2XSFA

Crystal structure of the rrm domain of mouse deleted in azoospermia- like
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
81
structure length
81
Chain Sequence
b'GKIMPNTVFVGGIDVRMDETEIRSFFARYGSVKEVKIITDRTGVSKGYGFVSFYNDVDVQKIVESQINFHGKKLKLGPAIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DELETED IN AZOOSPERMIA-LIKE
publication title Kinked Beta-Strands Mediate High-Affinity Recognition of Mrna Targets by the Germ-Cell Regulator Dazl
pubmed doi rcsb
source organism Mus musculus
molecule tags Rna binding protein
total genus 14
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2010-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xsfA00
5MLCV 3L3CA 1SJ3P 1N8RT 1WI6A 2RQ4A 2LA6A 2KH9A 1VQKS 1QM9A 2DGTA 3S01A 4TLQA 3SDEA 1YTYA 3NMRA 1QVGR 4LIRA 4RU2A 2M52A 5DETA 2RQCA 2XS5A 2RNEA 2LMIA 2VONA 3THPA 1SJRA 1SJFA 2XS2A 1URNA 2AYMA 3RW6A 2K8GA 3SXLA 2DNYA 2F3JA 1VQPS 2MKJA 3S7RA 3CCVS 2CPXA 2DHGA 2RUGA 4YOEA 1Q86T 1VQ9S 2CQGA 2WBRA 1X4DA 2GO9A 2DNZA 2CPFA 1JMTA 3NS6A 2MKSA 3CMAS 4W90B 1WEXA 1X4FA 3B4DA 4OZ0A 4QU7A 1ZZFA 2KN4A 3G8TA 1KQSR 2MQPA 3K0JA 2J8AA 2DIVA 1VBYA 2G1DA 2QA4S 1AUDA 2BOPA 2SXLA 2JX2A 1U1NA 2YWKA 2CQ1A 2Q79A 2D3OR 5DDPC 1U6BA 2DNRA 5CXTA 1X4HA 4TU7A 2DGWA 2OSRA 2CPJA 2KXFA 2KG0A 2ADBA 2HYIB 4WF9Q 4FXVA 5GMKa 1SJQA 1D8ZA 2MGZB 1U1OA 3CCES 2JVOA 1IQTA 1S79A 2DNGA 3CCSS 1QVFR 2V94A 2AYBA 3US5A 2DO0A 3NS5A 2OTJS 3I56S 2RS8A 2MZSA 4W92B 3CXCR 1WG1A 1PGZA 1VQLS 3G71S 3LQVA 2MKCA 3MD3A 2EK6A 2MZQA 3U1MA 3CUNA 4IOAQ 1NU4A 3MXHP 3V4MA 1VQNS 2M8HA 4QPTA 5DM6Q 2MQLA 2DNMA 1P1TA 2MXYA 5DDOC 1VC5A 1M5PC 2KT5A 4CQ1A 1WHYA 2CQ0A 2DNOA 1UW4A 3CCRS 1M1KT 2XS7A 2X1FA 3RW7A 3CCLS 1VBXA 3VAIA 2RRAA 2KI2A 3VALA 1X0FA 4WFNQ 3N9UC 2G0CA 2DH7A 1DRZA 4BS2A 2CPIA 5IQQA 2ERRA 2E5GA 2KG1A 1FHTA 1OIAA 2LYVA 1M5VC 2MKKA 4ZKAA 2CQHA 3ULHA 2MJUA 1DHMA 3HI9A 3TP2A 2F9JA 2DO4A 3CCQS 2BZ2A 3H2VE 2PE8A 4PKDB 1KC8T 1O0PA 5HL7Q 1H2UX 5FJ4A 4C0OC 2DGVA 3J7ZT 3P49B 2NLWA 3H2UB 2I38A 2U1AA 3G96A 1ZH5A 1VQ7S 2KM8B 2AYEA 1WI8A 2KFYA 3UWTA 3DLLQ 3CF5Q 3CC7S 3R27A 3UD3P 1HL6A 3BS9A 3MOJB 2XNQA 2MB0B 4P6QA 4TU9A 2LA4A 1VBZA 2XB2D 3BEGB 3Q2TC 2RRBA 1WHWA 2CPEA 2LECA 5LSOA 2MZTA 1FO1A 2DGUA 2I2YA 4J5OA 5IFMA 2QFJA 4F26A 2VOOA 1R8HA 2MMYA 1U6FA 1K9MT 1YIJS 2DNLA 4F25A 2OIHA 2M7SA 1VQMS 1WTBA 2GHPA 3R1LA 2LXUA 4WKRA 1ZZNA 1XN9A 2CQ3A 4CH0S 1YHQS 2N82B 1YJNS 1N88A 2MKIA 2CQPA 4OZ1A 3D2WA 1DBDA 5JVHQ 2AYGA 1WG4A 4A8XA 2DISA 2DNHA 1H2TZ 2RS2A 2YKAA 3CC2S 1YJ9S 3U1LA 2KVIA 3SDEB 1YWXA 2QEXS 3IRWP 2M9KA 2MSTA 1OPIA 1X5TA 3VAJA 3G9CA 2DGXA 4PR6A 2MY8A 2M8DB 1H2VZ 2MJNA 2K3KA 2HVZA 5JVGQ 2LXIA 2M4MA 4IUFA 5DDRC 2D9PA 1FNXH 4QU6A 2DHSA 5HO4A 1M5KC 5LSLA 3DXBA 5BJRA 4ED5A 2HGMA 4CIOA 2CQBA 5ITHA 1JJHA 3PIPQ 2VOPA 1U1QA 1X4EA 5IM0A 2E5JA 1JJ4A 4QQBA 5GAHU 3MUTP 3CCMS 2CQ4A 2KRBA 4F02A 2MQQA 2VODA 2FC8A 1KD1T 2EK1A 3IWNC 2KXNB 1Q7YT 3BO4A 2EVZA 2RU3A 1A7GE 2E44A 1FJCA 3MDFA 2CJKA 2CPHA 1WF2A 1U1KA 1SJ4P 2O3DA 1VC0A 1U1PA 2N7CA 5GVQA 2J0SD 3CCJS 1R8PA 2MPUA 2N3LA 1YITS 1H6KX 2DB1A 1FJEB 1U2FA 3THTA 1P27B 1A9NB 1Q82T 5EN1A 4IO9Q 1M5OC 3EX7B 3S8SA 4V19X 5H1SV 2UP1A 1VQOS 3EGZA 4FXWA 3P6YC 4UQTA 2DIUA 3VAGA 2U2FA 3VF0B 2X1BA 2M88A 1FJ7A 2YTCA 3UCUP 2FPHX 3UE2A 2N3OA 2MQOA 1VQ5S 2DGOA 3CPWR 1JJ2R 1WF0A 2DHXA 2MYFA 3OW2R 1VQ6S 2HGNA 3MURP 2MHNA 2RVJA 2CQDA 1M90T 2D9OA 5CA5A 2MZ1A 2X1AA 1WEYA 3I55S 1X4CA 2OJ3A 2DNKA 4LMZA 1K8AT 1X4GA 1X4AA 2B0GA 3UCZP 2LCWA 1WEZA 5LXYA 3LPYA 2L41A 2FHOB 3CMES 3VAFA 1VC6A 3VAHA 3MD1A 3ZZYA 1OWXA 2FY1A 3HHNB 2ADCA 1WWHA 5D78A 2JVRA 2MGZA 3NNHA 2KU7A 2XSFA 2M70A 3NNCA 3MUMP 2M0GB 2L08A 1BY9A 4WFAQ 4CH1A 3MUVP 3TO8A 1FXLA 2DNNA 1HD1A 2OSQA 3CD6S 2CQIA 2MKHA 1WHVA 2ZJPQ 3CC4S 4M5DB 3G4SS 1W2BR 4WFBQ 2CQCA 2HGLA 1VQ8S 1RKJA 2YH0A 4Y00A 3G8SA 2E5HA 4C7QA 4Y0FA 4U67Q 1WG5A 2KYXA 1YI2S 2LKZA 2MSSA 2JWNA 2YH1A 4C4WA 4EGLA 1KOHA 3TYTA 2DH8A 1DZ5A 2KRRA 2MZJA 3FEXB 1L3KA 1FT8A 1KOOA 4IOCQ 5GAGU 1U1LA 1PO6A 1X4BA 3P3DA 5D77A 3VAMA 4WCEQ 2ZJQQ 2L9WA 3NNAA 1OO0B 1S72S 5GADU 2LQ5A 2MQNA 1G2EA 3CCUS 3FEYB 2CPYA 2NZ4A 1D9AA 2DH9A 3CULA 2DGSA 2LEBA 1N54B 4Z2XA 2MY7A 1UFWA 1WHXA 2KHCA 2LEAA 3MI7X 5GAEU 1K73T 2ZJRQ 3R1HA 1HA1A 1F9FA 3P5TL 5LJ3Y 3ZZZA 1Q81T 3CTRA 2CQ2A 2CPZA 2HZCA 3G6ES 3UD4P 2J0QD 3VAKA 1SXLA 1VQ4S 5LJ5Y 3SMZA 2RT3A 3S6EA 2DHAA 2A3JA 2OTLS 1UAWA 3PIOQ 4TU8A 1CVJA 1B7FA 4YUDA 4LJMA 5DM7Q 4ERDA 2G4BA 3BO2A 5DDQC 3J7YU 2F9DA 2JRSA 2AD9A 1U1RA 3JB9k 2J76E 2E5IA 2MZRA 1UP1A 5CYJA 2KM8C 1HD0A 3Q2SC 4WIIA 3UCGA 1X5OA 2DK2A 2FC9A 2M2BA 2DNPA 2DGQA 4PRFA 2DNQA 2KXHA 5LXRA 1U1MA 2MQMA 3EGNA 2CPDA 1WELA 3B4MA 2X1GA 5IM0B 1WF1A 4UY8T 1X5SA 2XNRA 3BO3A 1YJWS 1X5PA 1RK8A 1N52B 1NO8A 2DITA 4YB1P 1NJIT 2PEHA
chains in the Genus database with same CATH superfamily
