2XSJA

Structure of desulforubidin from desulfomicrobium norvegicum
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
436
structure length
436
Chain Sequence
AKHATPLLDQLQSGPWPSFVADIKEEAERRHSNQDNVEYQIPVDVCDDLLGILELKYSDGTTHWKHGGIVGVFGYGGGVIGRYCDQPQMFPGVAHFHTVRVAQPAGMYYTTDFLKQLCDLWDMRGSGLTNMHGATGDIVLLGTTTPQLEEFYFELTHKMNNDLGGSGSNLRTPASCLGDSRCEWACYDAQELCYQMTQEYQDELHRPAFPYKFKFKFDGCPNGCVASIARSDMSFIGTWRDDIRIDQEAVAAYVGGEIQPNGGAHSGKDWGAFDIQKEVIDLCPTECMWMEDGKLQINNRECTRCMHCLNVMPRALRIGNDRGLSILVGAKAPILDGAQMGSLLVPFIKVEDPYDEIKEIIEGIWEWWMEEGKNRERLGELIKRQGLAKAIAAVGLTPVPQHVMEPRHNPYIFWKEKDVEGGWDRDIADYRKHHQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SULFITE REDUCTASE ALPHA SUBUNIT
publication title Structural Insights Into Dissimilatory Sulfite Reductases: Structure of Desulforubidin from Desulfomicrobium Norvegicum
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 119
structure length 436
sequence length 436
chains with identical sequence D
ec nomenclature ec 1.8.99.3: Transferred entry: 1.8.99.5.
pdb deposition date 2010-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01077 NIR_SIR Nitrite and sulphite reductase 4Fe-4S domain
A PF03460 NIR_SIR_ferr Nitrite/Sulfite reductase ferredoxin-like half domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xsjA04
3.30.70.2500 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xsjA02
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 2xsjA03
2C3PA 3MM5A 1RGVA 3MMBA 3IR6B 1FF2A 1FRJA 2C3MA 5CHCB 5BYRA 5BYSA 1JNZB 6FD1A 1IQZA 1C4CA 3VM1A 2VPZB 2FGOA 1FDAA 2PDAA 3MM7B 2WAQD 2C3OA 4OMFG 1AOPA 2Y0SD 5E7OB 3AOPA 2VKRA 1B0TA 2C42A 4S3DA 1JB0C 1BQXA 1KQGB 4S3BA 1FRXA 4HTRA 3MM7A 3MM6B 4RKUC 1D3WA 2FDNA 3GYXB 1B0VA 1F5CA 4XDDA 4AYBD 3VKRA 3VLZA 1PC5A 4S3EA 1R27B 1Y5NB 2V2KA 3B0NA 3B0JA 3EUNA 3MM6A 2FJAB 4AOPA 3MM8B 1CLFA 1FRIA 3VM0A 1FRKA 4G9PA 1WTFA 3OR1A 2UZAA 3PNIA 4S3AA 1BD6A 1KQFB 1Y4ZB 1SIZA 2Y0FA 1FDNA 5L8RC 3EXYA 3B0GA 1XERA 2V4JB 2WSCC 3HKZD 3EGWB 3MM8A 5GEPA 2GMHA 1H0HB 3VLYA 1FDDA 1FEHA 4S23A 5AOPA 1Q16B 2O01C 4KT0C 3MMAB 1FD2A 4XK8C 3C8YA 3MMCB 1B0PA 1JNRB 7FDRA 1GAOA 1BLUA 3VKPA 2VPYB 1PC4A 3B0LA 1BC6A 1FXRA 2GEPA 2VPWB 1G6BA 2XSJB 1GTHA 3MMAA 4L6V3 1SIWB 6FDRA 3MMCA 4XDCA 1BWEA 3MMBB 1FCAA 3OR2B 1H7WA 3GEOA 1Y5IB 1DAXA 1FERA 2FD2A 4GEPA 3IR5B 5BYQA 4ID8A 7FD1A 2FJDB 3NOYA 3VKQA 6GEPA 4Y28C 2XSJA 2VPXB 1A6LA 4S38A 1FXDA 1GT8A 4DHVA 3OR2A 1Y5LB 8GEPA 3B0MA 2GMJA 2C3YA 2V4JA 7GEPA 1C4AA 3MM9B 5FD1A 4G38A 3VKTA 1FDBA 1G3OA 1FRLA 1DURA 1ROFA 2FJEB 2WSEC 1KEKA 3IR7B 2PMZD 2IVFB 1FRMA 2AKJA 4S3FA 2ZVSA 1ZJ9A 3LW5C 1K0TA 1H98A 1VJWA 1DFDA 4S39A 3VLXA 4CI0B 1H7XA 1AXQA 2C3UA 3MM5B 3MM9A 5CH7B 2WSFC 3VKSA 1F5BA 1FTCA 2FJBB 1SJ1A 4YDDB 1ZJ8A 3B0HA 1IR0A 1GTEA 2PA8D 1F2GA 3OR1B 4S3CA 1FRHA 2Z8QA 4G39A 1HFEL 2AOPA 4OV1A 2WB1D
chains in the Genus database with same CATH superfamily
2BQUA 1EQMA 4B9NA 2HNDA 2Y9HA 2P5VA 2PDAA 1F0XA 2GCFA 2I2YA 2KN4A 3E8OA 1J5OA 3GV5B 1CG2A 2MQMA 2PC6A 1X5SA 3H98A 2VQEJ 2VJUA 3D2WA 4ZP6A 3OXLA 5F8IA 2ZBQA 1DLOA 5HN0A 2DXFA 3MPUB 1YJ9S 2R2UA 1R0BG 3QMQA 2YQ0A 2GVDB 5J2QB 1HR0F 2Y0BB 3T1YJ 4DF4A 2B4VA 4URGA 2XQCA 4CYUA 2EC0A 3H20A 4ZPBA 4OX6A 1FNOA 1UA0A 3W9HA 2ZM6F 2KKHA 1FO1A 1H72C 4DR4J 3QWPA 2LQ9A 2A10A 1WUUA 4ZHRA 2ZH9A 4B3MJ 1SJFA 4JYAJ 1TR0A 2BE9B 4UY85 4UF4A 4YDDB 2L41A 4G39A 1AYEA 1EX8A 5GADU 4CQ1A 5D4LA 2MZRA 1UWAA 4ED8A 5H9EK 1KQGB 3JTNA 3IP0A 3GJTB 4NWBA 4KHPJ 2BM0A 1J5EJ 3RJMB 2C2EA 3W2VA 1WC1A 3EM1A 4TQSA 4B3RJ 3FC9A 2FHMA 4OZ2A 5L8RC 3M9OB 2CFXA 1RT5B 5IZHA 2LQBA 2IPOB 3CF5Q 4FS1A 4Q43A 1RADB 4QWDA 4O44A 2XZTB 1MWQA 5HJXA 2GJ2A 2YQ1A 5ETKA 5DS7A 5DM7Q 2FJDB 5G0RB 2H5JB 2BKNA 5DZ6A 1QE1B 2VA2A 1Q8LA 4TU8A 1OWXA 4HHUA 3IBCB 1SJQA 3TNVA 1NK7A 4HTIA 4ECUA 3N01A 1RAGB 2C3MA 1CJUA 1S6OA 6FD1A 3D54A 5KFOA 2K7KA 4RX6A 1NHUA 1HNVB 1N36J 4JI2J 1FXLA 1S5ZA 1NHVA 1DY3A 3CO0P 4LF7F 2WONB 3MFHA 5IT4A 4PKDB 1Y9OA 4CP5A 2BJ7A 3NL0A 1S57A 3GFXA 2CUYA 2DHHA 2A1BA 2P9EA 5HK4A 1LV5A 4B08A 2ILZA 1RAOA 3FQLA 5F8MA 4IH6A 2CRLA 5M2RA 2B8QA 4DZ6A 4OI6A 1UJ5A 1SC3B 2XMTA 4C9DA 4QIEA 2NXJA 2HWIA 3I5CA 5KOWA 2YKPA 5ETSA 3I0SB 2QL9B 2C2OB 5CD4A 1HBNB 4WZMA 3A8KA 4P6QA 1H7WA 2QLBB 3GIRA 1QVGR 3MEDB 3SIPB 1FWLA 4DSLA 3DI6A 1S12A 4DV6J 4RNMA 2CQ1A 2ZZMA 3UD5A 1RT7A 4TY9A 1GXTA 5J2NA 1H38A 2IRXA 3M8QA 2OPPB 1P9YA 3H25A 2VG7A 1F5BA 1RHUB 4LFAF 2KVIA 4XIUA 4IH5A 1ZZNA 1IN0A 4OV1A 2Z2ZA 2HQGA 3GLJA 2JOQA 2YTCA 2YH1A 3D6HB 2PEHA 1RWMB 4ZCLA 3WDOA 1S0MA 2HHUA 3FKBA 1HD1A 1RK8A 2DHXA 2HGNA 2YNHB 1SKWA 3CIZA 1T0TV 4LIRA 1ZA1B 2E5HA 5KG4A 3J80Y 1U1MA 2IJRA 2HHTA 4G6VB 5F41A 2BJEA 5HAOA 1RLDA 2XY7A 1B0PA 3H7HB 3ZZRA 3QT7A 1WC5A 1XQIA 1VQNS 4Z2XA 2SXLA 5A8WB 4CO3A 5LSOA 1LWXA 3M32B 2UV8G 2E1RA 1UL3A 3PRVA 3V2UC 3NNHA 3EZUA 3IGNA 4ELUA 2OI2A 4DCPB 3C6UB 1S1WB 4DX8H 4AL7A 2HRUA 2CQ0A 4C0HA 3RB3A 5LMNJ 1LKZA 3WBZA 2AOPA 2QN6B 5BYSA 3FZBA 1XWLA 2A6OA 1Q53A 1VQKS 4RO0A 2NZ4A 3PEHA 2UXDJ 2LLZA 1EP4B 2IBKA 4V19J 2X3DA 1ZAWA 3PHTA 4RKUC 3PO5A 1D3WA 1LWEA 1JLBB 4OYOA 2DGSA 4Q0BB 4B9SA 1H74A 3HVAA 3KG1A 2LXUA 1UW4A 3LUYA 3PO4A 3I5AA 4LSLA 4P73A 1HNXJ 5CABA 1UFWA 4DL5A 4RPFA 3KLGB 2H9ZA 4DL6A 3J81U 1RT5A 