 3G4SA 3HOXB 4X3UA 2B3GA 4AIMA 3KLRA 1H9JA 1W6KA 3MWYW 3MEFA 4H13C 5FKAC 3CCVA 1WTXA 3T1YL 1YZ6A 2K75A 1VQNA 1JORA 1MGSA 1Y8OB 3CC4A 4CDFC 2EZVA 3NBHB 4A3FH 1IL2A 2DGYA 2F0TA 5EPKA 2R93G 1B7YB 2JA8H 5CBEE 3K7AH 2JP1A 3L9AX 1SYFA 4DR7L 2R93B 2M2LA 4O0AA 4JI1L 5C3EH 2QCPX 3PUZA 5IP9H 1YEZA 4YWLA 3DUZA 3J7AV 4RGTA 4F88A 1STYA 4JBJA 1EFWA 1IYUA 2YTXA 1LTAD 1H9KA 4QB4A 4DK6C 2E75C 1KQSA 4JI4L 4QF4A 1PFBA 4FXKC 3EN2A 3NPPA 2QA4A 2NVXB 4GNXB 1M8AA 5C4XH 1JOOA 2ENBA 2NN6G 5E4WC 3RD4A 2Z9HA 4C3HH 3FHWA 3CPWA 4ME3A 1IXRA 4HMJA 3S24A 3PQIA 3HOUH 2KQ3A 5EQ0A 4L5TA 2V4DA 1CKOA 2KCNA 1RKNA 2EYHA 1CZGA 2KCCA 3I4MG 5D3DA 4XTCS 4DUYQ 1O7ZA 3MA2B 1EOVA 3IAYA 3I4MB 4IPGA 2QEXA 3S17H 1GUOA 2OT2A 4DAPA 1B53A 1WTHA 2IPKD 4HSPA 1LV9A 5E1FA 1LTTD 4RCNA 2UXBQ 3BYTB 2DUDA 2E2HH 5HGTA 3JAME 2VY3A 3J7AF 3BG3A 1HZ9A 3OIQA 1I4XA 1EZ6A 4R1JA 1HA6A 4IUTA 3S9WA 2DNEA 2EYOA 1YJWA 1U4PA 2E5LQ 4XQNA 5M5WB 2EOTA 5E3FA 4B9XA 3QIAA 1SYEA 2ES2A 3UDFA 1TU2B 4XQJA 1FD7D 3JAMc 2EY5A 4P73A 2A6EC 3HG9A 3CKIB 1C0AA 2E2DC 4TRDA 2CQOA 1ONLA 4LW1A 1X54A 2F4VL 3M7GA 2F0WA 4X64L 4A3KG 3F2UA 4RGMA 1U5KA 2PMZB 3VA7A 3TRZA 4KHVA 1OXVA 1YNJC 3ICEA 2B2TA 1SNOA 4A3KB 5ELBA 1N32Q 3O13A 1L1OB 3MHBA 2IL8A 4HIOA 2GN5A 1JE4A 1PRTB 1Q1BA 5I2YA 5DLQE 1HJPA 4O1NA 5JOBA 2IX3A 1UEBA 1JOKA 1AE3A 1PZID 2DN8A 1EYAA 3AFPA 1O80A 3S2HB 1VQOA 2PQAB 1N8RC 1WI5A 4HEDA 2D0PA 2SDFA 1G6PA 2AQ1B 1ESFA 4UPAA 1TIID 2WACA 4K8JA 1K73C 3WOEA 1PH9A 4E6IA 4ID6A 3K0YA 2MNAA 1SYBA 1GO3E 1CQFA 4DV3L 4KK7A 1K83H 2A6HD 5IGFA 4GKJL 3FMCA 2PZUA 1TT2A 3HOYH 1ZKOA 1Q8KA 4A3JG 5C0XH 1Q8IA 4A3JB 2WKCA 3OTOL 1BVSA 1DXMA 1FNUA 2RHQB 4N9TA 2YTVA 3E0EA 1JJ2A 4HMIA 4JYAL 4O42A 2WKDA 4OXPA 1QNUA 2DJFC 1D2BA 1NNXA 3NE5B 1XYIA 1FGBD 2N3SA 2A69C 5ELOA 4LFCQ 4K14A 1HQMC 5K36G 5D3IB 1X6OA 2A8VA 1ZYRD 4PV1C 1P16A 5ELEA 1PYBA 1TWFH 2K04A 1AW7A 1STAA 4KY7A 1MHWC 2F0HA 5NUCA 4BA1I 4NW2A 2HDLA 3PIP3 3GO5A 1SN8A 3ZJYC 5IE8A 3JAML 2N55A 2SNMA 4OWXB 1MIUA 4XT3B 5H1SE 5JEAG 4DKAC 1N33L 4ZKCB 1S5ED 4KTAA 3F2CA 3I72A 1ZYRC 2B8GA 2P5ZX 5IY0A 4K5VA 4BS9A 1X3GA 3M4QA 5EPJA 2RQXA 1QOHA 2G5DA 3OOCA 4S3SA 2VUMG 4BA2I 5C5MA 5LHY1 1TY2A 4OX9L 3GD7A 1U4LA 3CF5A 3H3VH 2VUMB 3WOFA 5AFWA 4RCOA 2D2CC 4JV5L 1J6QA 2QW7A 3TSSA 1LT3D 1B3QA 3NXWA 3W3AA 2F0DA 4LF9L 4A3FG 1N9WA 4B3SL 1QNKA 4M1UB 3ER0A 5CV5A 1AN8A 4LK1C 4A3FB 2JA8G 4KHPQ 3ULPA 5DEHA 1G2SA 2JA8B 5C3EG 3K7AB 4KLKA 1IYVA 2ICEC 1MD2D 1X3PA 5FLXE 5IP9G 4EQNA 3I91A 5C3EB 4HCEA 2AWOA 5KYIA 2I0QA 3TP7A 3S1RH 1VQHA 1U0LA 3L0OA 1HR0L 2HIVA 2B2UA 3D0FA 3I3CA 1XX8A 3HOWH 1X55A 4WRDA 2KJXA 5C0XI 4IPHA 5EJWA 3AMUA 3E0JA 5FLXc 5C4XG 1V1QA 4DV4L 2VQFL 4I65A 1N34Q 3TBIB 4C3HG 1STHA 2KA7A 2CW0C 5C4XB 1AZQA 4C3HB 2F0LA 2L12A 4DN4M 2OWOA 2N78A 3HOUG 5CBAE 2AUKA 2R7DA 3HOUB 1I5FA 2I46A 1HR0W 5CR3A 1IBLQ 4A3EH 2KEEA 4X66L 1TWGH 3J81E 1JICA 1VQDA 2KCMA 4A76A 1VQ8A 1V8QA 4LF8Q 2LSSA 1S3OA 1SMYD 1LLRD 4NP5A 5EKLA 1L2FA 3Q6SA 3S17B 1WTRA 5KNDA 3DM1A 1PH3A 3E3XA 4JI2Q 4IZ8A 1VQFA 3I4LA 4DV5L 3SEBA 1EWHA 1PH2A 3LNNA 1Y8PB 1C4QA 2EJMA 1U9RA 2E2HB 4DR4L 3CHBD 4V190 2XN9C 3I4NH 2Z8LA 1V1PB 1DGSA 3J81c 2XWJB 1VQ7A 1K8AC 3KFUA 3AU7A 1IL8A 4B3RL 4PG3A 4RG1A 1PH7A 2K05A 3A8JE 2PPBC 4DR1Q 5KNBA 1HNXQ 1WCMH 5LMNQ 2LMCB 3A0JA 4H0LC 4HJ8A 4JK1C 5G3LD 4PZ8A 4OGQC 3H3VI 1Q7YC 4A3GH 1XMQL 3V2TA 1HTPA 4X62Q 4HN7A 2MO1A 2JYOA 5LL6S 1RTNA 3Q23A 2AQ3B 3K8AA 2LY7A 4DV6L 1Q86C 4LF4L 4A3DH 2ZXRA 3KLSA 1I4QA 1QZGA 5M5YH 2F0SA 4YCWA 3VYUA 1V9PA 5JJLA 3PMFA 1CTMA 3E5SA 4A4IA 4Q5VA 5KNCA 3BDCA 4WFN3 1FJGQ 4KD3A 1VS0A 3KDFB 4DNTB 1VQAA 4MZ9A
chains in the Genus database with same CATH topology
1CHPD 1Y69U 4FXDA 2OF1A 1A3UA 3MFGA 1EQTA 5HURA 4FVMA 4XYQA 5FLXL 2VXWA 3MZ5A 4OO1H 4JBWA 1TQOA 2MP1A 4IALA 4MN3A 3BVGA 1ET6A 4K2KA 1K83B 1BCPB 4HSVA 3QWNA 3A56A 3HOYB 5LL6X 5JVH3 2XNAC 3EJIA 2QDBA 1HHVA 2K33A 2X6GA 1D5XC 5JJZA 1J8IA 4CKCA 1F9QA 3EROA 4RA8A 3J81L 1KLGD 2WIIB 3EQLC 1DOKA 4ZK9B 3KBXA 5TSSA 1TWFB 3P20A 1RHPA 3RMHA 4CGYB 1KLUD 1Q1EA 3DXJC 5ELDA 1H9SA 2NTSA 1I3QB 4L6TB 3TP8A 1B1ZA 2F0JA 1LT4D 1YNNC 1EY4A 1EU4A 1F9SA 2F3WA 3SE0A 2Y0SB 5I6WA 1SBBB 3VR4A 1G291 3R8BA 2TMPA 4PNYA 1PTOF 5D14A 1EY8A 4DK0A 5JEAJ 2KOLA 1PRTD 1K8MA 4OO1I 2F0VA 2RBMA 3KLSX 3SR1A 5I4DA 3K5MA 1STEA 3EVQA 2HUGA 3J7YW 3S1RB 2L9HA 4RHRA 3N6RA 1A2UA 1PXUA 5C4ZA 2F0FA 3ZYYX 3HOWB 3K5LA 2ID0A 4ILWA 1EWCA 1GOZA 1PZJD 3QB3A 2MGSA 4IFDI 3J80E 5I2XA 5FO8B 3SHLA 4CJ2C 4LAAA 1S5BD 4A3EB 4J6HA 1TWGB 1OXXK 3PUWA 3NBIA 4C1NK 2L55A 3VYRA 1LO5D 1CT1D 3C1FA 3TZUA 5BN3A 5IGCA 3OPOA 4G4KA 1AEXA 1I4GA 3I4NB 2F03A 2A68D 1PLFA 4ZUIA 3TMEA 4XIGS 3DHQA 5D65A 2PO4A 2B8FA 1Q3LA 4R8IA 1WCMB 2M9VA 3GV3A 1A3VA 3MEHA 4KD4A 2IX1A 2F0GA 4A3GB 1LT5D 2PW7A 5C5LA 5A2QL 4G7OC 2A68C 4U673 2B2UC 1CM9A 4A3DB 2XSCA 3BDLA 1SNDA 5EBCA 5M5YB 1D1IA 1MBYA 4BBSB 3OSOA 4KN7C 4G7ZC 1A3TA 2JEAI 4CBVA 2SNSA 3PUVA 1V43A 5C6AA 3BVZA 3NBHA 4RAUC 4DGZA 3NWTA 3HGBA 4R9WA 1SNPA 1DZ1A 5CGKA 1Y1VB 3TZDA 1B9MA 4OO1G 1HQRD 5IT9E 1QILA 3NTIA 1DD2A 3FRPB 2OXPA 5I6YA 2B2WA 1SJED 3D4DA 3M85A 4BWGB 2K5DA 1C48A 4EGVA 1OO9B 2F3VA 3I8ZA 4CKEA 1I50B 3J80L 2L4NA 3OW7A 2FJ2A 1LTRD 3NWSA 1ENFA 3Q24A 4ZAIA 3A7LA 5FO7B 4GZYC 5K5PA 5FOBB 5EKIA 2XRSD 3U9SA 3NHHA 3RZOB 3L3OC 2R7ZB 1OXSC 3GQBA 2AUJD 4PMCA 2D62A 1G8ZD 1JC7A 2EVBA 3PV0A 3S1NB 1GHJA 4EQOA 3Q22A 1STGA 2K03A 1TS3A 5EBDA 1TWCB 3K5NA 2RSOA 5IIFA 1Y1WB 2O5JC 2C5CA 1GUNA 3MXNA 3AB9A 1L0YB 2MPMA 4A93B 1BUVT 5F2DA 2K6AA 2A6HC 4KJNA 3T56B 1UNSA 2KEDA 4X3KA 1STBA 5ELCA 2EPBA 2WINB 3N52A 5ELFA 3DWPA 3SXHA 1QE6A 2FINB 4UDUC 1IKMA 1XWEA 2EYMA 5CMDA 3ITPA 3GTQB 1BBXC 4AYBB 4M8AA 5EKKA 3VYSA 5IT9L 3H0GB 2F4IA 4C1NI 1CHQD 1NSNS 2PYKA 4FNFA 3HS0C 5CV9A 1TWHB 1NR2A 2J7ZA 3QG1A 4R8NA 1IHZA 2JA7B 3T16A 2K01A 4RKBA 1BCPD 2K32A 3CQZB 4K5XA 5CC4A 4IUPA 4LJZC 4J1MA 1CA6A 1KABA 1I4HA 4CKBA 1PTOH 4NKLA 3DEPA 1BCPC 1B2TA 2R6GA 3IKJA 4IURA 4K5WA 2RDGA 4F7XA 1LTSD 4IN3A 1FNVA 3OWEB 1VCIA 3S14B 4Q0FA 1GXDC 4N9PA 3UI2A 2BE5D 2L11A 4OIJA 1QCBD 1QJOA 4X3SA 1S5CD 1VMPA 1O78A 1J9OA 3MVVA 1JWSD 1Q90A 5KIXA 2E74C 3BDOA 4DAYA 1CI3M 1UAPA 1H9RA 2DY8A 1SYCA 1KDBA 2ZT9C 1ENAA 4TQUS 4FXGC 3KK7A 1EZ8A 1D5MC 4DFAA 1KDAA 1I6VC 2XIWA 1F2ZA 2C9OA 2MJ8A 3MAQA 1SMYC 4KV6A 3NQIA 4XQQA 3V96A 2SEBD 1SNCA 1WTPA 2VB3X 4MHEA 1D5ZC 3EFXD 5KRUA 2JXMB 1HUNA 3VR3A 2DY7A 2NZ1D 2FHTA 1PTOD 3H6MA 3BZDB 2XVSA 3M7NA 3D8GA 2NB0A 4KMUC 1SEBD 4CHTB 3HOVB 2MHVA 1OXUA 3OMCA 1EL0A 1KDCA 2E2JB 3P7JA 2K1BA 3R2TA 2R92B 1KNEA 1WTOA 2RA4A 1HFGA 1LTGD 2RKSA 1HFNA 1SJHD 5IGDA 2QEJC 2EYJA 4F87A 4XDXA 1TWAB 1SDFA 1PYWD 1ZXTA 2ICIA 2BA0A 