5MLCV 1EKRA 1D8YA 3H5SA 2VJUA 3P8BB 2CWKA 3ZO7A 1ZM3A 2CZVC 2XS5A 2RNEA 3ZNJ1 2VG5B 3UVJB 1S1TA 4OX6A 3RW6A 1U02A 1C4CA 1LW2B 2MKJA 4NRTA 2G1HA 5AXNA 2UUAF 1ZAXA 1H73A 2W7OA 3LAMA 3ETMA 2HRTA 1AA1B 4LFBJ 2V68A 2NSBA 4USIA 1I94F 4Q43A 2FVRA 4NYZA 1S57A 2IYIA 3HLUA 3IWXA 1U1NA 2BMBA 1B7YB 3ELHA 1KONA 1O51A 1U1OA 4YHHJ 2RIJA 2RS8A 1R8CA 2W9BA 2W7AA 4MKVA 3D1OA 4MYUA 1XWLA 3Q0AA 3DGPB 5F8GA 2MXYA 5DDOC 4CQ1A 3QATA 3C19A 3W9JA 3EXCX 3JSMB 3SFGA 3FNNA 3SFUA 3VAIA 4WFNQ 2VG6A 1WC0A 4DV4F 3DLHA 5L39A 2HHHJ 4NA1A 4K4TA 1ZAVA 2YWEA 2UUCF 4I2QB 4IG0A 4C8LA 2DGVA 1YBTA 3JYTB 2XMTA 2R7TA 1FKPB 2ILYA 1VQ7S 3QNWB 4ZLNA 3HF5A 3P5BP 4AQYJ 1VDHA 2MB0B 4C3LA 2FQQB 4RWXA 4X64J 2LA4A 3LWLA 2HS4A 4OJGA 3UN2A 4NLTA 3H8YA 4ZK7M 4P75A 1ELOA 1PILA 4AL7A 3IG1A 1SJ1A 1CC7A 2C3YA 5KAKA 2OH2A 3FZBA 3IRXA 2R8JA 3OD2A 3OVAA 4C3KA 4C0BA 4A8XA 3M8PA 1DTQA 5DQHA 1YJ9S 2W8KA 2M9KA 2C2RA 3NLCA 3MAQA 1H2VZ 3NWGA 3AT1B 2OP5A 5LSLA 1GTEA 4ED5A 4LFAJ 4MK7A 1TELA 5IM0A 4K4XA 3BKFA 5KT2A 4K4YA 4QQBA 3I0SA 2AGQA 1Q5YA 2GVZA 1NJWA 4A46A 3MDFA 3N4WA 5KT3A 2QLWA 2V9WA 2O3DA 3RAMA 2AZ1A 1FJEB 5EN1A 4ZPAA 1C1BA 4P10A 3W2WA 1E6YA 3X1LB 4GVBA 2GFFA 2E1PA 4ER8A 1MWYA 1WF0A 2DHXA 2Y1IA 2ZEJA 1J5OB 2IC3B 4HHHA 2YX1A 3QYYA 4OLPA 4WK1A 3GV7B 2HZAA 4DV1J 1UPMB 1S1VB 4Y2KA 3OBIA 2VJVA 4MJKA 3NNCA 3MUMP 4Q45A 2ALZA 5DG8A 2GVDB 5F9NA 4B3MJ 1LWFB 2NYHA 3PJWA 2GCFA 1XNRF 2C3UA 2Z0GA 3TYTA 2H1YA 2KRRA 5CCMA 3CCTA 5GAGU 2L9WA 3A3OB 1RYRA 3NCRA 4ED1A 4KSEB 3PR4A 4X2BA 4C8KA 2FGOA 2KHCA 4P2XA 1HA1A 4OIXA 5J2QA 2F1FA 2HVDA 1BWVA 3CJ4A 1NK9A 1SH3A 4NE9C 4F36A 2LQJA 1N5YB 2CZ4A 2R3VA 3UW1A 4V19J 3CGIA 1RADB 3M8ZA 3D7SB 1HQ2A 2XY5A 2IM1A 1XIQA 5IS2A 3JSYA 2DK2A 2XMVA 4CLUA 1KVJA 3OT9A 3HPOA 2HMIB 2W01A 3T5JA 3SCJE 4RW6A 1RWXB 5B0AA 1EKSA 4YY3F 1X5PA 3VR1A 4NCBA 2D41A 3GQCA 1NJIT 4JI6J 4I7FA 2YQ1A 3MEDB 3GR1A 4NI2A 1UZHA 4IG3A 3JAMU 1Q79A 5I42B 3CJKB 3KHHA 2WBRA 4F3MA 1JMTA 5C2CA 3QGHA 5EHHA 2WONB 3TEHB 2QIFA 2AJ2A 4CI0B 1WC3A 4FF1A 4C2MA 5GADI 1HR0F 1M1GA 3KLIB 3OSNA 1Z2LA 3DRSA 1X4HA 2DKOB 1JNRB 4FXVA 1UVNA 4OZ5A 2AEJA 1HNZF 2V94A 4ZHRA 4ED4A 2D69A 1GXTA 4KRWA 3FGVA 3M8QA 3QZ8A 4IOAQ 3ILIA 4JP8A 3NGUA 3J80Y 4H4KA 2A18A 4HL9A 4YMEA 4DSEA 1WKLA 1J5EF 3DM2B 1CJVA 3WZ0A 2PT0A 5F8MA 3ULHA 1PG5B 3L95X 5KFMA 4DR1J 2XCPA 4ZVHA 2W25A 2W4CA 3PYGA 3OVBA 2YPZA 4M5HA 3PTWA 3UWTA 3DLLQ 3T3FA 2NXJA 4C8MA 3GYXB 4DX8H 2UV8A 2XGQA 4L6V3 3DLEA 3TQEA 1FI4A 2AX0A 2HQCA 3NL0A 4ES3A 4WKRA 2JOQA 5DQGA 4HI2A 4A8FA 2IVYA 5EUHA 1BGXT 3A8EA 2QEXS 2BANA 2W2NP 4HHJA 3BGUA 4DL4A 2DGXA 1MMNA 3CVKA 1RLCL 2FHJA 3VVTA 4ID5A 3JSBA 3LP1B 4CWBA 4DV5F 2FLPA 1XNQJ 3NAIA 3CDUA 4NLGA 2EWHA 2AT1B 2W2OP 1JJ4A 3HVAA 2FHMA 3CCMS 1S5ZA 3DRPB 2HVIA 5HROB 2ZVSA 3C6TB 2E44A 2V69A 2P6TA 3PYEA 2RDJA 3UDCA 3D9BA 3GTYX 1H6KX 2HRYA 4XTTA 1Q82T 3TX8A 1JX4A 1RBOB 3EGZA 5KFUA 3FKBA 4KYZA 5DLFA 3TA0A 4DR6J 1FJ7A 2VQEF 1GMUA 3OUYA 2ATLA 3OL9A 2HHVA 2OMOA 2FUG9 5D3GB 1TKZB 4O4GB 1C1CB 3DDKA 1N56A 3G2XA 2XMMA 1WTFA 3LPYA 3EMTA 2JEIA 4JYAJ 3FRYA 4OJ3A 5E3CA 4LF2A 1HHSA 2BW7A 3NGDA 2YH0A 4WBFA 3M8SA 3MMAB 3TZYA 2W7PA 1YI2S 3MAAB 3EE3A 4LVNP 1EX8A 1TL5A 2MZJA 3CMQA 1KOOA 5HVFA 4UTGA 1B99A 4IG3B 3RB3A 1TFYA 1NDKA 4I67A 5HATA 5KFGA 4ED7A 1OY8A 5A8KB 1RQ0A 4QBUA 1WDTA 3MEGA 3ZNUA 1YJ7A 2PA8D 1SXLA 2FY8A 2RT3A 3GMGA 4O23A 2YKMB 2EFOA 1F9HA 3D0GE 4HHUA 2BJ3A 2IFXA 2EC0A 4JI0F 3QO9B 3CB4A 4DQSA 1CEZA 2W2MP 5CYJA 2FC9A 4JI8J 4ZVPB 2Z8QA 1S59A 1PJ5A 4ZJQA 1KLNA 1Y9OA 5ETPA 4NXMF 3SQGA 2FVQA 4UZBA 1I51B 4OYZA 3K57A 4JUZA 5K20B 4JI1F 3MM7A 4DN0A 2DGTA 2HQFA 1TUWA 4F4AA 1L3TA 3SCKE 3ILLA 5CYMB 3OTOJ 2C3OA 1X7VA 4DSFA 3C16A 3N28A 3GILA 3JQKA 3H5YA 2ILZA 1KR4A 4JV5F 4AL6A 4OYAA 1KQSR 3C3LA 4O3PA 1CULA 2F8MA 1VBYA 5J2NB 2HEKA 1KP6A 2GNKA 2AHOB 1U6BA 3KOAA 3M32A 4P71A 4WKYA 2KG0A 5KFNA 1HQEA 5K14A 4KT0C 2XLJA 2H3EB 3KLEA 4LRDA 3DI6A 3MR6A 3TWZA 4F4ZA 2ZBIA 2BQ3A 1RKIA 2GQ2A 4Q8FA 1EP4A 1S1XB 1VQNS 2M8HA 4QPTA 2IM0A 4DR4F 4GC6A 2BBEA 2WVBA 3MCSA 1NB2A 2A6OA 4LF6F 2HIYA 3RW7A 3PRDA 2RRAA 5JMNA 4I56A 1XK8A 3CNQP 4ID5B 4NZ0A 4G1QA 1VQYA 1NXIA 1SH0A 1CJTA 2I5JA 1RA7A 5KFHA 2OPQA 4WU2A 4FDFA 3GIKA 5KFOA 4F8RA 3KJVA 3PW0A 4QWDA 4PKDB 2UUBJ 3GWCA 1NM2A 1FEHA 5FJ4A 4TN2A 4BHQA 5KT4A 3C14A 5T14A 3H5XA 1VMBA 2GIRA 4LRBA 1HL6A 3BS9A 1XMBA 3JSRA 1HYSA 3PHEA 4IH7A 2RRBA 4IQXA 2CPEA 3UNGC 1GXUA 4F0HA 3G6YA 4NA2A 4AL5A 3DOMA 1YJUA 4J9RA 3M9NB 3WBZA 5I3PA 5IT9Y 2D3O1 4CYUA 4CH0S 4EBEA 3PW4A 4C0HA 2ZBQA 1T7PA 4N7TA 1VK8A 1RU2A 2P9EA 4M5GA 4BLGA 3HJVA 5D6GA 3M2RA 3VAJA 1B64A 2YNGB 3QIDA 2IBOA 2HVZA 3BQ0A 3DGVA 4LFCF 4DUTA 4ZP6A 3FCHA 4DPWA 2OUGA 4LSZB 3TX0A 1R6YA 2BDPA 4TYBA 2E5JA 2UV8G 4C9DA 4DPOA 2VFSA 1VHIA 4ZP8A 4O3QA 3KLVA 2VODA 1KD1T 2UZAA 1PJ7A 2MLXA 1O5JA 4RUHA 2PO4A 4MAKA 2GV1A 1U1PA 2N7CA 3G6XA 4U8VA 5GVQA 3CW2C 2P6SA 3FFIA 4QR1A 3S8SA 1JIHA 5H1SV 2DCLA 1T9VA 2U2FA 5KTQA 4WFYA 1YBAA 4J9UE 2RF2A 4P2FA 2MYFA 3T5KA 2VFRA 2J6SA 3GSIA 2IYGA 4TQRA 2WVDA 5CZXA 2B8QA 5KFTA 1X4AA 2B0GA 5KG1A 5BR8J 1WWHA 3OTCA 4KR0B 2ASJA 2ZKTA 2CJXB 3H7HB 2J7WA 1TVRB 1FTCA 4KE5A 2ZJPQ 3FK4A 3M6UA 1D3WA 2V8VA 3PX4A 4GVLA 4IDKA 4AYBD 4RZRA 1RTJB 3BH7B 2E1CA 4QWEA 2H5IB 1FDNA 3W8GA 2F4VJ 2K3IA 4OYMA 4USVA 3C46A 3NCPA 3W2VA 2V4RA 3N5BA 4NZ7A 2ZBRA 2GC8A 1HBOA 3ENQA 3Q8RB 2WSCC 4LRCA 2ZC3A 4UY85 1S0VA 4RUCA 2CNOB 1Q53A 2NXEA 1MSWD 5D0HA 4EWTA 2C2NA 2EFQA 1M0SA 5DM7Q 3KK1B 1SC6A 1YSJA 5CD4A 2PSZA 4LBIA 3UCGA 4KH1B 2DGQA 3AA9A 3MPVA 4M63A 2DNQA 