1X60A 4KE5A 2HS3A 3BSCA 4LRDA 3OHAA 2XLIA 2Y8WA 3D0IE 3N9UC 2W4DA 2AYEA 2IYIA 1SL0A 2RH3A 1BWVA 2EEYA 4ZS6A 4IDKB 2B9YA 2JJ4D 1RISA 2JHEA 1V9OA 4MK8A 5G0RA 1VLOA 3D6TB 1VJWA 5J2MB 3Q8VA 4CI0B 1QE1A 2WSFC 3KKFA 5HVHA 1QUPA 4DMZA 1PILA 4EUVA 2AKWB 1JNZB 1ZOTA 4DR5J 4JI5F 2VJVA 4NCGB 2VC1A 5MLCV 5K8MA 3DU6A 3LALA 2FDNA 3FFIB 5H9EJ 4AYBD 2Y1IA 2GAHC 1R27B 3CD5A 3P8BB 3OR1A 4HHJA 1WNEA 3UDLA 1W2BR 4Z37A 4FPIA 1RBLA 4Y34A 4DL7A 1ZETA 5JJBA 4GC6A 4M5IA 5I3UA 2PE8A 3H8YA 4OJGA 3VAGA 3EZ5A 3GG1A 2QLWA 4OYIA 4RLEA 4BHQA 3A3PB 1IKYB 1TL7B 2WCXA 2I0XA 4QZVB 5AJ3F 1TV6B 3UDVA 2DNLA 5D4PA 3MEKA 4DL0C 4F3QA 3DGPB 1HBMB 3A8EA 8GEPA 3UN5A 4R8UB 3MPDA 2IYGA 1I1GA 3MEDA 4ZVTB 3VWSA 1JJ4A 4LRFA 4NE9C 1U2CA 1IVZA 1F6TA 2C1EB 3GR0A 2OPPA 3TA1A 2ZJQQ 3P6YC 5DM6Q 4ILMA 1EKSA 1VRQC 5FDLA 3OSPA 4KRWA 2VOPA 2V68A 1N54B 1WC6A 2ATLA 1NK8A 1BQMB 3L9ZA 3PW5A 2LP4A 3IFEA 1B0VA 2LU2A 3N79A 1LW0B 2VU5A 3IBFB 4U8VA 4DL2A 3GJQB 3BV8A 2J0SD 2YQ3A 3T5JA 2CXEA 3BYPA 2DH8A 3BBCA 3AXMA 4Q8EA 6AT1B 3E01A 2VODA 1FVQA 5KT4A 3NNCA 3MAQA 2PI4A 3MMAB 3L95X 5KFKA 1NJXA 1X4BA 2NZCA 1MMNA 1S49A 4B3TF 1LWCB 1RT3B 2A18A 4DV2J 2YY3A 2VFTA 2FGCA 3UDCA 1D9AA 2VBWA 4ZK7M 1UCNA 3M32A 1LW2A 4X4TA 4JI3J 2FHJD 1YRUA 3DXBA 2BJ9A 2GC8A 1S1WA 3M05A 5GAEI 3TQEA 3M30A 3LP2B 2EC2A 1SQFA 2AJ0A 5HQ8A 4KO0B 3K5PA 2QX0A 3CJRA 3Q89A 4O0NA 2K1RB 2UP1A 1QD1A 3HLUA 4LF6F 2LQ8A 4Y0FA 1EP4A 4DR3J 4LRBA 1JLBA 4U9RA 1DTQA 4OI3A 4H4MB 3TJ8A 2DGQA 2Y0FA 1PJ5A 3MTJA 1XBWA 1HMVB 5DGAA 3DLLQ 3SCJE 1Q16B 1S10A 2OO4A 2IA0A 3KLGA 3JAMY 3NCQA 1L3KA 2KXHA 1U2RA 3RAQA 2HVIA 2Z2YB 4F25A 2VPXB 3GONA 3FK4A 1AB8A 2HHQA 1OJ4A 2J0XA 2PMWA 5B0EA 1VQSA 2I1RA 5D3GA 4OYZA 3CC4S 2FHOB 2XLKA 2GMLA 3QLHA 5DO2A 1IR0A 1U1LA 4GKKF 1TKDA 1S7HA 2HS4A 1WORA 5K9FA 3RRKA 1RWXB 4PUOA 3T9ZA 3D4JA 4OX9F 2GIFA 4NCGA 2EFOA 2OMOA 4S0MA 2I38A 3D3BJ 5CYQB 2V0NA 1LWFB 4D3HA 4CLUA 3FFIA 3KFWX 1HYSB 2GQ2A 2QC3A 3PDNA 3J80U 2V8HA 2CQ4A 1VBYA 2FVQA 3CCWA 4ZIVA 4WJBA 3CNQP 4NMXA 3QSYB 3N0VA 2QSFA 2F1FA 2WTFA 2QIFA 1F60B 5ETOA 4ERDA 5M2UA 4BBYA 5H9FK 3KK2A 5I42B 3TR5A 1KONA 3DGPA 1D9FA 1HBMA 4LFCJ 2YNGB 1OQ6A 3IRWP 3TJAA 4R8UA 1CVJA 3FRYA 3CJ2A 2DR5A 2PA8D 4OZ5A 2QLFB 1IBMF 1OPIA 2AEJA 4S3EA 1RGVA 2F8MA 2ZH5A 1PGZA 1RT6A 4ZN1A 1VQLS 4M8LA 1TFWA 2N3LA 4A47A 4CDIA 2QA4S 2XWXA 1FFWB 3HVTB 3NBPA 5L1LA 2H4YB 4YQWA 4CTAB 5F8JA 2G4BA 3LA0A 4CLWA 2F4VF 1GK8A 2RKIA 1BE4A 2CG4A 4ECYA 3IN5A 3OFEA 4NRTA 5HMYA 1LW0A 1KQFB 5A6PA 5FIIA 2DKOB 3GCWP 3DLGA 4ES3A 3PV8A 3HFVA 3KG0A 2PFFB 4NCAA 4EMDA 2BW7A 3BR9A 2M0GB 3SCIE 4FDFA 4PWUA 3OV7A 2W8LA 1R8CA 3MMAA 2BE7D 3FCHA 3T3FA 4FNHA 3CMAS 3DRRA 2VONA 4X65F 4OZJA 4QU6A 1L3UA 1Y10A 2XMKA 6GEPA 4DQPA 1RT3A 3UPFA 4UOFA 4YHHF 2CA9A 2ASDA 3EVOA 4DV7J 2VFVA 1AT1B 1AW0A 1YBAA 5JVGQ 2GQQA 2YKNA 3OXGA 3F41A 1KC8T 2BW2A 4K59A 1HHTP 4WZQA 4MFBB 4WP8A 3LP2A 3S7RA 1U0HB 5ETQA 4ATNA 2IM0A 2K1RA 4O3PA 4KIAA 2CADA 2UXBF 1IWGA 4C3LA 5JUMA 5KFVA 2DHGA 5KFQA 5D4NA 5I3QA 4H4MA 3EGNA 1N0VC 1Q1KA 4LR9A 3W9JA 4GVBB 2Q3PA 2FTRA 1FXRA 3R5AA 3NWGA 2LA4A 2R7OA 3EDQB 4RBUA 1D8YA 2NXEA 1YZ7A 3KK3B 4ICLB 2B7BB 4NLVA 1FXDA 5E5NA 2UUAF 4C8YA 4CNYA 2DNZA 3H4DA 2X1FA 4DV3J 4JBCA 3O5TB 1RT1A 4KKOB 2ZC4A 3H5YA 1PKUA 2CQBA 4J9VA 3QZ7A 1HFEL 1QSLA 1MLAA 3ZO7A 3PRBA 2OKQA 1ZA2B 1R8PA 2MSSA 4LF5F 1NK5A 1NKEA 4NOHA 3MXHP 2PIIA 3OQ2A 3LWMA 3SSQA 3RW7A 4RNHA 2E44A 1KNZA 3D3CJ 1T9YA 2D3UA 2R7QA 1ZPWX 1T7PA 4ZCKA 3RBDA 2OJ3A 1A7GE 1WHXA 4A8WA 1T9WA 1LWFA 5K5MA 3D0HE 2ZD1B 3R9LA 2DISA 1SXLA 1FWKA 1S6UA 1HYSA 1C1CB 1O5JA 2KXFA 4UOGA 2R8JA 3CJQA 2AP6A 3VTIA 2DR9A 3CULA 4LF9J 3EMTA 4K4VA 4A8YA 1F9FA 1PYTA 3F56A 1HHQA 2X1AA 1RB0A 5E3PA 1HLWA 3R5CA 3OTBA 4CO5A 4Z7CA 3VALA 3GQCA 1F1BB 1N5VA 4AXJA 2OH2A 4EBEA 4A8KA 4DV4J 4C8OA 5DJBA 4PG5A 3JTOA 2DGOA 5I42A 2E1AA 2F9DA 4JOUA 3WIUA 3UI3A 2RDJA 2W7AA 1GTEA 3C16B 2YNGA 3HHLC 1OYDA 2UUBF 2KFZA 5KFXA 2C42A 1S0NA 1JKHB 2VB6A 3UVJA 1R6VA 1TKXB 1NJWA 4NLOA 5KG2A 1NZ8A 3T6BA 2D3OR 3HVTA 2QSWA 3OL7A 2LDYA 4WTOB 4CTAA 2MZJA 3Q8PB 2XZWA 1R43A 1S9GB 3DMJB 2H48B 3HP6A 1VIXA 5E33A 4JP8A 1H0HB 3M2UB 3DGVA 5CZXA 4EFAC 1Q8KA 2GVZB 5ETVA 1CC8A 2ZC3A 2N82B 5LL6d 3ZNUA 1ZS6A 4FXVA 3JAMU 3H2UB 3DM2B 4AT1B 3NS7B 2IC3B 1FK9A 2FPHX 4F02A 2RMLA 2O66A 3FDSA 2JFKA 3MM9B 3G8QA 3MEEB 3A4TA 3EYZA 2IVFB 1IBLF 3RAXA 1QDUB 3S6EA 4ECXA 2EPIA 5B08A 5ETLA 3AB2B 2ZZTA 1C2PA 5F0UA 1G4CA 4J9RA 1F3VA 3MM7B 3PIOQ 1PBUA 2BRLA 3W62A 4YEAA 3CCLS 1F3FA 2GA7A 1WJ9A 3FQKA 2R7UA 4OZ3A 4UY8T 1IUJA 1UEUA 2RQMA 4A46A 1T02A 2V4JB 4JI4J 2MQLA 4KBIA 3ILLA 2QFJA 1NNDA 3B4MA 3R5DA 4Q8FA 1XNRJ 3PTWA 3Q86A 2HPUA 3UNGC 4CLPA 4C2MA 5GADI 1YKWA 3DNCA 2UUCF 2AJ2A 5JXSA 3IS9B 2J76E 4WK3A 4GVBA 1UFKA 3PRDA 3CGIA 5D6GA 3TEHB 3R97A 2YNIB 2R7TA 1GT8A 4WFXA 3T41A 3H59A 3DCAA 3KK3A 5CYMB 2RT3A 4S3FA 2W2MP 4ICLA 4EEYA 4LIWA 1YJVA 1ZJ9A 3PW2A 1T9XA 2UXCJ 2OTLS 4ZVSB 1RCOB 4A4JA 3ENWA 4YN3B 1HQ2A 3RB4A 3UNYA 3SYZA 3LPEA 4KKOA 1WHVA 5EWFA 1VBZA 1R0AA 1U1NA 5GMEA 5B0DA 2P2CB 2BMBA 2CQ3A 3GFZA 2IRYA 2H5IB 3MM6B 2QE5A 4MH8A 1T05B 3JSMB 4UOCA 4ZJOA 1DBDA 1XNQF 2F9JA 3C14B 3IO1A 3J81j 2WZ1A 4XK8C 4F50A 1S97A 2HNZB 3OFHA 3SXLA 2B6AA 1IR2A 3VKPA 5KFLA 5K8NA 4CLYA 1H73A 1C1CA 4HLBA 1FJ7A 4KC5A 4L76A 1X9WA 