2XSJA

Structure of desulforubidin from desulfomicrobium norvegicum
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
436
structure length
436
Chain Sequence
AKHATPLLDQLQSGPWPSFVADIKEEAERRHSNQDNVEYQIPVDVCDDLLGILELKYSDGTTHWKHGGIVGVFGYGGGVIGRYCDQPQMFPGVAHFHTVRVAQPAGMYYTTDFLKQLCDLWDMRGSGLTNMHGATGDIVLLGTTTPQLEEFYFELTHKMNNDLGGSGSNLRTPASCLGDSRCEWACYDAQELCYQMTQEYQDELHRPAFPYKFKFKFDGCPNGCVASIARSDMSFIGTWRDDIRIDQEAVAAYVGGEIQPNGGAHSGKDWGAFDIQKEVIDLCPTECMWMEDGKLQINNRECTRCMHCLNVMPRALRIGNDRGLSILVGAKAPILDGAQMGSLLVPFIKVEDPYDEIKEIIEGIWEWWMEEGKNRERLGELIKRQGLAKAIAAVGLTPVPQHVMEPRHNPYIFWKEKDVEGGWDRDIADYRKHHQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights Into Dissimilatory Sulfite Reductases: Structure of Desulforubidin from Desulfomicrobium Norvegicum
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords SULFITE REDUCTASE ALPHA SUBUNIT
total genus 119
structure length 436
sequence length 436
chains with identical sequence D
ec nomenclature ec 1.8.99.3: Transferred entry: 1.8.99.5.
pdb deposition date 2010-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01077 NIR_SIR Nitrite and sulphite reductase 4Fe-4S domain
A PF03460 NIR_SIR_ferr Nitrite/Sulfite reductase ferredoxin-like half domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xsjA04
3.30.70.2500 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xsjA02
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 2xsjA03
3MM6B 1Y5IB 1FEHA 2FD2A 3PNIA 1FRJA 4DHVA 2WAQD 1R27B 2VKRA 5GEPA 3OR2B 1GTHA 1HFEL 1PC5A 3HKZD 4ID8A 4XDDA 1F5BA 1SJ1A 4S38A 1JNZB 3MMAA 5AOPA 4Y28C 2FDNA 1FERA 2GEPA 4XDCA 1FRKA 1IQZA 4S3BA 1H98A 4KT0C 3EUNA 3B0NA 1PC4A 3MM7A 3VLYA 1GTEA 4G39A 7FD1A 1FF2A 1DFDA 4CI0B 3VKSA 4S23A 4OV1A 4OMFG 1C4AA 1BQXA 1H0HB 1BLUA 7FDRA 1VJWA 1A6LA 1FDBA 5CH7B 3MM5B 1FDAA 1BD6A 1CLFA 5BYRA 2AKJA 3IR7B 3MM8B 2PMZD 1G3OA 4S3EA 2Y0SD 2WSFC 3MMAB 4HTRA 1FRLA 3B0MA 3EGWB 3NOYA 1RGVA 3VLXA 3IR6B 1WTFA 6FD1A 1KQFB 3GEOA 1AXQA 2AOPA 1GAOA 2XSJB 1XERA 4S3FA 1ROFA 2WSCC 3VKTA 5BYSA 5BYQA 3MM9B 2FJDB 2ZVSA 2C3OA 1BWEA 2PA8D 1FRMA 1FCAA 1F2GA 3B0JA 2VPYB 3IR5B 3VM1A 2V4JB 3VKRA 1FXRA 3MM5A 1ZJ9A 4AOPA 1FRIA 3MMBB 1KQGB 1DAXA 1SIZA 4RKUC 3MMBA 2C3UA 3LW5C 1B0PA 3VLZA 1FRHA 3EXYA 1FXDA 2GMHA 1GT8A 4YDDB 2PDAA 4G9PA 4S3DA 2Y0FA 1B0TA 1H7WA 3MMCA 3VKPA 3MMCB 4XK8C 3VM0A 4AYBD 2UZAA 2FJEB 3B0HA 3OR1A 4G38A 5L8RC 3OR1B 1DURA 5E7OB 1Q16B 3MM7B 6FDRA 1F5CA 1FDNA 1FD2A 1Y5LB 4L6V3 3B0LA 2WSEC 1FRXA 3MM9A 4GEPA 3VKQA 2V4JA 6GEPA 1AOPA 1IR0A 2C3MA 3MM8A 8GEPA 1JB0C 1Y5NB 3OR2A 2VPXB 3AOPA 3MM6A 2C42A 1G6BA 2FJBB 2VPWB 2IVFB 1KEKA 2VPZB 1D3WA 4S3CA 2Z8QA 5FD1A 1K0TA 2WB1D 4S3AA 2FGOA 1Y4ZB 1ZJ8A 1SIWB 2GMJA 1FTCA 1C4CA 1JNRB 1FDDA 2FJAB 1BC6A 2XSJA 1H7XA 2V2KA 2O01C 5CHCB 3GYXB 4S39A 3C8YA 2C3PA 3B0GA 7GEPA 2C3YA 1B0VA
chains in the Genus database with same CATH superfamily
2HNYB 3D3BJ 3VF0B 4NRTA 5D6GA 4OI0A 1Q8IA 4JI0F 9ATCB 3KG0A 4IFVA 4RNFA 4EBCA 4CM0A 1WC4A 4H4MB 4ICLB 3BGUA 2RQCA 2RQKA 1LWEA 3D5MA 1GXTA 3BH6B 4PKDB 4J9OA 4LF7J 2R7XA 4ELUA 2KG0A 3TJ8A 4CLTA 3QGPA 1S5ZA 3RB6A 2GVZA 1C1BA 2EWHA 3TUPA 2YX7A 5C2CA 1HQUA 2HKEA 3I32A 4PG6A 4XDCA 1RUSA 1S1TA 1H2VZ 1UMJA 3VAHA 4RWWA 5AE3A 3ICLA 2OEKA 3DLKB 5F9LA 2UVRA 4UW2A 2U1AA 4C2MA 5AT1B 4LF5F 2EEYA 4PR6A 2B5JA 4DV3J 3GFYA 3H4DA 1QD1A 2K7KA 1C4AA 4LFAF 3CMQA 1MWZA 3CEDA 4PZVA 5AE2A 1QAJA 3FMWA 2XO6A 2LEBA 1SJFA 4UQTA 5D78A 5KFPA 3CMAS 3Q0AA 1VQLS 2ZUAA 2OPRA 1EHWA 3M1VA 3NRBA 2YPYA 3MTJA 4JV1A 4ZPTR 3RW7A 3NWRA 3QT7A 2KTQA 3BBBA 1SXLA 1RA6A 4ZVEA 2JC1A 4WFZA 5AXNA 3TVKA 3OTOF 1H74A 2CQ4A 4TKTA 3TZWA 3TZZA 2RDJA 1NJYA 2AMCB 1FI4A 