4CZCA 4Q44A 2E7XA 1X5SA 1VRQC 4MIAA 4X65J 3MM8A 1NO8A 2IAJA 1Q4RA 4WE1B 3MFHA 2UXBF 1HNVA 2H9ZA 1OMSA 4LIRA 2YNFA 1S6PB 4CLTA 4H4OA 2UXDJ 1JLBA 2I5JB 4H4MA 2B56A 5HLFA 4IFYB 3ZZRA 2DNYA 1VQPS 4ELVA 3R5AA 3E01A 4NLPA 1LWEA 1HWUA 2KJVA 2GQQA 1ZZFA 4F4KA 5AJ3J 2CJBA 1IJFB 3N6MA 1UA0A 2B6AA 4F2RA 4FPRA 3VQTA 5CXTA 2OSRA 3T1HJ 3C6UA 1OY6A 2QGFB 2C2KB 1KBRA 4GO7X 4UOFA 2EC2A 3SI8A 3MD3A 3CUNA 3DLGA 4PWDA 3M6XA 3W9IA 2QL5B 3KLHA 3O3LA 1ZAWA 2GZOA 2K7JA 4BS2A 1RWUA 5L8RC 3QT7A 3H25A 3F56A 1W7WA 5F0UA 3O8WA 2DO4A 4A8QA 5A8WA 2Q3PA 2W9CA 2M5YA 2ZH4A 1MLAA 2E66A 3IFEA 1VJQA 1KVIA 1ZOTA 3B8HA 2NLWA 4C11B 1DTTB 1U0SA 3DRXA 2BE2A 5ADZA 3UD3P 4RUBA 2LXFA 1HNIB 1TKXB 1WACA 1WHWA 2PFDA 2HURA 2FLLA 1RTIA 2NPFA 2HLTA 3ZZUA 4LF4F 3E2EA 3QJPA 2DNLA 1SC1B 2AMCB 3BQ2A 4ECZA 4PAAA 4OZ1A 2JSXA 3BSOA 1JLFA 2ASDA 1LK7A 3ZZ0A 2AYGA 3BPSP 3V5RA 2R8GA 1H2TZ 2HBRB 3SDEB 3IRWP 4KKOA 3UDEA 4FYVB 4J7CA 2M4MA 1RWPB 1FNXH 4RW4B 3QZ7A 4B3SJ 1VJWA 1YGYA 2VOPA 1Q8LA 1N33F 2XWYA 2BVZA 4ZVRB 4DXLA 3FJ2A 5IC6B 4F02A 2R7UA 2GHWA 1HPZB 4F4YA 2VZ9A 2RU3A 4K8RA 4KV8A 1FJCA 2RKIB 1TKTB 3DDIA 4CT8A 2KO1A 1IKYB 1PJ6A 1LQ9A 2J0SD 1R8PA 2N3LA 3JTNA 3PKMA 2PA3A 2QV6A 3TI0A 1NKEA 4IFVA 2R7XA 4M5JA 4DS5A 1HBNB 4XK8C 2VQFJ 1L3UA 4WZMA 3W65A 2YBVA 1RUSA 4UQTA 4J91A 4KHRA 3TEGA 4I68A 4Y2CA 1VQ5S 1R0CB 5KFPA 2V67A 4WZQA 1S10A 1TL7B 3FMWA 1N6QB 4K0KJ 3RUBL 5D4OA 2FJDB 2Z30B 3K89A 3V81A 1Q5VA 3LUYA 1RT1B 2EFGA 2Q1LA 3TUPA 1Q0NA 3D0IE 1FXLA 2PC6A 2KFNA 4X66F 1VQ8S 4OV1A 5ETOA 4U67Q 4L3NA 2YWFA 3NAHA 2YH1A 4O44B 2JEJA 1PAUB 1DZ5A 3B82A 3MR7A 5KT5A 4CH7A 2ATCB 2HBQB 2XEXA 3IS9B 2HRUA 5LMNF 1VLOA 2BV3A 4Z2XA 3A8IA 1VS3A 5KFZA 3DN9A 1V6HA 2OPPB 1U8SA 2DR7A 1Q81T 5F41A 2KDOA 1HQUA 4A48A 3I82A 3BKUA 3M2UB 1VQ4S 2XZDB 1IKVA 5J2PA 3K2YA 2B43A 2Y3YA 4K50A 4DLEA 4UW2A 2F7VA 3SIPB 3MM6B 1YJVA 4CM2A 2IHR1 1MG7A 3D67A 1N36F 3AOCA 4P73A 2AD9A 3T6BA 3LGHA 2J76E 5E3PA 1TV6B 1TZ0A 1IR2A 3EGNA 4AT1B 5KFJA 3PEJA 4Z37A 3KFWX 3LP0B 2OEKA 4QWCA 1JXVA 2DITA 4IO9Q 1IBCB 2Z56B 3OLBA 4I6AA 1LWCB 2VG7A 1U26A 6FD1A 1NDCA 2HNDB 2QRRA 2R2RA 2XMAA 1XMQJ 4A8KA 4ECYA 1SJRA 1SBRA 3CCWA 2HHSA 4PPDA 3FC9A 4NLYA 2NCKL 1D0EA 1IBKJ 1RT7A 3OL7A 2MQPA 1VRUA 2DY1A 5E3QA 4HVZA 2J8AA 4B02A 3HVTB 1F2HA 3UPFA 2HFUA 5CD4H 3ISND 1BQMA 4U9RA 3H4DA 1FK9B 4RKUC 3AY0A 4TQSA 1S79A 3D6HB 4UT4A 2DT9A 1REGX 4RW9B 3K58A 3MF5A 2KJWA 1IQZA 4Z7CA 4J9NA 8RUCA 1CJKB 4UOHA 2O01C 3V4MA 3J7Z5 1U24A 4DLGA 2OPSA 2CQ0A 2DNOA 4B3TF 1Q95G 2ROGA 5DG7A 2IA6A 3FVYA 3MWBA 5G0RB 4Q2MA 1PIEA 2W1BA 3CCLS 4RBTA 3MM5A 2CPIA 4R8UB 4DV6J 2MKKA 3NY0A 3FBBA 4JI6F 3HI9A 2ZUAA 3AB4B 1SKRA 4DI6A 2J9CA 2IJNA 2GMJA 3L7PA 5HBMB 3H2UB 3OR1B 1X9MA 5A0YB 2HFZA 1RU1A 3MMCA 4NLRA 1OS5A 3RU0A 1JXLA 3MOJB 2IVFB 4DL2A 3AOBA 5F9LA 4ZP9A 5HSPA 2DVIA 1RT2B 2LECA 5LSOA 4KGXB 3J81U 4KQZA 5IFMA 5HAOA 3MMJA 4CM0A 1VQMS 1WTBA 3U02A 2IMWP 1YHQS 5I3QA 3PHTA 2PGCA 4C98A 1HFEL 2H4WB 4DF4A 3EVOA 5H9EJ 3D28A 5A6PA 4BCAA 2G13A 2DNHA 3Q89A 4HKQA 4PWWA 2KVIA 2MSTA 1OPIA 3MPYA 4X4OA 3BH6B 5JVGQ 5HK4A 2LXIA 3QFWA 4IUFA 4HDHA 3UDVA 4X4TA 3I9ZA 4WP9A 3HSZA 1RHQB 2AJQA 1NPKA 5DZ6A 1T9UA 4F50A 3HHLC 2JFKA 3KUEA 1DLOA 1YG0A 1CG2A 2IRXA 5T7LA 2YVSA 4P7TA 3SZ2A 5ETKA 3IWNC 5C7PA 2XGPA 4DR1F 1KHWA 4ZPTR 2R4FA 4I69A 3C2PA 4M5MA 4LF8J 1Y0HA 3GV8B 4I4BA 4LSLB 2NREA 2HNZA 1VHFA 2JL9A 1N34F 1H3DA 4FVCA 2YTCA 2DXDA 2P9CA 2MLZA 1SV5A 2AJ0A 2E5LF 4LF1A 2XMJA 3TQ1A 1N32J 1U4BA 4KB7A 4FYDA 1M90T 5CA5A 2X1AA 2V2ZA 1REVA 1DARA 1IKXA 1X4GA 4AD6A 3W62A 2OLWA 1HMVA 3ZTOA 1RT4B 4KHMA 4DG1A 2WZ1A 1JLCB 3NGTA 5JXSA 1NKCA 4N76A 4ZP7A 1EB0A 1HD1A 3Q86A 2XULA 4DQIA 4JI2J 3KG4A 3R6LB 1EZZB 4DN9A 1SKSA 4NX9A 2BRKA 5B0EA 3PJ9A 3LALA 3PEHA 4ED8A 1Z2ZA 3BGOP 3P3DA 5GADU 2UXCJ 2CPYA 4YN3B 3RRHA 2DH9A 3SV3A 3FEZA 2W2QP 1NUEA 3HZGA 5LSRA 5GAHI 1QTMA 4RW7A 2FLOA 1SQEA 4IQMA 1F9FA 5LJ3Y 1NH7A 3ZZZA 2CQ2A 4CLSA 2NZCA 2JHEA 1VRUB 2V4JB 2J0QD 3KLGA 1IN0A 2WK4A 4N41A 2JEFA 5FD1A 1NSPA 3R9LA 2ZNYA 2ALYB 3HHLB 2VPZB 3T6JA 2C2OB 3JB9k 4IH6A 4N5SA 4X62F 4CNZA 2HWTA 3TARA 5DRKA 3IC1A 3L09A 1UFKA 1HKAA 2OI2A 3QMQA 4U7UD 3IAS9 1AZSA 1SH2A 3B4MA 1C4AA 2EKYA 5LM7E 1N48A 1RWMB 2M3DA 4P2SA 2FHJD 1L3SA 2YNIB 5K9FA 3S1TA 1TAQA 4ZVGA 4Q5VA 1S1UA 3EJMA 2NR0A 3R6GB 3OJSA 1IWGA 3NMRA 3M1VB 4ALZA 3MM5B 4NWBA 3M9OB 4B3OB 3RBEA 1URNA 3T1YF 5F8JA 1FRKA 2F3JA 4DUYJ 3Q23A 2RDIA 4DR7F 3UQSA 1NLKL 4B08A 3DRRB 2ZHAA 4FYXB 4X4UA 4RLEA 2PMWA 4QU7A 1AFIA 1UMJA 2ASLA 2BW2A 5LOQA 3W3SA 3POTB 5CCLA 2CAJA 1S7HA 4Y3CA 3IA0A 3TRGA 4Q2LA 3IBWA 4ZCKA 3HHDA 1RAHB 2OEMA 2VD3A 3MEEB 1QVFR 5T41A 4P2MA 4DHVA 2WTFA 4C48A 1TUVA 4DFKA 3BBFA 1VRTA 3W7BA 2EK6A 4KGVB 3MXHP 4EI2A 3K5NA 4R0EA 2V6AA 4K4ZA 3MMBB 2YKNA 3RJMB 4EBCA 1KQKA 1ZA2B 2JC1A 1D09B 2RILA 5SZTA 3N9UC 1B0PA 2KG1A 2G0IA 2KT2A 1QE1A 4IR9A 4ZOSA 3TP2A 4MK9A 5T7LB 1H2UX 3EZOA 2YNHA 3OFHA 5C2GA 1KWMA 3OR2A 3TUJC 3SYZA 3QT5A 1T9YA 3ITHB 4LRAA 3W63A 2V2VA 4DR3J 5IZHA 2H4YB 4JI7F 4FS2A 5IV4A 3PRVA 5RUBA 4KPYA 4J5OA 2N4CA 2HHXA 1HIYA 5F3ZA 3GU0A 1YKWA 2CIMA 4NLQA 3HVWA 3CC2S 4F3QA 1FRIA 4DSIA 2FB0A 2HFVA 2R7OA 2JEGA 4LIWA 1TL3A 4RW8B 2F4FA 1FXDA 2BACA 3EWGA 