4IG0B 3SBMA 4NXNF 3T5LA 3SMZA 2YPYA 3G9CA 1NZAA 3CMES 2FLOA 2WK4A 1SC6A 1FKOB 4U7UD 2AF6A 3D1HA 3T1HF 1N52B 1WKLA 2BXJA 2QO3A 4QBUA 1GNKA 2JDJA 1RA6A 3I0RB 1FNXH 4GC7A 2DEJA 4ED4A 3QO9B 3V6DB 3C16A 3QNWB 3TZYA 1WG4A 3O44A 3KJFB 1RKJA 4I4BA 3BGFA 2LXFA 4PQAA 4P72A 2XI3A 2N7YA 3D6FB 2E5LJ 3CT9A 2LEPA 5CCMA 1NJYA 1DTTB 1MWZA 2E66A 4AOPA 1TKXA 3GIKA 2XHWA 4B9UA 3HZGA 1FI4A 4XPEA 2EXUA 9ATCB 3VLYA 2MY7A 1XMOF 3BH7B 3EVWA 4K4ZA 4YY3F 4LBIA 1EAYC 3M2UA 4LF1A 5E41A 1UWBB 2GVZA 3KJNB 3J7AN 1KOOA 5U47A 3ILIA 4CLZA 2XYHB 3FZ2A 2DHAA 5KTQA 1O8BA 1Y5LB 3BR8A 2C3YA 4X4RA 4ZPTR 1LXNA 1ZBTA 2E1CA 1ULRA 4NZ6A 1WWHA 2RJZA 3MM9A 4Y6IA 5C7PA 1S9EA 4G65A 4OYMA 4S3CA 3N28A 1N33J 3V6KA 4LF8F 3IR6B 2FLLA 4K8RA 3BKTA 1VQ9S 5CQGA 4O4GA 1SH3A 3GWCA 4JI1J 3H5XA 2KYXA 3MM7A 4JI6F 2DD8S 2M7SA 3JB9k 2DY9A 2JLEA 3IBWA 4CCHA 3QFWA 4P2SA 2XM3A 2NXUA 4P52A 1TL5A 5DQHA 4ZVFA 1MMDA 1RWWB 1FEHA 4S23A 3RBEA 5EN1A 1K0VA 1JNRB 1HPZB 4CM2A 4PQUB 4QPTA 4F4KA 4FYWB 2M8HA 1SC1B 1Y0HA 3FBEA 2WHOA 4IFYB 3R7NB 4DR1J 3KLEB 2XS7A 2HBQB 2XHCA 4YB7A 3IS9A 4PG6A 4M95A 2JEGA 2BX6A 1M5PC 3ZZZA 2JEFA 2X3GA 3R1LA 4I69A 2JZ5A 5CYMA 2MKKA 4IQXA 1HNZF 1VISA 1YITS 1V3ZA 4M5MA 3K89A 1YWXA 1JJHA 3LF0A 3M9NB 3T19A 2MGZA 1WHWA 3KHGA 3CC2S 1JLEA 3OL9A 2R8GA 1H2VZ 2PSZA 2IIHA 3AJ2A 4JB8B 3AY0A 3DOMB 4ZVEA 4U7UK 1A0OB 1HI1A 4IOBA 4N5SA 3EUNA 3MM6A 2OEKA 4RW4A 4LRAA 3CPWR 2LFVA 2X7IA 4DS5A 3LPYA 1EB0A 1KQKA 1KWMA 3BSNA 3JSMA 3SQGB 2W2QP 4PWDB 3T5KA 2VASA 3C14A 1Y3KA 5EDWA 3B78A 1D0EA 4ETXA 2HNZA 4XO0A 4JI8J 1Y7PA 2B56A 2RQ4A 3NAHA 2DGVA 1Y11A 1GXLA 1VI7A 3NS6A 3KUHA 2QLJB 4PZVA 5C42B 1S1VA 2CYYA 4IG0A 4O3SA 4OZNA 5D0HA 1RHQB 3NGSA 2I5JB 3DRPB 4CH1A 4WYLA 4RJVA 5J1EA 2WB1D 4P10A 2WVEA 3I0RA 2HK3A 2QA4G 4PPZA 5I3PA 1QTMA 2VQEF 1TL3A 3QO9A 1C0UB 5LXYA 3V6DA 2B7CB 4P9SA 2JC0A 3GG0A 4F4ZA 3D1OA 4G1PA 4ILRA 4G9PA 2CIMA 4J9UE 4K0KJ 3I6PA 4RZRA 3FEXB 2MHNA 1VGYA 3TA2A 1RWPB 3T1YF 4I7FA 3I82A 3SFUA 3HDSA 5KT6A 3J7YI 3HJVA 4DR4F 2BANB 1RCXB 2ALYB 1UWBA 1BY9A 4B3MF 4FYDA 4JYAF 1RBOB 2H5EA 1UVKA 3TAPA 5DETA 3CVKA 2HW3A 5D0EA 4KHMA 3MM5B 3N5BA 4ENOA 3PX6A 1FWPA 5A8KB 1U47A 1EQ0A 3G71S 1VLYA 5CHCB 3E51A 2HRYA 1N4LA 2CKWA 5CYJA 4KHPF 1FNMA 2YKMB 3SSSA 5BXIA 3OLBA 4I56A 1SJ4P 1J5EF 4B3RF 3D6MB 4LJMA 2V2QA 3PJXA 3MD3A 4AE5A 1Q78A 3N6LA 3OHBA 4DPUA 1UW9A 2D3O1 3PACA 3P5BP 1R8HA 2HG4A 3SV4A 5HP1A 3B8HA 1U02A 1IKVA 1F9EB 5HROB 1NMEB 3D0GE 4J9OA 5L1IA 4KGKA 1WC3A 2RU3A 1TTHB 1PC4A 2C2ZB 2QYGA 2MXYA 3CCJS 2GEPA 1TUGB 3CDAA 4DSFA 1HPZA 3K17A 4M1KA 4NA2A 2F8HA 4PQUA 4FKYA 4GEPA 4V19X 3QJLA 4LQ3A 1U8SA 1TVRA 1N5QA 2GIQA 3KLEA 1ZM3A 3HSGA 4GKJF 4RW8B 1NH8A 1R31A 2IAJB 1H98A 2CJ9A 2HFUA 3M2VB 4WKYA 3CDEA 1N5YA 1TK5A 1N36F 4LQ9A 4JI2F 4QYRA 3VGVA 3R2DJ 4FXDA 3D28A 2L48A 5A6WA 3ADAC 2Q1LA 4ED1A 3MR7A 2V34A 1AUSL 2VQFJ 1QSYA 4USIA 3W5ZA 1YRXA 4O3NA 2RSQA 3CO9A 3B0JA 4R5PA 3G6ES 1WTFA 3GILA 4P74A 2YH0A 4YP3A 1SV5B 4USMA 3F73A 2QMUB 4IOAQ 2W2OP 2GGPB 2CPHA 3CJ0A 4QW8A 3W7BA 4LF4J 2WBMA 3JS9A 3KXDA 2UU9F 1IJFB 3MPVA 4ZCMA 1BWEA 1IKWB 3VAHA 3C19A 4B3SJ 3BGRB 1N5TA 4WXWA 2DPIA 2NSCA 3BYRA 3VQTA 3P49B 4EI2A 2V6AA 4XTTA 3MR3A 5C42A 3VLXA 2KFYA 3X1LB 4QPXA 2MQNA 4UW2A 2I5JA 1VC6A 1YZ6A 2CG8A 3A8JA 2FJXA 3D68A 3GPAA 2G9OA 2QT7A 1DQ8A 5HBMB 1JLAA 4KGXB 1JXEA 5GAEU 4JV5F 3P4UB 1RHKB 1RAAB 4HTRA 2AJ4A 2ZOFA 2KM8C 3L7PA 2FVPA 2KZMA 1VRUA 1NDLA 3VLZA 3L3CA 1Q0NA 2LEBA 3JXOA 1YJTA 3LGMA 1AZSA 1ZM4A 5IM0B 4XAKA 2UZAA 3QIPA 1RSCA 3TZXA 3GSIA 5E3CA 3TUIC 3RB6A 1AA1B 1QJHA 2XGQA 1REGX 2M4MA 1RUSA 4H4KC 1JXLA 4DSEA 3MHYA 2Q43A 1YG0A 2R7WA 1NSKL 3R7BB 1UVLA 2VPWB 4KPCA 1SIWB 4DQIA 3K7RA 4DU8A 1RAHB 2JX2A 2HVHA 2E5IA 2W2PP 1WD6A 4ZDNA 4A8XA 3VKQA 1XK8A 2HFNA 2HVEA 2RRBA 2MQQA 3DHWC 4TY8B 4ECWA 3VKTA 3Q8UA 3ILJA 3PFOA 2VG5B 1VQ7S 2UVRA 4FBTA 1RTHB 5G4DA 4N76A 2R9LA 1VC5A 2UXDF 3G6VA 1N56A 3MM5A 2KG0A 2OSQA 1FF2A 1HWJA 4NEZA 3ONQA 3SFGA 4ETZA 2QL5B 1LFWA 2HFSA 3AH6A 4X84A 3EJMA 3AA9A 2ZNZA 1IKXB 1TQLA 4HDGA 4OX7A 1HNXF 4J9KA 2KHDA 1PC5A 1GX6A 2HHWA 1WF2A 1Q95G 2CQGA 3CD6S 5CCLA 4F0MA 5KFGA 2QA2A 2X1BA 3JYTB 1P27B 4C7QA 2F8EX 1Q4RA 3V6HA 5K14B 1YVFA 1WSVA 1E6YB 4C11B 5HQLA 5AXKA 2HQFA 7FD1A 3RU0A 3I32A 3HXMA 3IWNC 1MU2B 2FUG9 2LA6A 3V4IB 1K47A 1NUEA 4DCOB 4DOZA 3BSOA 4RW8A 4DR5F 5IQ6A 5C5JA 5LOQA 4C8ZA 2J8AA 3M2VA 2VG6A 5E3QA 3N5FA 3BKFA 3Q2TC 4YB1P 2RS2A 4OI1A 4MIBA 1JX4A 1JB0C 2JSXA 4RUBA 3CCES 3TVZA 1WOOA 4FXWA 5A2QU 1RHJB 2OD4A 1UAWA 4ZLPA 5DQGA 4A8MP 1UKUA 2LCWA 2KZZA 3DHXA 2DB1A 2ZOMA 2KT5A 2AT1B 3TA0A 2E7WA 1NHKL 3M8PA 5HO4A 4NI2B 4OZLA 2E29A 1SQEA 2B51A 1SV5A 3B6BA 1GEHA 4DN0A 2GGPA 2VPYB 2R7VA 2QGFB 4DX7A 4OLPA 1WEZA 3MR2A 3NCRA 3TAQA 5DG9A 1IKWA 1U09A 3IAS9 1UEKA 3W61A 1HWLA 2DTJA 1P6TA 1HW8A 4W98A 1J27A 1SBRA 1NPPA 3TVKA 4ZJLA 1IBCB 1OY9A 1AFJA 4FNIA 1DLOB 4M5LA 4LT6A 1C4CA 2CDRB 2N4DA 5D77A 2DCLA 2HSEB 4ES1A 4OMFG 2WOMB 4F04B 3Q2SC 3VAMA 1M1KT 3BO4A 5LSLA 4C98A 2XZDB 3KUGA 5HBMA 2HYIB 3RRHA 3BBFA 2ZE2A 2HHPA 3MCNA 4QWAA 2QFIA 1B3TA 1RTZA 2BJ3A 4F2SA 3UD3P 4W90B 3H4BA 2IM2A 1XC9A 2CAJA 4WWSA 3ZXWA 2W1BA 5IM0A 2DR6A 4DQSA 2O01C 1PJ6A 3OD2A 4DV2F 1GAOA 2UVUA 3ENVA 4E8UA 1CSJA 1GTHA 3MPYA 1XR5A 2NUHA 2HGLA 4JI3F 1MN9A 3RBXA 4BC7A 5KFPA 1YIJS 4NLYA 