1RTIB 3KTQA 1RTIA 4FKYA 3B8HA 1SC3B 4M8LA 3UCUP 1R3NA 3PYGA 3TZXA 3V6KA 1X5SA 1RT7B 1RA7A 2CPJA 2WSCC 3NS7B 4I7FA 4A46A 4DXLA 3MM9B 1VBZA 3B78A 1N5TA 2ZVSA 4NYPA 4DFPA 1Y9OA 1SJRA 1KQKA 4A8XA 1KRPA 1OSCA 4EYIB 3AT1B 3HXMA 1A7GE 3GR1A 3EVMA 4H4OB 3R1LA 4IR1A 1JLFB 1QE1A 1JLFA 1PBAA 3LALA 3I9ZA 4Q7AA 4KBIA 1G7CB 3ISND 1B0PA 1UVLA 2Y9HA 2APOA 1RT6A 3SFUA 2RU3A 3PKYA 3GEOA 4LBHA 3O2IA 1XBWA 1GT8A 1TVRA 1TK5A 4JYAF 1F9HA 1A0OB 2FZCB 2QMXA 5KTQA 3CXCR 2BJ3A 2HK2A 3C6UB 3DN9A 1B0TA 2NPIA 1LW2A 3K5OA 3M8QB 5THWA 1CC8A 4FF1A 1M1GA 2F63A 1GNKA 1P27B 3CCJS 4DQIA 2UZAA 2ZM6F 3I0RA 5KG7A 3F0NA 4J7CA 4WU2A 4OHXA 3G86A 5KFWA 2A6MA 3L3CA 5D0HA 1N5QA 1Q5YA 2AW0A 3EGNA 2OKQA 3IAM9 4O4RA 4USWA 2NLWA 2XULA 1A9NB 3B0LA 3FEXB 2BV3A 3GIKA 3QGIA 2OUGA 2MZJA 3A3NB 4MIAA 2NCKL 2RRNA 3EZ5A 3ISNC 4DFJA 2BMBA 2HNDB 1NHKL 4P74A 1D0EA 4S3FA 1LKZA 4WCEQ 1KTQA 3ADAC 2DNMA 4U67Q 3QRQA 4DSEA 1B7YB 2HK3A 3CCVS 3DMJB 4ER8A 1C0UA 3CT9A 3QFWA 1ZZNA 5K14A 3KXDA 1H72C 2LCWA 3MAHA 1REGX 4HI2A 4OYWA 4ZP7A 4A8SA 2DR8A 1S49A 2R8JA 4JI7J 1HNWF 3LTOA 1PAUB 3I0SA 3CCSS 4QCLA 4RW7B 2J5AA 3P49B 4ELVA 5K8PA 1NBEB 3QQCD 4DUYJ 1FK9A 3KDOA 4CYUB 5GAEI 2O1PA 3GYXB 5LOQA 4A8MP 4KGZB 3MCOA 1W2BR 3GV8B 1N33F 2VB6A 2KO1A 2OP5A 2QIFA 3EZOA 4ZP6A 1GH8A 1YRXA 2IM1A 3M1VB 4UTGA 1R0AB 1R27B 1NSPA 3ENAA 3Q8VA 5KOWA 2UUAJ 4PWDA 4XPEA 4ZLPA 4LF6F 4ETZA 2MKIA 4LF9J 1I3OB 4KRWA 4Y2MA 5HLFA 2XYHB 2LECA 2OIHA 3OSPA 3OFFA 2DY1A 2FDNA 3IMQJ 3OTCA 4CM2A 2X1FA 4ZCLA 5J1EB 1OIAA 2N3OA 4NL5A 3TJAA 4O3SA 1U2FA 4CLKA 4ED7A 4DOZA 2HLUA 5GAEU 1UCNA 4EFAC 3V6DA 3G6YA 1TL1B 1NH7A 4O0IA 2M88A 2MY7A 4USTA 2OPSA 4YY3J 3C46A 1CC7A 1K0VA 4OMFG 4LF7F 1AT1B 4LIRA 4LF2A 1A6LA 4IG0A 2GZOA 4H4OA 5KG4A 2GFFA 1BD6A 2HNDA 1S6PB 4ATNA 2QA4G 4ICLA 4OZ1A 2FLNA 5C24A 2Z30B 3PM9A 5J2MA 1G3OA 3M8YA 3BQ1A 3KHRA 4FPIA 3SZ2A 3OVBA 1KVIA 2IBKA 1RTHB 2WW8A 4BDPA 1HR0F 3QPIA 2IMOA 1YJTA 1IKXB 3HO1A 3OFHA 1TV6A 3MEGB 4PG4A 1HNXJ 4IR9A 1NZ8A 4DLEA 3N4WA 3I0RB 2V2QA 2JLEA 5GAGI 4DV7J 3U1NA 2HVZA 2XI3A 2DHGA 4ZVRB 2MKKA 3NBPB 4GVBA 3MOJB 1W25A 4M94A 4IH5A 2W01A 4DV4F 4FBUA 3GQCA 2B9WA 3PJ9A 3POTB 4EBEA 3D68A 4Y0FA 2A18A 2ZH1A 3HLUA 5J2QA 2J8SA 3TRGA 4X65J 1OYEA 3LW5C 4LUBA 3VAJA 2YKMA 2DK2A 1V3ZA 3S01A 2B9YA 6AT1B 2QV6A 4YDDB 1XNRF 2I5JB 3FBCA 4Z7YA 2JSXA 3BS9A 2FHJD 2QX0A 1S12A 4M5HA 4BHQA 4ES1A 4F26A 2PI5A 3KJFB 3R97A 4DCJB 2CJYB 3KHLA 2ZJQQ 2FHMA 2FJEB 3KG4A 1Q8LA 2KM8C 2FZKB 2ZWOA 2VFTA 1U1RA 3IM9A 4C3MA 2B4OA 3EVOA 4TLQA 4ZCKA 2NZ4A 3LGHA 2EG1A 5KG0A 4B3SF 1AW0A 4WJBA 2RAQA 2V8VA 4KIAA 1XEZA 4PUOA 4GEPA 2WVDA 2WOMA 5E41A 5L9NA 2C2KB 1S72S 1YX2A 4FXWA 5K8OA 3PG9A 1H73A 2DISA 1BQMA 1RWNB 3LP0B 4K5RA 4RW9A 3VQSA 2BQRA 2J0SD 1ZA1B 5KFKA 3HHNB 3M9MB 2ZHBA 3HSJA 1RT6B 3B54A 1RWXB 2V9KA 1NK8A 3SXLA 3M9OB 5L1IA 5CYMA 3OTEA 3VGSA 1XNQF 2DVIA 1D3WA 5HLFB 3VQTA 4K4ZA 4F3MA 3GIJA 4TQSA 1VHIA 2KYXA 3GSIA 4WTOB 5DLFA 1YJNS 4ERDA 1TL7B 1Y3JA 1HI8A 2F8MA 2QTWA 4UOHA 2XLIA 3SDEB 4ED5A 3KJNB 4DWIA 2Y0BB 1C4CA 2YWEA 2UXBJ 4G6VB 3W8PA 3CC4S 2EBEA 3PFEA 3C8YA 2Z2ZA 3KFWX 4C8ZA 1N36F 3S8SA 3KHHA 3IO1A 3ITHA 1KD1T 3CDUA 1RWUA 3GTYX 4CO1A 4ZPWR 5DM7Q 3DOKB 2ZITA 4CCHA 1T94A 4YB7A 4H4MA 1NSKL 4P2FA 2G2ZA 4N47A 3G82B 3RYLA 1ICEB 2V94A 1U2CA 2VD3A 3CGIA 3W9JA 4ANDA 3V6JA 2QLBB 1U2RA 3H42A 3QFHA 4F0KA 4DS5A 1U1KA 3PTWA 3TX0A 2CJXB 3P8BB 1HHSA 3IBWA 3QNWB 2MLXA 4ED8A 3EICA 3FFIA 5KG2A 1LNQA 2PI4A 2V8HA 1TV6B 5CQGA 2GEPA 2FC9A 5D77A 4EO8A 4ZVSB 4Z7CA 1GMWA 3MEGA 3J81Y 2F40A 5IT9Y 2JH3A 3N9UC 4DV2J 1M0SA 1WD6A 2VF3A 4KR0B 4ED3A 3IAS9 1K1QA 4KT0C 2C2ZB 3JQKA 3FQLA 3HX9A 3SQGB 2KHDA 3AOCA 2VDHA 2JVRA 3G8SA 5EN1A 1KTVA 5J1PA 2R8HA 4PXDA 4WPAA 4Q0BA 