1S6UA 4IH5A 2FJBB 5C25A 1ZM2A 5HJXA 1S9FA 1YZ7A 3I0RB 1DFDA 5J2MA 2CQ4A 2X51A 3HFKA 1Y5IB 1WC6A 1TL1A 1C0UB 1VQSA 4WP8A 1RT3A 2YXLA 5A8RA 1SJ4P 3V6HA 5HMZA 1MMDA 2P9GA 3EX7B 2B51A 5HANA 4Y2IA 2FPHX 1FXRA 3ONQA 2ACMA 4OQJA 2Q66A 2GA7A 2VHGA 2MHNA 5F3TA 5IQ6A 4DCJB 2D9OA 3OHBA 4DV7F 1IKWB 3ET6A 3F44A 2Y1LB 2CNNB 3AXMA 2QLJB 2FHOB 2RHQB 2WB4A 3MECB 4FKXA 4CO5A 3C8YA 2MGZA 1LK5A 4TY8B 2KU7A 3CD7A 2V8PA 4WFAQ 1HBUA 3TOQA 2R9LA 2V63A 2CQIA 1WHVA 3GP9A 5E33A 3HP6A 3B78A 1UVLA 1R0BG 4ANCA 2XC9A 4C7QA 1NJZA 3GIMA 1UPPA 3DU5A 3NMAA 1NBEB 3TR5A 1FFSB 3NNAA 4USJC 1G2EA 1RTHA 5ETLA 1K44A 2I1RA 3DMJB 3TJAA 4YEAA 5M2PA 1EAYC 3TJ9A 1YX2A 1CC8A 4LQ3A 2OPRB 3AJ2A 1S12A 4DCOB 3PNIA 3W5XA 2Y1JA 3AHPA 5E3AA 4ECQA 2LQ8A 3Q8QB 4ICLB 3CO9A 3S6EA 3Q8PB 3TANA 2NS1B 2D1CA 4OHXA 3CJRA 4Q0BA 2GJFA 2K1RB 3G82B 5DDQC 1JKHA 2UVWA 3FSXA 2ZM6J 3T9NA 2QL9B 2DR8A 4CTAA 1KLMA 4RBUA 4YQWA 5C24A 5L38A 4K5RA 3RRKA 4NCAA 3K59A 1YVFA 1QLNA 3AJDA 4TXSA 1YBUA 4FYWB 3PYDA 1NDLA 1WI6A 4Y2AA 3DLJA 3CJ8A 3W61A 2WOMA 1YTYA 1T9WA 1U49A 2X7IA 2RQCA 1RT5A 1PYSB 5GMEA 4DV2J 1UVKA 3ILOA 1SJFA 2AYMA 3SXLA 2R7SA 3D54A 3NBPB 1X4DA 1YJRA 3N0VA 1XQIA 1RT6B 2XG8A 1V5VA 4FF2A 5KFWA 1UWAA 4RBVA 1JLAB 1GMWA 4B9SA 2UUAJ 2G1DA 2J7KA 3H98A 2HNYB 2G2ZA 4DS4A 2CQ1A 2XMWA 4J9PA 4LSNA 4KFBB 1SC3B 4QIEA 2HYIB 1MROB 5F8LA 1I94J 3VQSA 4ZA1A 1R3NA 3US5A 3GB0A 2NXNA 2WAQD 1PGZA 3DKDA 3E8OA 3DLKB 1S99A 2VBWA 2DTJA 4AXIA 4RWWA 3DYAB 4PQAA 1M5PC 2DR9A 3CCRS 4B9NA 1FKOB 1BQNB 1M1KT 2GHVC 4EK2A 1S9GB 2V34A 1R43A 2VFVA 5B09A 2XYPB 3IM9A 4FF4A 3ZTSA 1OIAA 2DRAA 2CQHA 4ZPCA 2Y8WA 2VC0A 2ZWOA 4M5DA 4OYWA 2ZBPA 3LGMA 2BE9B 2OFGX 1RT3B 4NMLA 5CHCB 3QQCD 3Q8SB 1IJEB 1YRTA 2B8PA 5E5NA 1RDRA 3BF4A 1N0UA 1U0HA 2JFDA 3CF5Q 2J9DE 4ES1A 3QIPB 3BSCA 4XAKA 3DNCA 1FNOA 1VK3A 4CLFA 2UUCJ 2XM3A 3GCWP 2WW8A 2BJ9A 2WVEA 2OMLA 2KB2A 2IPOB 2GIFA 1R0AB 1WOSA 1IBMF 3Q22A 2R7RA 1JLGA 3R1LA 4FPIA 2BEFA 4RPFA 1P9QC 2KYZA 2H65B 5DGAA 4OZLA 1NPPA 1U09A 1G3OA 2MJNA 3V6KA 1R6VA 1T05A 4QU6A 4X4QA 3KK3A 1M5KC 5FDLA 5B0FA 1JLEA 2GJ2A 3D0HE 2KVQE 5EX3A 3MUTP 2AGOA 3GONA 4JI5F 2LLZA 3FMBA 2J6TA 3AD9C 3AJ1A 1SIWB 2LP4A 2C2EA 2EVZA 3MPUB 4DFMA 1H38A 1XBWA 1JWWA 2IA0A 4Z7YA 1XC9A 3J81Y 3VF0B 3MR5A 1RWWB 1JJ2R 1DURA 4XO0A 2ZD1B 1YRUA 4JOUA 2E7VA 2ZWPA 3GIRA 2UVUA 2Y0BB 2V4QA 4JV1A 3CJSA 4DV3F 1VC6A 3VAHA 1XR7A 3IR5B 4L74A 2BUNA 2M70A 4OZ3A 2M0GB 4USHA 4ZJOA 4USKA 2DNNA 4E2FB 2D74B 4ZCIA 2MKHA 1W2BR 3UDLA 2FZGB 1SKUB 3G8SA 3FZ2A 3BGRA 2B5JB 3DOKB 1IVZA 1U1LA 1WJ9A 1Y5LB 1U7LA 2PD1A 2A6MA 4ZVQB 5CYQA 5IC4B 1BC6A 3OSPA 1FKAF 3WIVA 3VGVA 1S0NA 3AA8A 2CJAA 3LWMA 2I6WA 4JI3F 3KLFA 3KHRA 3ZFVA 3MAHA 4DQQA 1AROP 3W5YA 4C6AA 2VQFF 1P6TA 4R5PB 3KK2A 1CLFA 2ZHOA 5LJ5Y 2GQCA 3QLHA 2A3JA 2QC3A 4KO0A 3BN7A 1KHVA 2YX7A 4Y28C 1UJ6A 3BBCA 1GQEA 4F0MA 3J7YU 3G8QA 3E51A 1SPBP 3Q2SC 2HK2A 1X5OA 3VGTA 4DJBA 1AT1B 2IM3A 3H0PA 2X1GA 4PQUA 1GXLA 1WF1A 3A12A 4HACB 1ZA1B 3FSYA 2B9EA 4P72A 1OYDA 2YQ0A 3AOAA 2QYCA 4F0KA 2A2CA 5L1IA 4X4RA 5L1JA 2PEHA 3L3CA 3NWRA 1RI7A 1XR5A 3R5BA 1F5BA 5LMUJ 1QVGR 3N5FA 4YY3J 2VONA 3THPA 1S0OA 1WC1A 2DHHA 3HSJA 5F8HA 2RQMA 2CPFA 5DJBA 4G1PA 4HTIA 2YX4A 3G8TA 3R5CA 4KY3A 1XJWB 2BKOA 5I4MA 3KTQA 3HZEA 3CDBA 5L1LA 2CPJA 1HR0J 4DU7A 3NEKA 1UWBB 4OL8A 2AYBA 5KFXA 5F8IA 4EZ9A 3HULA 3TVZA 2AEFA 4YR3A 3GFXA 1HNZJ 3X3UA 5E41A 5DQIA 4O3RA 1LWXA 3J7AN 2XBPA 3AODA 2V2KA 3CT9A 4HR2A 5KFKA 4DDFA 4CO1A 1RAEB 2KZZA 4MH8A 1DHMA 2J0WA 2LQBA 5DG9A 3GV5B 1XMQF 3A13A 4BWMA 1J5EJ 4X4NA 2RJZA 1SUQB 3G96A 3K8WA 1LW0B 1EJ7L 5B08A 2VV5A 2VUGA 1LKZA 2HFSA 3GFZA 2HAIA 3RBZA 2O67A 4JI4F 4NLWA 1NK6A 1FRMA 1WNEA 3BDPA 2WHOA 1T03A 2VOOA 2LVWA 3I5CA 2MMYA 2OIHA 5HP1A 2NYIA 4DBQA 4RNNA 1DY3A 1VI7A 4OZJA 3GR0A 2DPJA 2OO4A 1NJXA 3MM9A 2FJWA 4PUOA 2HPUA 2P2CB 1UJ5A 5IXUA 1LXNA 1IR0A 4N47A 5C42A 1Q16B 2MY8A 4FNHA 3UN5A 2AU0A 2HFNA 5BYRA 2ZH5A 1S1TB 3RGIA 2CXEA 1U48A 4DL0C 1WOPA 4ED6A 1HBMA 3G6VA 2C2DA 4PXBA 2RDDA 3CJQA 2K06A 1PYTA 4IRKA 3QGIA 3NXZA 1FNMA 5IT4A 3H42A 4DV5J 1I5OB 3SCIE 1XEZA 1WF2A 4U8YA 4LBHA 1RBAA 3SSSA 1YITS 3DCAA 3ILJA 5D0GA 4DUZJ 4P52A 4AE5A 2PI4A 3BYRA 1G1XA 5K5MA 3V2UC 4EO6A 2POKA 1WC5A 4RX6A 3UCUP 2W9BB 2N3OA 3HHLD 3UO0A 2OFHX 3PY8A 4Y6IA 4HT7A 4LQ9A 2XSJA 3FQLA 1D9DA 3I55S 3PRBA 4OJHA 2VQEJ 2RMLA 2LCWA 1QAIA 2ZNZA 4Y34A 5I3UA 5LT5A 2VG6B 3ISNC 3OVSA 3MCOA 5H9FJ 3MUVP 3OPKA 2OSQA 3NRBA 3T5LA 3CC4S 3G4SS 4DQPA 4A47A 4J9OA 4KGMA 2Y8YA 4IG0B 1R27B 4KIAA 4PG6A 2DH8A 4OYPA 2F63A 5SUHA 3PX6A 3PXGa 1JLQA 1X4BA 1UEKA 2AJ1A 2BYCA 1Q7LB 2DGSA 2C1EB 3K5OA 2IIHA 4J9LA 2ZOGA 1LXJA 1S1WA 4GKJF 2HZCA 1KNZA 5B0BA 2ZKUA 3IG1B 3FBEA 3OL6A 4ZITA 4GKKF 3IRXB 3PKYA 4QYZK 4DMZA 2G2YA 3M8PB 2LFVA 1DTQB 2Q6BA 3KUHA 1RHKB 3N79A 2ZH1A 3P4UB 4WIQA 3OFFA 5ETQA 2BM0A 2E7WA 1FE4A 2XHCA 3TZXA 1HD0A 2R7VA 3OTEA 1BUXA 3D6TB 4C8YA 4ZN3A 3HXMA 2V0NA 2MQMA 3BPDA 4JI0J 4I6WA 3LTOA 5IM0B 2VL1A 4P9SA 1RAAB 3LA0A 3HCXA 3I0SB 3KJQB 1J27A 2GVZB 4MKBA 2CUYA 4NZ6A 4JI2F 3BR9A 1MU2A 4NXMJ 5GMDA 3HMJG 4N56A 2LMIA 2UU9F 1C1BB 2VFUA 4RL1A 1SL2A 4LBPA 3W2WB 1F60B 1E6YB 2YWHA 2CPXA 4GVBB 1U8WA 4UQGA 1ZPWX 3KKFA 2HW3A 3B6BA 5K8OA 