2IJ0A 5CV8A 4L63B 5T1IA 1Y8NB 4HAEA 1V1PA 3MXGA 2ZXOA 1LTBD 5C0XG 2BOSA 1B3AA 2LKVA 4IUVA 1A15A 2L5TA 4X3TA 4PMBA 4IFDH 4DAVA 2NVTB 3NSWA 3PO3B 2A5HA 1STNA 2QKIC 1TVXA 4ZLTF 1HRJA 1HA5A 1QB5D 4QIWB 3R2IA 2B2WC 1JWMD 2KUMA 2O5IC 1UEAB 1QG7A 4TSSA 1ZEQX 5KGUA 2NYZD 2RDFA 1PFMA 3K5OA 4J8QA 1SAPA 1NAPA 1II3A 5BN4A 1OXTA 3OIPA 1KNAA 3FDTA 3RZDB 4YIJA 4KKSA 4K2LA 3T53B 1JOQA 1BOSA 3ERQA 3MTSA 2EY1A 5JVG3 2ZXPA 1GUGA 2A73B 2EJFC 5A2QE 1EQVA 4K6DA 1GUWA 3FPUB 1F2LA 3RLFA 2JSOA 4DA2A 1D6EC 1TS2A 4MIUA 2X6LA 5DAUA 4FF1A 1SXTA 1A2TA 2PNRC 4RWSC 4ZKBB 2BA1A 4XYOA 1WTQA 3GTPB 2F0PA 3PUYA 1BXTA 3GTOB 3P75A 3C46A 5G3LF 1EOTA 4QMGA 4PQXA 4IUQA 3CRKC 2J0TD 5KEEA 3L7ZC 4FF3A 1PTOB 1RCVD 3QOLA 2JA6B 3A8IE 3X3NA 1QWYA 4ABNA 5CORA 3URYA 3S1MB 1KTKA 2IW3A 4PMWA 5C4JB 4RFBA 1SSOA 1PRTC 1HUMA 5I9PA 3NTKA 1JQYD 5E4XA 4BY1B 2O4XA 3X3MA 1BO0A 1I4RA 2Q8IB 2F0MA 1NUCA 1O7YA 2I07B 2H4OA 4ME5A 1W6JA 4CJ0B 1WD0A 4KI0A 2K28A 1GJXA 1VDZA 5COYA 5KYLA 1BDOA 1R4PB 2EY2A 1RODA 1CK1A 4ULLA 1TKWB 3NTHA 1A6XA 1LTID 2WV6D 3QJYA 2KECA 1HCZA 4NDXA 2JEBI 4ZQ3A 1PZKD 2FMMA 4DNRB 3MXPA 2NTTA 3FPPA 5T1GA 2M00A 2XWBB 3T4AC 2PW5A 1IW7D 3A7AB 1VF5C 3ONAB 1RD9D 3ND9A 1EY5A 1E2ZA 2YU9B 2B2YA 1PFNA 1RTOA 1MSGA 5EPLA 4A3IB 1HTLD 1AP0A 2CQAA 4IUUA 3KBGA 5DNFA 1IW7C 1T5XD 3BYYB 1TS5A 2F0IA 1EY7A 2AWNA 1EIGA 2A6ED 3S1QB 5IGEA 5M5XB 2K7VA 5C3XA 4UAIA 1G6ZA 1JB3A 1ML0D 3KUPA 2B2VA 3C3LA 3MC0B 3Q0AA 1MI2A 2D9UA 4HTHA 1YNJD 1EEID 1DJRD 1K8OA 2HCCA 3RUZA 2F0OA 1L0XB 4C2MB 3VA5A 5C44B 2F0UA 3ND8A 3D31A 4DK1A 1JWUD 3MXUA 4IFDG 2R3ZA 2HDMA 1U4RA 1PRTF 5C3WA 2OEOA 2Z4HA 1DCZA 4OHJA 3KF8A 3A54A 3M4YA 2KHSA 1R9TB 5M3MB 5CV6A 1Z7TA 5IGGA 1NCVA 5M9OA 4IQZA 1FNWA 1X32A 4Z9CB 3VR5A 3GTGB 4TKOB 3I70A 3T51B 5C0XJ 3HP3A 2K5QA 3OWFA 1H9MA 4A3BB 5FO9B 2PZTA 1SYDA 1GHKA 5JPMC 1FR3A 4OL7A 3NUCA 1B9NA 4HR7B 4P2CB 3IFTA 2PZWA 3HRZC 4HCSA 2NVQB 2L0CA 4ODGA 3QOJA 1GUTA 1G2TA 3HZXA 3K6OA 2BDNA 1EFID 3LWEA 2Q8TA 3VR6A 5I9OA 1AFPA 1XTCD 2A69D 5EGTA 2WP8J 1SNQA 2K5WA 5IOCA 1RF2D 1B44D 5C4HA 3G7LA 4WJWA 4C56C 1F2MA 3CRLC 4KHZA 1F2YA 1F9PA 2NBFA 1CA5A 3EA6A 2F0KA 4A3MB 3GTLB 2F0NA 2EJGC 2FFKB 1TS4A 2O2LD 1B4OA 3PUXA 4DXFA 2LFNA 3FKIB 1WD1A 3I73A 1CZWA 5BN5A 4B9WA 3IFDA 1XXGA 3U9OA 4FYDA 1DM0B 3NP8A 3SDZA 2IWHA 3MFYA 1AZPA 4C3JG 3WDNA 4QUFA 1LACA 3C2PA 2J4XA 3H09A 4C3JB 5M3FB 2TSSA 4KKTA 2Z1CA 3TDQA 1DYQA 2G9DA 2R61A 3FVQA 2PCFB 4I7ZC 4RGOS 2JA5B 2N88A 4L8JA 3HOZB 3OMGA 3HKZB 3I90A 3P1HA 1I6HB 1Z47A 4DU9A 2L1BA 5CV4A 4FO2A 4B08A 3TN2A 4BBRB 1ENCA 2VNUD 1KAAA 3DWAA 3PO2B 2JE6I 1SFOB 4KN4C 2HCIA 3IL8A 4RH6A 1TY0A 3GTKB 4H7BA 4KKUA 1ILPA 2HQEA 1EY9A 1BF4A 4G57A 1DOLA 2PQEA 4K6LA 2CW0D 1G91A 4FP5D 1EEFD 2VB2X 3HEJA 1B50A 2IX0A 2NUCA 1E0BA 2F1MA 3D3RA 2SOBA 3A8KE 1T5EA 4RGNA 1S4ZA 1R4QB 3DEOA 3SK6A 1V1OA 4DF7A 4FF2A 3H94A 1F9RA 1CQVA 1DONA 2EYLA 1Q12A 3DMUA 1MSHA 2LS01 4XXEA 1U4MA 1ICWA 5CV7A 1X3QA 2BE5C 1JCKB 3GTJB 1EY6A 2AQ2B 3A55A 1ESRA 1ET9A 5JPNC 3S15B 4C3IG 3TP6A 2BDOA 1ILQA 1EU3A 4DXGA 4C3IB 2CVRA 2E76C 1RDPD 1TR5A 3VYTA 2IT1A 2EE1A 3H3VC 1LABA 2A74C 3BVMA 1VF7A 5IODA 1E2WA 5JAVA 4EVOA 1JR0D 1CFMA 3TP5A 4ZYSA 3M3YB 3M4OB 4K8IA 2NN6H 3D4WA 3SK8A 2H1EA 3LX0A 4FF4A 3GTMB 1DOMA 4KY6A 4QCLA 2MUYA 3T13A 1LT6D 1SYGA 2NWGA 1F77A 3E6ZX 4WORA 1SE4A 1WTVA 1S5DD 4XT1B 5DM63 3S16B 1PTOC 2GA4B 5J1ZA 1GUSA 5IGBA 2B2YC 4H44C 4CJ1B 2EY6A 1H9SB 1SNMA 3D6CA 4RKLA 3BS1A 2CHBD 3QO2A 1E2VA 4F8MA 1C8CA 1BR9A 1BCPF 3SK4A 1PMRA 4IFDJ 2YYZA 4BY7B 3K59A 4RHSA 2B63B 5J39A 2KVMA 5FK9C 1HXYD 2F0QA 4LMQD 1D1KA 1M4VA 2EYFA 2B2VC 2QF7A 4NMZA 4V0BA 3NQTA 1I4PA 1Z6HA 3SVMA 3C1EA 1S5FD 3OHXC 4ZRZA 3W2DA 2DNCA 2RVLA 2NVYB 5A35A 1UUPA 1IKLA 3PIO3 4Y7NB 2B2TC 1WTWA 2X69A 2EDGA 3G6JB 2G9HD 3FEWX 3D4RA 5J22A 1FYCA 1BQQT 1YNND 3GP7A 1NR4A 2NN6I 2D5DA 3DWQA 3H91A 4OIKA 1SE3A 2XRQD 3CU7A 2FMCA 3R3OA 3V05A 2BCOA 4KY5A 3K57A 1WVLA 3S2DB 3GV6A 4IUNA 1BNZA 2RDHA 2RSNA 1RJTA 3NK9A 3VR2A 2Q8RE 4ZUJA 5K36H 1EIHA 2EXZA 5DM73 2B39A 4KJOA 2E2IB 5ISRA 1O7LA 2WB1B 3R93A 1PDQA 3SK5A 3D6WA 3LWUA 1VMCA 5CYUA 2F0EA 2QILA 4G7HC 1EY0A 5JEAH 2WAQB 4QUCA 1HPCA 2Z4IA 1SE2A 3K58A 4EQPA 1EYCA 4U68A 2EYPA 1EYDA 3HOXB 4X3UA 3KLRA 1H9JA 1W6KA 3MWYW 4H13C 5FKAC 1WTXA 1JORA 1MGSA 1Y8OB 2EZVA 2F0TA 5EPKA 5CBEE 2JP1A 3L9AX 1SYFA 2R93B 2M2LA 2QCPX 3PUZA 3J7AV 3DUZA 4RGTA 4F88A 1STYA 1IYUA 1LTAD 1H9KA 4QB4A 2E75C 4QF4A 1PFBA 4FXKC 3NPPA 2NVXB 1M8AA 1JOOA 2ENBA 2NN6G 5E4WC 3RD4A 4HMJA 2KQ3A 5EQ0A 2V4DA 2KCNA 1RKNA 2EYHA 1CZGA 2KCCA 5D3DA 4XTCS 1O7ZA 3MA2B 3IAYA 3I4MB 1GUOA 2OT2A 4DAPA 1B53A 2IPKD 4HSPA 1LV9A 5E1FA 1LTTD 4RCNA 3BYTB 5HGTA 3JAME 3J7AF 3BG3A 3OIQA 1I4XA 1EZ6A 1HA6A 4IUTA 3S9WA 2DNEA 2EYOA 1U4PA 4XQNA 5M5WB 2EOTA 5E3FA 4B9XA 3QIAA 1SYEA 1TU2B 4XQJA 1FD7D 2EY5A 2A6EC 3HG9A 3CKIB 2E2DC 4TRDA 1ONLA 3M7GA 2F0WA 3F2UA 4RGMA 3VA7A 2PMZB 4KHVA 1OXVA 1YNJC 2B2TA 1SNOA 4A3KB 5ELBA 3O13A 3MHBA 2IL8A 1JE4A 1PRTB 1Q1BA 5I2YA 4O1NA 5JOBA 2IX3A 1JOKA 1PZID 2DN8A 1EYAA 1O80A 3S2HB 4HEDA 2SDFA 2AQ1B 1ESFA 1TIID 2WACA 4K8JA 3WOEA 4E6IA 4ID6A 3K0YA 1SYBA 1CQFA 4KK7A 2A6HD 5IGFA 3FMCA 2PZUA 1TT2A 1ZKOA 5C0XH 1Q8IA 4A3JB 2WKCA 1DXMA 1FNUA 4N9TA 4HMIA 4O42A 2WKDA 1QNUA 1D2BA 3NE5B 1XYIA 1FGBD 2A69C 4K14A 1HQMC 5K36G 5D3IB 1ZYRD 4PV1C 5ELEA 2K04A 1AW7A 1STAA 4KY7A 2F0HA 5NUCA 4BA1I 4NW2A 2HDLA 3PIP3 3GO5A 3JAML 2N55A 2SNMA 4XT3B 5JEAG 4ZKCB 1S5ED 4KTAA 3I72A 1ZYRC 2B8GA 4K5VA 4BS9A 5EPJA 2RQXA 1QOHA 3OOCA 4S3SA 4BA2I 5C5MA 5LHY1 1TY2A 3GD7A 1U4LA 2VUMB 3WOFA 5AFWA 4RCOA 2D2CC 3TSSA 1LT3D 3NXWA 3W3AA 2F0DA 1QNKA 4M1UB 5CV5A 1AN8A 4LK1C 4A3FB 5DEHA 1G2SA 2JA8B 3K7AB 1IYVA 2ICEC 1MD2D 1X3PA 5FLXE 4EQNA 3I91A 5C3EB 4HCEA 2AWOA 5KYIA 3TP7A 2B2UA 3I3CA 1XX8A 4WRDA 2KJXA 5C0XI 5EJWA 3AMUA 3E0JA 4I65A 3TBIB 4C3HG 1STHA 2KA7A 2CW0C 5C4XB 1AZQA 4C3HB 2F0LA 2L12A 4DN4M 5CBAE 2AUKA 3HOUB 2I46A 5CR3A 2KEEA 3J81E 1JICA 1V8QA 1SMYD 1LLRD 4NP5A 5EKLA 3Q6SA 3S17B 1WTRA 5KNDA 3DM1A 4IZ8A 3I4LA 3SEBA 1EWHA 3LNNA 1Y8PB 1C4QA 2EJMA 1U9RA 2E2HB 3CHBD 4V190 2XN9C 2Z8LA 1V1PB 2XWJB 3AU7A 1IL8A 2K05A 3A8JE 2PPBC 5KNBA 2LMCB 4H0LC 4JK1C 5G3LD 4OGQC 3V2TA 1HTPA 4HN7A 2JYOA 5LL6S 1RTNA 3Q23A 2AQ3B 2LY7A 2ZXRA 3KLSA 1I4QA 2F0SA 3VYUA 3PMFA 1CTMA 3E5SA 4Q5VA 5KNCA 3BDCA 4WFN3 4KD3A 4DNTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QIL A;  1BCP D;  1CHP D;  1D5Z C;  1EU4 A;  1JWU D;  1LTT D;  1FNU A;  2AQ2 B;  3EFX D;  1G8Z D;  3BYT B;  1ET9 A;  1M4V A;  3MFG A;  1PRT F;  1CK1 A;  2J4X A;  1PTO D;  1SBB B;  1SE2 A;  1EU3 A;  1I4X A;  4DXG A;  3BZD B;  1LT5 D;  4OHJ A;  2TSS A;  1SEB D;  