5LM7E 2EFNA 5KFYA 3OLAA 2V8PA 1WHVA 3OL7A 5DDOC 1FDBA 3Q83A 3VGVA 3X1LB 3ZO7A 4RPFA 5L1LA 1FDAA 3POTA 4O44B 4DX6A 2RQ4A 4J91A 4PWDB 2YKMB 2ZOGA 3A3PB 4FYXB 4YS2A 1RK8A 3EPGA 1N32F 3CCZA 1HHTP 4RO0A 2DKOB 1N54B 2RQMA 3FZBA 4LVNP 4PQAA 3D4JA 3PW5A 3NL0A 4J9LA 4KE5A 1RGVA 2LQBA 3BBFA 3K8VA 1RT4A 4C0OC 1RBOB 5J1EA 4DR7J 2MKHA 2XHWA 4MFBB 1U26A 3BN4A 3VZHA 1SKUB 1MN9A 4JI3F 3BGOP 4ED2A 3OLBA 1RADB 1RTDA 4JI8J 2BJ8A 3NNHA 1SC4B 1BUXA 4F25A 3BO4A 3HJFA 4DR4F 1SJ3P 4ZP8A 2Z58B 1TKTB 2LXUA 1LFWA 1BQMB 3IR5B 4RW9B 1FXRA 3DOKA 2M70A 4I2PA 4DQPA 3D67A 3J81U 4LSNB 2V68A 1TZ0A 1J5EJ 1D9DA 2QRRA 2XI2A 2LP4A 5F8NA 1S9GB 5J2MB 2QFIA 4OI3A 3W60A 3LWMA 1N34J 2ADCA 3I4HX 4NLTA 5CYMB 1VC6A 4RWXA 5HQMA 4NCAA 3CF5Q 5CXTA 3EYZA 1RT1B 1IKXA 4B08A 2ZNYA 2HZCA 3LF0A 1LW0B 2D9OA 3QJJA 1RHRB 2WBMA 1XMQF 2JDJA 1JLQB 3MMCB 4ZCMA 4DV5J 2NYIA 3TUJC 1MU2B 5KFRA 1TL7A 5A8WA 1PIEA 1LWFA 3MTKA 3V5RA 1IBKF 3B0GA 2F8EX 2FHJA 2RUSA 4OYIA 3OR1B 1QSSA 4CT8A 1YG0A 4W4MA 4RNMA 2HW3A 4NXMF 2C28A 3GSDA 1FRXA 3MEEA 4R0JA 4DV6F 3VKQA 4L74A 2CIMA 2NXEA 3ZFVA 2UU9F 3AQPA 3N6NA 2IJRA 4RNOA 5DZ7A 3CNQP 2AQ4A 1WELA 3V6HA 2QN6B 2RD5C 1N88A 4JV2A 4DBQA 2VPXB 2W9BB 2IHR1 3I4PA 1G6BA 4L72B 1N6QA 1L3SA 4I64A 2HBZB 5H9FJ 1JK9B 3ZNJ1 4LF5J 2YKNA 3HF5A 4U7UD 1WC0A 5IWAF 4BWMA 4IOAQ 3SV3A 1UEUA 1V5VA 3NGKA 2LDYA 1UTAA 4PCQA 3VWSA 1FTCA 4DU8A 1JNRB 1CG2A 4EGLA 5HROB 4N7TA 4WFNQ 3T19A 2M9KA 5KFLA 1H2UX 4K4YA 3RRHA 1SL1A 4HDHA 2KXNB 3UW1A 1M1KT 1GFWB 1F0XA 2KRRA 3FC9A 2ZBPA 3W63A 1PCAA 2YQ3A 5BR8F 3JSMB 1IKWA 2NXUA 1SC1B 2WTFA 4DR5J 3M8RA 1X9MA 4U8VA 4B3OA 2CWXA 2RT3A 1UVIA 1WTBA 3G4SS 1BMQB 1QM9A 1GTHA 1RWMB 1RYSA 5KT5A 2OI2A 3TUZC 3LP1A 2CVIA 1NDCA 2GIFA 1YQHA 2BRKA 4A8OA 3F73A 3T5HA 1FJEB 2E5LJ 2E29A 2I38A 4ZA1A 4B3TJ 2HHQA 2KFZA 2B6AB 1PILA 2W9AA 2D41A 3QIDA 1RT4B 3G6VA 3JSBA 4MAKA 4DX8H 4B9VA 1V3SA 1WC3A 4XO0A 4N41A 2K3IA 1S1WA 4C8OA 2IC3A 4J5OA 3OXFA 1PC4A 4XPCA 4XTTA 3W2VB 3W7BA 3B4DA 1YBAA 2VBXA 2VV5A 2XS2A 1W26A 1UVMA 1CPZA 1XJWB 2DNRA 1UWBB 4LR9A 1BXNA 5AXLA 1NAQA 2EFGA 4YN3B 5BXIA 3KK1A 3DOMB 1D09B 3CW2C 3HZEA 5CH7B 5HL7Q 4NLGA 3KUEA 4OYMA 1IVZA 1T9UA 5CD4A 4DUZF 3WDOA 2SXLA 5B0GA 5DG7A 1TVRB 1O8BA 2Y8WA 3LOUA 3DM2B 1RISA 1RWWB 2RJZA 2VH7A 3G87A 4C8MA 1M5VC 1IJFB 4ECYA 4K8RA 3BSOA 4DV0F 4Y2CA 1SKSA 2M2BA 1K47A 4OYXA 5IT0A 1WG1A 2XMVA 3PV8A 1WOSA 1LWFB 2XSJB 3MEDB 4J9PA 1S1VA 4WFAQ 2MYFA 4USKA 3T5JA 3ILLA 5AXMA 2ZDPA 1OMSA 1DRZA 5J1NA 5I42A 5FLXU 3OBIA 1N5VA 1SQEA 1SPBP 2J76E 2DGVA 3R8YA 4WKYA 3QGGA 1RXOB 4CO3A 5C5JA 4LF8F 2HHUA 3DLGA 2JLGA 1RTJA 1NB7A 2GIRA 3D3CJ 3QZ7A 3MMBA 5I3UA 3RG6A 3TARA 1IBLF 3FRZA 3T1HF 4KHPF 3CJ0A 3R7BB 3TVYA 3OVAA 2CZ4A 2HEKA 3SSQA 5CYJA 5DM6Q 1NUEA 2CPYA 1HQEB 4DUYF 3FEYB 3VKPA 2CQCA 3W62A 4DI6A 1M5OC 3VM0A 2H48B 2QYCA 4PEOA 4CWBA 3FNNA 5KFIA 3VALA 4X84A 4G65A 4RUAA 3U1MA 1BHNA 5CYQB 5ETMA 2K3KA 1NKCA 1E6VA 3C14A 3MPYA 4DL0C 2B4VA 3PIPQ 3IRWP 3JAMU 5DLGA 5KFMA 2CYYA 3QBCA 4X4QA 2ATLA 2DHXA 2HBYB 2KZMA 2UVVA 1Z1ZA 4P7VA 2GMLA 1F5AA 3NGRA 4Y3CA 4A8FA 5EUHA 1XIQA 2KVIA 3U1LA 1F1BB 4HLBA 2IRXA 2IYGA 2XY6A 1JB0C 4O44A 3D66A 1U47A 3R7NB 4P7TA 1VIOA 3OFEA 1Q4RA 3JTOA 4LVOP 2PT0A 1RT3A 1RWPB 4K50A 2PD1A 3FBFA 2VPZB 4YP3A 1VQ4S 3GFZA 3K57A 1RHMB 3OL6A 1U45A 2EPIA 5C25A 4RBUA 5HVGA 4P2MA 4D3GA 2DNQA 1ZPWX 2OD6A 2XQCA 3J80U 3OUYA 2IDLA 1VBKA 1VRUB 1NPKA 2OPPB 3VKSA 2OD4A 3DGVA 4U7UK 3DCAA 5L9XA 4P72A 4X4SA 1RAFB 5KT3A 1Q82T 1S9FA 4YR3A 3R6LB 4KGVB 3UPFA 1P1TA 5F8HA 1X9SA 2P8IA 4F2RA 2J7WA 3NNCA 3P96A 2WZ1A 4QIEA 4F67A 5DQHA 1HWLA 2XMUA 3L7UA 3LH2S 2L9DA 1TL4A 1UWBA 1FEHA 1OQ6A 1GEHA 1S6QB 5F8JA 1NCLA 1GXLA 3I5CA 4Z37A 3CDBA 3BSAA 4KYZA 2J9DE 1FKPA 