2QEXS 3KNAA 3DRXA 3DLJA 1QSSA 1OYEA 4X4QA 3LANA 2AGQA 4Y3CA 4WF9Q 3HX9A 3LP1B 2VG5A 3MZIA 2B43A 2HAFA 3C2PA 4JI0J 2B3TB 4EZ6A 3R1HA 4PEOA 4YB6A 5ETMA 1Q7YT 4DR3F 2PA3A 3ILOA 3VAFA 1X0PA 4O44B 3QJPA 2OIHA 1EHWA 3KLFB 3VKRA 5EWGA 2KFNA 1IKXA 3VM0A 3FEYB 4ZPAA 2LU1A 1NO8A 1O0PA 1VQ8S 2F5GA 3W8GA 1B64A 4USWA 3C3LA 2IY5B 4ED3A 4C4WA 3SDEB 1QAYA 2EKYA 2CWXA 3UW1A 5KFUA 5LM7E 5KFEA 4K4SA 1EIYB 4BC9A 4CT9A 1WC4A 1YX2A 2AZ3A 1U6FA 1E6YA 4TU7A 2KH9A 1A6LA 2DR7A 5T41A 2HFOA 2HQCA 4NLSA 4IRCA 2L9DA 3QFHA 1IWAA 3C15A 1SQGA 3MDFA 3LWLA 1MU2A 3V4IA 1HNWJ 2NUUG 4ECVA 1L3SA 4X4SA 2O5DA 1VQYA 2GNKA 5DGBA 1OMSA 4ZJQA 2V67A 4S3BA 2ZH6A 2CPEA 2HNYB 4RNNA 2D74B 3PEJA 2W7PA 2P8IA 3BM7A 2KL8A 2XBPA 2F63A 2ZKTA 3TRGA 3HKZD 3AA8A 3S8SA 2M3DA 3I4PA 3I4HX 2CQHA 3M8QB 1X4EA 1FJGJ 2D9OA 1RABB 3R6GB 4NI2A 4Q45A 3ZTOA 2VD3A 3J7A1 1PAEX 1YQHA 2CPJA 3FUYA 3OR2B 2NYIA 4ID8A 4HVZA 4LFCF 1GH8A 3OUYB 5KFFA 1ZPVA 1YSJA 2DH9A 3R5GA 4KTQA 3M1VA 5KFYA 2XMWA 3BB5A 1M5KC 4OJ3A 4CO4A 1Q8IA 2MSTA 4A8FA 3MMBA 3H2VE 1I5OB 2V8VA 1AOPA 3TUJC 1X0FA 2XC9A 2V8GA 3Q22A 4ZCIA 2MKJA 4ZPCA 2WOMA 2HLTA 2AGOA 3CJSA 2ZZNA 5D8HB 5KAKA 3UO0A 3UN2A 1RHMB 2ZDOA 5LJ5Y 1U1KA 2NPIA 4S3AA 4GMKA 3A13A 5GMDA 2HZVA 2CQ2A 4NZ0A 1S48A 1QUVA 1PCAA 3KHHA 2RILA 1KTQA 2IM3A 4HDHA 4ER8A 1G6BA 2I8EA 3CWJA 1SKUB 3TEGA 1YBUA 4DV7F 4QWBA 1Q79A 3RTVA 4ECZA 1FJCA 3VF0B 2HFZA 3FSIA 3BPSP 2F3JA 1GQEA 2BOPA 3RRGA 1Q5VA 1RTJA 1FRLA 4W92B 1LWEB 2PMZD 1ZTTA 1OSDA 4BS2A 2EI5A 3O2IA 1VMBA 3PZPA 4IQMA 2XMMA 4K2XA 2MPUA 3CEDA 2PEBA 4LSLB 1IBKJ 3I96A 4ZVOB 3NG8A 3ITHA 1OPZA 4PWWA 5RUBA 3LP1A 1N6QA 1FDAA 1U8WA 5HI7A 2CQPA 1T03B 1UA1A 4DLEA 1F5AA 5B0GA 4ZPWR 2YBVA 2LQ5A 4PG7A 4YB5A 3W65A 3ZTPA 1B7YB 2V8DA 4Q7AA 1NK6A 2QTWA 3B0NA 1KVKA 3TUPA 4DG1B 1DJ0A 3CD0A 3KLFA 4KPYA 3NCPA 3HFZB 4NLXA 3P96A 4J9PA 1SB6A 5E3AA 1E6VB 2GMHA 4O23A 3U27A 3FBBA 4NRUA 4G1IA 1IJEB 1XIQA 4GO5X 2W25A 5I4MA 2W2NP 1U26A 1BXNA 3SDEA 1ITPA 4M5HA 2AEFA 3NMRA 4P2XA 2CJBA 1RXOB 2AEMA 2L08A 4JI7J 3BPDA 3B0MA 2XYGB 1ROFA 2IM1A 4ZVQB 1GXUA 4LBPA 2N3OA 3L09A 2EFNA 2XCPA 3WHIA 2V2ZA 1SJ1A 1JLCB 3OR1B 5KFHA 1QVFR 2VV5A 4QWEA 1EKRA 2HHHJ 1HW9A 3QPIA 2GV1A 4PG8A 4TLQA 2HMIA 4B3OB 5I3UB 5T7LA 4MYTA 4LFBF 3NWRA 2HBYB 2B9EA 3FRZA 2HNYA 5IT9Y 3H5SA 4DSIA 1EETB 4DBQA 2ZH1A 3HHKA 4PCQA 2J9EA 5DDRC 3QRRA 3MAAA 4R0JA 5HANA 1K9MT 4IG3B 2CNNB 1RA7A 1WEYA 2AQ4A 4MIWA 3RGIA 3VVUA 2ZBPA 1RU1A 4OHXA 4DV4F 1HI8A 2XLJA 4HT5A 5FDLB 3OR2A 4F4WA 2KHCA 2MQOA 1M0SA 4I0WA 1X4HA 1CULB 4EYHB 1RWKB 3RZAA 3OUYA 1WDTA 2HBRB 3U7JA 2IHR1 1KKHA 2HK2A 4A48A 3M7VA 5IC4B 4FF2A 3W5XA 3E01B 4PAAA 3QAUA 2W4CA 2MKCA 1V5VA 5EHHA 2W9CB 1S6PA 3DOLA 2IDEA 2LQJA 5AE3A 1S79A 1REVA 4DFMA 4MIAA 4HT7A 5HL7Q 3TO8A 3MEGB 4K2JA 3HZEA 3PX0A 2OP5A 3PHEA 4CO2A 3OTEA 4K50A 3QGPA 1LW2B 3CE8A 2YX4A 4IOCQ 3G6YA 2POKA 1SJ3P 4ZP8A 5LT5A 2FIUA 2CQCA 4H4OA 4IO1A 1HBOB 3Q8RB 2BJ8A 2KVQE 2PN6A 3M30B 4L74A 6FDRA 3K5NA 3PCOB 2BOAA 4B9MA 3ZFVA 2V69A 2WBRA 3A12A 2DNPA 3C6TA 1FESA 4IFVA 2KB2A 2HZAA 4NEYA 5C25A 3G8TA 4YMEA 5D78A 3HULA 1SPBP 2UUWA 3I5BA 1R8BA 1HWIA 3LTOA 1DTQB 2ILYA 3PM9A 4NASA 1FKAF 3AOCA 3GSDA 2JEIA 5F3ZA 4LUBA 3CJKB 2DHSA 2HHXA 1K73T 4NX9A 5KT3A 1CS4B 2GHVC 2RF2B 1PJ7A 1T03A 1D9DA 3CTRA 1K1SA 4X62J 3DDIA 4C0OC 2HBZB 1X8DA 4JI4F 4ITSA 5CD4H 4H4KA 4DSJA 3NAIA 3D1QA 3RBZA 3THTA 4UQTA 4DXLA 4NLDA 1XNRF 1FDNA 5D15A 2EVZA 4X66J 5D3GB 4DG1A 2F65A 5K8OA 4MKVA 3M8ZA 2N7CA 2AGPA 3KLVA 3QLHB 3BREA 4F0HA 1E6VA 2L3MA 2YXLA 1R89A 1VQOS 5F9NA 3IAM9 3TI0A 2GAGC 4PUOB 5IXUA 2EWHA 2R2RA 4F3OA 2J6TA 4O0IA 4DDFA 4DQQA 1WG5A 4ED6A 1CPZA 4EGLA 4J37A 1U7LA 1JLCA 1TMMA 3NKYA 1QAIA 2FHKA 3DLBA 3GYGA 4GRSA 2IDLA 4HH0A 2ASJA 3B4DA 5AXLA 2CJQA 1X9SA 4UTGA 3TVYA 1IBLJ 5KFJA 5K20B 4B3OA 9RUBA 1PYOB 2Z0GA 2RD5C 3OVSA 2OSRA 3KK2B 5KFWA 2RAQA 1EETA 2J6UA 2Y1RI 3ZZUA 4CH7A 3DXSX 2HHSA 4IG3A 2AU0A 3HMJG 3KOAA 2EFGA 1VS3A 1RT6B 4I6WA 5T14A 3R8YA 2V5HG 5HLFB 3J7YU 3NBPB 1B70B 1UEVA 4P71A 2GS8A 4IKAA 1CJTB 4MT1A 3X3UA 3I87A 1XTZA 1RAIB 2AYMA 2RKIB 3BGUA 1B4SA 1FX2A 1CULA 1ZJ8A 2UVVA 4DR7J 2Z8QA 3PJ9A 2UUCJ 2R7XA 4CRJA 1FE0A 3DLGB 3JQKA 1M1GA 1TP7A 2WAQD 2D9PA 5IC6B 2E5LF 1TFYA 1RKIA 4OX8A 3IGVA 4F8RA 1FRXA 1MN7A 1HNIA 4TXSA 2ZWOA 4HKQA 2BABA 4TN2A 1S4FA 3ENQA 2MLZA 2W9CA 1Y5NB 3DRRB 2XSFA 1WF1A 3NP5A 4EO6A 1NXIA 1VC0A 3GU0A 3ELHA 2QG9B 4M94A 1NDPA 2DRAA 1YJUA 3DKDA 4OYBA 3MEGA 3DRYA 4C48A 1KLMB 4HI2A 1X4GA 2D69A 3OJUA 3NLCA 2YKNB 3N4WA 2BM1A 2EFVA 2VF3A 5HSPA 1FHTA 4OYWA 1W26A 3AT1B 5HVGA 3N6NA 1YHQS 1HBOA 4U95A 2JWNA 2MKYA 4J5OA 1T9VA 4YR3A 4RNFA 5D4OA 2IMOA 3PW7A 4OZ1A 5E2QA 1JJ2R 3U1LA 1D09B 1RE1B 4DV0J 1IM6A 1N33F 3QT6A 3BKUA 3CJ3A 1AXQA 2C3UA 2ZBRA 3KMSA 2YNFB 4WFNQ 2MKSA 2C3PA 4QW9A 3AFGA 4JI1F 1V3SA 3FBFA 1I3OB 3AXKA 2C3OA 2UV8A 1L3TA 4WYWA 2KT2A 2U1AA 3CJKA 4KH0B 2AMCB 1CS4A 2MMYA 2UVWA 1S59A 3PYFA 2RF2A 4ZPDA 1U2FA 2RDDA 5IT9U 2IJNA 2ZDPA 4Y2CA 3HSZA 1RT1B 4DR1F 3MCSA 2JLFA 1H3DA 4CLLA 3VQSA 4AL5A 4F67A 2CVIA 3RAMA 4ZMMA 2K7JA 3NY0A 2OPRB 4S38A 2PGCA 2DNNA 4TYAA 1WG1A 2B4UA 3M9MB 3LW5C 4HEA9 4WIQA 1T11A 5JVHQ 1XEZA 1U6BA 3MCMA 1UFLA 2EKNA 4Q5VA 4M5DA 2GJIA 4C8MA 2OPSB 4U8YA 4TQRA 4WKRA 2EG2A 5E7OB 3UWTA 2XGPA 1FKPB 2RQKA 1X9MA 4Q2LA 1ELOA 4B02A 