4XDDA 3M30A 3RTVA 3TAQA 1FRJA 3QSYB 2EFPA 2K7KA 4BDPA 4WK3A 2HHPA 4ZLPA 2QE5A 1HNWF 2O5DA 1RAJA 2KXFA 4JV5J 2FD2A 3V6DA 1Y7PA 2Z2ZA 1T03B 2LQ9A 4F67A 1E6VA 1IBLF 2OTJS 4KHPF 3KDOA 1DQAA 2FJAB 1NNDA 1IXKA 4A8OA 2GMHA 4LF5F 1GX5A 1RHUB 5KG0A 3LAKA 3TZZA 1UW4A 3LP2A 4L73A 4NCGA 1KFDA 3VALA 4CT9A 1ZETA 1QSLA 4DR4J 4H4KC 4EEYA 4ES2A 4LF6J 3HJFA 2F9JA 1Q8BA 3HD2A 4PXDA 5J2QB 1O0PA 3TA2A 2LEPA 2AV5A 4ILMA 2YKPA 4URGA 5KFVA 3T9ZA 3J80U 2AYEA 1CQMA 1RTDA 3ISZA 4X4VA 1MMLA 3IGVA 4TU9A 4WTYA 1YK9A 5MAOA 1U25A 3HD1A 4PEOA 5FLXU 4K2JA 1WSRA 4RW6B 3Q8UA 3FBCA 2RAQA 3U7JA 3PV8A 2AGPA 3WX4A 3PCOB 2CVIA 3K5MA 4W98A 4PG4A 2FVPA 4MYTA 3U27A 1H72C 2AW0A 1X5TA 4NA3A 1Q1KA 3TVKA 4I7FB 2R2UA 3E3XA 4NI2B 1OSDA 2WSEC 5HO4A 2J0XA 1C2PA 3EDRB 1CS4A 2RU9A 5AT1B 3NGKA 4CIOA 1QY7A 4JBCA 5GAHU 1M5HA 2YWGA 4LFCJ 2QYGA 2H48B 2KRBA 4Q8EA 3D3BJ 8ATCB 5CZVA 1RP5A 3DRSB 4OYOA 2VG5A 3MPDA 3UVJA 4MIWA 1M5OC 1DQ9A 2ZBCA 2F40A 4ZHRB 1LW2A 4QWAA 1I3OB 2M88A 3SSRA 1EETA 3EZUA 2IDEA 1YJTA 4P74A 3CDAA 3M8QB 2OGUA 3OW2R 5E2QA 2DJWA 1H7XA 3T41A 2EBEA 2QA1A 2LU2A 4J90A 3DU6A 3ZTPA 3MOZA 5HMYA 3UCZP 3CJ5A 3FCWA 3HHNB 4QPXA 1MNEA 2W9AA 3KHGA 2JVRA 4WP3A 1V3SA 3G87A 3SCLE 1CJVB 2VA3A 3I5AA 3I6PA 5D8HB 4ZVEA 3MCNA 3HKWA 4NLXA 3GJSB 2HVHA 2MQ8A 3DXSX 5F0WA 3PJXA 2C2ZB 3QT6A 3VZHA 4NLDA 4RUAA 4C4WA 1KOHA 1N4LA 2ACYA 3CJ0A 4CLYA 3DGPA 3NCQA 2DPIA 2V50A 5D77A 1RWNB 3JSMA 4A8WA 5EWGA 2NZ4A 4FXDA 3QFHA 5ETSA 4E98A 5A6WA 1KSPA 2FVSA 4GO5X 3DLEB 1YDLA 1T11A 1ZPVA 3O44A 4WFZA 1VCTA 2JLGA 2C42A 4TY9A 2EFVA 4I2QA 3AQPA 3JYTA 3PX0A 1FKPA 4YDDB 2W8LA 2QT7A 1UAWA 4ETXA 3PIOQ 4DQRA 4ED0A 2QMWA 4LF7F 2FJVA 2BANB 1FRLA 1FD8A 3RRGA 4ZIVA 2I8EA 3ZC4A 1TMMA 5G4DA 3GYGA 1O8BA 2BJEA 4LF9F 3R97A 1WUUA 3GFHA 1JB0C 4HTJA 2PFFB 3BDEA 5BXIA 1FX4A 3FUYA 1BE4A 3JQMA 3SEOA 4QOTA 3RB6A 5CAAA 2VKZG 1FESA 4C8NA 4HH1A 4ZCLA 3BQ1A 4ELUA 2UXBJ 3TAMA 1RCOB 3CCVS 2YPYA 4LT6A 1RYSA 3DLBA 4MK8A 2DNZA 3OQ2A 2Y1RI 1F5AA 3OUYB 4QYRA 1X4FA 3R3TA 2KN4A 3NG8A 2J9EA 2CJQA 1QD1A 1ULRA 1AUDA 3AXKA 4UZCA 2AJ4A 1FERA 4AFFA 1NHUA 3BSAA 4TU7A 1PYOB 3JQJA 3VGUA 2JH3A 1U2RA 5L9XA 1UEUA 3ZZOA 4DV0F 1GAOA 3GFYA 4NXNF 3TJ8A 3JXOA 1GFWB 1EARA 1RTZA 4B9UA 1VIXA 4CO3A 1J5OA 2IC3A 2A2DA 1FE0A 5DM6Q 3CJTA 2VBYA 2CA9A 4USWA 1VC5A 2V8DA 5H9EK 5HVGA 3NOGA 4DCPB 4FVMA 2QZ8A 4USMA 2EW9A 4DPUA 3SSQA 3R7SB 1S1VA 1FHTA 1EQMA 1UVJA 2FIUA 4LR7A 1SQGA 2GVDA 4B9MA 1LWFA 2CRLA 1YQHA 1XR6A 5HL7Q 5AE1A 3RR8A 4H54A 3MEGB 4O0IA 1WI8A 2G9OA 3M8YA 3EICA 4L3KA 4OX9F 4MKAA 4QR0A 3F0NA 4EMDA 2XHWA 3Q83A 1EETB 2JDJA 2E1RA 1TFWA 4N8OA 1WDDA 1YIJS 2DR5A 4OHZA 2NPIA 3BM7A 2LXUA 2CQ3A 3SQGB 1YJNS 2MKIA 1AB8A 4M95A 4LF4J 1N5YA 1SB6A 3MM7B 1K1SA 3FCVA 3THVA 3U1LA 2Q6CA 3CDEA 4PWUA 2KZMA 1X8DA 3G9CA 2J6UA 2DEJA 2M8DB 1RWKB 1I1GA 4PYDA 3TAPA 2ZZNA 4PG8A 3C16B 2HMIA 5IT9U 4O3SA 3SV4A 2VPYB 1U1QA 2BQUA 1NAQA 2EG2A 1Q8IA 3CD5A 1F3FA 2H5JB 3MZIA 1CULB 1KN6A 3RZAA 2CJKA 4M1KA 3KDNA 1N33J 1TR0A 3M32B 1H7WA 4K5SA 1GMWD 1NK0A 1HQEB 5K14B 3MEDA 3MPWA 5I42A 4KGZB 3KLEB 1OY9A 4P7VA 1UFLA 3CJKA 2X1BA 3DI6B 5IWAF 4WXWA 4X4SA 2WONA 3CPWR 2FZKB 1EP4B 3F41A 3BN4A 1S4FA 1WEYA 9ATCB 3KLIA 1R8BA 2VIHA 2AEMA 3KMSA 2DRDA 1H0HB 3MD1A 2FY1A 1T8EA 2B4VA 4G1QB 1FJGJ 2AF6A 1CJTB 4DSJA 1BY9A 3TO8A 1S0MA 2OPQB 1NKBA 3PW5A 3KJVB 2CQCA 1RKJA 3DOLA 1WG5A 2KYXA 4XDCA 2MLYA 5E0OA 4EGLA 3C14B 4IOBA 1L3KA 1FT8A 2CG4A 2F8HA 2DCUB 1PO6A 4QYZJ 4X66J 3OXLA 3R7NB 3QT8A 4U6PA 2E29A 1HYSB 3CCUS 3FEYB 4NLUA 3TAMB 3UD5A 5U47A 3DM2A 3QWUA 3HFZB 4DL3A 3PFOA 4B3RF 5LMNJ 3DOMB 1IM4A 1HI1A 2CPZA 2NSCA 4CYUB 2HKEA 3WQPA 4WWSA 3SMZA 1Q8KA 1H98A 5JJBA 2PMHA 5K8NA 3PACA 1J2VA 3M2RB 2HBZB 3HKZD 3J7YI 3CCZA 4URQU 2G4BA 2F9DA 2E5IA 3KYLA 2MZRA 3IP0A 2D3ZA 1HWIA 2M2BA 2DNPA 2XY7A 4PRFA 3JAMY 2CPDA 1WELA 4O3OA 4EBDA 4ED2A 1N36J 2FLNA 4NLVA 3K5PA 2X3GA 2MDAA 1AXQA 1N52B 1VYAA 2QMXA 5HN0A 4TLQA 2FDNA 1UVMA 5EWEA 1NCLA 4NOHA 4YR2A 3FFIB 4LFBF 1T94A 2GMLA 2IM2A 2BJDA 3LP1A 5L1KA 2J5AA 1TUGB 2ABYA 5AXKA 2APOA 2RF2B 1WEXA 1FWPA 2WB1D 2KT3A 3DRPA 3MR3A 3N6LA 5HROA 2D3UA 2PN6A 3ICLA 3C6TA 2FTRA 4YHHF 2FJXA 2AIRB 3PYFA 2SXLA 3BSNA 2D3OR 3D66A 4QIVA 4IR1A 3TA1A 1XERA 1ZM9A 5GAEI 3BR8A 4ZS6A 2HHTA 1B0TA 3CJ3A 4NLOA 3R7BB 1B4SA 1T3NA 2IRUA 3OFGA 3G71S 3LQVA 3EM1A 2MKCA 1DAXA 2AJFE 4IDKB 2B9WA 5D3GA 3KWMA 3SQOP 1TKZA 4O4RA 4O4GA 1C1CA 3R5DA 2AQ4A 2KT5A 5HMXA 1NHKL 2XS7A 1S76D 2VU5A 2X1FA 3I31A 3W1YC 2HHHF 3D4JA 4X4PA 3W2VB 5BYSA 3AD8C 4B3TJ 5LMUF 1HBOB 5AE2A 3GJTB 2PE8A 4AQYF 2JNJA 2A0FB 4ZCMA 1UA1A 3MMAA 4ZLJA 4X64F 3MAAA 4WTOB 2U1AA 1Y4ZB 1ZH5A 1VLYA 4OHWA 3QPIA 2Z57B 3B54A 2OHDA 4QR2A 2GGPA 3Q2TC 4QW8A 4RJVA 1BMQB 4PXEA 1RJJA 2QMUB 5A8KA 2VB6A 3A3NB 4UF4A 1TMJA 4OX7A 2QG9B 4FF3A 1RSCA 3MM8B 2IAJB 5JUMA 3D2WA 5BYQA 2YKMA 4MKYA 1HNVB 5KFIA 4LFAF 2YNFB 2FHKA 4H4OB 3QO9A 1JLBB 1CPZA 4H4MB 2DYAA 4EFAC 5HLFB 2Z58B 3W60A 1NDPA 2BABA 1K0VA 2GJIA 4B17A 3E01B 3EPGA 1LWEB 3RBXA 3ZXWA 3DOLB 1JJHA 1TP7A 4GMKA 3G86A 4LUBA 3PDNA 1L3VA 3JTOA 2KXNB 3TUIC 1HLWA 2B6AB 5CABA 1A7GE 4U7UK 2FVCA 3C6UB 4X84A 5CYMA 1A9NB 1HI8A 3R2CJ 1VQOS 5FLXY 4WYWA 3EVWA 1IM6A 3ETOA 1AUSL 3BJYA 1F9EB 