2D3UA 2JRSA 1TAUA 3AD8C 3ZZPA 4DN0A 2VIHA 2AJ1A 2IRUA 2HHVA 2DPJA 2F9DA 2QLXA 4FYVB 3ZNUA 1URNA 1J5OA 1NJIT 1HNZJ 3FMBA 2QJ3A 1RT1A 4WK1A 3GFHA 5HQ8A 5SZTA 5GADU 4X4NA 4QW9A 4EEYA 1RWVB 4USVA 1DHMA 4X4VA 3H7HB 4M5MA 5JVGQ 2BOPA 1QSLA 2W2PP 1T8EA 1SB6A 5SUHA 4C0HA 2H9ZA 3DFEA 3KDNA 4R8UA 4A8WA 4Q0BB 5D4OA 2AJQA 1S76D 3CDWA 1BQXA 3DLJA 1H0HB 1PYOB 2AGPA 1U1QA 3QRPA 1CQMA 2V4RA 3GIIA 3SIPB 4CLPA 2AKJA 3ZZYA 4QW8A 2JL9A 3VTIA 1KNZA 4DFMA 3N28A 5ETQA 4YQWA 1HBOB 4GKKF 1FJCA 3I5AA 3QGHA 4ZLNA 3OHAA 1TAQA 2HVIA 2AKWB 3U27A 4ENOA 3EGWB 5ETSA 2DIUA 4M5JA 4DX7A 1HQEA 5H1SV 5AJ3F 2RDIA 2BQUA 3D0HE 3H8YA 2VZ9A 5HBMA 1I94J 3HHEA 1VJQA 1PJ7A 4M5IA 4MH8A 4MT1A 5RUBA 2FVQA 3QSIA 4M5LA 2VG6B 1UKUA 3IXQA 3DRRB 4NYOA 3OVSA 1MLAA 4N5SA 1IWGA 3DRRA 4B3RJ 4X2BA 3UD3P 4KGXB 3GCWP 2V69A 4ZVOB 3TAMB 2I1RA 5GMEA 3W66A 2OMLA 1WF2A 4OZLA 2YKQA 1FE0A 2D9PA 2DHHA 4ZCIA 1NK4A 2HZVA 2VPYB 4C8KA 1S6QA 3OTBA 1FWKA 2CJQA 3KLEB 3KYLA 2GHVC 2CVEA 3Q8YA 4BLGA 2ASJA 3HM9A 1SI9A 3L95X 2V8GA 3VAGA 1KQSR 3D1OA 2KZZA 4TU8A 1ZAVA 1FRHA 2HS3A 5F8MA 4B3OB 1X8DA 3FCHA 2UUBJ 3BBCA 3MPUB 3KHGA 5DJBA 1UEKA 4USHA 4F7VA 3G8QA 5F3ZA 3AA8A 4K7QA 4NYZA 2DNHA 4P10A 1RI7A 1BQNB 4ZVHA 5A8RB 2O67A 1RAHB 1HMVB 1JJHA 2LU1A 2C2RA 3MUVP 4QU7A 2YWGA 3M8SA 2LFVA 1HYSB 1NXIA 1LWXA 1FDNA 2V8DA 3R9LA 5EX3A 1Y5LB 3M6WA 3BSCA 4NI2A 5D15A 4DDFA 4ZN3A 3N01A 2YWKA 4CZCA 4DQRA 1VBYA 2J6TA 2HAIA 2BM1A 2V4QA 2V4JA 2PFFB 2VBWA 3BR8A 1VCTA 1GQEA 4X4PA 4KO0B 4NLRA 4EYHB 2ASDA 3R5JB 1I94F 2W9BA 1U1PA 2RSQA 1EIYB 8RUCA 3GR0A 1RHKB 1NNDA 2Z8QA 3H90A 2IJFA 3MAAB 2M3DA 2FHOB 3CJQA 3D0IE 3MAAA 3MCMA 2HQIA 2PEHA 4I0WA 2K06A 3QJPA 2GC8A 1JLBA 3OT9A 3MD3A 4RW6A 2N82B 1R6YA 2RHQB 2RKIA 5LL6d 1BC6A 4ZHRA 4Q2MA 1N48A 3WIUA 2E9TA 1IQTA 4LSZB 1D9FA 1HHQA 4R0EA 1YLXA 4JB8B 2ZUGA 2Q3PA 2QT7A 4YY3F 1RT2A 2HNZA 4FP9A 3UR3C 4RUCA 4F4WA 4DQQA 1B0VA 2GNKA 1U02A 2YTCA 2ZH8A 4TYAA 3BGRA 1IN0A 3EGZA 2AYMA 2CPDA 1DARA 3CDEA 3HVWA 5M2UA 3VAMA 4KHRA 4TY8A 1RHJB 1SL2A 2W8KA 1MMNA 2BVZA 1V3RA 3LQVA 1IM4A 4DG1A 3IS9A 4OX9J 5D0EA 4FKXA 4J9NA 4Y34A 1P9YA 1XMOF 1RWKB 4DUTA 1WG5A 1RTZA 1GMWD 2CUYA 4C11A 1T3NA 4XDDA 3RJMB 4RNNA 3RUBL 4PXCA 3R3TA 3AB4B 4MFBA 3V4IB 3DU6A 2R7TA 4TU9A 1UL3A 1IQZA 3E01B 2HHTA 4CT9A 2OJ3A 3R5CA 1RTDB 4DSJA 4DR4J 1EZZB 5LMUF 5DGBA 4K0KF 2GO9A 3Q89A 3RRGA 1S77D 2HVHA 5A2QY 4DR3F 2MZRA 2AJ4A 2RNEA 4AUKA 2DR9A 4S23A 4OV1A 1X4AA 2CQDA 3TAMA 2R8KA 1KSPA 3CO0P 3F44A 3CJKB 3UN2A 1S0OA 3KK1B 4RUBA 4V1Ak 5LT5A 4JBCA 3Q86A 5T41A 1WF0A 3PJWA 4USUA 2VC1A 4ANCA 1RB0A 2F5GA 4DPTA 3X3UA 4J90A 3HSZA 4FPRA 4ILMA 3DRPB 5KFFA 1KLMB 4S3EA 1OPZA 1E6YA 2EKNA 3VCDA 4ZIWA 2G0CA 1FFSB 2YNGB 3SCLE 1UFLA 2O5DA 2UXCJ 1KONA 1LW0A 4HTRA 1WNEA 4USMA 3TA0A 1KP6A 5KG3A 2DR7A 3KJQB 4CTAB 1C1BB 2CA9A 5E3CA 4RW8B 4X64F 2HHHF 2DNPA 2I8EA 4ZHRB 1UFWA 1XERA 2ROGA 5L1JA 1HKAA 2CRLA 3LPYA 1JKHB 4IO9Q 4DL3A 3GJTB 3CD6S 2IAJB 5BYQA 3BO2A 4IUFA 1RP5A 1GXUA 1BWEA 4FS2A 1S4EA 2QO3A 3GZ7A 4E98A 2C2MB 1T7PA 4OHZA 1AFIA 9RUBA 4KKOB 3MM5A 3D2WA 2R4FA 3LP2B 3GJRB 3IS9B 3IA0A 2F8HA 2C3UA 3KLHA 2F65A 2YY3A 4DPUA 2CJBA 1ZM9A 3PXGa 3ZTSA 2AEJA 2B56A 3CD7A 2E5HA 3D28A 3EXCX 2RS2A 1R8HA 1ZM4A 2K2PA 2CPFA 3KNGA 1J5OB 4OYBA 3J7A1 4QQBA 5A6WA 1PSDA 1AFJA 3HHLC 5B0CA 4RU9A 3OTOJ 4KHMA 2FYXA 5E7OB 1C2PA 2DNYA 3V81B 2WB4A 5B0EA 1S1UB 1UJ6A 4F36A 3HCXA 2ASYA 2EG2A 2UUWA 2PSZA 2E1RA 3W2WB 3FEZA 1AUDA 2O66A 1SBRA 1ZZFA 3OJUA 3QIPA 2MQMA 3D6MB 3D6HB 4KV8B 2QE5A 3L09A 2NXCA 5G0RB 3MR6A 4ZDNA 5HJYA 4GVLA 3AOPA 3C19A 1S7HA 2FJBB 3RAQA 2E66A 2RU9A 3CJ2A 4BS2A 1M5KC 2XCPA 4NMXA 4N77A 4A8KA 1TFWA 1C1CA 2DNOA 4K4UA 5KG5A 1KLNA 4WIQA 3QWPA 4A8YA 3BGFA 1DLOA 1F3FA 4OHVA 