1FGB D;  1DYQ A;  1LTI D;  2WV6 D;  3R8B A;  1I4H A;  2R61 A;  1RDP D;  1PTO F;  5D3I B;  1TS3 A;  1I4P A;  4RGO S;  3BVG A;  1PTO H;  5ELE A;  1PZK D;  1ET6 A;  1PRT D;  1AW7 A;  1S5F D;  2NTT A;  3KLS X;  1BCP C;  1D6E C;  3BVM A;  5I4D A;  3W2D A;  1BCP B;  1STE A;  5FKA C;  1FD7 D;  1TS2 A;  3R2T A;  1L0Y B;  2RDG A;  1FNW A;  1JR0 D;  1SXT A;  4Z9C B;  1LTG D;  1UUP A;  1LTS D;  4RHR A;  4ZYS A;  1LLR D;  2XNA C;  1FNV A;  3BVZ A;  3OWE B;  1SJH D;  2QEJ C;  4RGM A;  1S5E D;  1UNS A;  2G9H D;  3SEB A;  3DWA A;  1D5X C;  1PYW D;  2ICI A;  1RD9 D;  1EWC A;  5ELB A;  1BXT A;  1GOZ A;  3O13 A;  5ELC A;  3CHB D;  1LT6 D;  3GP7 A;  2XN9 C;  1PZJ D;  1V1P B;  2IJ0 A;  2Z8L A;  4L63 B;  1TY0 A;  4RH6 A;  1S5C D;  1F77 A;  1HQR D;  4RGT A;  1KLG D;  1PRT B;  1QIL A;  1V1P A;  1SE4 A;  3DWQ A;  5ELF A;  1LTB D;  3DWP A;  1JWS D;  1S5D D;  1SE3 A;  4O1N A;  1LTA D;  2XRQ D;  1HTL D;  1TY2 A;  4UDU C;  1EFI D;  4K6L A;  3V05 A;  1PTO C;  1EEF D;  1PTO B;  1RCV D;  1SJE D;  1XTC D;  1PZI D;  4RCO A;  5TSS A;  1S5B D;  4BWG B;  1T5X D;  3TSS A;  1LT3 D;  3BYY B;  1RF2 D;  1TS5 A;  1B44 D;  4C56 C;  3URY A;  1KTK A;  1KLU D;  1D5M C;  1HA5 A;  2AQ1 B;  2RDH A;  1ESF A;  4RFB A;  1AN8 A;  5ELD A;  1PRT C;  2AQ3 B;  3EA6 A;  1LO5 D;  3R2I A;  4RGN A;  2CHB D;  1LTR D;  1JQY D;  1JWM D;  1ENF A;  2NTS A;  1I4Q A;  1BCP F;  1CT1 D;  1V1O A;  1CHQ D;  1TS4 A;  1MD2 D;  2O2L D;  3MC0 B;  4DXF A;  1I4R A;  4L6T B;  4RHS A;  1CQV A;  1I4G A;  2XRS D;  5D3D A;  4TSS A;  1EEI D;  1DJR D;  5FK9 C;  1B1Z A;  2SEB D;  1HXY D;  1L0X B;  1XXG A;  1JCK B;  1LT4 D;  2IPK D; 
#chains in the Genus database with same CATH topology
 1CHP D;  2VQE Q;  4EX5 A;  5ELN A;  5GAH C;  1Y69 U;  4FXD A;  1NBW A;  2OF1 A;  1A3U A;  3MFG A;  1Y1V H;  1EQT A;  5HUR A;  1UE5 A;  4FVM A;  1UE7 A;  4XYQ A;  5FLX L;  2VXW A;  4NXN Q;  3MZ5 A;  5HY6 A;  3S1Q H;  2KEN A;  4OO1 H;  4JBW A;  1TQO A;  2MP1 A;  3HKZ E;  4IAL A;  2Z6B A;  4DUZ L;  3HKS A;  2Q2T A;  4MN3 A;  1JJG A;  3BVG A;  1ET6 A;  4K2K A;  2ASB A;  4B3M Q;  1K83 B;  3HOY G;  2EIF A;  1BCP B;  2MFI A;  4HSV A;  3QWN A;  3A56 A;  3HOY B;  5LL6 X;  4POG A;  4FDB A;  4H02 A;  5JVH 3;  1I50 H;  2OQK A;  2VS1 A;  2XNA C;  2ZTE A;  3EJI A;  2QDB A;  1VQK A;  1J5E Q;  1HHV A;  2K33 A;  4R4I A;  2X6G A;  3EIV A;  1D5X C;  5JJZ A;  1GVP A;  1J8I A;  3F2B A;  4CKC A;  3RLN A;  4JVZ A;  1F9Q A;  3ERO A;  4RA8 A;  3RZO H;  3J81 L;  1KLG D;  2R7Z H;  2WII B;  2K52 A;  3EQL C;  1N36 Q;  3M4P A;  5BR8 L;  1DOK A;  4CDD C;  4ZK9 B;  2UXB L;  4DR5 Q;  3KBX A;  5TSS A;  1TWF B;  3P20 A;  4GNX C;  3S1N H;  1EQQ A;  1EUJ A;  1RHP A;  3RMH A;  5JJK A;  3M9B A;  4CGY B;  1KLU D;  1Q1E A;  3TEH B;  3DXJ C;  5ELD A;  4IOA A;  1H9S A;  3H15 A;  4DR3 Q;  3CCR A;  2NTS A;  1Y1W H;  1LM0 A;  1I3Q B;  4GOP B;  4L6T B;  3EBE A;  1JJC B;  4NXM Q;  3TP8 A;  1I94 L;  4JG2 A;  4YY3 Q;  1B1Z A;  3B6Y A;  2VL6 A;  2F0J A;  3CXC A;  4LF5 L;  1LT4 D;  1YNN C;  1O7I A;  1EY4 A;  1EU4 A;  4DV7 Q;  2Y0S G;  1F9S A;  4LFA Q;  2HQL A;  2F3W A;  3SE0 A;  2Y0S B;  3U4V A;  5I6W A;  1SBB B;  3VR4 A;  4AQY Q;  1PHJ A;  1G29 1;  3U50 C;  3R8B A;  1A0I A;  2TMP A;  4GS3 A;  4PNY A;  4HJA A;  1IYJ B;  1PTO F;  5D14 A;  1SMX A;  1EY8 A;  2I5H A;  4DK0 A;  3G71 A;  1IBM L;  5JEA J;  5GAE C;  2KOL A;  1PRT D;  1K8M A;  4OO1 I;  2F0V A;  2RBM A;  3KLS X;  3SR1 A;  1YI2 A;  5I4D A;  3GTQ H;  3K5M A;  1STE A;  3EVQ A;  2HUG A;  4LUV A;  3J7Y W;  3S1R B;  2VZA A;  2E8G A;  2L9H A;  4RHR A;  1YHA A;  3HOW G;  3H0G H;  1X9N A;  4A3L H;  3N6R A;  1A2U A;  1PXU A;  2F0F A;  3ZYY X;  5C4Z A;  3HOW B;  4HIK A;  3K5L A;  4JI3 Q;  2ID0 A;  4ILW A;  1EWC A;  1NMG A;  1RIP A;  1GOZ A;  1QUQ B;  4APV A;  2UXC Q;  1PZJ D;  1TWH H;  2JN4 A;  1EYG A;  3CCU A;  3QB3 A;  2MGS A;  4IFD I;  3J80 E;  1OTC A;  5I2X A;  5FO8 B;  3SHL A;  1QZH A;  1PV4 A;  3HOZ H;  2JA7 H;  4CJ2 C;  1IBK L;  4LAA A;  1K3B C;  3CQZ H;  4A3E G;  4DR2 Q;  1S5B D;  4JOI A;  4A3E B;  4GLV B;  4J6H A;  1TWG B;  2IHF A;  1OXX K;  3PUW A;  1E1O A;  3NBI A;  4C1N K;  3J80 c;  2L55 A;  3VYR A;  1LO5 D;  2ALY B;  1C7Y A;  1CT1 D;  3C1F A;  3TZU A;  5BN3 A;  5HGQ A;  5IGC A;  3I4N G;  3OPO A;  5IP7 H;  4G4K A;  2Q2I A;  5AJ3 Q;  1AEX A;  1I4G A;  3I4N B;  2F03 A;  4JI8 L;  2A68 D;  1H95 A;  1PLF A;  4ZUI A;  3TME A;  4QL5 A;  4QIW E;  4XIG S;  3DHQ A;  5D65 A;  1WCM G;  2PO4 A;  2B8F A;  1Q3L A;  1VQ5 A;  4R8I A;  3S14 H;  1WCM B;  4JI6 L;  1K3R A;  2M9V A;  2Q2H A;  3GV3 A;  1A3V A;  4A3G G;  3MEH A;  4KD4 A;  2IX1 A;  2F0G A;  1Y14 B;  1TXY A;  4LWC A;  3CCM A;  2GVB A;  3KF8 B;  4A3G B;  1WYD A;  1LT5 D;  4A3D G;  2PW7 A;  5C5L A;  5A2Q L;  4G7O C;  2A68 C;  4U67 3;  2B2U C;  1CM9 A;  4A3D B;  2XSC A;  3BDL A;  4BBS G;  1QUQ A;  1SND A;  5EBC A;  2ZJP A;  2HHH L;  5M5Y B;  1D1I A;  1MBY A;  4P72 A;  4BBS B;  3OSO A;  1YIJ A;  4KN7 C;  4G7Z C;  1A3T A;  2JEA I;  4CBV A;  2SNS A;  3PUV A;  1V43 A;  4KHP L;  5C6A A;  3ULL A;  3BVZ A;  1PYS B;  3NBH A;  4MTN A;  4RAU C;  4HID A;  4DGZ A;  3NWT A;  3HGB A;  1Y1V G;  2I5M X;  4R9W A;  1UE1 A;  2Z6K A;  1SNP A;  5IYC G;  1DZ1 A;  5CGK A;  1Y1V B;  1D7Q A;  2AKW B;  1GKH A;  1B9M A;  3TZD A;  4X65 L;  4OO1 G;  3NEM A;  1QVC A;  1HQR D;  5IT9 E;  1QIL A;  3NTI A;  3MXN B;  1DD2 A;  3FRP B;  4I7A A;  2OXP A;  5I6Y A;  2B2W A;  2UUA L;  2WFW A;  1SJE D;  3D4D A;  3M85 A;  4BWG B;  4GKK Q;  4LF6 Q;  2K5D A;  1C48 A;  4EGV A;  4LFB Q;  1N34 L;  1OO9 B;  2F3V A;  3I8Z A;  4GNX A;  4QY7 A;  4CKE A;  4YWM A;  5IT9 c;  1I50 B;  3HOV H;  1KAW A;  3J80 L;  2L4N A;  1KD1 C;  3OW7 A;  2FJ2 A;  1LTR D;  3NWS A;  1ENF A;  3Q24 A;  4ZAI A;  3A7L A;  4JC0 A;  5FO7 B;  1XMO Q;  4GZY C;  5K5P A;  2WB1 E;  3BZK A;  5FOB B;  2R7Z G;  5EKI A;  2XRS D;  3U9S A;  3NHH A;  2E2J H;  3RZO B;  2R92 H;  3STB D;  3L3O C;  4LF8 L;  2R7Z B;  4GLX A;  1OXS C;  3GQB A;  4JI2 L;  2AUJ D;  4PMC A;  1TWA H;  2D62 A;  1G8Z D;  1JC7 A;  2EVB A;  3PV0 A;  3S1N B;  5EAY A;  1XNR Q;  1GHJ A;  4EQO A;  1VQ9 A;  1KIX A;  5GAD C;  2F52 A;  3Q22 A;  1STG A;  2K03 A;  4DR1 L;  1Y1W G;  1TS3 A;  5LMN L;  5EBD A;  4DPG A;  1TWC B;  3K5N A;  2UUC Q;  3TS0 A;  2RSO A;  5IIF A;  1Y1W B;  2O5J C;  2NVT H;  2C5C A;  1GUN A;  4NPS A;  4A93 G;  3MXN A;  3AB9 A;  3PO3 H;  1L0Y B;  4DNI A;  2MPM A;  4A93 B;  1BUV T;  2UXD L;  5F2D A;  2K50 A;  2K6A A;  2A6H C;  4KJN A;  3T56 B;  4JI5 L;  4GN5 A;  