4PPDA 2ACYA 4DR2J 3OFFA 4K4YA 3TW0A 4X64F 4CT8A 1Q5YA 2C28A 2ZBCA 1LK7A 3WIVA 1P1LA 3KMQA 4NLUA 2IA6A 4DZDA 4JI8F 3NGKA 4DV1J 4CM0A 2KJVA 2Z56B 4ZVUB 3CIMA 4DI6A 3IM9A 1U6ZA 4ALZA 3GE9A 3IXQA 4U96A 4YS2A 5F8NA 3CCUS 5ETTA 3GP9A 3R5BA 4FBUA 1NKCA 3CCSS 1U1RA 2DIVA 3S01A 3UVJB 1MROA 5HLFA 1X5OA 1JWWA 2OPQA 1Z4UA 3PFEA 2IVMA 2G0CA 5LMUJ 4L3NA 1YJNS 1BGXT 3MOJB 1CJTA 4DUYJ 1RYRA 4DUZJ 3MUVP 1UVIA 4EYIB 3V4MA 1TKTA 4KJIA 3BGOP 1H2UX 2NXCA 3IC1A 3AD8C 2ZBIA 3K59A 5GAHI 3FMBA 4C0BA 4K0KF 5IT0A 1DRZA 3LOUA 1FK9B 3BDEA 4U6PA 1TKZA 3ZZYA 4NLPA 1EJ7L 1FD2A 5IFMA 2QMXA 4L72B 4NMLA 4ZKAA 1KLMA 3WC2A 3M8SA 4P75A 3CD7A 4ID5B 1WOPA 3U02A 1KVIA 3JSYA 3IA0A 4RUCA 3MI7X 2DNRA 3DLEB 1X7VA 3V6JA 1D8ZA 2DK2A 2VHGA 2ZFHA 2CNOB 3L4BC 2ZH8A 3LP0A 4I2PA 5CH7B 1MWYA 2YKQA 1TAQA 1BQNB 4MTPA 1S0VA 4AXIA 3BS9A 3MOZA 2YNFA 2FYXA 2ATCB 2KYZA 4MK7A 4ZA1A 2H54B 3LQVA 1NJIT 3T9NA 3PR4A 2GO9A 1P9QC 3Q8QB 2BUNA 3AQPA 4NXMJ 1HIYA 1LFPA 1FX4A 4B9LA 4WFAQ 2EBEA 1YJWS 5F8HA 1UPPA 3MMCB 2G1DA 1N34J 2RIJA 3C66A 3D9BA 2C2NA 4HYKA 3OTCA 1R0AB 2DJWA 3ENAA 1VRTA 3R2CJ 1SUQB 1NEEA 3M8WA 1HL6A 2BVZA 2HEKA 2DGTA 4RWWA 3MUMP 1RT2B 4NYZA 2OPRA 4FF4A 1GMVA 1TL1A 2JH3A 4G1QB 3NS5A 3B0HA 1NB2A 1KS2A 2VQFF 2ZEJA 4OV6A 3PIPQ 1UP1A 1WF0A 2VC0A 1VQ4S 1KBRA 3Q8YA 5KG5A 3DRSB 3PKYA 2B6AB 2OPSA 1SVDA 2V2VA 1UMJA 1FKPA 1NM2A 4OI0A 3G87A 2EBGA 4DFKA 3HD2A 5KFMA 2XYPB 4I6YA 3PNIA 1BD6A 4LF4F 3F44A 3PYEA 2DVIA 3HI9A 4OHVA 4OYPA 3KUEA 2QLXA 4WTYA 4O3OA 2Z57B 3ISND 3C8YA 3QT8A 1K8AT 4UZBA 4B3SF 4B9VA 2LVWA 3UCUP 1KR4A 4OHZA 3KNGA 2PD1A 2KU7A 2QJ3A 4BCAA 2APOA 3DLHA 4ZVGA 4QOTA 4C8KA 2B4PA 2FHJA 4PYDA 2XTJP 3EZOA 4RW7A 1RJJA 3G82B 2CNLB 4E98A 3G8SA 3AHPA 2OTJS 2FJVA 4ECRA 5KFRA 5EX0A 1CJKA 3AOPA 4NL5A 2VUGA 4AUKA 2OHDA 1T3NA 1LEOA 3TANA 4GKJJ 2JNJA 5KG0A 3OJSA 1KD1T 1UJ4A 4P7TA 1S77D 3NMAA 3DYAB 3M2RB 2W01A 2Y1LB 2XY5A 4KQZA 2AZ1A 4OQJA 2ZVIA 1FFGB 4AQYJ 1O51A 3CC7S 3MAHA 4OFZA 2KO1A 2C2MB 2CPYA 3KDNA 4R25A 1RLCL 3QATA 1S9EB 1XN9A 1S1UB 3HSJA 2Y8YA 3OBIA 2N4CA 2VFUA 2CDQA 4NCBA 5J2PB 1QY7A 1XMQJ 3HO1A 3IR5B 5BYQA 3ISZA 3SZ2A 3DLKA 1R8AA 4QU7A 4O4GB 4ID5A 1FVSA 2J9DA 1YJRA 2F4FA 2H1YA 1PG5B 3FJ2A 3QSIA 3EICA 1DURA 1KEKA 3DLEA 2WW4A 5A8RB 1P8GA 3MFIA 2MQPA 4B17A 4DR6J 2DNOA 1F2GA 2B9WA 2IMWP 2UU9J 4NA3A 4ED7A 3THPA 2ROGA 1ZYQA 1BQNA 2DR8A 2ZH7A 4KGZB 3KG4A 2YPZA 3BN4A 4KV8B 4DPYA 4P7VA 3PYDA 4LR7A 4OJHA 4FF1A 1VHIA 1DARA 3EE3A 3V5RA 1N32J 4USHA 4EK2A 4X4NA 5CAAA 4C8NA 3VGSA 3C46A 2YX1A 3IM8A 2OD6A 2WVBA 2P9CA 1ZAXA 5L9NA 2DO0A 5GEPA 4F7VA 1YI2S 4LREA 1RACB 3SI8A 1FD8A 4LMZA 4JV5J 4QR2A 3CXCR 2JC1A 4NZ7A 2LMIA 2HZCA 3FMWA 4BWMA 1MW7A 3MMCA 2MGZB 5E3RA 4DCJB 1JLEB 4OIXA 1YRTA 1SUQA 5IV4A 2GVDA 5J2QA 3BQ0A 4DSKA 3WX8A 1RT2A 3M8RA 4WK1A 5KT5A 4TVAB 4RW4B 2V94A 2FVRA 3U1MA 4G1QA 1N5SA 2AX0A 3CDWA 4LF2A 2MJNA 3W64A 4F36A 2XNQA 3GFHA 3DRSA 3UR3C 3TZWA 3MM8B 4UT4A 1Z1ZA 1OSCA 4LVOP 4ZOSA 1S1VB 3QIDA 3EGVA 4BLGA 1RAEB 3WX4A 3ZTRA 3SEOA 4ELVA 5AOPA 4USVA 2MY8A 4ZIWA 2E1MC 2BDPA 1TMJA 1XR7A 5C24B 1JLQB 5J1EB 1C1BB 1TK0A 4RW9B 2FD2A 5IV3A 3HVRA 1JLFB 4K5SA 1XMBA 4NPOA 1FFSB 4G3IA 1TL3B 4X4PA 3US5A 1UVJA 2HVZA 5KG6A 3BH6B 4USUA 5BJRA 3CDBA 5FLXY 2VBZA 3OTOJ 2Z2LA 2KRRA 1XR6A 4GVLA 3E3XA 2WRMA 4DUTA 2BQRA 3G82A 2C22A 2AYBA 3K5MA 3UE2A 4I7FB 3W66A 3ZZ0A 1S72S 1NKBA 1NAQA 1NU4A 1U0SA 5IWAJ 4QQBA 3GV8B 3PVXA 4HI1A 2HQ3A 1WEXA 4DJBA 3QRPA 3GMGA 1VFJA 4IUFA 4EBDA 2X1GA 1YLXA 3DYAA 3ET6B 3M2RA 1XERA 3BO3A 2GO8A 5E0OA 4M5GA 1HNVA 1WOSA 2G2YA 2V9WA 3RG6A 2MZ1A 4TNOA 3D7SB 3EXCX 4UZCA 5KG1A 2XS5A 1HQEB 5EWEA 2WONA 3SSRA 1X4AA 3W63A 4FVMA 2HIYA 2OEMA 2BA9A 1AFIA 3CJTA 4Y2MA 4XDCA 5KT2A 1S1UA 3CJ8A 1FERA 3K57A 4USJC 3AB4B 1S9FA 3W8PA 1I94J 2ZITA 3NRBA 7GEPA 5J2PA 1SC4B 1KP6A 2R3VA 1SI9A 2ASYA 3H42A 2CZVC 1DFDA 2IBOA 3I0SA 2V8PA 4JI0F 2ZHBA 3FNNA 1FRHA 5A8RA 2G0JA 1HBNA 1YK9A 7AT1B 3RYLA 4L3KA 5BYRA 1Y00A 2J5AA 5HP1B 4N7TA 2XMUA 5A76A 1IKVB 4FPRA 3GJSB 2V63A 5MAOA 4WIIA 4Z7YA 4Q2MA 2ERRA 2MKIA 3W3SA 3OL8A 4KV8A 1NK0A 1RWVB 2VFRA 3AQOA 2W9AA 5B7WA 4PXEA 3ETOA 3I55S 1TVRB 3UR0A 1Q8BA 2J0QD 5F8LA 3VGTA 3VVTA 4F0KA 3WC0A 1IQTA 4N47A 4CIOA 1N5YB 3QBCA 1YGYA 1F2HA 4DV5F 3GJRB 2OFHX 2XWYA 3UCZP 2NREA 3NXZA 2D1CA 2M70A 2YNHA 2P6TA 3FSXA 2AIRB 4DU7A 1FE4A 1HNWF 2ZVSA 2GIRA 2FY1A 2V4QA 3P3DA 3MPWA 2A6MA 4R5PB 4YR2A 3VCDA 3V81B 5A8WA 4PXCA 2RHSB 2ZHAA 1BUXA 1V3RA 2DNYA 3ULHA 5KFBA 3GIJA 2FZGB 2CJXB 3C6UA 4WU2A 1F5CA 1U1QA 2A2CA 1U45A 1QLNA 3HT3A 4PG4A 3TP2A 4FZVA 3L7UA 1RAFB 4QWCA 1ZTWA 3CSKA 2O3DA 1FJGF 3MM8A 2J6SA 1N48A 2DGXA 2JRSA 1SL1A 3MTKA 3PJWA 1BLUA 3I9ZA 3D67A 1SCJB 1B7FA 5DLFA 2NR0A 1KN6A 1G2EA 4Q0BA 2PT0A 5FJ4A 5C24A 1JLQA 3PR5B 1JLAB 4I2QB 3JSRA 1C1BA 4RW9A 1M90T 2G1HA 2DPJA 1JLFA 2FJEB 4GO7X 4ELTA 3CCVS 1VRUB 5L38A 1IM4A 5A2QY 1DHMA 3VKSA 1T8EA 1AZSB 1H2TZ 3QIPB 4UQGA 5GAGI 4IR9A 2FLPA 5BR8J 2PFDA 2CJKA 4IDKA 3I31A 4S3DA 1RWNB 4N41A 3FBCA 2HRTA 4J90A 2M9KA 5J2MA 3JQJA 2XI2A 2OFGX 4ECQA 3CMQA 3H90A 4UUXA 3EVMA 1PAUB 1SIZA 4TU9A 4OZ0A 3CCRS 1TAUA 4JUZA 2ALZA 4KAIA 2W9BB 4CLKA 5IS2A 4ZPVR 3TUZC 5DDOC 2BBEA 3ET6A 3HHLB 5EX3A 2NQPA 3ZTSA 3BGLA 5L1KA 1HQEA 4TYBA 2AJFE 2VDIA 5KG3A 3HSDA 2LXIA 5HJYA 1TK8A 4DS4A 4WP3A 1FRMA 1IBKF 