2MTLA 3VVTA 1WKLA 1JWWA 2ZDOA 2FJAB 1LFPA 3EE3A 4DN9A 3CJ5A 2CFXA 4B3SJ 2JEIA 3BR9A 1Q5VA 3V4MA 1C0TA 1UAWA 4I6YA 2R7QA 1MW7A 1QVFR 3WC2A 2XMMA 2AJ0A 2LDIA 1JLEB 3DDNA 4RBTA 2CWKA 3IFEA 5A76A 2ZOFA 3HJVA 2R7WA 4OZ0A 1BE4A 3BZQA 2HFUA 5EWGA 1U0SA 3KJVA 1IUJA 3NWGA 3LO3A 4Q2LA 1LK5A 3UN5A 2G9OA 3DGPA 2HURA 3KK2B 4WFBQ 3H4BA 5IS2A 4J9QA 4OYOA 3P3DA 1YJUA 2KYZA 1X4BA 2MJUA 1U7LA 4P6QA 4S3BA 2ZZTA 2EFPA 1TKZB 5AJ3J 4OZJA 1N5YB 3RBZA 3MCNA 2LYVA 4O23A 2X1BA 4QBUA 3MM7A 2H51B 2JEFA 3L7OA 2MQLA 1VK8A 3A1YG 2RF2A 5LXYA 4WZMA 3SSRA 2YX1A 4B3RF 5KFTA 2QA4S 1IXKA 4UOFA 1IBLJ 1EETA 2RE1A 1CJKB 4B17A 3H5SA 1TL3B 2GJIA 3MMJA 4FYWB 1RAIB 1D8YA 2CAJA 3PY8A 1CEZA 4C7QA 4FZVA 2VG5B 3JSYA 1OO0B 5D8HB 1K44A 1HBUB 4HKQA 2WSFC 3DLEB 3ONQA 2JC0A 3MMAB 4NE9C 2BUNA 1FRLA 2FIUA 5JVHQ 5CCMA 4J9KA 3B0MA 3O6QA 3TP2A 3AXMA 2GA7A 3CJ3A 4K59A 1LOUA 3KLIA 4KPCA 4JV0A 5EWEA 3AB2B 4HHUA 2BXJA 1OSDA 2CQ3A 1XTZA 2GAHC 2L9NA 4B02A 4RZRA 3MWBA 3GILA 2X3GA 2FLLA 1AZSB 5BYSA 1XQIA 2Z4PA 3KUHA 3TO8A 2EW9A 1YVFA 1WI8A 2C3OA 2JNJA 2ZBCA 1U25A 3H59A 4UF4A 5JXSA 5F8IA 2ZZNA 1SQFA 3NKYA 4QYRA 4CLYA 1H3DA 4ZJLA 4EK2A 2VG7A 1YBTA 4DPXA 3VAKA 3PX4A 1VISA 4RLEA 2NR0A 3E3XA 1KHWA 1UWAA 2WW4A 3DRPA 3PCOB 1KLMA 4G1QB 2P6SA 4OZNA 4ALZA 3O8WA 3CUNA 1C1CB 3AJ1A 1Q86T 3EJMA 3ILOA 2E1CA 2P9CA 4FF3A 1OJ4A 1K73T 1Y11A 2DT9A 2RVJA 3C6UA 5A8RA 3M8WA 2DYAA 4WU3A 1M5HA 1TKZA 2MZTA 1B3TA 4JI7F 2HRTA 2VA2A 2N3LA 1NDPA 1Q16B 3MM7B 1R89A 3NCRA 2IAJA 1UZDA 4WFXA 5GAGU 4WE1B 6FDRA 2ZEJA 1EX8A 4UZBA 2E5LF 1PKUA 2XYPB 2XEXA 3TVZA 1L3UA 3L4BC 2CQHA 3TW0A 1S0MA 2QL7B 2QFJA 5KFHA 2E9ZA 3UDLA 4OJHA 3HT0A 2DR6A 3IG1B 3GCXP 3L9ZA 3UE2A 2QEXS 2ZE2A 3UD5A 2KVQE 4NCBA 4DR7F 2ZFHA 5F8LA 3NMRA 4FDFA 2RHSB 1SH3A 3UO0A 1TMJA 2CNKB 1KEKA 2YNIB 1F9FA 1QTNB 1SCJB 3C16A 3DYAA 4TYBA 1L3TA 1H2TZ 1DTTA 4JI0J 3BEGB 4UY85 1WORA 3AY0A 2V50A 3ZZZA 3W61A 3DNCA 1CULB 3BN7A 1IWAA 4KH0B 1SJQA 2V2ZA 4E8UA 3UD4P 2MXYA 4HDGA 3G2XA 4Y2KA 3V2UC 2WONB 1VQ7S 5LMUJ 2FJWA 4DZDA 2OLWA 4B9MA 3MR7A 2DRDA 3BGLA 1QE1B 3R2CJ 1FNXH 4Q8FA 4DHVA 2OTJS 4U9RA 5ADZA 4ZVQB 5HP1A 2E1AA 5A0YA 2DRAA 2MSSA 2XLJA 2EK1A 4KC5A 4CLWA 5U47A 3HKZD 2EFVA 1X4FA 5J2NA 2IIHA 3SMZA 2F1FA 3MMAA 4Y28C 1PYSB 3MPDA 2DO0A 5DG9A 1NPRA 2BYCA 3H5UA 4X62F 1H6KX 3PO4A 2M8HA 2VBZA 3A8KA 4LSLA 2VBYA 4ES2A 1UA1A 1RE1B 1S9EA 4ZPBA 4QIWD 4ED6A 1NHUA 1S9EB 1UW9A 1VC0A 4HACB 1SKWA 3BJYA 2HS4A 1NJWA 2MGZB 1N0UA 1C0TB 4HH0A 3BKTA 3THVA 1DFDA 2V2VA 2KI2A 2OPSB 5D0GA 1RDRA 2WRMA 3ELHA 4WP9A 4OX8A 1NH8A 4FXVA 5HAOA 4DF4A 3CJRA 3IG1A 2DGXA 1S0NA 3PR4A 1WHYA 2ZE2B 4ECXA 2W25A 3SEOA 3MM8B 1DTQB 1I5OB 2PMZD 1SV5B 1WHWA 4CH0S 2NSCA 2Z2LA 1C0UB 5B0DA 5LSOA 1TR0A 2JZ5A 1JJCB 1RKJA 1WSVA 1IBCB 3OHBA 3W5XA 4IOCQ 2XHCA 4U95A 2DRBA 2AJFE 1YJWS 2F4VF 1TMMA 1RWOB 1X60A 1UPPA 4DL5A 1AXQA 1JLAA 5K8MA 2B7CB 3RBEA 2AOPA 2H5IB 4MIBA 3DLKA 2VHGA 3JAMY 3VKTA 2H54B 2VA3A 2GQ2A 1OY8A 2DPIA 4ZPVR 4LQ3A 4Y6IA 1FO1A 3ZZOA 1U6FA 1YRUA 4MYTA 1GX5A 5KFJA 4X65F 1VQPS 1HBNA 3ET6A 1VQ8S 5IT9U 4DL7A 4DV1J 2JHEA 4OJ1A 1SIZA 1HI0P 4RJVA 5HP1B 2CZ9A 3P45B 3UVJB 3H2LA 4J9MA 3KLFA 2KXHA 4NLDA 1U0HB 2NUHA 4AL6A 5F9NA 4TU7A 3DMJA 3D1QA 3D6TB 3HZGA 3JTPA 3DYAB 1IKYA 3HI9A 2HHHJ 4N76A 2Y0FA 1H7WA 3KKFA 2W8LA 1Q8BA 4Q43A 2CKWA 2XTJP 2HMIA 3N5FA 3T1YJ 3B0HA 1Y0HA 2DHAA 2QMUB 1WDDA 5DO2A 3VGTA 1NKEA 4ZJQA 4G38A 5E3RA 2MGZA 1F5CA 1HW8A 2L9WA 4HT7A 4IDKA 3PX6A 5EDWA 1VQKS 2P6TA 2BE2B 1O0PA 2NPFA 3OV7A 1Q0NA 1DQAA 5DRKA 2BKNA 2V0NA 3ISZA 3I87A 2DH8A 3NP5A 2PMHA 3CJTA 3AQOA 3BM7A 3CSKA 4MKVA 3RB0A 5LJ3Y 8GEPA 4RW4A 3CCWA 2XMAA 1VQSA 4MK8A 4BWJA 3UNGC 4C8NA 2ZOMA 4NA2A 4UOGA 1RSCA 1NK6A 3M6XA 4P71A 5KT4A 1RU1A 5FD1A 