3DLGB 4DV1F 4PWDB 4DOZA 1N34J 2DNKA 1K8AT 5J2NA 4FS1A 2ZHBA 3BB5A 1WEZA 1RAOA 3KLHB 2L41A 1IUJA 2E5LJ 4NYOA 4B3MF 3ZZYA 1T3OA 4FBUA 3K8VA 3PZPA 4K7QA 3I87A 4OZNA 4HEA9 2EG1A 4AXJA 5A8WB 4GC7A 2W9CB 3HM9A 3M9MB 1S1XA 4ZDNA 1MN9A 2LKZA 3HDSA 2UVVA 2JWNA 2VDHA 4OI3A 1LV5A 2DD8S 3C66A 2QTWA 1X60A 2BE2B 4B9TA 1B70B 4D3GA 4LRFA 1KEKA 4YP3A 5B0GA 4KTQA 4CP5A 3VAMA 4XPCA 5B0CA 3M2VA 2QL7B 3I32A 7FD1A 1W2IA 1N5VA 1PC5A 2JLFA 4YB7A 1Z1ZA 3UFCX 2LEBA 4ZVSB 1RTIB 2BOAA 3FQKA 1YLXA 3VZIA 1BLUA 2PIIA 3WX8A 1K73T 2ZJRQ 3R1HA 3P5TL 2XO6A 5KOXA 4K2XA 4DUZF 2HQ3A 4IKAA 1DJ0A 4KBIA 2AX1A 1JLFB 4R25A 3PW7A 1HNXJ 2WVFA 2B7CB 3GSDA 4KKOB 3BO2A 2UVRA 2OELA 1JQGA 4PXCA 2KM8C 1GH8A 2CKWA 4CO2A 5LXRA 2JZ5A 2OD6A 3BO3A 3KMQA 4X62J 2QX0A 1RHMB 3OJUA 3H4BA 1N8RT 1BQXA 4KV8B 2KH9A 2R8HA 4YR0A 1QM9A 3N01A 2ZH9A 2BQRA 4RU2A 3NKYA 2YNGA 2B3TB 2OKQA 1AYEA 4IFVB 1N5SA 4NL5A 1VQ9S 4TYAA 2UUTA 1CQNA 4W90B 2XQCA 3T1YJ 2FZCB 2E9TA 2Y9HA 3K0JA 2BA9A 4ECWA 1RLDA 4DR7J 2BOPA 2GGPB 2DNRA 2YKQA 3V81B 2DGWA 2DXFA 1D8ZA 1MN7A 2HS0A 4ANDA 3CCSS 1P9YA 3NS5A 5KFEA 4L76A 2VA2A 4NASA 3OV7A 3UR3C 2HZVA 1F0XA 1D1UA 2X3DA 3ENVA 1P1TA 1RXOB 2WCXA 1SQFA 2AP6A 6FDRA 1UETA 5J1EA 2PEBA 3NGSA 1VBXA 2DH7A 1RAGB 4ZN1A 4IO1A 3CSKA 3KNAA 3MR2A 1TVRA 1HWJA 2CWXA 1R8AA 1WSVA 1HQUB 2VFTA 2BKPA 3AAWB 3P49B 3AFGA 2CG8A 2KM8B 1RTJA 1IKVB 1O6XA 5J2PB 3QJJA 1NK5A 2GW8A 2XWXA 1KQGB 4NEZA 2RHSB 3VHQA 2NUUG 5KG2A 4S0MA 4ENOA 2F5GA 2QFJA 1D9FA 4F3OA 1U6ZA 5AXLA 2RH3A 4JI7J 4J9VA 2HBYB 1QUVA 4FYYB 1NK8A 2VPXB 4ITSA 3TVYA 2DISA 1U45A 1UVIA 2VG7B 4FP9A 2IJRA 4OI6A 2MKYA 4QCLA 1XNQF 3KK1A 4QZVB 1X9WA 2WVCA 4CO4A 2ASYA 5EDWA 1ZS6A 1S7IA 4DSKA 4FBTA 4YB5A 1TAUA 2H51B 1RT7B 5IT0A 2DXEA 1JNZB 3QBCA 4Q7AA 2I0XA 1LOUA 1N5QA 2MQQA 1XMOJ 4WE1A 3WDOA 4NYPA 1Q7YT 3M2VB 1QDUB 1K0TA 4IRDA 1NSKL 4F2SA 4TVAB 1S48A 4DR6F 5E3RA 3QGPA 1S6PA 1VC0A 1BQMB 3M6WA 5C5JA 1FF2A 1P27B 3PM9A 4IFYA 3M4XA 3DRYA 1T02A 4NRUA 2DIUA 2OD4A 4CLLA 1FVSA 3UE2A 1NK4A 1JXEA 1S77D 4ZPDA 3MURP 4JYAF 4LMZA 1ACMB 2OPSB 4ECXA 2NXCA 1Y3JA 4K59A 2Z4PA 4HI1A 2XI2A 5D78A 1LFWA 4F4WA 4DV7J 4NEYA 1UKUA 1FEEA 3MEKA 4CH1A 3P96A 4DR5J 4CRJA 2OAUA 4WFXA 3KHLA 4WFBQ 2HGLA 1QUPA 4Y0FA 1PKUA 3MHYA 2L3MA 1FD2A 1SIZA 4JV0A 4G1IA 4IRCA 2CNLB 3FEXB 3RB0A 3IGNA 3M8WA 3MMCB 1S72S 1NEEA 3IO1A 5IOLA 4CLZA 5AXMA 4XIUA 3CULA 5J1NA 4UUWA 3RYLA 1F3VA 1WC4A 4J37A 8AT1B 3CTRA 5KOWA 2IMOA 1NMEB 4C11A 3ZTRA 1DTTA 2A1BA 4DFPA 1VIOA 4OHYA 4TU8A 4JI8F 4M5KA 1CVJA 1B7FA 2W4DA 1HNIA 1TKXA 1FDAA 4ZVFA 3TZWA 2P8IA 5J1PA 2NQPA 3IR7B 4UY8T 2F65A 4OJ1A 1DLOB 4M5NA 5E7OB 2EBGA 4J9MA 4OI2A 5HQMA 2MEWA 4KPCA 1L5UA 3OTOF 5J1EB 1RBLA 2RQ4A 2ZH7A 3I4HX 3S01A 4ZJLA 3SDEA 2A10A 2QLFB 1WD6A 2M52A 2HNZB 4UOGA 2XS2A 5D0EA 4RW4A 1PCAA 3R5GA 4BC9A 2RUGA 4YOEA 1S4EA 2GS8A 2GO9A 4RNOA 1RB0A 1SV5B 4BWJA 5KG5A 2RE1A 3ZZPA 2XMKA 4U96A 4PCQA 4K4UA 1VOMA 1HPZA 4RNMA 3GIIA 1REVB 1IKXB 4U95A 2RKIA 1TKTA 1UL3A 3FSIA 2Q79A 1IKYA 3K7RA 4D3HA 5DDPC 2ZDOA 1HMVB 4DG1B 4OI0A 3NS7B 1HBNA 1NSQA 2J7UA 3HT3A 1LFPA 1F6TA 5HI7A 2BRLA 2IY5B 1GX6A 4W92B 3PW2A 2VKRA 3U1MA 4DX6A 1TL7A 2DNMA 3ADAC 3HFVA 3TUZC 4ECRA 2BM1A 1N6QA 2HS3A 4HDGA 1WHYA 7AT1B 4EO8A 1TK8A 2XMUA 5A2QU 2E1AA 2UUBF 4OV6A 1X0FA 1RT1A 2G0CA 1DRZA 2E5GA 2K2PA 2XCAA 5B0DA 1S9EA 2LYVA 4ZPVR 2Q43A 4DSLA 2OEJA 4DU8A 4RW7B 1CBKA 3CCQS 2QLBB 2HG4A 3J81j 2GO8A 3KLGB 1TQLA 5HQ8A 3ZTQA 4O44A 3D5MA 3PG9A 2B9YA 3CC7S 3R27A 4G3IA 1NB7A 3KXDA 1GK8A 3IS9A 5KFAA 4ECSA 2VH7A 4C8OA 2XZWA 1VBZA 3BEGB 2DGUA 3IM8A 2QA4G 1G7CB 4PG7A 1R8HA 2F8EX 2OPPA 1UJ4A 3M6VA 1AZSB 4F25A 4J9KA 5ETVA 1XN9A 4J9QA 2Z2LA 3V4IA 2IJFA 3M2UA 1TK0A 2DR6A 3QRRA 1S1UB 1YZ6A 1IBMJ 2ZZMA 5A76A 4OYXA 3MM6A 4PG5A 4PR6A 2K3KA 2C2MB 1TV6A 3DXBA 2HGMA 5H9FK 2CQBA 4M8LA 4MMOA 4O0NA 3GJQB 2VDIA 2H5EA 3LP0A 3BGFA 2ZC4A 1FRXA 1V3RA 5L46A 3BO4A 1LWCA 4DR2J 2QFIA 4UOCA 2HNDA 3OFEA 1T0TV 4JI5J 2DB1A 3GPAA 1U2FA 3THTA 1ZBTA 3PVXA 2V8GA 3ENAA 4KAIA 4DF8A 4FXWA 3P6YC 4DPXA 2V8HA 3W64A 3L9ZA 1FDBA 4MIBA 1VRTB 1AW0A 3W9HA 4DFJA 5HVHA 5BR8F 4PYAA 2KTQA 1GEHA 1WOOA 2YKNB 5KG4A 3HVTA 3CMES 1OJ4A 2BKNA 2XZTB 3W66A 2AKWB 2XLKA 1FK9A 1NSAA 1QE1B 4M5LA 1VGYA 4RW9A 1UW9A 1LEOA 4ECTA 3EVMA 1BXNA 4LVOP 3IBFB 4DV3J 2EEYA 2F4VF 1CJKA 1Y11A 2EI5A 7FDRA 1BD6A 3O2IA 4TNOA 2YNHB 2COLA 4YB6A 2ZH2A 3OR2B 3V6JA 4WPAA 1OQ3A 4ZVUB 4QIFA 4WCEQ 2P5VA 2MQNA 3D6FB 5G0RA 2HHUA 4ZVOB 4L75A 4R8UA 1G4CA 2HLUA 1UFWA 2LEAA 2NUHA 1R7IA 2CJ9A 2ZOMA 2EPIA 1KTQA 2YKOA 4I6YA 5B7WA 5HBMA 1Y5NB 3OR1A 4RO0A 3IAM9 1F5CA 1NPRA 2KL8A 5A0YA 2YWWA 4JI3J 3O5TB 3GJRB 4OMFG 1RA6A 1B3TA 3MGJA 1TL3B 2JRSA 1S6QA 1RT2A 1U1RA 4X65F 2QLXA 1UP1A 4YFUA 1KRPA 4WIIA 1ITPA 2R2SA 2L9NA 5C25B 3R5JB 4USTA 2Z2MA 1KTVA 1QSSA 1P1LA 1FJGF 5J2MB 2UXDF 2V2QA 1FWKA 5KG7A 1QSYA 2W24A 4YB1P 1TL1B 2B9XA 1SJ3P 1VQKS 2LA6A 5A8RB 4DV4J 2B4UA 3HHEA 4TKTA 2HHWA 1S9EB 5DETA 5AJ3F 4ZPWR 4IYQA 2VPWB 5HMWA 3OHAA 2CQGA 3D68A 3A3PB 2CFXA 2FYXA 4PZVA 2MKSA 4DZ6A 5GAGI 1TK5A 4K4SA 2ZFHA 3T1HF 3I4PA 3ET6B 3RR7A 4Y2MA 2D7SA 3QSIA 2JX2A 2CDQA 1VBKA 4YDXA 2ADBA 4LSLA 3RAXA 4WF9Q 5KG3A 4ZMMA 2MGZB 1X9SA 4WXOA 2DNGA 5F8NA 2UUWA 2DO0A 