2YTY A;  2UU9 Q;  1UNS A;  3KOJ A;  1HZB A;  2KED A;  1B70 B;  4HJ9 A;  4X3K A;  1STB A;  5ELC A;  2EPB A;  5LMN W;  2RCF A;  3TQY A;  1L1O A;  2WIN B;  5FJ8 H;  3N52 A;  1FJG L;  5ELF A;  1YVC A;  3DWP A;  3SXH A;  4AH6 A;  1QE6 A;  3CMA A;  3KF6 B;  2FIN B;  2JA9 A;  4UDU C;  2VQE L;  5JJI A;  1IKM A;  2V1C C;  3L2P A;  1XWE A;  2EYM A;  5CMD A;  3RZD H;  1NY4 A;  4AYB G;  3ITP A;  1VQ4 A;  4NXN L;  3GTQ B;  1BBX C;  3AFQ A;  4AYB B;  4M8A A;  2PQA A;  3UDX A;  3H0G G;  5EKK A;  4A3L G;  4LUO A;  5IT9 L;  3VYS A;  4JI4 Q;  3H0G B;  3AEV A;  2F4I A;  3OW2 A;  1BKB A;  4C1N I;  4DAY B;  1CHQ D;  1NSN S;  2PYK A;  4FNF A;  1ASZ A;  4IO9 A;  3HS0 C;  5CV9 A;  1TWH B;  4PZ7 A;  1NR2 A;  2J7Z A;  3QG1 A;  4TVA B;  1KRS A;  4R8N A;  2JA7 G;  1VQG A;  1IHZ A;  4JBM A;  4CDC C;  3PF5 A;  1J5E L;  3T16 A;  3GTP H;  2K01 A;  4RKB A;  2JA7 B;  2A19 A;  1BCP D;  2K32 A;  3A5U A;  3CQZ B;  4K5X A;  5CC4 A;  3GTO H;  4JI7 Q;  4IUP A;  2ZM6 L;  4LJZ C;  4J1M A;  1CA6 A;  1YJ9 A;  1KAB A;  4HJ7 A;  4YHH L;  1I4H A;  1PVO A;  2IY5 B;  4ZCK A;  4WJ3 M;  4DR5 L;  4CKB A;  5IP7 G;  1PTO H;  4NKL A;  5FLM H;  2JA6 H;  3DEP A;  1YJN A;  1BCP C;  1B2T A;  3J81 i;  5LMU Q;  3S1M H;  4JI0 Q;  2R6G A;  3IKJ A;  4IUR A;  3CME A;  4K5W A;  2RDG A;  4F7X A;  5C4J H;  1LTS D;  3KF6 A;  4IN3 A;  4R4C A;  1FNV A;  3OWE B;  4JBK A;  4CDE C;  4BY1 H;  1VCI A;  3S14 B;  4Q0F A;  1GXD C;  2F3I A;  4N9P A;  3UI2 A;  3J81 j;  2BE5 D;  2L11 A;  4NXM L;  4OIJ A;  1QCB D;  1QJO A;  4X3S A;  1S5C D;  1VMP A;  1O78 A;  1J9O A;  2K4K A;  3MVV A;  4YY3 L;  1JWS D;  1Q90 A;  5KIX A;  1YHB A;  2E74 C;  3BDO A;  3GDE A;  4DAY A;  1CI3 M;  1UAP A;  1H9R A;  4LF7 Q;  2DY8 A;  1SYC A;  1KDB A;  1MKH A;  2K5V A;  2ZT9 C;  1ENA A;  1XNQ L;  5J3B A;  4TQU S;  4FXG C;  4AQY L;  3KK7 A;  4L5R C;  1EZ8 A;  3UE0 A;  1D5M C;  2BH8 A;  4DFA A;  1YBY A;  1SRU A;  1KDA A;  1I6V C;  2XIW A;  1F2Z A;  2C9O A;  2MJ8 A;  1PFS A;  3MAQ A;  1SMY C;  4JOI C;  2LXK A;  4KV6 A;  1UE6 A;  3CCL A;  3NQI A;  4XQQ A;  3V96 A;  2SEB D;  1SNC A;  1WTP A;  1W2B A;  4HJ5 A;  2VB3 X;  1HNW Q;  4MHE A;  1D5Z C;  1E24 A;  3EFX D;  5GAG C;  5KRU A;  4GKJ Q;  2JXM B;  1HUN A;  3VR3 A;  2DY7 A;  3FP9 A;  2UXC L;  2NZ1 D;  2YU9 H;  2FHT A;  3CPF A;  4UP8 A;  1PTO D;  3H6M A;  3PSI A;  3HOV G;  3BZD B;  2XVS A;  3M7N A;  3D8G A;  4A3I H;  3OTO Q;  2NB0 A;  4KMU C;  1SEB D;  4CHT B;  3HOV B;  4QQB X;  3NEL A;  4DR2 L;  2B29 A;  2MHV A;  1OXU A;  3OMC A;  4R4Q A;  4JYA Q;  1EL0 A;  2R92 G;  1KDC A;  3CW2 C;  1CKN B;  2E2J B;  3NEN A;  3P7J A;  2K1B A;  4GLA C;  3R2T A;  3RLO A;  2R92 B;  1KNE A;  1WTO A;  2RA4 A;  1HFG A;  1LTG D;  3E9H A;  2RKS A;  1HFN A;  4B3T Q;  1SJH D;  5IGD A;  5M5X H;  2QEJ C;  2EYJ A;  4F87 A;  4LNQ A;  3J7Z C;  4XDX A;  1TWA B;  1SDF A;  1XTD A;  1PYW D;  1ZXT A;  3CAM A;  2ICI A;  1K8G A;  2BA0 A;  2CFM A;  2OQ0 A;  2IJ0 A;  5CV8 A;  4L63 B;  1VQL A;  5T1I A;  4DAM A;  1Y8N B;  4DR6 Q;  4HAE A;  1V1P A;  4A3C H;  2RF4 A;  3MXG A;  2ZXO A;  1LTB D;  4C2M H;  5C0X G;  4YWK A;  5C44 H;  3UE1 A;  1N33 Q;  2BOS A;  1B3A A;  3KLW A;  2LKV A;  4IUV A;  1A15 A;  2ZTC A;  2L5T A;  2Z6K C;  4X3T A;  4PMB A;  4IFD H;  4POF A;  4DAV A;  3PO3 G;  2NVT B;  3NSW A;  3PO3 B;  2A5H A;  1STN A;  2QKI C;  1TVX A;  4OEL B;  4ZLT F;  4DUY L;  1A63 A;  1HRJ A;  1HA5 A;  2XGT A;  4OEM B;  5IYD H;  1QB5 D;  4QIW B;  3R2I A;  2B2W C;  1R9T H;  4YCU A;  5M3M H;  1JWM D;  2KUM A;  2KHI A;  1VQP A;  2O5I C;  1SR3 A;  3OYY A;  5FJ8 G;  4LF9 Q;  1UEA B;  3U58 A;  1QG7 A;  4TSS A;  1M90 C;  1ZEQ X;  1FGU A;  5KGU A;  2NYZ D;  2UUB Q;  3GTG H;  2K5N A;  3KYH C;  2RDF A;  4BXX H;  5E7N A;  1PFM A;  4A3B H;  3K5O A;  4J8Q A;  1SAP A;  1NAP A;  1II3 A;  2N8N A;  3KDF A;  5BN4 A;  4EQ5 A;  2E5L L;  1E22 A;  1OXT A;  3OIP A;  1KNA A;  3FDT A;  1CKN A;  3RZD B;  4DV2 Q;  3G6E A;  2NVQ H;  4O2D A;  4YIJ A;  4KKS A;  4K2L A;  1JMC A;  3T53 B;  1JOQ A;  1BOS A;  3ERQ A;  1K9M C;  3MTS A;  2EY1 A;  3RNU A;  5JVG 3;  4A75 A;  2ZXP A;  1GUG A;  2A73 B;  2EJF C;  1ICF B;  5A2Q E;  1EQV A;  4K6D A;  1GUW A;  3FPU B;  1F2L A;  3RLF A;  4DV4 Q;  2VQF Q;  3CP0 A;  2JSO A;  4DA2 A;  4L5Q A;  3UDG A;  1D6E C;  1XPU A;  1TS2 A;  4MIU A;  2X6L A;  5DAU A;  1N32 L;  3CD6 A;  4IPD A;  4FF1 A;  1Q46 A;  1SXT A;  1A2T A;  2PNR C;  4WJ4 A;  2L15 A;  1CSP A;  4RMF A;  1NJI C;  4RWS C;  4ZKB B;  4A3M H;  3CCS A;  2BA1 A;  4XYO A;  1WTQ A;  3GTL H;  3GTP B;  2F0P A;  4X66 Q;  1C9O A;  3PUY A;  1BXT A;  3GTO B;  3P75 A;  3C46 A;  4UY8 C;  3FKI H;  5G3L F;  1EOT A;  1WFQ A;  3G48 A;  4QMG A;  4PQX A;  3DM3 A;  3CC7 A;  4IUQ A;  3CRK C;  2J0T D;  5KEE A;  3L7Z C;  5FLM G;  2OCE A;  4FF3 A;  2JA6 G;  4DR4 Q;  1PTO B;  1RCV D;  3QOL A;  1HZA A;  2JA6 B;  3A8I E;  3X3N A;  1XNR L;  1QWY A;  4C3J H;  4B3R Q;  5M3F H;  4ABN A;  1KC8 C;  5COR A;  3URY A;  1WJJ A;  1EIF A;  1KTK A;  1L1O C;  2IW3 A;  3S1M B;  4PMW A;  5C4J B;  4RFB A;  4BY1 G;  1SSO A;  1PRT C;  1HUM A;  2BH2 A;  3W5O A;  1VQ6 A;  5I9P A;  3NTK A;  1JQY D;  5E4X A;  1FVI A;  2UUC L;  4BY1 B;  2JA5 H;  1K0S A;  2O4X A;  3X3M A;  5IYB H;  1BO0 A;  4L5S A;  3CCJ A;  1XMQ Q;  1I4R A;  3TS2 A;  2Q8I B;  3F2D A;  2F0M A;  1NUC A;  1I6H H;  4GOP A;  1O7Y A;  2I07 B;  2FXQ A;  4P75 A;  1PH6 A;  1PH1 A;  1X65 A;  2VUM H;  2H4O A;  2NZH A;  2OTL A;  4ME5 A;  1W6J A;  4CJ0 B;  1WD0 A;  4KI0 A;  2K28 A;  1GJX A;  2JJQ A;  4BBR H;  1SE8 A;  1VDZ A;  5COY A;  2UU9 L;  5KYL A;  1BDO A;  4LFC L;  3PO2 H;  4DV0 Q;  1R4P B;  1SFO H;  1JT8 A;  4MNO A;  2AMC B;  5IWA Q;  2EY2 A;  1ROD A;  1CK1 A;  3GTK H;  4ULL A;  1TKW B;  3NTH A;  1A6X A;  1LTI D;  2WV6 D;  3QJY A;  2KEC A;  1HCZ A;  1IZ6 A;  4NDX A;  2JEB I;  3F8T A;  4ZQ3 A;  1PZK D;  3CCQ A;  2FMM A;  4DNR B;  3MXP A;  1T9H A;  2NTT A;  3K81 C;  4IPC A;  3FPP A;  4DUZ Q;  5T1G A;  3JAM i;  2M00 A;  2XWB B;  3T4A C;  1HZC A;  2PW5 A;  1IW7 D;  3T1H Q;  3A7A B;  2IHE A;  1VF5 C;  3ONA B;  1Q82 C;  1LTL A;  1RD9 D;  3ND9 A;  1EY5 A;  2EXD A;  1KXL A;  1E2Z A;  2YU9 B;  2B2Y A;  1PFN A;  4A3I G;  1RTO A;  3KJP A;  1MSG A;  5EPL A;  4A3I B;  2D0O A;  1HTL D;  3GTJ H;  1JB7 A;  1YHQ A;  1AP0 A;  2CQA A;  4IUU A;  3KBG A;  5DNF A;  4JI7 L;  1IW7 C;  2JK8 A;  3S15 H;  1T5X D;  3BYY B;  1TS5 A;  1KRT A;  2F0I A;  5BR8 Q;  1EY7 A;  4C3I H;  2AWN A;  1EIG A;  4GN4 B;  2A6E D;  3S1Q B;  5IGE A;  5M5X B;  2K7V A;  3I56 A;  5C3X A;  