3H5YA 3BQ0A 1HNIA 2B9XA 5L46A 2D74B 2X1GA 2IMWP 2FZGB 2GQQA 1U8SA 4IH7A 1DLOB 5HVHA 5L1KA 2HQ3A 3HULA 3M4XA 5IWAJ 2Z2YB 4KB7A 1YITS 2XNRA 1UPMB 5AE1A 2O01C 4I56A 5C2GA 4GKKJ 1G2EA 3DXBA 2DGSA 1RACB 1PO6A 4K4TA 3DHXA 2YXLA 1FJGJ 1JXVA 3MD1A 2HNYA 3ZZRA 3QLHB 3NGTA 3T6JA 3MEEB 1HPZB 3UR0A 2R2SA 3PNIA 3CCUS 1I6JA 3HPOA 3LGNA 2CNOB 1N0VC 4OHWA 2ASLA 1U4BA 3GJQB 2QYGA 1DTQA 2C2NA 2WAQD 3PRVA 1RT5B 5DQGA 1N56A 2UU9J 4LIWA 5KFBA 4F4KA 1CVJA 1BY9A 1FTRA 2PEBA 4PQUA 3MEKA 3L7PA 1HFEL 3W5ZA 2YNGA 1Q7YT 4ID8A 4RR5A 1RTHA 1F5BA 1OY9A 2K1RA 3KLGA 2YNFA 2QA1A 3T1AA 3GFXA 4PYDA 3QT8A 1SJ4P 4YR0A 1YI2S 1FRKA 1NHVA 1YWXA 3PYDA 3RZAA 3G71S 2GGPA 2CPHA 1X4HA 1MMDA 3HFKA 1V9OA 1WC5A 3QAEA 4ITSA 4M5DB 4IRKA 2CXEA 4LRFA 1U8WA 5KFNA 4DMZA 3HKWA 3GG1A 2RIJA 3CB4A 4FNHA 5KFQA 2CG4A 2BRLA 3J81j 1FF2A 5C7PA 2JEJA 2DXFA 4G39A 1NSQA 3Q23A 1S79A 4IRCA 2R7OA 1L3VA 1BLUA 2JOQA 2AEMA 2NS1B 2W2OP 3LAKA 4I6AA 1VJWA 2UV8G 3JSMA 4E2FB 4X62J 4J9SA 4YB6A 2VG5A 2DY9A 2R2RA 2Q6CA 1O6XA 2MY8A 2BM0A 4B9TA 2YQ1A 2ZNZA 3UVJA 2R7VA 2E5GA 2ALYB 4PABA 1U0HA 2PIIA 2FB0A 4OI2A 3CTRA 2YBVA 3NOYA 2D69A 3BB5A 4WP8A 4LREA 5ETTA 1ZA2B 3N79A 4QU6A 4IFYB 3IR6B 4KFBB 2FLOA 2JLFA 2IM0A 3CCLS 2HRUA 1VI7A 4K4WA 4JOUA 2CQ2A 4RUHA 4LFCF 1CULA 2VDIA 3RBXA 3DXSX 1YTYA 1IJEB 1G4CA 1T02A 1HNVA 3FBEA 1UVKA 2B7BB 4P9SA 1T9YA 4C3KA 4ZPAA 4UY8T 1EQMA 1FRMA 4MKBA 4KTQA 3C66A 3MI7X 2XZTB 3M8PB 4UUXA 3G96A 1FWPA 2OELA 3HVTB 5LMNF 3R5AA 5D4NA 3I55S 2KL8A 2B4UA 3GWCA 2W2MP 2YVSA 2MZ1A 3UNYA 3CULA 2BZ2A 3R27A 1N52B 4ETXA 4DSLA 1P1LA 1WOPA 2Y3YA 2YH0A 4FNIA 1FE4A 4D3HA 2GMHA 2DEJA 2ILZA 1FX4A 3THPA 4DU7A 4PG8A 3MR5A 1VK3A 4ANEA 2B3TB 2JWNA 4EI2A 4B9NA 4EZ6A 2UXBF 1CLFA 1O5JA 4R25A 1VDHA 2QC3A 4CNZA 4DPWA 3MUMP 1AROP 5KT7A 2LVWA 4CO2A 2P5VA 3MR2A 2VUGA 1HI1A 3HHLD 3FK4A 4ZVTB 1DURA 1XMQJ 1JLGB 4DR3J 4P73A 4L6V3 4QR2A 2X1AA 3W9IA 1CJTA 2XMTA 4MKYA 3Q8UA 2FVRA 2L08A 2J6SA 4YFUA 4DR2F 1YKWA 2VC0A 2C22A 1EKRA 2M52A 3ZC4A 2AU0A 4TN2A 2R2TA 2KHCA 1YSJA 2B51A 4ZVPB 5B7WA 3RR8A 4DR6J 1XN9A 1Y5NB 5T7LA 1XNQJ 2PO4A 4CH7A 2CDQA 4HTIA 3SCKE 1NZAA 2HVEA 1NEEA 1XR7A 4ZOSA 3K5LA 3T9NA 1X0PA 4ECTA 2DH7A 4FYDA 5LSLA 3UCZP 2J7UA 2I5JA 3TQ1A 2WB1D 1RAJA 2P9GA 2RB7A 1SL0A 1S59A 3GYNA 1GK8A 2DH9A 4HHJA 5F3TA 4JI6F 2KG1A 3K58A 2P9EA 4LFBJ 5JJBA 4YEAA 2XM3A 4K2XA 5KFVA 4NLYA 3BH7B 3CCRS 1N5YA 2BE9B 2GGPB 1M5PC 2QGFB 3FGVA 2B5JB 4LF4J 5KFEA 1HNVB 2KDOA 3U7JA 2YH1A 3NLCA 3CE8A 3PEHA 4WWSA 3B82A 3NS5A 4MKAA 4O3PA 2A6OA 3AHPA 1MMLA 1EETB 2BKOA 3NG8A 1FVSA 3HVTA 4CH1A 1L5UA 4CNYA 2IVMA 2CZVC 5KOXA 2PMWA 3BKFA 3O44A 1FRJA 3CJ8A 2FPHX 4CO0A 4F3OA 3AA9A 3D0GE 4ZK7M 3EMTA 2DCLA 3K89A 4B3TF 1ZAWA 1DQ8A 2DJWA 5J2NB 4Y2IA 3LA0A 1T95A 3ZZUA 1XNRJ 2ABYA 3GU0A 1JNZB 5AOPA 2BOAA 2CNLB 2NREA 3CJ4A 2D1CA 3QYYA 5LJ5Y 2HWTA 1V5IB 1N5SA 3K8WA 3WX8A 2ZM6J 4A8QA 1FFGB 2F4FA 2OGUA 1H98A 3FBBA 1JXEA 1AZSA 1PG5B 2NXJA 3EUNA 3EWGA 5IQQA 1ZBTA 4OIXA 5A8KA 2MQPA 2UVUA 4JI4F 3VLYA 3QT6A 4IDKB 5KAKA 2KFYA 2QSFA 1IM6A 4UQGA 4ZVFA 3G8TA 2GAGC 2IFXA 3UDCA 3HMJG 4ED0A 2ZJPQ 3DRXA 1NKBA 3J7AN 1SVDA 2MLZA 3H20A 4F0MA 3Q8RB 2H5EA 3M9NB 5DS7A 1MG7A 2ZH2A 3NNAA 2VG7B 2RILA 2WK4A 4DCPB 4K4VA 1NLKL 2XBPA 4RU2A 2JFDA 2R3VA 5FLXY 4PQUB 2PE8A 2LU2A 2M4MA 3PW2A 2F7VA 4IYQA 4K5SA 3HHKA 1VQ5S 4B9SA 4QYZJ 4U7CA 5ITHA 1IR2A 4DS4A 2J0QD 3KLGB 4O3RA 4NLOA 2A3JA 2ZH9A 3T1HJ 4KHPJ 1HARA 1LW2B 4WP3A 4F4YA 1TKDA 5CZXA 3BQ2A 1BWVA 1WTFA 2ACYA 2HFOA 2IPOB 2HGMA 5HJXA 4G1IA 1X5PA 2VFVA 1FK9B 2NSBA 5E3AA 4PXEA 4DV0J 4HHHA 1OS5A 1WC6A 2ZHOA 3SQGA 3ILJA 3H2VE 4OJ3A 4ZN1A 5A2QU 2HFSA 3VV2B 3T5LA 4EZ9A 2HPUA 5IZHA 2OHDA 3JSRA 4L73A 4Q8EA 3GP9A 3VM1A 4DUZJ 2BX6A 4ZS6A 4LBIA 