2XB2D 8AT1B 1UZHA 3G4SS 3EGZA 2DIUA 2DNGA 4DPXA 2HQIA 1IKYA 1TL7A 1TV6A 4KHRA 2YKOA 4B9TA 3T6JA 3AODA 4K5RA 3Q23A 2DT9A 2GHPA 3FVYA 1V5IB 1R6YA 3IWLA 4MKAA 3PYGA 2M88A 3B0GA 2K8GA 2XO7A 4MKBA 3M6XA 4N56A 3BN7A 1WI8A 4HACB 3IRXB 3TOQA 3TAMB 1BQMA 4JI7F 3QQCD 1HR0J 1SJRA 4FN5A 4HTJA 1URRA 2VG6B 1S6QB 3KWMA 4KFBB 1AROP 2LDIA 3HPOA 4OHYA 3DU5A 3AOBA 1NSPA 3CCQS 2ROEA 1TZ0A 5JMNA 1DQ9A 4IRDA 4C3KA 2ZM6J 2CQIA 2CPZA 2XMVA 3B82A 2JLGA 3QT5A 4RUHA 5FLXU 2FJBB 1LWCA 2HHHF 2Z30B 2QMWA 1RAJA 3M8PB 4URQU 4RUAA 3V81A 4WFZA 2EK1A 1S1TB 2HKEA 4USTA 1NSAA 5KFTA 1PIEA 1V6HA 3R5JB 3KJQB 3IG1B 2I6WA 2HURA 3THVA 3GTYX 4DV6F 1NRKA 1QM9A 1LK5A 4KO0A 2HHVA 1JQGA 4KT0C 3PY8A 4XPCA 2FZKB 2RNEA 4YFUA 2AHOB 3HD1A 2FQQB 4K4TA 4C3MA 2ZJPQ 3OVAA 2WVCA 1R7IA 4CWBA 1HMVA 3SQOP 4I2QA 4H54A 2ZE2B 4QR0A 2D41A 2AJQA 1S4EA 2E7VA 2BZ2A 2C2DA 5ETPA 4U7CA 3AD9C 1ZZFA 2I9SA 3MR6A 4ZVHA 2EW9A 3CB4A 2OEJA 1MNEA 3GYXB 1WELA 2DEIA 2O67A 4RU9A 4K4XA 4LF7J 3QRQA 1TELA 1T94A 2AV5A 5DDQC 2FB0A 2A2DA 1VOMA 5DZ7A 3T5HA 3KLIB 2B5JB 3B54A 3OL6A 4RW6B 4K4UA 2W9BA 3W2WB 4JV1A 5LMNF 2ZWPA 2AW0A 1FEEA 3TQ1A 2EG1A 3HHLA 4L6V3 4K4WA 4FS2A 4LFBJ 5CYQA 2W4PA 1RP5A 5DQIA 1N88A 2RUGA 3FGVA 1AUDA 1RWOB 3H0PA 8RUCA 4HL9A 2V50A 2MLXA 1A9NB 3RB0A 4ED5A 2K06A 2YVSA 1Q81T 4QIWD 4J9MA 1LXJA 2GW8A 2YWHA 2VL1A 4PR6A 1VJQA 2IRUA 3OW2R 3NEKA 1JJCB 2CJAA 4LFAJ 4KSEB 3RR8A 4X62F 4Y2IA 2KXNB 2HVDA 2WB4A 5KT7A 1U25A 1X4FA 2Q6BA 4NYPA 4PRFA 2JVOA 4X66F 2FJAB 1CLFA 1FRKA 1OO0B 3UQSA 3F0NA 1I51B 5KG7A 3RW6A 3MR5A 2PI5A 4N77A 1UETA 4RL1A 4FYXB 3DOKB 3C15B 3R7SB 3VAJA 4OI2A 2ZJRQ 3CJ5A 4WP9A 2W24A 4ZITA 2HIQA 2XSJB 2J0WA 1KHWA 4HACA 4ANDA 2FVSA 3IRXA 3TAMA 4V1Ak 1SH2A 3U1NA 1N0UA 4ANEA 3NOYA 2KT3A 5D0GA 1S6QA 4G38A 1WACA 4KFBA 1FJEB 2FY8A 1UPMB 1HKAA 4S39A 4E2FB 4DEZA 2O1PA 1LOUA 4IO9Q 2OUGA 5A0YB 2G13A 3GV7B 2Y3YA 2V4RA 3OSNA 1NJZA 4ZLJA 2R7SA 1FRJA 2YWWA 1LNQA 2R2SA 2R8IA 2XY6A 3K8WA 2Z58B 1RBAA 4ANCA 4DPWA 2MEWA 5H9FJ 2ADCA 1CQMA 3AJ1A 2H3EB 1VK3A 2JVRA 4C8LA 2E9RX 1OY6A 1S1TA 5J1PA 1MMLA 2L9NA 3K0JA 3EPGA 4I64A 4J9LA 5GAHU 4Q44A 2ZHOA 3IG1A 4MFBA 3BDPA 1K1QA 3UN3A 2X51A 3M1VB 1JIHA 1NK9A 1U0HA 3LH2S 1HARA 5LXRA 4A8SA 2BRKA 4WBFA 4EBCA 4RR5A 2QYCA 2EFPA 4RU2A 2AJ1A 3MMBB 4I67A 1FTRA 2B4OA 4TKTA 2GMJA 4YDXA 2AKJA 1RZMA 3FCWA 1NSQA 4DR7F 2Q66A 1JK9B 4HR2A 1U1PA 4UOHA 1VQMS 2KI2A 3JSBA 1BC6A 3KDOA 4ILLA 4YR0A 2FGOA 4IH7A 2BKPA 2G0IA 3VV2B 4MK9A 1RTIB 1B0TA 3GFYA 1VQPS 5HQMA 3J7Z5 4JI5J 1SKSA 1VR6A 2ABYA 3HK2A 1GMWA 4L73A 3BQ2A 4DLGA 1VDHA 2RRNA 2WVDA 3EWGA 2M5YA 3GZ7A 1RTJB 4LVNP 3G2XA 3GYNA 2XULA 2G2ZA 4DL4A 2MTLA 3EPIA 3JTPA 3KLIA 5KFSA 2B5JA 3GIMA 4RW6A 4X4UA 3ITHB 5KFIA 3K2YA 3W2WA 2K3KA 4PABA 2J8SA 1N6QB 3QGGA 4DV0F 2NXNA 2VOOA 4ED0A 1GFWB 2CZ9A 1FA0A 4YOEA 5AJ3J 5FD1A 2ZD1A 1G3OA 3KHLA 3Q24A 2VBYA 4QJVA 3CCTA 4JV0A 2YWKA 2DNKA 2EFQA 2NCKL 5M2PA 1KQSR 1G1XA 1RHRB 3MF5A 2VPZB 4CLSA 4DFPA 2VA3A 3SCLE 1W7WA 1PO6A 3ICLA 4JV2A 1C0TB 1K44A 2DY1A 3LGHA 1WKKA 4XDDA 4NLWA 2LEAA 3EX7B 5D0RA 2KDOA 2QRRA 1BHNA 4K7QA 5EUHA 5B0AA 1Y4ZB 4FYVB 4NA1A 2VFSA 4WFBQ 4CZCA 2RS8A 2ZUAA 1NBEB 3I56S 1JKHA 4EO8A 3B0LA 1CQNA 2M52A 3DOKA 4MKYA 1HHSA 4F2RA 4N8OA 1VBKA 1RU2A 4LBHA 1S9GA 3DMJA 4B3TJ 4KGMA 4Y28C 4AL6A 2XSJA 2DRDA 2MZTA 2HMIB 4ED2A 1FDBA 1WDDA 3KK1B 5T7LB 1NK4A 3P5TL 2JL9A 3HF5A 5CA5A 3M6UA 2XMJA 3DM2A 3ZZTA 2NLWA 1WHYA 2IC3A 5A0YA 1WC0A 2COLA 1T95A 3MAAB 2Y0SD 2NSBA 4DR2F 3AOAA 1X5TA 3LAKA 2ZNYA 3MEEA 2J7WA 4NLTA 1NLKL 2B9XA 2AD9A 1NPKA 2H65B 3BF4A 4LF6J 5ETNA 5L9XA 4DPOA 3UD4P 4HHHA 3EXYA 4DV1F 5HMXA 2BYCA 1ZH5A 2QA1A 2DNHA 2ZOGA 3ZNJ1 7FDRA 3O8WA 5L46A 1WI6A 2K3IA 4TLRA 3TWZA 1UZDA 1Y5IB 2DGWA 2NPFA 1F9HA 1NDKA 4MJKA 5LMUF 1S6PB 2V4JA 3DOLB 3HHLD 1HA1A 3CCZA 4DUYF 3DFEA 1REVB 2VICA 2BJ1A 3M4XA 4W4MA 4DUZF 3IMQJ 2HAIA 4LRCA 2HLUA 5KFCA 5F3TA 2RHQB 2FC8A 2YNIA 3LGNA 4GKKJ 4PYAA 2E9TA 2FJWA 3BQ1A 4H4OB 3HHEA 2B0GA 4WCEQ 4LSNB 1RTIA 4F4XA 1RYSA 4OX9J 5ADZA 1X31C 4P2MA 2MZSA 3C6TB 3S1TA 3HT0A 4IFVB 3R6LB 4ECTA 2GX8A 3R27A 2Y1JA 1CBKA 2EK6A 5C25B 5AXNA 2U2FA 2CWKA 1YBTA 3K5OA 2DBBA 2BEFA 4OJ1A 2MQ8A 1FCAA 3I9V9 1FT8A 2GQCA 3HVWA 2KM8B 4A8OA 4M5KA 1T05A 4X64J 2MLYA 1NPRA 3HHNB 4J9NA 3A3NB 3ETMA 4J9SA 1OS5A 3LAMA 5AE2A 4O4RA 1U48A 2XCAA 2FLNA 1RT4B 2IVYA 3MUTP 2RU9A 1FTCA 1ACMB 1GX5A 3ZZPA 3TX0A 1YTYA 2YKAA 1G7CB 4J91A 4RNOA 1IBMJ 1VBXA 2RRAA 2ASLA 3FEZA 2KG1A 5LJ3Y 1FKOA 4DWIA 1VYAA 1U24A 3KJVB 4NXMF 5L39A 1C0TA 5C2CA 3VZIA 3SCKE 3VAKA 2ADBA 2DGUA 4ECSA 2F4VJ 1RTDB 1N34F 4Y2KA 4DV3F 3G86A 4X2BA 3KLHB 2H51B 2CPIA 2ZH2A 2D3ZA 1SL2A 2DH7A 3RR7A 4AFFA 4OYAA 4USKA 1S76D 5HMWA 1HBUB 1T9TA 1KTVA 3HCXA 1DTTA 1I6JA 4IYQA 4M5NA 4DN9A 2H4WB 4LSZB 2KRBA 2F7VA 2P6SA 1DQAA 1Z2ZA 4X65J 2BR0A 2CZ4A 2WSEC 2OELA 1QAJA 5IQQA 3QZ8A 2BKOA 1SH0A 4FF3A 2E5JA 4YHHJ 3KK1A 5K8PA 4QIFA 4DPTA 3PKMA 5AT1B 1IQZA 2QZ8A 1HQUB 2XEXA 4R0EA 4F4AA 3FSYA 3KHRA 5H1SV 4LF9F 5LSRA 1S0OA 4OYXA 2B8PA 2M8DB 3AJDA 2DNQA 4DX6A 4LR8A 4WU3A 1VIOA 2ACMA 4BDPA 1Q86T 5ETRA 2MDAA 1OY8A 4N8NA 1P1TA 2UXBJ 1T9UA 1GMWD 2CPXA 3H40A 2HS0A 2R8KA 1PYSB 3M6WA 2ZKUA 2CNKB 2E7XA 2R8HA 5HMZA 1BMQB 1VQ5S 3GEOA 5GVQA 2W8KA 2KTQA 3NGTA 2GJFA 1M5SA 3QGHA 5AXMA 2MZQA 2XNRA 1HNIB 2IFXA 3KYLA 2LYVA 5KFAA 3OFGA 1NB7A 2RQCA 3PX4A 2UUAJ 3NOGA 5J1NA 5B09A 5B0CA 1U4BA 4L75A 4IFYA 2A3JA 3MD1A 3A3OB 4URSA 4NYOA 2C2KB 2WW8A 3OT9A 3LO3A 3SV3A 1L3VA 2D7SA 3D5MA 4LF5J 2ZH3A 2E5GA 4MYUA 1JLGB 4AQYF 3AD7C 4LSNA 3Q0AA 3GIIA 2DITA 2YX7A 1QAXA 2Q6CA 5B0FA 2WSCC 4ZP7A 3A8IA 2RUSA 4KY3A 5DLGA 3MMJA 5F9LA 1XMQF 3DOMA 1Q7LB 4UUWA 4KYZA 3MECB 1HI0P 3Q8SB 2RDIA 1S99A 1J2VA 2CPDA 4Y65A 4NLQA 2VIHA 1KHVA 4DR6F 3CJ4A 1S1XB 3OLAA 3PW4A 2CPFA 3HKWA 2CQDA 2OLWA 3SQGA 5GMKa 4PWDA 3TYTA 2J7UA 1OQ3A 3G6XA 3GR1A 1APSA 1ZAVA 3BO2A 4HH1A 1RDRA 1RT4A 2MYFA 5ITHA 2E9ZA 3BZQA 1QTNB 2VBXA 3VM1A 2VKRA 1H6KX 1N32F 2UUBJ 4OI4A 3DRPA 3M8YA 3GB0A 3OXFA 3W1YC 3CUNA 4DL3A 4ZLNA 2FZCB 3KJVA 3ZC4A 1EZZB 2L9WA 5C2GA 4ES2A 1W25A 2FVCA 4FYYB 1LQ9A 4NLRA 1FDDA 3HM9A 4Y00A 4FKXA 3EDRB 5L1JA 1RTDA 2UXCF 1C0UA 3KLHA 4WFYA 5AE1A 2HWTA 3TJ9A 3O6QA 5KFNA 4CO1A 4M5DB 2HWHA 2BJDA 2P9GA 2ROPA 3VR1A 1HBUA 2OAUA 1MSWD 2RB7A 4F3MA 1L5UA 4IR1A 2AYGA 5F0WA 4F26A 4FVCA 3K8VA 1OIAA 3BSAA 2BANA 3P45B 1Y3JA 3MGJA 2UUTA 1CEZA 4DF8A 3PW0A 1NDCA 4D3GA 2Z2MA 1TUVA 1HQUA 4EZ9A 5GAGU 4E0DA 4YUDA 3OPKA 2VZ9A 3R3TA 4RWXA 2CVEA 3W60A 2LECA 2VH7A 4X4VA 4IRKA 3VAIA 5A8KA 1B99A 3JQMA 2R42A 5DRKA 1ICEB 4PXDA 3EGWB 3W9IA 3G96A 1U49A 1MROB 2OPQB 2YKMA 3TZZA 1KFDA 4QYZK 2R4FA 2JFDA 5SZTA 3POTB 4M63A 2ZUGA 4MMOA 2QL7B 4M5JA 2OMLA 4RBVA 1Q82T 3NNAA 5KOXA 1TKTB 2XMAA 5KFZA 4FP9A 3DDNA 5B0BA 2CJYB 3OTOF 5HROA 1X4CA 4WXOA 3HJFA 4J7CA 2ZH4A 1CJVB 5KFDA 4MAKA 3E2EA 4I6AA 3CCMS 4CLTA 4P2FA 1CC7A 5IWAF 1T3OA 1TKZB 1KOHA 1XJWB 2M2BA 3DC2A 1U1OA 1BQXA 2VDHA 1RI7A 1UTAA 3N6MA 3TARA 2IAJA 1M5HA 2V2KA 3HHDA 1YJ7A 3W5YA 4F4YA 3L7OA 1URNA 3Q83A 1JLGA 2WVFA 4KH1B 2OGUA 4WE1B 5DG7A 3PG9A 1M5VC 2HFVA 4C97A 2NS1B 3DN9A 4ZVRB 3MCOA 3K58A 3LP0B 3IWXA 4I2PB 1XNQJ 2AX1A 2BE2B 3NGUA 2BV3A 1NCLA 1JXVA 4KB7A 3H2LA 3WQPA 1JMTA 1I94F 2RE1A 1SKRA 2FC9A 1DZ5A 3MWBA 2DYAA 3MECA 3ISNC 2J9CA 1X4DA 2XO6A 3NOCA 3K5LA 4NXNJ 4X4OA 3H5UA 3D66A 4O3QA 4EWTA 1Z2LA 2HNDB 1NH7A 3MURP 3GCXP 2DXEA 1S1XA 2YWFA 5CXTA 3OVBA 1TL4A 1IXKA 2PO4A 3T1HJ 3OTDA 1O6XA 3FCVA 5DDPC 4ZP9A 1J5OB 3BGRA 2LKZA 4ZLLA 4PXBA 2NYHA 1TUWA 4O3RA 2QV6A 2KJWA 4QIGA 1KSPA 2R2TA 3UDEA 2G2OA 2C2RA 1PSDA 4OLOA 1VRTB 3TX8A 1ZM9A 1W2IA 2R7RA 4CYUB 3O1LA 1TL1B 4ZN3A 4AD6A 5HVFA 1XMOJ 2J7KA 1N8RT 1PBAA 4YY3J 4ZVPB 4Y2AA 4ZHRB 5F8GA 5IOLA 2MJUA 3UFCX 3T1AA 1C4AA 3CDUA 3BBBA 3NGRA 3RUBL 3QAEA 3VGUA 1WKJA 1H7XA 1D1UA 2XS2A 1KDNA 1VK8A 3O3LA 1ZM2A 4OHWA 4QIVA 5SUHA 3M6VA 4LF8J 1R0CB 2DXDA 1UVMA 4TY8A 4QR1A 1IR1A 2PMHA 4DX5A 3W2VB 2MHEA 2J9DE 4WPAA 3NGDA 5THWA 3ZTQA 1RTHA 4C6AA 4JI6J 1MG7A 2K2PA 4U67Q 2GFFA 1UVNA 2DNMA 4DFJA 3ZZOA 5CZVA 4DQRA 1HD0A 1VCTA 2A0FB 4CH0S 2W7OA 3A1YG 2BQ3A 1KLNA 4CO0A 3HFKA 4RW7B 3UCGA 1VHFA 4BWJA 3VZHA 3POTA 2VKZG 1CJKB 5HATA 1M5OC 3CW2C 2E1PA 1S7IA 2GZOA 2DO4A 1YDLA 3JYTA 4CLFA 4J9QA 4QCLA 1GMUA 2RVJA 3KTQA 1HWUA 1CJUB 5K14A 5BR8F 4DV5J 4C11A 3QYYA 1CJVA 3QGIA 1WTBA 3PXGa 3WZ0A 1HNZJ 2MKHA 4NLGA 2HGMA 3QWUA 3BJYA 2F40A 1R3NA 4KR0B 3VHQA 4OL8A 1EARA 1TU0B 2Z4PA 2YWEA 2V9KA 4RBTA 2DCUB 2XG8A 4KGVB 1RQ0A 4A8QA 3QJJA 1FRIA 4CNZA 3DLKB 1KVJA 2GHWA 4EU0A 1M1HA 3J81Y 3AAWB 2BACA 2Q79A 4WE1A 1RWUA 3BEGB 3J7ZT 4I68A 2YWGA 5DG8A 1X5PA 1VQ6S 1WSRA 2BE2A 2DRBA 4QYZJ 1DAXA 3DI6B 1KRPA 1RT7B 2JEJA 2IJFA 2HQDA 5J2NB 1HWKA 4DHVA 8ATCB 2AWZA 2VG7B 3IR7B 1K0TA 2MB0B 4I1TA 1UJ6A 1KFSA 5EGYA 3DDKA
chains in the Genus database with same CATH topology
3IR6B 2BQUA 4B9NA 2HNDA 2FLLA 4U7CA 1U7LA 2P5VA 1JLCA 2PDAA 1F0XA 3NKYA 2GCFA 2FHKA 1QAIA 1ZZFA 2I2YA 3DLBA 2I9SA 5CQGA 1VQ9S 4HH0A 3MR6A 4O4GA 4ZVHA 2ASJA 3B4DA 2KN4A 1SH3A 2EW9A 3E8OA 5AXLA 2CJQA 3GV5B 3GWCA 1J5OA 3CB4A 3H5XA 2KYXA 1X9SA 3MM7A 4JI6F 1CG2A 3TVYA 1MNEA 2MQMA 3GYXB 2DD8S 2M7SA 1WELA 2PC6A 1X5SA 2O67A 5KFJA 3JB9k 2JLEA 4RU9A 3H98A 4K4XA 4B3OA 3IBWA 3D2WA 4ZP6A 1T94A 3OXLA 4CCHA 2Z0GA 2AV5A 2RD5C 4P2SA 3OVSA 5F8IA 2NXUA 1DLOA 5HN0A 1YJ9S 1TL5A 5DDQC 2FB0A 2A2DA 5DQHA 1VOMA 4ZVFA 2R2UA 2OSRA 3KK2B 3T5HA 3QMQA 3KLIB 1MMDA 2B5JB 5KFWA 3OL6A 1FEHA 4S23A 5J2QB 1HR0F 1EETA 4RW6B 3RBEA 2J6UA 4K4UA 2W9BA 3W2WB 2Y1RI 1JNRB 1HPZB 4JV1A 5EN1A 1K0VA 4PQUB 3ZZUA 5LMNF 4QPTA 4CH7A 4F4KA 3DXSX 2HHSA 2AW0A 2M8HA 4IG3A 1FEEA 2B4VA 4URGA 1Y0HA 4DF4A 2AU0A 3TQ1A 2EG1A 3HHLA 4L6V3 3HMJG 3H20A 4K4WA 2EC0A 3KOAA 2EFGA 4ZPBA 2WHOA 4FS2A 5CYQA 1VS3A 2W4PA 4IFYB 4OX6A 1RT6B 1RP5A 3KLEB 1FNOA 5DQIA 2XS7A 1N88A 2RUGA 3FGVA 1UA0A 4I6WA 5T14A 1AUDA 2ZM6F 2V5HG 5HLFB 2KKHA 1FO1A 4YB7A 3IS9A 3J7YU 3NBPB 4HL9A 1UEVA 3QWPA 2LQ9A 4PG6A 4M95A 2A10A 2JEGA 4ZHRA 2ZH9A 1A9NB 4IKAA 3RB0A 3X3UA 1M5PC 4ED5A 3I87A 3ZZZA 1XTZA 2JEFA 2YVSA 1SJFA 1Q81T 4QIWD 2AYMA 2RKIB 2X3GA 3BGUA 4J9MA 3R1LA 1TR0A 4UY85 4I69A 2JZ5A 5CYMA 1CPZA 2MKKA 1LXJA 4YDDB 1ZJ8A 2GW8A 2L41A 4IQXA 2UVVA 2Z8QA 1YITS 1HNZF 4G39A 2YWHA 1V3ZA 2VL1A 1YWXA 4PR6A 1JJHA 3LF0A 3M9NB 5GADU 2R7XA 4CQ1A 3T19A 2IRUA 2MGZA 3OW2R 5D4LA 1FE0A 2MZRA 1WHWA 3DLGB 3KHGA 1TP7A 2CJAA 2WAQD 4ED8A 3CC2S 1JLEA 2D9PA 3OL9A 2E5LF 1TFYA 4KSEB 2R8GA 3RR8A 4X62F 1H2VZ 4Y2IA 1RKIA 4OX8A 2PSZA 2KXNB 3IGVA 4F8RA 1KQGB 3JTNA 1FRXA 1HNIA 2WB4A 3AJ2A 5KT7A 4NWBA 4TXSA 1U25A 1X4FA 4HKQA 2Q6BA 3AY0A 4NYPA 4PRFA 2BABA 4TN2A 4ZVEA 2JVOA 