4UAI A;  1G6Z A;  1JB3 A;  2DJG C;  4UP7 A;  1ML0 D;  3KUP A;  2B2V A;  5GQO A;  3MC0 B;  3C3L A;  3Q0A A;  1MI2 A;  5LMU L;  4A3C G;  2D9U A;  1VQB A;  4JI0 L;  4HTH A;  1KHI A;  1YNJ D;  1EEI D;  1DJR D;  4K0K Q;  5C44 G;  1A8V A;  1W3S A;  3J7A 5;  1K8O A;  2HCC A;  3RUZ A;  3M3Y H;  2F0O A;  2R7F A;  1L0X B;  4C2M B;  2RHS B;  3VA5 A;  1GM5 A;  5C44 B;  2F0U A;  3ND8 A;  3M4O H;  1RL2 A;  2JQO A;  1CSQ A;  1L0W A;  3D31 A;  4DK1 A;  2Y0S E;  3W1B A;  1JWU D;  3MXU A;  4IFD G;  3GTM H;  2R3Z A;  1I94 Q;  2HDM A;  1U4R A;  1PRT F;  5C3W A;  4IJH A;  1HH2 P;  1IBL L;  2OEO A;  2Z4H A;  2GVA A;  5IYD G;  1X56 A;  1DCZ A;  4LF5 Q;  4OHJ A;  3KF8 A;  3A54 A;  5M3M G;  3M4Y A;  4LF7 L;  2KHS A;  4ALP A;  1R9T B;  3S16 H;  5M3M B;  5CV6 A;  4P71 A;  2WAQ E;  1Z7T A;  3TRE A;  5IGG A;  1XPO A;  1NCV A;  1S40 A;  5M9O A;  4BXX G;  2I5L X;  4IQZ A;  1FNW A;  1X32 A;  4Z9C B;  3VR5 A;  4A3B G;  3GTG B;  4TKO B;  1E7Z A;  1IBM Q;  3BU2 A;  3I70 A;  3T51 B;  1D8L A;  5C0X J;  3HP3 A;  2K5Q A;  2CWP A;  1H9M A;  3OWF A;  4A3B B;  2Z0S A;  5FO9 B;  3AYH B;  2PZT A;  1SYD A;  1GHK A;  5JPM C;  2K14 A;  1FR3 A;  3STB C;  4BY7 H;  4OL7 A;  3NUC A;  1HNX L;  4OWT B;  1B9N A;  2B63 H;  4HR7 B;  4P2C B;  3F1Z A;  3IFT A;  2PZW A;  3HRZ C;  4HCS A;  2NVQ B;  2L0C A;  1CKM A;  4ODG A;  3QOJ A;  1GUT A;  1G2T A;  3HZX A;  1HNZ Q;  3K6O A;  4X62 L;  4NB3 A;  1HNW L;  2BDN A;  1EFI D;  3LWE A;  2Q8T A;  3VR6 A;  4DV1 Q;  5I9O A;  1AFP A;  1EWI A;  1JE5 A;  1XTC D;  2A69 D;  5EGT A;  2WP8 J;  1SNQ A;  2K5W A;  3CC2 A;  5IOC A;  1RF2 D;  1B44 D;  5C4H A;  3BZC A;  3G7L A;  4WJW A;  4C56 C;  1F2M A;  3CRL C;  3T1Y Q;  4KHZ A;  4N8X 1;  1F2Y A;  4A3M G;  1F9P A;  2NBF A;  1CA5 A;  1IBK Q;  1Z9F A;  1MJE A;  2NZO A;  3EA6 A;  2F0K A;  4A3M B;  3GTL B;  2F0N A;  2EJG C;  2FFK B;  1TS4 A;  3FKI G;  3PGZ A;  2O2L D;  3PUX A;  1B4O A;  4DXF A;  4DR7 Q;  2PNH A;  2LFN A;  4JI1 Q;  1AE2 A;  3FKI B;  3UDI A;  1WD1 A;  2NVY H;  3I73 A;  1CZW A;  5BN5 A;  3PCO B;  3WWV A;  4B3T L;  4Y7N H;  4B9W A;  3IFD A;  1XXG A;  2HD3 A;  4QGU A;  3U9O A;  4FYD A;  4YCV A;  1DM0 B;  3NP8 A;  3SDZ A;  1S72 A;  2IWH A;  3MFY A;  1AZP A;  4C3J G;  5M3F G;  3WDN A;  2CH4 A;  4JI8 Q;  4QUF A;  1LAC A;  3C2P A;  2J4X A;  4DR6 L;  3H09 A;  4C3J B;  4B3M L;  5M3F B;  2TSS A;  4KKT A;  1M1K C;  2QGQ A;  2Z1C A;  3TDQ A;  1VQM A;  1DYQ A;  2G9D A;  2KHJ A;  2R61 A;  3LGJ A;  1FL0 A;  2JA5 G;  4JI6 Q;  1I3Q H;  3FVQ A;  3HOZ G;  1Q81 C;  5IYB G;  3HKZ G;  2PCF B;  4I7Z C;  4RGO S;  2JA5 B;  2N88 A;  4L8J A;  3HOZ B;  3OMG A;  1X3E A;  3HKZ B;  3I90 A;  3P1H A;  1VQE A;  3KJO A;  1I6H B;  1Z47 A;  4DU9 A;  4JCV E;  2L1B A;  3S2D H;  5CV4 A;  1E3P A;  4FO2 A;  1KL9 A;  4BBR G;  2ZJQ A;  4B08 A;  3PO2 G;  3TN2 A;  1ENC A;  4BBR B;  2VW9 A;  1N36 L;  3PIP A;  1EIY B;  2HHH Q;  2VNU D;  1KAA A;  3DWA A;  3PO2 B;  2JE6 I;  1SFO B;  4KN4 C;  1AH9 A;  3A5Z B;  4IOC A;  2HCI A;  2YV5 A;  3IL8 A;  1TY0 A;  4RH6 A;  2E2I H;  2UUB L;  1NE3 A;  3GTK B;  4H7B A;  4OWW B;  4KKU A;  3RN2 A;  2HQE A;  1EY9 A;  1ILP A;  1BF4 A;  4G57 A;  1DOL A;  2PQE A;  2PMZ E;  4K6L A;  1P8L A;  5L37 A;  2CW0 D;  1G91 A;  4FP5 D;  1EEF D;  3DLL A;  4X65 Q;  2VB2 X;  3HEJ A;  4DR3 L;  1B50 A;  4DV2 L;  2IX0 A;  2NUC A;  1E0B A;  2KCT A;  1XJV A;  1E1T A;  2F1M A;  5GRO A;  3D3R A;  2SOB A;  2UUA Q;  3A8K E;  3QR8 A;  1T5E A;  4R4O A;  4RGN A;  1A62 A;  1S4Z A;  1WOC A;  1R4Q B;  2F4V Q;  3DEO A;  4X64 Q;  3SK6 A;  3HOX H;  1V1O A;  4DF7 A;  4FF2 A;  4DV7 L;  3H94 A;  4IJL A;  1F9R A;  1PH4 A;  1CQV A;  1K28 A;  2XTI A;  2EYL A;  1VQJ A;  1Q12 A;  4LFA L;  1DON A;  3DMU A;  1MSH A;  2LS0 1;  2ZTD A;  3K0X A;  4XXE A;  1U4M A;  3VDY A;  1ICW A;  5CV7 A;  1X3Q A;  2BE5 C;  1JCK B;  3GTJ B;  1EY6 A;  3K80 C;  1GD7 A;  2AQ2 B;  3A55 A;  2R93 H;  1ESR A;  1ET9 A;  5JPN C;  3S15 B;  4C3I G;  3TP6 A;  2BDO A;  4GOP C;  1ILQ A;  1EU3 A;  4DXG A;  4C3I B;  2CVR A;  2E76 C;  1RDP D;  2MO0 A;  1TR5 A;  4JW0 A;  3VYT A;  3I2Z A;  2IT1 A;  2EE1 A;  3H3V C;  1LAB A;  2A74 C;  4DV3 Q;  2NVX H;  3BVM A;  4JI3 L;  2KBN A;  1VF7 A;  5IOD A;  1E2W A;  5JAV A;  4PZ6 A;  4EVO A;  1JR0 D;  1CFM A;  3TP5 A;  4ZYS A;  3M3Y B;  2LXJ A;  3M4O B;  4K8I A;  2NN6 H;  3D4W A;  3SK8 A;  2H1E A;  3LX0 A;  4FF4 A;  3GTM B;  1DOM A;  4KY6 A;  4QCL A;  2MUY A;  3T13 A;  3CCE A;  1LT6 D;  1NMF A;  2UXD Q;  1SYG A;  2NWG A;  1F77 A;  3E6Z X;  4WOR A;  3I4M H;  1SE4 A;  4JI5 Q;  3K7U C;  3E9I A;  1WTV A;  1S5D D;  4XT1 B;  5DM6 3;  2K5H A;  3S16 B;  4GN3 B;  1PH5 A;  2CWA A;  4DV0 L;  1QVG A;  1G51 A;  1PTO C;  4BBS H;  5IWA L;  4DK3 C;  4AYB E;  2RCN A;  2GA4 B;  5J1Z A;  1LUZ A;  2Q2U A;  1GUS A;  1SLJ A;  5IGB A;  2B2Y C;  4H44 C;  5AJ3 L;  4CJ1 B;  2EY6 A;  1H9S B;  1SNM A;  3SGI A;  3D6C A;  4RKL A;  3BS1 A;  2CHB D;  3QO2 A;  5M5W H;  1E2V A;  4F8M A;  1K0R A;  4BY7 G;  1C8C A;  1BR9 A;  1BCP F;  1QVF A;  5IYC H;  3SK4 A;  2B63 G;  1PMR A;  4IFD J;  3ERS X;  2YYZ A;  1YIT A;  4BY7 B;  3K59 A;  4RHS A;  2B63 B;  2ZJR A;  3W1G A;  5J39 A;  2KVM A;  1NTG A;  1CUK A;  5FK9 C;  1HXY D;  4MTK A;  2F0Q A;  4LMQ D;  2OTJ A;  1LYL A;  1VQC A;  3T1H L;  4OX9 Q;  1PA6 A;  4UP9 A;  4A3K H;  1D1K A;  2C35 B;  4UHV A;  1M4V A;  2EYF A;  4JV5 Q;  2B2V C;  1UWV A;  2PI2 A;  2QF7 A;  4J15 A;  4NMZ A;  3AQQ A;  3PF4 A;  4V0B A;  1PH8 A;  4B3S Q;  3NQT A;  2HIX A;  2A1A A;  1I4P A;  1Z6H A;  2QDL A;  3SVM A;  3Q8D A;  2ZM6 Q;  2H5X A;  3C1E A;  1S5F D;  3OHX C;  4ZRZ A;  3S2H H;  1B8A A;  3W2D A;  2DNC A;  2RVL A;  1EQR A;  2NVY B;  4YHH Q;  1ASY A;  5A35 A;  1UUP A;  1VQI A;  1IKL A;  3PIO 3;  4Y7N B;  1HR0 Q;  2B2T C;  1BBU A;  1WTW A;  2X69 A;  2AHO B;  2EDG A;  4R4T A;  4P74 A;  3G6J B;  2G9H D;  3FEW X;  4QJF A;  3D4R A;  5J22 A;  1FYC A;  1BQQ T;  1YNN D;  3GP7 A;  2CH4 W;  1SRO A;  4K0K L;  1NR4 A;  2NN6 I;  4GKK L;  1X3F A;  4LF6 L;  2D5D A;  4LFB L;  3DWQ A;  3H91 A;  1TWC H;  4OIK A;  1SE3 A;  2XRQ D;  2N49 A;  3CU7 A;  4A3J H;  2ATW A;  3I4O A;  2FMC A;  2EQS A;  3R3O A;  3V05 A;  2BCO A;  3I7F A;  4JPB W;  4KY5 A;  3K57 A;  4A93 H;  1XMO L;  1WVL A;  3A74 A;  3S2D B;  3GV6 A;  4IUN A;  3PIO A;  1BNZ A;  2RDH A;  2RSN A;  1RJT A;  4N8F A;  4OON A;  1BBW A;  3NK9 A;  2MQH A;  3VR2 A;  1XNQ Q;  3J80 i;  2Q8R E;  4ZUJ A;  5K36 H;  1EIH A;  2HT1 A;  4DV5 Q;  2EXZ A;  5DM7 3;  3RR5 A;  2WB1 G;  3ULJ A;  2B39 A;  4KJO A;  2E2I B;  