1N33J 3K17A 2ZH5A 4G1PA 1DAXA 4RKUC 5T7LB 4F50A 2W4PA 3A8EA 3H98A 3JQMA 3G82A 2CG8A 4DL4A 2W4DA 4F4XA 4GO7X 4OI6A 5J2PB 5DETA 3TANA 1Z2ZA 4GKJJ 3A13A 2HQDA 2PDAA 3Q24A 2MMYA 2ZBRA 5IFMA 4WTYA 4WZQA 2Q43A 4AOPA 1M1HA 1RAEB 3TR5A 3NGUA 5IC6B 3CVKA 2CJKA 3K5MA 1R0CB 3TJ9A 2Z57B 3WBZA 2Y1JA 1FD2A 5KT2A 3FZ2A 2YX4A 4L75A 3OL8A 1X0FA 3F41A 3M8PA 2QA2A 3P5TL 3TEHB 2LQ8A 2IJNA 3HSGA 2COLA 5CABA 1DJ0A 2EVZA 5DDPC 3RAXA 2KRBA 4QJVA 4OZ3A 4OYZA 4L76A 4PXBA 1FKOB 3SCJE 2ZH7A 1TKXA 3MURP 2BJ1A 2AZ1A 4M5KA 4NOHA 2FGOA 1ZM2A 3CDAA 2DGWA 4MJKA 3MXHP 4NMLA 1ZM3A 4BCAA 3M6UA 1WKKA 4X64J 1ZETA 2UP1A 3MPVA 1HNWJ 2HHWA 3PX0A 4QWAA 3PW0A 2IA6A 2C2OB 2F9JA 2GJFA 2CNNB 3CCQS 1RYRA 2OAUA 5I42B 2XS7A 4UZCA 1UZHA 1T9XA 3R5BA 3QLHA 2R9LA 2MHEA 1QVGR 1M90T 7GEPA 2D3OR 4DR5F 5JUMA 5GVQA 1VQOS 5IM0B 2KN4A 3MR3A 2QZ8A 5IV3A 1VQMS 3EPIA 1YBUA 2PN6A 4IFVB 4O0NA 3MFIA 2VFSA 1RT5A 2YNHB 2AYBA 1SV5A 1S97A 1S6PA 2KU7A 1KR4A 3FUYA 5I3PA 1NJXA 3SFGA 3OR2B 4DEZA 1RBAA 3GV5B 1VHFA 3HT3A 2WVEA 4CLSA 5CA5A 2MQ8A 1U1OA 3D9BA 1RJJA 3ENVA 3Q8PB 4DL2A 2DGOA 2DBBA 4PWWA 3HVAA 2ZJRQ 3I82A 2KJVA 1YZ6A 1X4DA 2DIVA 2P2CB 1MU2A 1NU4A 1WUUA 2GQCA 4M5DA 3W3SA 2BE7D 2E44A 1LEOA 1K1SA 4IH6A 2J9CA 3B0NA 2YQ0A 2G0IA 3R7SB 3C3LA 1OY6A 4HR2A 7FD1A 1QUVA 1N36J 4NPOA 3AODA 1VQYA 2CPIA 4OL8A 2Q6BA 4ED4A 2OSRA 4NLUA 3UCGA 2UUCF 1GMVA 1EARA 3PHTA 4OFZA 1R0AA 1WC1A 5BYRA 2I9SA 3DDKA 4NLXA 1J5EF 3GJSB 2QG9B 3EDQB 4LF1A 4ZIVA 4NXNF 2HHXA 1QAYA 2VQEJ 2J8AA 1R43A 1IKYB 1X7VA 2GIQA 3C6TB 3CCTA 5F8GA 1VRTA 4C3LA 1LWCB 3VHQA 3OPKA 2HGLA 2KT3A 3P6YC 4DV5F 1KQFB 4Y2AA 2W7PA 3SSSA 3MAQA 4ILLA 4YMEA 3B6BA 1UFKA 4I7FB 3GPAA 1TL1A 3JXOA 3KWMA 4LFAJ 2EK6A 3OFGA 4PUOB 1GX6A 2V63A 5CCLA 1VMBA 3ITHB 1XMBA 3MOZA 5KFSA 3OJSA 2Y1RI 1FFWB 4IKAA 2QMWA 2OH2A 1VS3A 3M2RA 4QR1A 3UWTA 2FY8A 4JI1J 4XIUA 3VAFA 3IM8A 4N56A 1RHUB 2DNKA 1KQGB 5ETVA 3TUIC 2U2FA 2ZBIA 5EGYA 4ECUA 3IGNA 5GMKa 1J27A 1TKXB 3WHIA 1KOOA 4P52A 5BJRA 5HATA 5IXUA 4DSFA 1MWQA 3DI6B 5DG8A 2QL5B 3T1YF 1ELOA 1MNEA 2BANA 1LK7A 3NAIA 4AYBD 4EU0A 4AD6A 4C6AA 2XGQA 4DV4J 2C2EA 3MEDA 2JEGA 3OR1A 1UEVA 1JLGA 2M8DB 4I69A 2FLPA 2V67A 3AD7C 2HSEB 4ED1A 2MDAA 4ZLJA 2ALZA 4GVBB 5ETOA 4C98A 2VFRA 2LXFA 2Z2MA 3BKUA 1F3VA 1SH2A 5L38A 4X66F 1N8RT 2GW8A 3UFCX 2YNHA 4ILRA 1Q53A 1NB2A 3DOMA 3PYFA 4QWEA 3EGVA 2LEAA 3K2YA 4LR7A 2LKZA 4NWBA 5I3UB 3W1YC 5FDLA 4NX9A 4IQMA 3RB4A 4FBTA 1H38A 4ZPCA 4DPYA 1FJGF 1B4SA 2EI5A 3DRSA 4K2JA 2NQPA 3F56A 2H4YB 1U24A 4YDXA 3M30A 1FWLA 1LQ9A 3A4TA 2W9CA 2BR0A 2UV8A 2QLFB 1TQLA 2W9CB 1ZOTA 2XSJA 2BBEA 2BKPA 3C14B 2MQOA 2RDDA 2V2KA 2W2NP 5CHCB 3MUTP 2N4CA 2FQQB 2R2UA 3NBPA 2MB0B 1O51A 2N7YA 2DGTA 2C3YA 3MM6A 4WBFA 4F3QA 2CPXA 3MM6B 1JQGA 3NOGA 4NA3A 1HWKA 4F8RA 4JI1F 3QIPB 1NK7A 2IBOA 1KC8T 1CS4A 1EQ0A 3G6XA 3JS9A 1RT3B 2Z0GA 3QATA 1HWJA 1HNZF 2FC8A 4C48A 1U48A 1T9WA 2LEPA 3NAHA 1R8BA 5IOLA 3TEGA 1QAIA 4NXMJ 4YOEA 1U1LA 2UUAF 2J0XA 2DO4A 3CWJA 2R7UA 5A8WB 5HMZA 2FVPA 2CQIA 5B0FA 4MK7A 3A12A 1ZH5A 2HAFA 4HEA9 1S1WB 2ZZMA 1YJ7A 2IC3B 3OUYB 4KSEB 2PC6A 4AQYJ 2XY7A 1TELA 3QO9B 4M63A 4NI2B 1GTEA 1WEZA 2H3EB 3MF5A 4JI2F 1NDLA 2BJEA 3UDEA 5LXRA 2B9EA 3CD5A 4C97A 3VGUA 1TKTA 1S57A 2A2DA 4B3MF 4U8YA 4F2SA 3SCIE 2G2YA 4LSNA 4CRJA 3GYGA 4X66J 3ZTPA 4I2PB 4G3IA 2DD8S 3IBCB 1U6ZA 3TNVA 2FVSA 4C0BA 2ZKUA 2GO8A 3BYRA 3MPWA 3G6ES 2HYIB 1FKPB 4ZPDA 2GHWA 1P6TA 1HBMB 1FKOA 1SC6A 2MQNA 2Y0SD 3N5BA 3B4MA 4IG3B 4LRDA 3KJVB 3FFIB 3CD0A 5H9FK 4IG3A 2FVCA 2AWZA 4J9VA 3TA1A 2GS8A 3TA2A 2AHOB 4QWCA 5C25B 2XWXA 4PWUA 3TAPA 3RR7A 5E3QA 3WZ0A 4ECRA 2NZCA 4CTAA 4P2XA 1U1NA 4W92B 3TX8A 1X5OA 5HROA 2HIYA 1FX2A 1VRUA 1APSA 4A4JA 1WEYA 4ELTA 4PPDA 1YJ9S 5EX0A 1NSAA 