1S4FA 2BM0A 3ENQA 4U7UK 2W9CA 1HI1A 4IOBA 1Y5NB 3DRRB 4N5SA 2XSFA 4X66F 3EUNA 2C2EA 3W2VA 1WF1A 3MM6A 2FJAB 3NP5A 4EO6A 4TQSA 1CLFA 1FRKA 1OO0B 4RW4A 3UQSA 2FHMA 1VC0A 4M94A 3CPWR 2DRAA 5KG7A 1YJUA 5L8RC 3RW6A 4DS5A 3LPYA 3MEGA 3M9OB 3MR5A 2CFXA 1RT5B 2PI5A 3DRYA 4N77A 1KQKA 1KLMB 4HI2A 5IZHA 1UETA 2LQBA 3CF5Q 3BSNA 3JSMA 3DOKB 4FS1A 4Q43A 1X4GA 3VAJA 4QWDA 3OJUA 4OI2A 3SQGB 4PWDB 2ZJRQ 3CJ5A 3NLCA 2YKNB 3T5KA 2VASA 3N4WA 2BM1A 2W24A 2EFVA 1Y3KA 4O44A 5EDWA 1FHTA 2HIQA 2XSJB 3B78A 1D0EA 2J0WA 1KHWA 4ETXA 2FVSA 2HNZA 3N6NA 3IRXA 1YHQS 4XO0A 1HBOA 3TAMA 1Y7PA 1SH2A 2GJ2A 2B56A 2RQ4A 3NAHA 2JWNA 3U1NA 1N0UA 2DGVA 4J5OA 4YR3A 4RNFA 5DS7A 5DM7Q 2FJDB 3NOYA 5D4OA 1GXLA 1VI7A 3NS6A 5G0RB 2IMOA 2KT3A 3PW7A 5C42B 1S1VA 2CYYA 4IG0A 1QE1B 4OZ1A 1S6QA 4OZNA 5E2QA 1Q8LA 1WACA 2VA2A 1JJ2R 4O3SA 3U1LA 4KFBA 4G38A 1FJEB 2I5JB 1N33F 4TU8A 3DRPB 1OWXA 4S39A 4CH1A 3CJ3A 4DEZA 1AXQA 2C3UA 2O1PA 1LOUA 1SJQA 4IO9Q 3KMSA 3TNVA 2YNFB 4WYLA 5A0YB 4WFNQ 2MKSA 2G13A 3GV7B 1NK7A 2V4RA 3OSNA 5J1EA 2WB1D 4HTIA 1NJZA 2C3PA 4ECUA 2R7SA 4QW9A 3N01A 1FRJA 2C3MA 1S6OA 6FD1A 3D54A 4JI1F 1V3SA 5KFOA 2K7KA 4RX6A 1NHUA 2R2SA 1HNVB 2R8IA 3K8WA 2XY6A 1FXLA 2C3OA 3I0RA 2UV8A 1NHVA 2QA4G 4PPZA 5I3PA 1QTMA 4LF7F 5H9FJ 1L3TA 4WYWA 2VQEF 2ADCA 1TL3A 2KT2A 2WONB 3QO9A 1C0UB 5LXYA 3MFHA 5IT4A 3V6DA 1CQMA 2U1AA 3AJ1A 2B7CB 4PKDB 1Y9OA 2JC0A 3CJKA 1VK3A 2JVRA 4C8LA 3NL0A 3GFXA 3GG0A 2E9RX 4F4ZA 2A1BA 2P9EA 2MMYA 1S1TA 5J1PA 1LV5A 4B08A 2ILZA 2UVWA 1MMLA 3D1OA 4G1PA 2RF2A 4ILRA 3FQLA 4ZPDA 2L9NA 1U2FA 5F8MA 4G9PA 3K0JA 3EPGA 2CIMA 4I64A 4J9LA 5GAHU 2IJNA 4IH6A 2CRLA 3I6PA 4RZRA 5M2RA 4Q44A 3FEXB 2ZHOA 3IG1A 4MFBA 3BDPA 2MHNA 2ZDPA 4OI6A 1K1QA 1UJ5A 1VGYA 3TA2A 2XMTA 2X51A 3M1VB 4Y2CA 1JIHA 3T1YF 1NK9A 4C9DA 4QIEA 2HWIA 3I5CA 5KOWA 4I7FA 3LH2S 2YKPA 3I82A 3I0SB 1RT1B 1HARA 5LXRA 4DR1F 3SFUA 3HDSA 4A8SA 3MCSA 5KT6A 2BRKA 3J7YI 2JLFA 4EBCA 1H3DA 2QYCA 2EFPA 4RU2A 3VQSA 1HBNB 4DR4F 2AJ1A 3MMBB 4WZMA 2BANB 4P6QA 1H7WA 4AL5A 4I67A 4F67A 1FTRA 2B4OA 2CVIA 3RAMA 4ZMMA 2K7JA 1QVGR 1UWBA 1BY9A 3MEDB 4TKTA 4B3MF 2OPRB 4FYDA 2PGCA 4S38A 2DNNA 4TYAA 1WG1A 4JYAF 4DSLA 2H5EA 2GMJA 3DI6A 4RNMA 2CQ1A 2B4UA 1UVKA 3TAPA 2ZZMA 4YDXA 5DETA 1RT7A 4TY9A 1GXTA 2AKJA 3M9MB 4DR7F 5J2NA 1H38A 2IRXA 3LW5C 2Q66A 3M8QA 3CVKA 4HEA9 2HW3A 5JVHQ 1XEZA 4KHMA 3MM5B 1JK9B 3N5BA 1U6BA 2OPPB 1UFLA 3H25A 2VG7A 3PX6A 1F5BA 1U1PA 4LFAF 2KVIA 5A8KB 4XIUA 4Q5VA 1VQMS 2KI2A 4IH5A 1ZZNA 3JSBA 1U47A 1IN0A 3G71S 4OV1A 1VLYA 1BC6A 4M5DA 2GJIA 5CHCB 3E51A 2HRYA 4ILLA 4C8MA 1N4LA 4YR0A 2OPSB 2FGOA 4TQRA 4IH7A 4WKRA 2CKWA 2EG2A 5CYJA 2JOQA 4KHPF 2YTCA 5E7OB 1FNMA 2YKMB 4MK9A 3SSSA 2YH1A 1RTIB 3OLBA 1B0TA 3GFYA 4I56A 3UWTA 2PEHA 1SJ4P 2XGPA 1J5EF 4ZCLA 3WDOA 1VQPS 1FKPB 2RQKA 3J7Z5 1X9MA 4Q2LA 1S0MA 4B3RF 2HHUA 1HD1A 1ELOA 1RK8A 4LJMA 4B02A 1SKSA 3PJXA 4PPDA 2ACYA 2DHXA 2HGNA 3MD3A 4AE5A 1Q78A 3N6LA 2ABYA 2YNHB 3OFFA 3OHBA 3HK2A 4K4YA 3TW0A 4X64F 3BQ2A 4DLGA 3PACA 4CT8A 1SKWA 3CIZA 2RRNA 4LIRA 2C28A 1R8HA 2ZBCA 2E5HA 2HG4A 2M5YA 1LK7A 3SV4A 5HP1A 5KG4A 1P1LA 3GZ7A 3J80Y 1U1MA 3B8HA 1RTJB 4LVNP 3KMQA 1IKVA 5HROB 2HHTA 4G6VB 5F41A 3GYNA 2BJEA 2XULA 4NLUA 2IA6A 4DL4A 3D0GE 4J9OA 2XY7A 1B0PA 4JI8F 5L1IA 3NGKA 3JTPA 4KGKA 3ZZRA 3EPIA 3KLIA 5KFSA 2RU3A 2B5JA 2KJVA 1PC4A 3GIMA 2MXYA 3CCJS 2GEPA 1VQNS 3CIMA 4Z2XA 4RW6A 3CDAA 2SXLA 5A8WB 4DSFA 4X4UA 3ITHB 5KFIA 3K2YA 1HPZA 3W2WA 2K3KA 4M1KA 4NA2A 1U6ZA 2F8HA 4ALZA 4PQUA 4CO3A 3GE9A 3IXQA 5LSOA 3M32B 2UV8G 4GEPA 4V19X 3QJLA 1N6QB 2E1RA 3QGGA 1UL3A 4LQ3A 5F8NA 3CCUS 3V2UC 4DV0F 3NNHA 1U8SA 3EZUA 3R5BA 4FBUA 4ED0A 2VOOA 1TVRA 1NKCA 1FA0A 3IGNA 3CCSS 1U1RA 1N5QA 4ELUA 4YOEA 2GIQA 2DIVA 3S01A 3KLEA 1ZM3A 5FD1A 2ZD1A 3C6UB 4GKJF 1MROA 1S1WB 4RW8B 1G3OA 5HLFA 1NH8A 3KHLA 1X5OA 3Q24A 4DX8H 2VBYA 1JWWA 2OPQA 1R31A 4QJVA 1Z4UA 3PFEA 4AL7A 3CCTA 4JV0A 2IAJB 1H98A 2CJ9A 2HRUA 2IVMA 2G0CA 2YWKA 2DNKA 3M2VB 4WKYA 2CQ0A 4L3NA 4C0HA 3CDEA 2EFQA 1YJNS 1N5YA 3RB3A 1BGXT 1TK5A 3MOJB 1LKZA 1N36F 4LQ9A 4JI2F 5M2PA 4QYRA 3WBZA 1RYRA 2AOPA 1KQSR 4FXDA 3D28A 2L48A 5A6WA 3MUVP 1G1XA 3MF5A 5BYSA 1UVIA 2VPZB 3FZBA 4EYIB 3V4MA 1XWLA 2Q1LA 1Q53A 1TKTA 1VQKS 4KJIA 4DFPA 2VA3A 4ED1A 2NZ4A 3SCLE 1H2UX 3PEHA 1PO6A 2LLZA 3ICLA 1EP4B 1QSYA 2IBKA 4JV2A 1C0TB 4V19J 3IC1A 4USIA 1ZAWA 2ZBIA 4RKUC 3PO5A 1D3WA 1LWEA 1YRXA 4O3NA 1JLBB 3K59A 5GAHI 4XDDA 4NLWA 2DGSA 3FMBA 4C0BA 2LEAA 4Q0BB 4K0KF 4B9SA 2RSQA 3CO9A 3B0JA 5IT0A 3HVAA 3EX7B 3KG1A 2LXUA 1UW4A 1DRZA 2KDOA 4R5PA 3LOUA 3LUYA 2QRRA 3I5AA 4LSLA 1WTFA 3G6ES 3GILA 1FK9B 3PO4A 5EUHA 5B0AA 1Y4ZB 3BDEA 2YH0A 4U6PA 4YP3A 1SV5B 4NA1A 2VFSA 1UFWA 4WFBQ 4CZCA 3F73A 4DL5A 4IOAQ 2RS8A 1TKZA 2GGPB 3ZZYA 4NLPA 3KLGB 2H9ZA 2CPHA 3CJ0A 4QW8A 3I56S 3W7BA 4DL6A 2WBMA 1JKHA 1FD2A 5IFMA 2QMXA 1RT5A 4L72B 4EO8A 4KE5A 2HS3A 3BSCA 3OHAA 4NMLA 4ZKAA 1KLMA 2XLIA 3B0LA 3D0IE 1CQNA 3WC2A 2M52A 3DOKA 3N9UC 2W4DA 2UU9F 4MKYA 2AYEA 1IJFB 3MPVA 4ZCMA 2IYIA 3M8SA 1HHSA 4F2RA 1BWEA 3CD7A 4N8OA 1SL0A 1IKWB 4ID5B 2RH3A 3VAHA 3U02A 1KVIA 3JSYA 3BGRB 1N5TA 3IA0A 4RUCA 3MI7X 1S9GA 3DMJA 2DNRA 4KGMA 4WXWA 4Y28C 2XSJA 3DLEB 4ZS6A 4AL6A 1X7VA 3V6JA 2DPIA 4IDKB 2B9YA 2MZTA 2JJ4D 1RISA 1D8ZA 2JHEA 2HMIB 1V9OA 2DK2A 4MK8A