5ISR A;  1MJC A;  1O7L A;  2WB1 B;  3R93 A;  1PDQ A;  3SK5 A;  3D6W A;  2PI2 E;  3LWU A;  1VMC A;  2WAQ G;  2F0E A;  5CYU A;  1XPR A;  3HFZ B;  2QIL A;  3U4Z A;  4G7H C;  1EY0 A;  5JEA H;  3BJU A;  2WAQ B;  4QUC A;  3I55 A;  4X6A H;  1HPC A;  4Y52 H;  2Z4I A;  2CCZ A;  4HIM A;  3JC6 6;  1SE2 A;  4LUZ A;  2CKZ B;  1HNZ L;  3IRB A;  3K58 A;  1YNX A;  4EQP A;  1EYC A;  3RN5 A;  4U68 A;  4DV1 L;  2EYP A;  3HOX G;  4DV6 Q;  1EYD A;  4LF4 Q;  3G4S A;  3HOX B;  4X3U A;  2B3G A;  4AIM A;  3KLR A;  1H9J A;  1W6K A;  3MWY W;  3MEF A;  4H13 C;  5FKA C;  3CCV A;  1WTX A;  3T1Y L;  1YZ6 A;  2K75 A;  1VQN A;  1JOR A;  1MGS A;  1Y8O B;  3CC4 A;  4CDF C;  2EZV A;  3NBH B;  4A3F H;  1IL2 A;  2DGY A;  2F0T A;  5EPK A;  2R93 G;  1B7Y B;  2JA8 H;  5CBE E;  3K7A H;  2JP1 A;  3L9A X;  1SYF A;  4DR7 L;  2R93 B;  2M2L A;  4O0A A;  4JI1 L;  5C3E H;  2QCP X;  3PUZ A;  5IP9 H;  1YEZ A;  4YWL A;  3DUZ A;  3J7A V;  4RGT A;  4F88 A;  1STY A;  4JBJ A;  1EFW A;  1IYU A;  2YTX A;  1LTA D;  1H9K A;  4QB4 A;  4DK6 C;  2E75 C;  1KQS A;  4JI4 L;  4QF4 A;  1PFB A;  4FXK C;  3EN2 A;  3NPP A;  2QA4 A;  2NVX B;  4GNX B;  1M8A A;  5C4X H;  1JOO A;  2ENB A;  2NN6 G;  5E4W C;  3RD4 A;  2Z9H A;  4C3H H;  3FHW A;  3CPW A;  4ME3 A;  1IXR A;  4HMJ A;  3S24 A;  3PQI A;  3HOU H;  2KQ3 A;  5EQ0 A;  4L5T A;  2V4D A;  1CKO A;  2KCN A;  1RKN A;  2EYH A;  1CZG A;  2KCC A;  3I4M G;  5D3D A;  4XTC S;  4DUY Q;  1O7Z A;  3MA2 B;  1EOV A;  3IAY A;  3I4M B;  4IPG A;  2QEX A;  3S17 H;  1GUO A;  2OT2 A;  4DAP A;  1B53 A;  1WTH A;  2IPK D;  4HSP A;  1LV9 A;  5E1F A;  1LTT D;  4RCN A;  2UXB Q;  3BYT B;  2DUD A;  2E2H H;  5HGT A;  3JAM E;  2VY3 A;  3J7A F;  3BG3 A;  1HZ9 A;  3OIQ A;  1I4X A;  1EZ6 A;  4R1J A;  1HA6 A;  4IUT A;  3S9W A;  2DNE A;  2EYO A;  1YJW A;  1U4P A;  2E5L Q;  4XQN A;  5M5W B;  2EOT A;  5E3F A;  4B9X A;  3QIA A;  1SYE A;  2ES2 A;  3UDF A;  1TU2 B;  4XQJ A;  1FD7 D;  3JAM c;  2EY5 A;  4P73 A;  2A6E C;  3HG9 A;  3CKI B;  1C0A A;  2E2D C;  4TRD A;  2CQO A;  1ONL A;  4LW1 A;  1X54 A;  2F4V L;  3M7G A;  2F0W A;  4X64 L;  4A3K G;  3F2U A;  4RGM A;  1U5K A;  2PMZ B;  3VA7 A;  3TRZ A;  4KHV A;  1OXV A;  1YNJ C;  3ICE A;  2B2T A;  1SNO A;  4A3K B;  5ELB A;  1N32 Q;  3O13 A;  1L1O B;  3MHB A;  2IL8 A;  4HIO A;  2GN5 A;  1JE4 A;  1PRT B;  1Q1B A;  5I2Y A;  5DLQ E;  1HJP A;  4O1N A;  5JOB A;  2IX3 A;  1UEB A;  1JOK A;  1AE3 A;  1PZI D;  2DN8 A;  1EYA A;  3AFP A;  1O80 A;  3S2H B;  1VQO A;  2PQA B;  1N8R C;  1WI5 A;  4HED A;  2D0P A;  2SDF A;  1G6P A;  2AQ1 B;  1ESF A;  4UPA A;  1TII D;  2WAC A;  4K8J A;  1K73 C;  3WOE A;  1PH9 A;  4E6I A;  4ID6 A;  3K0Y A;  2MNA A;  1SYB A;  1GO3 E;  1CQF A;  4DV3 L;  4KK7 A;  1K83 H;  2A6H D;  5IGF A;  4GKJ L;  3FMC A;  2PZU A;  1TT2 A;  3HOY H;  1ZKO A;  1Q8K A;  4A3J G;  5C0X H;  1Q8I A;  4A3J B;  2WKC A;  3OTO L;  1BVS A;  1DXM A;  1FNU A;  2RHQ B;  4N9T A;  2YTV A;  3E0E A;  1JJ2 A;  4HMI A;  4JYA L;  4O42 A;  2WKD A;  4OXP A;  1QNU A;  2DJF C;  1D2B A;  1NNX A;  3NE5 B;  1XYI A;  1FGB D;  2N3S A;  2A69 C;  5ELO A;  4LFC Q;  4K14 A;  1HQM C;  5K36 G;  5D3I B;  1X6O A;  2A8V A;  1ZYR D;  4PV1 C;  1P16 A;  5ELE A;  1PYB A;  1TWF H;  2K04 A;  1AW7 A;  1STA A;  4KY7 A;  1MHW C;  2F0H A;  5NUC A;  4BA1 I;  4NW2 A;  2HDL A;  3PIP 3;  3GO5 A;  1SN8 A;  3ZJY C;  5IE8 A;  3JAM L;  2N55 A;  2SNM A;  4OWX B;  1MIU A;  4XT3 B;  5H1S E;  5JEA G;  4DKA C;  1N33 L;  4ZKC B;  1S5E D;  4KTA A;  3F2C A;  3I72 A;  1ZYR C;  2B8G A;  2P5Z X;  5IY0 A;  4K5V A;  4BS9 A;  1X3G A;  3M4Q A;  5EPJ A;  2RQX A;  1QOH A;  2G5D A;  3OOC A;  4S3S A;  2VUM G;  4BA2 I;  5C5M A;  5LHY 1;  1TY2 A;  4OX9 L;  3GD7 A;  1U4L A;  3CF5 A;  3H3V H;  2VUM B;  3WOF A;  5AFW A;  4RCO A;  2D2C C;  4JV5 L;  1J6Q A;  2QW7 A;  3TSS A;  1LT3 D;  1B3Q A;  3NXW A;  3W3A A;  2F0D A;  4LF9 L;  4A3F G;  1N9W A;  4B3S L;  1QNK A;  4M1U B;  3ER0 A;  5CV5 A;  1AN8 A;  4LK1 C;  4A3F B;  2JA8 G;  4KHP Q;  3ULP A;  5DEH A;  1G2S A;  2JA8 B;  5C3E G;  3K7A B;  4KLK A;  1IYV A;  2ICE C;  1MD2 D;  1X3P A;  5FLX E;  5IP9 G;  4EQN A;  3I91 A;  5C3E B;  4HCE A;  2AWO A;  5KYI A;  2I0Q A;  3TP7 A;  3S1R H;  1VQH A;  1U0L A;  3L0O A;  1HR0 L;  2HIV A;  2B2U A;  3D0F A;  3I3C A;  1XX8 A;  3HOW H;  1X55 A;  4WRD A;  2KJX A;  5C0X I;  4IPH A;  5EJW A;  3AMU A;  3E0J A;  5FLX c;  5C4X G;  1V1Q A;  4DV4 L;  2VQF L;  4I65 A;  1N34 Q;  3TBI B;  4C3H G;  1STH A;  2KA7 A;  2CW0 C;  5C4X B;  1AZQ A;  4C3H B;  2F0L A;  2L12 A;  4DN4 M;  2OWO A;  2N78 A;  3HOU G;  5CBA E;  2AUK A;  2R7D A;  3HOU B;  1I5F A;  2I46 A;  1HR0 W;  5CR3 A;  1IBL Q;  4A3E H;  2KEE A;  4X66 L;  1TWG H;  3J81 E;  1JIC A;  1VQD A;  2KCM A;  4A76 A;  1VQ8 A;  1V8Q A;  4LF8 Q;  2LSS A;  1S3O A;  1SMY D;  1LLR D;  4NP5 A;  5EKL A;  1L2F A;  3Q6S A;  3S17 B;  1WTR A;  5KND A;  3DM1 A;  1PH3 A;  3E3X A;  4JI2 Q;  4IZ8 A;  1VQF A;  3I4L A;  4DV5 L;  3SEB A;  1EWH A;  1PH2 A;  3LNN A;  1Y8P B;  1C4Q A;  2EJM A;  1U9R A;  2E2H B;  4DR4 L;  3CHB D;  4V19 0;  2XN9 C;  3I4N H;  2Z8L A;  1V1P B;  1DGS A;  3J81 c;  2XWJ B;  1VQ7 A;  1K8A C;  3KFU A;  3AU7 A;  1IL8 A;  4B3R L;  4PG3 A;  4RG1 A;  1PH7 A;  2K05 A;  3A8J E;  2PPB C;  4DR1 Q;  5KNB A;  1HNX Q;  1WCM H;  5LMN Q;  2LMC B;  3A0J A;  4H0L C;  4HJ8 A;  4JK1 C;  5G3L D;  4PZ8 A;  4OGQ C;  3H3V I;  1Q7Y C;  4A3G H;  1XMQ L;  3V2T A;  1HTP A;  4X62 Q;  4HN7 A;  2MO1 A;  2JYO A;  5LL6 S;  1RTN A;  3Q23 A;  2AQ3 B;  3K8A A;  2LY7 A;  4DV6 L;  1Q86 C;  4LF4 L;  4A3D H;  2ZXR A;  3KLS A;  1I4Q A;  1QZG A;  5M5Y H;  2F0S A;  4YCW A;  3VYU A;  1V9P A;  5JJL A;  3PMF A;  1CTM A;  3E5S A;  4A4I A;  4Q5V A;  5KNC A;  3BDC A;  4WFN 3;  1FJG Q;  4KD3 A;  1VS0 A;  3KDF B;  4DNT B;  1VQA A;  4MZ9 A; 
#chains in the Genus database with same CATH homology