3NOCA 1HBUB 3I56S 3V4IB 4C97A 1VQLS 3LANA 2RQKA 1Y10A 2BJ1A 1NU4A 2V9KA 2CYYA 4DPYA 3GYNA 4I0WA 3OLAA 1RTHB 3CWJA 3HT0A 1RT4A 1JLCA 1M1HA 2BR0A 2HHQA 5IQQA 3T5HA 3RBDA 4NMXA 3H2VE 1R89A 4DZDA 1KC8T 2MTLA 4DL5A 3IN5A 2R42A 3QAUA 1HARA 3EGVA 3CE8A 4EUVA 2QJ3A 3J7ZT 2I38A 3IR6B 2XTJP 3QRQA 3LH2S 2WRMA 4Q0BB 4PABA 2XNQA 4P6QA 3UR0A 2I9SA 1QAXA 2DBBA 4FNIA 1JKHB 4LREA 2MZTA 1V9OA 3GCXP 1V5IB 4ATNA 4CTAB 1KLMB 5D4LA 2GIQA 2C3PA 2FJEB 2C28A 1U2CA 3TW0A 5C24B 4JI4J 1ZZNA 1ZM4A 1NZ8A 2V4JA 1N88A 3PFEA 1DBDA 3I9V9 4WYLA 1WG4A 4B3SF 2RS2A 2YKAA 5ETMA 2WOMB 3HHLA 2CZ9A 4N8NA 4WU3A 5DS7A 1RT5B 1XNRJ 4OZ2A 1IWAA 3NGRA 3RB4A 4RNHA 1VR6A 2B4PA 3BGLA 2YNIA 1HHQA 5KFLA 3ZZTA 4DX5A 4CLPA 3VGSA 3UI3A 4LSNB 3M1VA 4KH0B 3F73A 2B4OA 4B3OA 2MHEA 4QIGA 1W26A 2IBKA 2ZH6A 4V19X 3FBFA 1SKWA 3GZ7A 2ZITA 3VAGA 2WW4A 5THWA 3CIMA 4K0KF 3DRRA 1C0TA 2DGOA 1URRA 1GNKA 3MTJA 1VQ6S 2RVJA 4EZ6A 3POTA 1EHWA 1ZTTA 2R8KA 4DX7A 1S97A 2OJ3A 5M2UA 3MCMA 3VTIA 1KQFB 4ZLLA 4ID8A 3LPEA 1S6QB 2BXJA 1EIYB 2JJ4D 2ADCA 4DL6A 3MEEA 4DWIA 3EDQB 4LR8A 1G6BA 2L08A 5IV3A 4TLRA 1V3ZA 3A1YG 4KGKA 1HI0P 1RCXB 3M8RA 2JLEA 4M5DB 2E5HA 3KG1A 1NJYA 3BBBA 3U1NA 5KFCA 4EU0A 2HWHA 2EFNA 3MMBA 1U0HB 2PMZD 2LQ5A 4JV2A 1CJUA 3IWLA 1D9AA 1FFGB 2W2PP 1N54B 2MY7A 1WHXA 4A8YA 2QN6B 3MI7X 5GAEU 1JLGB 1HWLA 4MFBA 2YY3A 5KFBA 1SVDA 1MW7A 4V1Ak 2ZH8A 4RR5A 2OTLS 2DEIA 3GG1A 2KHDA 3ITHA 4GKJJ 3W8PA 3T19A 3KUGA 3R8YA 3H5UA 4CCHA 3LF0A 3AD7C 2ROEA 1PBAA 1PAEX 4J9SA 3TNVA 4GKKJ 1WORA 1T05B 2XYHB 1GT8A 2KFZA 1XTZA 2WBMA 3KK3B 1K47A 5FDLB 1JLEB 4ELTA 1KS2A 1U1MA 4OLOA 3DDNA 1NRKA 4W4MA 2RRNA 1OQ6A 1HWKA 5KT6A 2HQDA 1RACB 1TU0B 3CJ2A 5EX0A 1RAFB 5EGYA 4PPZA 2XY6A 3ENWA 4HT5A 3BKTA 1FTRA 2CNKB 3LOUA 3WHIA 2PDAA 2R2TA 1OPZA 1IBKF 4RW8A 1W25A 4MTPA 3JS9A 1OYEA 4R0JA 3S7RA 1RHJB 4URSA 4ZVTB 1ROFA 3NS6A 4XPEA 3CMAS 3I0RA 4CDIA 1FX2A 1U47A 2UU9J 4OZ0A 3QAEA 1H74A 3HSDA 1C0UA 3CIZA 4OX8A 1TKDA 5K8PA 2DIVA 4GRSA 2QA4S 2QA2A 4ANEA 2V5HG 2YWKA 3O6QA 4CLKA 3BYPA 2CDRB 2VBZA 2HQGA 4A8SA 4EYIB 2HK3A 1SJQA 1MWZA 3CCES 1Z4UA 1TL4A 1BWEA 4ECUA 3I96A 1HHTP 1KFSA 1RZMA 1HNXF 1HNWJ 5EWFA 3CXCR 1ZYQA 3BGRB 1CSJA 2MZQA 4OYBA 2RUSA 1F1BB 4QIWD 2MQLA 4ZPBA 1IKWA 1IBLJ 4DV6F 1K1QA 4KHPJ 4OFZA 5CYQB 3FDSA 2VICA 4QW9A 3RAQA 3MECA 4LF5J 1FRHA 1WKJA 3BV8A 2ERRA 4TY8A 1M5VC 2EXUA 1FVQA 4ZKAA 5ETRA 4CNYA 3HHKA 2BZ2A 3K5LA 3KLFB 1AFJA 1NH8A 2IDLA 1T95A 2BE7D 3KK2B 3QLHB 1QTNB 3KNGA 4ETZA 4KO0B 4FZVA 2LDIA 4U7CA 3HVRA 3DMJA 3L4BC 2ZE2A 3PR5B 1FO1A 4N77A 1C0TB 3OXFA 3BZQA 4F26A 3A8JA 2ROPA 2OPRA 4A4JA 1F2GA 2M7SA 4PQUB 2GHPA 2L48A 2HSEB 4ICLA 3VV2B 3UN3A 4KC5A 5JVHQ 2WSFC 3M7VA 2RSQA 4ILRA 4HLBA 5A2QY 3PO5A 4QWBA 2K1RA 3G82A 3D3CJ 2LU1A 5CH7B 1UEVA 2HFOA 1ZTWA 2D9PA 2VASA 4G6VB 2BJ7A 3Q24A 5BJRA 1FWLA 2QSWA 4KJIA 4OI4A 5ITHA 3D1HA 2YQ3A 3C15A 3KG0A 1X4EA 4LF8F 4A8MP 3LO3A 2Y0SD 3CEDA 2VC1A 3H2LA 1CJUB 3LGNA 1GTHA 3JTPA 2ZUGA 2LDYA 4DEZA 3QJLA 1N32F 1T9TA 3A4TA 2XLIA 4MFBB 1FDDA 3NBPA 3MTKA 5KFSA 6AT1B 3AH6A 1UZDA 5HQLA 2MQOA 2R7QA 3L7UA 1KKHA 2KKHA 1RT6A 4DL7A 1HW9A 3R2DJ 2ZVIA 1JLAA 1S49A 1X4CA 2HNYA 1SI9A 4K4VA 4KFBA 3MFIA 5L9NA 1MROA 4ED3A 2C22A 3AQOA 1KVKA 3D6MB 4JI1J 1UCNA 5K8MA 2UXCF 3DLKA 1A0OB 5DZ7A 5KFRA 1UTAA 4AUKA 3D1QA 2Z2YB 3DYAA 4IOCQ 4M94A 1FKOA 1BQNA 4E0DA 1RAIB 3OTBA 1OO0B 1S9GA 3GLJA 1JJCB 2GAHC 1XMOF 3HO1A 1X0PA 3IMQJ 2QSFA 5HP1B 3G6ES 1A6LA 3KJNB 4FKYA 3VAKA 3I5BA 1VISA 1SL1A 9RUBA 1QAYA 2G2OA 1HW8A 2DRBA 3MM9B 3QIPA 4PUOB 5KFFA 1IR1A 4YUDA 1OSCA 4LJMA 5C42B 4ECVA 3W5ZA 3CD0A 3EPIA 4QJVA 1NZAA 3CDWA 1RABB 2ZZTA 3O1LA 4LF7J 2ZOFA 3WIUA 2KXHA 1R0AA 1HBMB 4I2PA 3LW5C 5D15A 2H54B 4LF9J 4DR5F 3KJFB 3T1AA 4WJBA 4CLWA 3DHWC 4DUYF 2N7YA 3P45B 5D4PA 5LL6d 4OI1A 2K8GA 4HH0A 5KFYA 2DHGA 1Q86T 2B7BB 3Q8VA 2RB7A 3B4DA 3M05A 1N5TA 1Y00A 4I64A 4DPTA 1T9XA 2XSJB 1SCJB 5I3UB 2ZE2B 2HIQA 5GMKa 5KT7A 2JVOA 4G65A 5KG6A 1IQTA 5DO2A 1GMVA 2MZSA 2C3MA 5M2RA 1WG1A 2O1PA 2ZD1A 5CQGA 4DV0J 4NXNJ 1FCAA 1JLQB 1PSDA 5KFQA 1QAJA 2CADA 5FIIA 2EKNA 2KI2A 3UNYA 4LR9A 3WC2A 2PI5A 1SC4B 5ETNA 3GE9A 3VVUA 3OXGA 1N0VC 2J8SA 2AZ3A 2HQIA 3C15B 4C3MA 1DQ8A 2MJUA 3H90A 1S1WB 4C8ZA 2B5JA 3DOKA 4DR3F 4C0OC 3OL8A 1Q78A 3H40A 3N6NA 3OTDA 2KFYA 5DLGA 2BX6A 3EYZA 1TTHB 3GIJA 1FA0A 3VWSA 3RG6A 2XB2D 3BREA 3IXQA 2G0JA 2VF3A 4O3NA 2RD5C 3CO0P 1APSA 2I2YA 1PC4A 4OHVA 3FRZA 3QGGA 4OYIA 1U6FA 2IVMA 3QWPA 1K9MT 4OX9J 4K4WA 4L72B 1FFWB 2HVEA 2HWIA 1RGVA 3DFEA 1VFJA 3HX9A 2JC0A 2N82B 5DGBA 4R5PA 2CQPA 2O66A 1YRXA 3EUNA 5ETTA 2ZH3A 4BBYA 1MU2B 1YWXA 2J9DA 4NPOA 3L7OA 4EYHB 5DDRC 2DHSA 1WKKA 1BHNA 5D4NA 1P8GA 3HK2A 3PIPQ 4HACA 4USUA 4Y65A 3M30B 2XI3A 2FC8A 3NP5A 1ICEB 2EK1A 2AWZA 3WC0A 2CPHA 3EGWB 2IRYA 4B9LA 1X31C 4I1TA 1U1KA 1RISA 4RU9A 3CCJS 2L9DA 2MPUA 2QO3A 3V6DB 5KFDA 4ZIWA 1R31A 4F4XA 2UP1A 2DY9A 2ZDPA 1E6VB 4NLSA 3IBCB 2E9ZA 1NHVA 5AE3A 4CO0A 2HGNA 2CQDA 2MZ1A 4F04B 5IWAJ 3SBMA 4F7VA 1Y3KA 3AB2B 4UUXA 5LXYA 2R8IA 3LP2B 3VAFA 2HAFA 4NCGB 2N4DA 1OWXA 1SL0A 2VBXA 3NNHA 4E8UA 1UWBA 2XSFA 2BJ8A 1I6JA 4I2PB 1NK7A 3CD6S 2GX8A 2CVEA 4M5IA 4Y00A 4YS2A 4HYKA 2E1MC 2MSSA 1MWQA 4RNFA 1EQ0A 1RTDB 4MT1A 3Q8YA 1KDNA 2ZJQQ 2R7WA 4BC7A 3K17A 2GAGC 3J7A1 3QRPA 1LNQA 5D0RA 2XYGB 4DR2F 1M5SA 3HSGA 1RWOB 4B9VA 1B0VA 3UD4P 2E9RX 3DC2A 3H59A 3EZ5A 1SUQA 2ZM6F 2FGCA 2DHAA 1LW0A 4B3RJ 2NXUA 3EXYA 3DHXA 4ERDA 1RE1B 4FN5A 1QJHA 3VCDA 2XO7A 4JB8B 1PBUA 1RHRB 3A8KA 1CS4B 2CJYB 3PO4A 5HJYA 2XNRA 1S6OA 3GG0A 1JK9B 1YJWS 1RWVB 1RK8A 2W4PA 3H20A 4DV2F 4ILLA