 1CHP D;  1Y69 U;  4FXD A;  2OF1 A;  1A3U A;  3MFG A;  1EQT A;  5HUR A;  4FVM A;  4XYQ A;  5FLX L;  2VXW A;  3MZ5 A;  4OO1 H;  4JBW A;  1TQO A;  2MP1 A;  4IAL A;  4MN3 A;  3BVG A;  1ET6 A;  4K2K A;  1K83 B;  1BCP B;  4HSV A;  3QWN A;  3A56 A;  3HOY B;  5LL6 X;  5JVH 3;  2XNA C;  3EJI A;  2QDB A;  1HHV A;  2K33 A;  2X6G A;  1D5X C;  5JJZ A;  1J8I A;  4CKC A;  1F9Q A;  3ERO A;  4RA8 A;  3J81 L;  1KLG D;  2WII B;  3EQL C;  1DOK A;  4ZK9 B;  3KBX A;  5TSS A;  1TWF B;  3P20 A;  1RHP A;  3RMH A;  4CGY B;  1KLU D;  1Q1E A;  3DXJ C;  5ELD A;  1H9S A;  2NTS A;  1I3Q B;  4L6T B;  3TP8 A;  1B1Z A;  2F0J A;  1LT4 D;  1YNN C;  1EY4 A;  1EU4 A;  1F9S A;  2F3W A;  3SE0 A;  2Y0S B;  5I6W A;  1SBB B;  3VR4 A;  1G29 1;  3R8B A;  2TMP A;  4PNY A;  1PTO F;  5D14 A;  1EY8 A;  4DK0 A;  5JEA J;  2KOL A;  1PRT D;  1K8M A;  4OO1 I;  2F0V A;  2RBM A;  3KLS X;  3SR1 A;  5I4D A;  3K5M A;  1STE A;  3EVQ A;  2HUG A;  3J7Y W;  3S1R B;  2L9H A;  4RHR A;  3N6R A;  1A2U A;  1PXU A;  5C4Z A;  2F0F A;  3ZYY X;  3HOW B;  3K5L A;  2ID0 A;  4ILW A;  1EWC A;  1GOZ A;  1PZJ D;  3QB3 A;  2MGS A;  4IFD I;  3J80 E;  5I2X A;  5FO8 B;  3SHL A;  4CJ2 C;  4LAA A;  1S5B D;  4A3E B;  4J6H A;  1TWG B;  1OXX K;  3PUW A;  3NBI A;  4C1N K;  2L55 A;  3VYR A;  1LO5 D;  1CT1 D;  3C1F A;  3TZU A;  5BN3 A;  5IGC A;  3OPO A;  4G4K A;  1AEX A;  1I4G A;  3I4N B;  2F03 A;  2A68 D;  1PLF A;  4ZUI A;  3TME A;  4XIG S;  3DHQ A;  5D65 A;  2PO4 A;  2B8F A;  1Q3L A;  4R8I A;  1WCM B;  2M9V A;  3GV3 A;  1A3V A;  3MEH A;  4KD4 A;  2IX1 A;  2F0G A;  4A3G B;  1LT5 D;  2PW7 A;  5C5L A;  5A2Q L;  4G7O C;  2A68 C;  4U67 3;  2B2U C;  1CM9 A;  4A3D B;  2XSC A;  3BDL A;  1SND A;  5EBC A;  5M5Y B;  1D1I A;  1MBY A;  4BBS B;  3OSO A;  4KN7 C;  4G7Z C;  1A3T A;  2JEA I;  4CBV A;  2SNS A;  3PUV A;  1V43 A;  5C6A A;  3BVZ A;  3NBH A;  4RAU C;  4DGZ A;  3NWT A;  3HGB A;  4R9W A;  1SNP A;  1DZ1 A;  5CGK A;  1Y1V B;  3TZD A;  1B9M A;  4OO1 G;  1HQR D;  5IT9 E;  1QIL A;  3NTI A;  1DD2 A;  3FRP B;  2OXP A;  5I6Y A;  2B2W A;  1SJE D;  3D4D A;  3M85 A;  4BWG B;  2K5D A;  1C48 A;  4EGV A;  1OO9 B;  2F3V A;  3I8Z A;  4CKE A;  1I50 B;  3J80 L;  2L4N A;  3OW7 A;  2FJ2 A;  1LTR D;  3NWS A;  1ENF A;  3Q24 A;  4ZAI A;  3A7L A;  5FO7 B;  4GZY C;  5K5P A;  5FOB B;  5EKI A;  2XRS D;  3U9S A;  3NHH A;  3RZO B;  3L3O C;  2R7Z B;  1OXS C;  3GQB A;  2AUJ D;  4PMC A;  2D62 A;  1G8Z D;  1JC7 A;  2EVB A;  3PV0 A;  3S1N B;  1GHJ A;  4EQO A;  3Q22 A;  1STG A;  2K03 A;  1TS3 A;  5EBD A;  1TWC B;  3K5N A;  2RSO A;  5IIF A;  1Y1W B;  2O5J C;  2C5C A;  1GUN A;  3MXN A;  3AB9 A;  1L0Y B;  2MPM A;  4A93 B;  1BUV T;  5F2D A;  2K6A A;  2A6H C;  4KJN A;  3T56 B;  1UNS A;  2KED A;  4X3K A;  1STB A;  5ELC A;  2EPB A;  2WIN B;  3N52 A;  5ELF A;  3DWP A;  3SXH A;  1QE6 A;  2FIN B;  4UDU C;  1IKM A;  1XWE A;  2EYM A;  5CMD A;  3ITP A;  3GTQ B;  1BBX C;  4AYB B;  4M8A A;  5EKK A;  3VYS A;  5IT9 L;  3H0G B;  2F4I A;  4C1N I;  1CHQ D;  1NSN S;  2PYK A;  4FNF A;  3HS0 C;  5CV9 A;  1TWH B;  1NR2 A;  2J7Z A;  3QG1 A;  4R8N A;  1IHZ A;  2JA7 B;  3T16 A;  2K01 A;  4RKB A;  1BCP D;  2K32 A;  3CQZ B;  4K5X A;  5CC4 A;  4IUP A;  4LJZ C;  4J1M A;  1CA6 A;  1KAB A;  1I4H A;  4CKB A;  1PTO H;  4NKL A;  3DEP A;  1BCP C;  1B2T A;  2R6G A;  3IKJ A;  4IUR A;  4K5W A;  2RDG A;  4F7X A;  1LTS D;  4IN3 A;  1FNV A;  3OWE B;  1VCI A;  3S14 B;  4Q0F A;  1GXD C;  4N9P A;  3UI2 A;  2BE5 D;  2L11 A;  4OIJ A;  1QCB D;  1QJO A;  4X3S A;  1S5C D;  1VMP A;  1O78 A;  1J9O A;  3MVV A;  1JWS D;  1Q90 A;  5KIX A;  2E74 C;  3BDO A;  4DAY A;  1CI3 M;  1UAP A;  1H9R A;  2DY8 A;  1SYC A;  1KDB A;  2ZT9 C;  1ENA A;  4TQU S;  4FXG C;  3KK7 A;  1EZ8 A;  1D5M C;  4DFA A;  1KDA A;  1I6V C;  2XIW A;  1F2Z A;  2C9O A;  2MJ8 A;  3MAQ A;  1SMY C;  4KV6 A;  3NQI A;  4XQQ A;  3V96 A;  2SEB D;  1SNC A;  1WTP A;  2VB3 X;  4MHE A;  1D5Z C;  3EFX D;  5KRU A;  2JXM B;  1HUN A;  3VR3 A;  2DY7 A;  2NZ1 D;  2FHT A;  1PTO D;  3H6M A;  3BZD B;  2XVS A;  3M7N A;  3D8G A;  2NB0 A;  4KMU C;  1SEB D;  4CHT B;  3HOV B;  2MHV A;  1OXU A;  3OMC A;  1EL0 A;  1KDC A;  2E2J B;  3P7J A;  2K1B A;  3R2T A;  2R92 B;  1KNE A;  1WTO A;  2RA4 A;  1HFG A;  1LTG D;  2RKS A;  1HFN A;  1SJH D;  5IGD A;  2QEJ C;  2EYJ A;  4F87 A;  4XDX A;  1TWA B;  1SDF A;  1PYW D;  1ZXT A;  2ICI A;  2BA0 A;  2IJ0 A;  5CV8 A;  4L63 B;  5T1I A;  1Y8N B;  4HAE A;  1V1P A;  3MXG A;  2ZXO A;  1LTB D;  5C0X G;  2BOS A;  1B3A A;  2LKV A;  4IUV A;  1A15 A;  2L5T A;  4X3T A;  4PMB A;  4IFD H;  4DAV A;  2NVT B;  3NSW A;  3PO3 B;  2A5H A;  1STN A;  2QKI C;  1TVX A;  4ZLT F;  1HRJ A;  1HA5 A;  1QB5 D;  4QIW B;  3R2I A;  2B2W C;  1JWM D;  2KUM A;  2O5I C;  1UEA B;  1QG7 A;  4TSS A;  1ZEQ X;  5KGU A;  2NYZ D;  2RDF A;  1PFM A;  3K5O A;  4J8Q A;  1SAP A;  1NAP A;  1II3 A;  5BN4 A;  1OXT A;  3OIP A;  1KNA A;  3FDT A;  3RZD B;  4YIJ A;  4KKS A;  4K2L A;  3T53 B;  1JOQ A;  1BOS A;  3ERQ A;  3MTS A;  2EY1 A;  5JVG 3;  2ZXP A;  1GUG A;  2A73 B;  2EJF C;  5A2Q E;  1EQV A;  4K6D A;  1GUW A;  3FPU B;  1F2L A;  3RLF A;  2JSO A;  4DA2 A;  1D6E C;  1TS2 A;  4MIU A;  2X6L A;  5DAU A;  4FF1 A;  1SXT A;  1A2T A;  2PNR C;  4RWS C;  4ZKB B;  2BA1 A;  4XYO A;  1WTQ A;  3GTP B;  2F0P A;  3PUY A;  1BXT A;  3GTO B;  3P75 A;  3C46 A;  5G3L F;  1EOT A;  4QMG A;  4PQX A;  4IUQ A;  3CRK C;  2J0T D;  5KEE A;  3L7Z C;  4FF3 A;  1PTO B;  1RCV D;  3QOL A;  2JA6 B;  3A8I E;  3X3N A;  1QWY A;  4ABN A;  5COR A;  3URY A;  3S1M B;  1KTK A;  2IW3 A;  4PMW A;  5C4J B;  4RFB A;  1SSO A;  1PRT C;  1HUM A;  5I9P A;  3NTK A;  1JQY D;  5E4X A;  4BY1 B;  2O4X A;  3X3M A;  1BO0 A;  1I4R A;  2Q8I B;  2F0M A;  1NUC A;  1O7Y A;  2I07 B;  2H4O A;  4ME5 A;  1W6J A;  4CJ0 B;  1WD0 A;  4KI0 A;  2K28 A;  1GJX A;  1VDZ A;  5COY A;  5KYL A;  1BDO A;  1R4P B;  2EY2 A;  1ROD A;  1CK1 A;  4ULL A;  1TKW B;  3NTH A;  1A6X A;  1LTI D;  2WV6 D;  3QJY A;  2KEC A;  1HCZ A;  4NDX A;  2JEB I;  4ZQ3 A;  1PZK D;  2FMM A;  4DNR B;  3MXP A;  2NTT A;  3FPP A;  5T1G A;  2M00 A;  2XWB B;  3T4A C;  2PW5 A;  1IW7 D;  3A7A B;  1VF5 C;  3ONA B;  1RD9 D;  3ND9 A;  1EY5 A;  1E2Z A;  2YU9 B;  2B2Y A;  1PFN A;  1RTO A;  1MSG A;  5EPL A;  4A3I B;  1HTL D;  1AP0 A;  2CQA A;  4IUU A;  3KBG A;  5DNF A;  1IW7 C;  1T5X D;  3BYY B;  1TS5 A;  2F0I A;  1EY7 A;  2AWN A;  1EIG A;  2A6E D;  3S1Q B;  5IGE A;  5M5X B;  2K7V A;  5C3X A;  4UAI A;  1G6Z A;  1JB3 A;  1ML0 D;  3KUP A;  2B2V A;  3C3L A;  3MC0 B;  3Q0A A;  1MI2 A;  2D9U A;  4HTH A;  1YNJ D;  1EEI D;  1DJR D;  1K8O A;  2HCC A;  3RUZ A;  2F0O A;  1L0X B;  4C2M B;  3VA5 A;  5C44 B;  2F0U A;  3ND8 A;  3D31 A;  4DK1 A;  1JWU D;  3MXU A;  4IFD G;  2R3Z A;  2HDM A;  1U4R A;  1PRT F;  5C3W A;  2OEO A;  2Z4H A;  1DCZ A;  4OHJ A;  3KF8 A;  3A54 A;  3M4Y A;  2KHS A;  1R9T B;  5M3M B;  5CV6 A;  1Z7T A;  5IGG A;  1NCV A;  5M9O A;  4IQZ A;  1FNW A;  1X32 A;  4Z9C B;  3VR5 A;  3GTG B;  4TKO B;  3I70 A;  3T51 B;  5C0X J;  3HP3 A;  2K5Q A;  3OWF A;  1H9M A;  4A3B B;  5FO9 B;  2PZT A;  1SYD A;  1GHK A;  5JPM C;  1FR3 A;  4OL7 A;  3NUC A;  1B9N A;  4HR7 B;  4P2C B;  3IFT A;  2PZW A;  3HRZ C;  4HCS A;  2NVQ B;  2L0C A;  4ODG A;  3QOJ A;  1GUT A;  1G2T A;  3HZX A;  3K6O A;  2BDN A;  1EFI D;  3LWE A;  2Q8T A;  3VR6 A;  5I9O A;  1AFP A;  1XTC D;  2A69 D;  5EGT A;  2WP8 J;  1SNQ A;  2K5W A;  5IOC A;  1RF2 D;  1B44 D;  5C4H A;  3G7L A;  4WJW A;  4C56 C;  1F2M A;  3CRL C;  4KHZ A;  1F2Y A;  1F9P A;  2NBF A;  1CA5 A;  3EA6 A;  2F0K A;  4A3M B;  3GTL B;  2F0N A;  2EJG C;  2FFK B;  1TS4 A;  2O2L D;  1B4O A;  3PUX A;  4DXF A;  2LFN A;  3FKI B;  1WD1 A;  3I73 A;  1CZW A;  5BN5 A;  4B9W A;  3IFD A;  1XXG A;  3U9O A;  4FYD A;  1DM0 B;  3NP8 A;  3SDZ A;  2IWH A;  3MFY A;  1AZP A;  4C3J G;  3WDN A;  4QUF A;  1LAC A;  3C2P A;  2J4X A;  3H09 A;  4C3J B;  5M3F B;  2TSS A;  4KKT A;  2Z1C A;  3TDQ A;  1DYQ A;  2G9D A;  2R61 A;  3FVQ A;  2PCF B;  4I7Z C;  4RGO S;  2JA5 B;  2N88 A;  4L8J A;  3HOZ B;  3OMG A;  3HKZ B;  3I90 A;  3P1H A;  1I6H B;  1Z47 A;  4DU9 A;  2L1B A;  5CV4 A;  4FO2 A;  4B08 A;  3TN2 A;  4BBR B;  1ENC A;  2VNU D;  1KAA A;  3DWA A;  3PO2 B;  2JE6 I;  1SFO B;  4KN4 C;  2HCI A;  3IL8 A;  4RH6 A;  1TY0 A;  3GTK B;  4H7B A;  4KKU A;  1ILP A;  2HQE A;  1EY9 A;  1BF4 A;  4G57 A;  1DOL A;  2PQE A;  4K6L A;  2CW0 D;  1G91 A;  4FP5 D;  1EEF D;  2VB2 X;  3HEJ A;  1B50 A;  2IX0 A;  2NUC A;  1E0B A;  2F1M A;  3D3R A;  2SOB A;  3A8K E;  1T5E A;  4RGN A;  1S4Z A;  1R4Q B;  3DEO A;  3SK6 A;  1V1O A;  4DF7 A;  4FF2 A;  3H94 A;  1F9R A;  1CQV A;  1DON A;  2EYL A;  1Q12 A;  3DMU A;  1MSH A;  2LS0 1;  4XXE A;  1U4M A;  1ICW A;  5CV7 A;  1X3Q A;  2BE5 C;  1JCK B;  3GTJ B;  1EY6 A;  2AQ2 B;  3A55 A;  1ESR A;  1ET9 A;  5JPN C;  3S15 B;  4C3I G;  3TP6 A;  2BDO A;  1ILQ A;  1EU3 A;  4DXG A;  4C3I B;  2CVR A;  2E76 C;  1RDP D;  1TR5 A;  3VYT A;  2IT1 A;  2EE1 A;  3H3V C;  1LAB A;  2A74 C;  3BVM A;  1VF7 A;  5IOD A;  1E2W A;  5JAV A;  4EVO A;  1JR0 D;  1CFM A;  3TP5 A;  4ZYS A;  3M3Y B;  3M4O B;  4K8I A;  2NN6 H;  3D4W A;  3SK8 A;  2H1E A;  3LX0 A;  4FF4 A;  3GTM B;  1DOM A;  4KY6 A;  4QCL A;  2MUY A;  3T13 A;  1LT6 D;  1SYG A;  2NWG A;  1F77 A;  3E6Z X;  4WOR A;  1SE4 A;  1WTV A;  1S5D D;  4XT1 B;  5DM6 3;  3S16 B;  1PTO C;  2GA4 B;  5J1Z A;  1GUS A;  5IGB A;  2B2Y C;  4H44 C;  4CJ1 B;  2EY6 A;  1H9S B;  1SNM A;  3D6C A;  4RKL A;  3BS1 A;  2CHB D;  3QO2 A;  1E2V A;  4F8M A;  1C8C A;  1BR9 A;  1BCP F;  3SK4 A;  1PMR A;  4IFD J;  2YYZ A;  4BY7 B;  3K59 A;  4RHS A;  2B63 B;  5J39 A;  2KVM A;  5FK9 C;  1HXY D;  2F0Q A;  4LMQ D;  1D1K A;  1M4V A;  2EYF A;  2B2V C;  2QF7 A;  4NMZ A;  4V0B A;  3NQT A;  1I4P A;  1Z6H A;  3SVM A;  3C1E A;  1S5F D;  3OHX C;  4ZRZ A;  3W2D A;  2DNC A;  2RVL A;  2NVY B;  5A35 A;  1UUP A;  1IKL A;  3PIO 3;  4Y7N B;  2B2T C;  1WTW A;  2X69 A;  2EDG A;  3G6J B;  2G9H D;  3FEW X;  3D4R A;  5J22 A;  1FYC A;  1BQQ T;  1YNN D;  3GP7 A;  1NR4 A;  2NN6 I;  2D5D A;  3DWQ A;  3H91 A;  4OIK A;  1SE3 A;  2XRQ D;  3CU7 A;  2FMC A;  3R3O A;  3V05 A;  2BCO A;  4KY5 A;  3K57 A;  1WVL A;  3S2D B;  3GV6 A;  4IUN A;  1BNZ A;  2RDH A;  2RSN A;  1RJT A;  3NK9 A;  3VR2 A;  2Q8R E;  4ZUJ A;  5K36 H;  1EIH A;  2EXZ A;  5DM7 3;  2B39 A;  4KJO A;  2E2I B;  5ISR A;  1O7L A;  2WB1 B;  3R93 A;  1PDQ A;  3SK5 A;  3D6W A;  3LWU A;  1VMC A;  5CYU A;  2F0E A;  2QIL A;  4G7H C;  1EY0 A;  5JEA H;  2WAQ B;  4QUC A;  1HPC A;  2Z4I A;  1SE2 A;  3K58 A;  4EQP A;  1EYC A;  4U68 A;  2EYP A;  1EYD A;  3HOX B;  4X3U A;  3KLR A;  1H9J A;  1W6K A;  3MWY W;  4H13 C;  5FKA C;  1WTX A;  1JOR A;  1MGS A;  1Y8O B;  2EZV A;  2F0T A;  5EPK A;  5CBE E;  2JP1 A;  3L9A X;  1SYF A;  2R93 B;  2M2L A;  2QCP X;  3PUZ A;  3J7A V;  3DUZ A;  4RGT A;  4F88 A;  1STY A;  1IYU A;  1LTA D;  1H9K A;  4QB4 A;  2E75 C;  4QF4 A;  1PFB A;  4FXK C;  3NPP A;  2NVX B;  1M8A A;  1JOO A;  2ENB A;  2NN6 G;  5E4W C;  3RD4 A;  4HMJ A;  2KQ3 A;  5EQ0 A;  2V4D A;  2KCN A;  1RKN A;  2EYH A;  1CZG A;  2KCC A;  5D3D A;  4XTC S;  1O7Z A;  3MA2 B;  3IAY A;  3I4M B;  1GUO A;  2OT2 A;  4DAP A;  1B53 A;  2IPK D;  4HSP A;  1LV9 A;  5E1F A;  1LTT D;  4RCN A;  3BYT B;  5HGT A;  3JAM E;  3J7A F;  3BG3 A;  3OIQ A;  1I4X A;  1EZ6 A;  1HA6 A;  4IUT A;  3S9W A;  2DNE A;  2EYO A;  1U4P A;  4XQN A;  5M5W B;  2EOT A;  5E3F A;  4B9X A;  3QIA A;  1SYE A;  1TU2 B;  4XQJ A;  1FD7 D;  2EY5 A;  2A6E C;  3HG9 A;  3CKI B;  2E2D C;  4TRD A;  1ONL A;  3M7G A;  2F0W A;  3F2U A;  4RGM A;  3VA7 A;  2PMZ B;  4KHV A;  1OXV A;  1YNJ C;  2B2T A;  1SNO A;  4A3K B;  5ELB A;  3O13 A;  3MHB A;  2IL8 A;  1JE4 A;  1PRT B;  1Q1B A;  5I2Y A;  4O1N A;  5JOB A;  2IX3 A;  1JOK A;  1PZI D;  2DN8 A;  1EYA A;  1O80 A;  3S2H B;  4HED A;  2SDF A;  2AQ1 B;  1ESF A;  1TII D;  2WAC A;  4K8J A;  3WOE A;  4E6I A;  4ID6 A;  3K0Y A;  1SYB A;  1CQF A;  4KK7 A;  2A6H D;  5IGF A;  3FMC A;  2PZU A;  1TT2 A;  1ZKO A;  5C0X H;  1Q8I A;  4A3J B;  2WKC A;  1DXM A;  1FNU A;  4N9T A;  4HMI A;  4O42 A;  2WKD A;  1QNU A;  1D2B A;  3NE5 B;  1XYI A;  1FGB D;  2A69 C;  4K14 A;  1HQM C;  5K36 G;  5D3I B;  1ZYR D;  4PV1 C;  5ELE A;  2K04 A;  1AW7 A;  1STA A;  4KY7 A;  2F0H A;  5NUC A;  4BA1 I;  4NW2 A;  2HDL A;  3PIP 3;  3GO5 A;  3JAM L;  2N55 A;  2SNM A;  4XT3 B;  5JEA G;  4ZKC B;  1S5E D;  4KTA A;  3I72 A;  1ZYR C;  2B8G A;  4K5V A;  4BS9 A;  5EPJ A;  2RQX A;  1QOH A;  3OOC A;  4S3S A;  4BA2 I;  5C5M A;  5LHY 1;  1TY2 A;  3GD7 A;  1U4L A;  2VUM B;  3WOF A;  5AFW A;  4RCO A;  2D2C C;  3TSS A;  1LT3 D;  3NXW A;  3W3A A;  2F0D A;  1QNK A;  4M1U B;  5CV5 A;  1AN8 A;  4LK1 C;  4A3F B;  5DEH A;  1G2S A;  2JA8 B;  3K7A B;  1IYV A;  2ICE C;  1MD2 D;  1X3P A;  5FLX E;  4EQN A;  3I91 A;  5C3E B;  4HCE A;  2AWO A;  5KYI A;  3TP7 A;  2B2U A;  3I3C A;  1XX8 A;  4WRD A;  2KJX A;  5C0X I;  5EJW A;  3AMU A;  3E0J A;  4I65 A;  3TBI B;  4C3H G;  1STH A;  2KA7 A;  2CW0 C;  5C4X B;  1AZQ A;  4C3H B;  2F0L A;  2L12 A;  4DN4 M;  5CBA E;  2AUK A;  3HOU B;  2I46 A;  5CR3 A;  2KEE A;  3J81 E;  1JIC A;  1V8Q A;  1SMY D;  1LLR D;  4NP5 A;  5EKL A;  3Q6S A;  3S17 B;  1WTR A;  5KND A;  3DM1 A;  4IZ8 A;  3I4L A;  3SEB A;  1EWH A;  3LNN A;  1Y8P B;  1C4Q A;  2EJM A;  1U9R A;  2E2H B;  3CHB D;  4V19 0;  2XN9 C;  2Z8L A;  1V1P B;  2XWJ B;  3AU7 A;  1IL8 A;  2K05 A;  3A8J E;  2PPB C;  5KNB A;  2LMC B;  4H0L C;  4JK1 C;  5G3L D;  4OGQ C;  3V2T A;  1HTP A;  4HN7 A;  2JYO A;  5LL6 S;  1RTN A;  3Q23 A;  2AQ3 B;  2LY7 A;  2ZXR A;  3KLS A;  1I4Q A;  2F0S A;  3VYU A;  3PMF A;  1CTM A;  3E5S A;  4Q5V A;  5KNC A;  3BDC A;  4WFN 3;  4KD3 A;  4DNT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...