chains in the Genus database with same CATH topology
5MLCV 1D8YA 4MKBA 4NZ6A 3OTOF 3OLBA 1L5UA 3H5SA 4I6AA 1LWCB 4JI2F 5J1EB 2RQ4A 2VG7A 2ZH7A 3I4HX 3BR9A 1U26A 3S01A 1MU2A 3SDEA 2A10A 6FD1A 1ZM3A 2HNDB 2CZVC 2QRRA 1WD6A 3HMJG 2M52A 2R2RA 4N56A 2XS5A 2RNEA 2HNZB 2LMIA 4A8KA 2VG5B 4ECYA 1SJRA 2UU9F 2XS2A 1S1TA 1C1BB 4OX6A 2VFUA 3RW6A 1SL2A 4RW4A 1SBRA 1C4CA 3CCWA 2HHSA 4PPDA 1LW2B 2MKJA 1F60B 3W2WB 4NRTA 1E6YB 2YWHA 4BC9A 2CPXA 2RUGA 5AXNA 4YOEA 2UUAF 1ZAXA 4UQGA 2GO9A 2W7OA 4NLYA 3LAMA 1ZPWX 4RNOA 3KKFA 2HW3A 1SV5B 4BWJA 5K8OA 1D0EA 5KG5A 2RE1A 1RT7A 4XDDA 3ZZPA 2XMKA 3M30A 2NSBA 4PCQA 4USIA 3RTVA 3OL7A 1I94F 4K4UA 1VOMA 2MQPA 1VRUA 1HPZA 3TAQA 4Q43A 4RNMA 1FRJA 5E3QA 4HVZA 2FVRA 2J8AA 4NYZA 1REVB 2EFPA 3GIIA 2IYIA 3HLUA 3IWXA 1IKXB 2K7KA 4BDPA 4WK3A 1U1NA 4B02A 2HHPA 2RKIA 3HVTB 1TKTA 4ZLPA 1UL3A 2QE5A 3UPFA 3FSIA 2Q79A 5CD4H 1IKYA 1HNWF 3K7RA 4D3HA 5DDPC 2ZDOA 3ISND 2O5DA 1BQMA 1RAJA 4U9RA 1KONA 1HMVB 2KXFA 3H4DA 4DG1B 1FK9B 2FD2A 4OI0A 4RKUC 1O51A 3V6DA 3AY0A 1HBNA 1Y7PA 1U1OA 1T03B 2LQ9A 1S79A 4TQSA 4F67A 2DT9A 4RW9B 1E6VA 3K58A 2J7UA 3HT3A 1IBLF 2OTJS 2RIJA 2RS8A 3MF5A 1LFPA 5HI7A 4KHPF 2BRLA 1R8CA 2KJWA 1IQZA 1GX6A 4W92B 2W9BA 2W7AA 3PW2A 1DQAA 2FJAB 1NNDA 4J9NA 2VKRA 3U1MA 1IXKA 2O01C 3D1OA 4A8OA 3V4MA 2GMHA 4LF5F 3J7Z5 4MYUA 1GX5A 2DNMA 1XWLA 3TUZC 5KG0A 3Q0AA 5F8GA 2BM1A 2MXYA 1U24A 3LAKA 5DDOC 4DLGA 4ECRA 1N6QA 2HS3A 2OPSA 4HDGA 4CQ1A 1WHYA 2CQ0A 2DNOA 1UW4A 4B3TF 2ROGA 3EXCX 4EO8A 3JSMB 1TK8A 2XMUA 5DG7A 2IA6A 3FVYA 3SFGA 3FNNA 3LP2A 3MWBA 5G0RB 3SFUA 4NCGA 4Q2MA 2E1AA 3CCLS 2UUBF 1KFDA 3VAIA 4RBTA 3VALA 1X0FA 1RT1A 4WFNQ 4CT9A 2VG6A 2G0CA 1DRZA 3MM5A 2CPIA 4R8UB 2E5GA 2K2PA 1ZETA 2XCAA 5B0DA 1QSLA 1S9EA 2LYVA 2MKKA 4ZPVR 2Q43A 4JI6F 4DV4F 4DSLA 3DLHA 4H4KC 4EEYA 4ES2A 3HI9A 4RW7B 3AB4B 5L39A 2F9JA 3HJFA 3CCQS 1Q8BA 4PXDA 1SKRA 4NA1A 4K4TA 1ZAVA 1O0PA 3TA2A 5J2QB 2LEPA 2YWEA 2AV5A 2HG4A 2J9CA 2GO8A 4ILMA 2YKPA 4URGA 3KLGB 2UUCF 4I2QB 4IG0A 5KFVA 3T9ZA 4C8LA 2DGVA 1TQLA 2IJNA 3JYTB 2GMJA 5HQ8A 2XMTA 4O44A 2R7TA 3L7PA 5HBMB 1FKPB 3H2UB 2ILYA 3OR1B 1VQ7S 3D5MA 2AYEA 3HF5A 1CQMA 1X9MA 5A0YB 1RTDA 2HFZA 2B9YA 3CC7S 3R27A 4G3IA 1NB7A 3ISZA 3MMCA 4NLRA 3RU0A 1OS5A 3IS9A 5KFAA 4ECSA 1JXLA 3MOJB 4X4VA 2IVFB 4DL2A 1MMLA 3IGVA 2MB0B 2VH7A 4C8OA 4C3LA 5F9LA 4RWXA 4TU9A 4ZP9A 4WTYA 2LA4A 2XZWA 3LWLA 3BEGB 1VBZA 2HS4A 2DVIA 4OJGA 1RT2B 2LECA 5LSOA 5MAOA 4NLTA 2DGUA 1U25A 3H8YA 2QA4G 4ZK7M 1G7CB 4PG7A 4KQZA 5IFMA 1R8HA 1ELOA 2F8EX 2OPPA 1UJ4A 4RW6B 3M6VA 4F25A 3MMJA 1VQMS 1PILA 1WTBA 4J9KA 4AL7A 1XN9A 4J9QA 3U02A 3U7JA 2IMWP 1YHQS 2Z2LA 3IG1A 3V4IA 1SJ1A 3PV8A 2AGPA 3WX4A 5I3QA 2IJFA 1CC7A 3M2UA 2PGCA 2C3YA 5KAKA 2OH2A 1TK0A 4C98A 3FZBA 1HFEL 3IRXA 4DF4A 2R8JA 2CVIA 5H9EJ 1S1UB 3OVAA 4C3KA 4C0BA 3D28A 3K5MA 4A8XA 3M8PA 4BCAA 5A6PA 2G13A 2DNHA 2ZZMA 1DTQA 4PG4A 5DQHA 2FVPA 1YJ9S 2W8KA 4HKQA 4MYTA 3U27A 2KVIA 2M9KA 2MSTA 1OPIA 2AW0A 1X5TA 2C2RA 3MM6A 3NLCA 4NA3A 4PG5A 3MPYA 1Q1KA 4PR6A 3TVKA 3MAQA 4X4OA 4I7FB 1H2VZ 2K3KA 2R2UA 5JVGQ 3NWGA 3E3XA 2LXIA 1OSDA 4IUFA 4HDHA 4X4TA 2WSEC 2OP5A 5HO4A 3I9ZA 1TV6A 2J0XA 5LSLA 1C2PA 1GTEA 3DXBA 4ED5A 2HGMA 2RU9A 4MK7A 3NGKA 4CIOA 1QY7A 2AJQA 2CQBA 4M8LA 4MMOA 4F50A 5IM0A 4K4XA 3HHLC 2JFKA 4JBCA 5KT2A 4K4YA 4QQBA 3I0SA 1M5HA 2YWGA 1DLOA 5GAHU 1YG0A 2AGQA 1CG2A 2H5EA 3LP0A 2IRXA 2KRBA 3BGFA 5T7LA 2YVSA 4P7TA 2ZC4A 1NJWA 1FRXA 1V3RA 4Q8EA 3SZ2A 3IWNC 2XGPA 4DR1F 5CZVA 3BO4A 1KHWA 1LWCA 4ZPTR 4A46A 2R4FA 4I69A 3MDFA 3C2PA 3N4WA 5KT3A 2QLWA 2V9WA 4UOCA 1Y0HA 3GV8B 2HNDA 1RP5A 2O3DA 3DRSB 3RAMA 3OFEA 4I4BA 4LSLB 2NREA 2DB1A 2HNZA 1FJEB 1U2FA 2VG5A 3THTA 1ZBTA 3PVXA 1VHFA 5EN1A 2V8GA 4ZPAA 4MIWA 1M5OC 4KAIA 1C1BA 1DQ9A 2JL9A 2ZBCA 2F40A 4DF8A 4ZHRB 4FXWA 3P6YC 1LW2A 3W2WA 1N34F 1E6YA 3X1LB 2V8HA 1H3DA 4QWAA 2M88A 3SSRA 1EETA 4FVCA 2YTCA 3EZUA 1FDBA 2GFFA 2P9CA 1YJTA 4MIBA 1SV5A 1MWYA 1VRTB 1WF0A 2DHXA 2Y1IA 1AW0A 2AJ0A 1J5OB 2E5LF 3CDAA 2XMJA 4DFJA 3TQ1A 3M8QB 2IC3B 5BR8F 3OW2R 1U4BA 4KB7A 5E2QA 4FYDA 1M90T 2DJWA 1H7XA 2KTQA 2YX1A 2EBEA 5CA5A 2QA1A 2X1AA 2LU2A 1REVA 3QYYA 3DU6A 1DARA 1IKXA 2YKNB 3MOZA 1X4GA 5HMYA 5KG4A 3UCZP 3CJ5A 3HVTA 4OLPA 4WK1A 3GV7B 3CMES 2OLWA 1HMVA 1RT4B 4KHMA 2XLKA 4DG1A 1FK9A 3HHNB 1JLCB 4QPXA 1MNEA 2W9AA 3KHGA 2JVRA 5JXSA 1S1VB 1V3SA 4Y2KA 3SCLE 1NKCA 2VA3A 3OBIA 3I5AA 1QE1B 3I6PA 4ZP7A 4N76A 4MJKA 3NNCA 1VGYA 4RW9A 3MUMP 5D8HB 1HD1A 4Q45A 4ZVEA 2ALZA 3HKWA 4ECTA 5DG8A 2XULA 4NLXA 4LVOP 2HVHA 4DQIA 5F9NA 2F4VF 3DXSX 5F0WA 1LWFB 3KG4A 3PJXA 3VZHA 3PJWA 4DN9A 1SKSA 2GCFA 4NX9A 4NLDA 1XNRF 4RUAA 2C3UA 2EI5A 7FDRA 2BRKA 5B0EA 4C4WA 2Z0GA 1BD6A 1KOHA 3TYTA 1N4LA 3O2IA 4TNOA 2ACYA 2KRRA 2YNHB 3CJ0A 3LALA 2COLA 3PEHA 4YB6A 3DGPA 2ZH2A 4ED8A 3NCQA 3OR2B 5CCMA 3V6JA 3CCTA 1Z2ZA