2CPZA 2FJDB 3J7YI 1U09A 4JI8F 3AOBA 4NA1A 1F2GA 2G0JA 4DV7F 4OQJA 1Q1KA 1KWMA 4AL5A 4CQ1A 2V34A 3OXGA 5MLCV 1ZJ9A 5IM0A 1FRIA 1RAOA 2AEFA 1TL5A 1WKJA 3MMBB 3VZIA 2YWHA 2HHSA 4Y65A 2MKJA 5FDLB 3VLZA 4LRCA 1HBOA 1RU2A 3E51A 3AJDA 3HSDA 3BYPA 3LAMA 1FXDA 3T6BA 3BPSP 3GV7B 4GC7A 4JI5F 4HYKA 5K14B 4MYUA 3C6TA 3ETMA 3HHLA 4NXNJ 1LWCA 1FEEA 4QYZK 2XMJA 3I0SB 4USIA 5E0OA 2IRYA 2RMLA 2W2QP 4YHHJ 5ETKA 2XLKA 2VJVA 4FF2A 2H1YA 2BDPA 2XWYA 1SH0A 1E6VB 2BABA 1FT8A 2YWWA 3QO9A 4WFYA 5CYQA 1WACA 1PAEX 3W2VA 1QJHA 1UJ5A 5DQIA 3IGVA 3A3OB 1JJ4A 5D3GA 3E2EA 2E7VA 5HN0A 4X4OA 1X4EA 2WOMB 2M5YA 1FKAF 1F9EB 1IBMJ 4OX9F 4AFFA 1N4LA 2A10A 1AOPA 1UA0A 2DB1A 2W1BA 3PRBA 1VC5A 2A2CA 1TU0B 3W8GA 3NS6A 1U49A 3BGRB 3PR5B 1LV5A 2FY1A 4UT4A 2YKPA 1J2VA 5KFXA 4M1KA 7AT1B 2RUGA 5K20B 3CPWR 2BJ7A 2EKYA 4KH1B 8AT1B 2VPWB 3W65A 1WG4A 5IT4A 1Q81T 1S10A 1B99A 3BF4A 3D6FB 3I6PA 4S3AA 5H9EJ 3DDIA 1BQNA 1R31A 2ILYA 2DITA 4OV6A 3R2DJ 3QZ8A 1Z4UA 1EKSA 2D7SA 2HFZA 5K9FA 3ZTQA 4AXJA 2GMJA 1DY3A 3PACA 5HMXA 3R5GA 2I0XA 1X9WA 4ECWA 2HBRB 5GAHU 4YUDA 4TXSA 5M2PA 1T03A 2CQBA 1T03B 5KFGA 2MPUA 2B4PA 4DL6A 4ID5B 5B08A 3GIMA 1VR6A 2GJ2A 5A6PA 4NZ6A 4QOTA 4FS1A 4KO0A 3P4UB 4EUVA 3O5TB 1R7IA 4NEZA 4TNOA 5C24B 1XC9A 2MJNA 3AJ2A 1U1MA 1FD8A 3NCQA 1MWYA 3SI8A 1PC5A 3VAIA 4JI5J 1ZTWA 2KH9A 2IDEA 1KS2A 3ETOA 1N32J 4S38A 1PYTA 2AX1A 2MHNA 3C16B 2QLJB 3OQ2A 1X31C 4OI1A 3KK2A 1KN6A 2KXFA 1JLBB 2IM3A 4RW6B 2ZBQA 4WXOA 5KFCA 5BR8J 2VKZG 2M0GB 5IQ6A 3T41A 5D3GB 1HD0A 1S6UA 4IRDA 2N4DA 1S1VB 3DKDA 3H0PA 3IRXA 1HA1A 1M5SA 3AFGA 4LQ9A 2HZAA 2V5HG 3GIRA 4L3NA 2WVBA 4ZLLA 3M32A 5CZVA 3TOQA 4UOCA 1IKWB 1FVQA 2BEFA 2VOPA 3PYEA 3J80Y 3R6GB 1NDKA 3MM5B 3DLGB 2CJ9A 1YJVA 3OW2R 3I9V9 2CJAA 2BACA 4C11B 1RABB 4NLWA 2UUBF 4LRBA 2EC0A 1NJZA 1Q79A 1FA0A 4OHYA 1VRTB 3KMSA 4DFKA 4I68A 3HHLB 2OSQA 3AH6A 1OWXA 1AA1B 2YKNB 3M30B 5IC4B 4QZVB 6FD1A 4G9PA 3NOCA 3CC7S 2F4VJ 3KMQA 2BA9A 1RCXB 2OO4A 2E7WA 1ZTTA 1KFDA 4ID5A 3EM1A 2HQFA 4S0MA 1VBXA 2FJVA 4PYAA 2C1EB 3M2RB 1WF1A 1S4FA 1WJ9A 3O1LA 3W2WA 1VRQC 1TFYA 5B09A 1MN7A 2M7SA 1ACMB 1YIJS 3ZZ0A 2PGCA 4KAIA 2MZSA 2X3DA 2PA3A 2ZH6A 1CS4B 1T3OA 5G0RA 1HBMA 4OJGA 3EXYA 3DM2A 3T5KA 4JV5J 1PJ5A 2XNQA 3DGPB 3DHWC 3LPEA 4RBVA 3QSYB 1HL6A 2X51A 1VFJA 4WXWA 3ILIA 1JLQA 3HHDA 3MMCA 2BANB 2UVWA 1QTMA 2IVYA 2Y8YA 1SQGA 2MSTA 2VFUA 2POKA 4HI1A 4J9RA 1R8PA 2DNZA 2V9WA 3OL9A 4YHHF 3CIZA 2A1BA 1QAXA 3ENWA 2I6WA 4DV6J 2DXDA 3B0JA 1Z2LA 4R8UB 4IOBA 1F6TA 3K5NA 4DV3F 3M2UB 1QSYA 3M2UA 4M95A 5F0UA 2B43A 5KG6A 1HD1A 4I2QA 1T9VA 1Y7PA 1YGYA 3FRYA 4BBYA 1DQ9A 1IBMF 3LUYA 3KLHB 2D3ZA 2F3JA 2DXEA 4P2SA 1FNMA 2H5JB 3OR2A 4P75A 2BQ3A 1N6QB 3QRRA 1VQ9S 1S48A 4YB5A 1OYDA 2HFNA 4R5PB 3GLJA 3IC1A 4OLPA 1T9TA 3LANA 4ZVUB 1CSJA 1S7IA 3BDPA 2AP6A 2CQPA 2ZVIA 5F0WA 4DSIA 1ZJ8A 1R0BG 4PRFA 5DDQC 1NRKA 2R8IA 1F2HA 1SIWB 4AXIA 2B0GA 3T9ZA 1RQ0A 5HVFA 4ECZA 2GX8A 4MK9A 3OXLA 5HMWA 3BSNA 4HTJA 1UJ4A 3PZPA 3IRXB 2BJDA 2HRYA 3KG1A 1P9QC 1S1UA 2C3PA 4J9UE 2XYGB 1NO8A 4M5NA 2XZDB 2XMWA 1Y4ZB 3PEJA 3HD2A 4Y00A 3JB9k 1URRA 4LJMA 4B9UA 4PPZA 2A0FB 4DG1B 3AD9C 1YRTA 2E1MC 2MKCA 4TY8B 5FJ4A 5GEPA 2L3MA 4C8LA 1WWHA 3J7ZT 1S1XA 1VLOA 3LP1B 1Y10A 3RTVA 4ZJOA 1U6BA 1SJ1A 2OMOA 4NLPA 2B6AA 4USJC 3A8JA 4DV2F 4AQYF 4RL1A 1Q78A 2H4WB 1HMVA 3EDRB 1Q7LB 4O3OA 3M8ZA 2OEJA 2ROPA 4NLQA 2CPEA 3FCWA 2DCUB 4LBPA 2ZWPA 4NASA 4X4RA 4B3MJ 4ES3A 5I4MA 1TUWA 4NCGA 5ETPA 3EX7B 3K5PA 4DJBA 3RBDA 4I6WA 4CI0B 2XO7A 5EWFA 2HFVA 2GV1A 3ENQA 3PDNA 2UXDJ 7FDRA 2WCXA 3D54A 3FDSA 4QIGA 2MLYA 4BC9A 3KLEA 1W2IA 1ZS6A 2HIQA 2IY5B 3AAWB 4KV8A 4JI6J 1ULRA 4LF8J 4LFBF 4MTPA 4OYAA 3CO9A 4KGKA 2V6AA 5HO4A 1VQ6S 1L3KA 4NEYA 2AGQA 1WI6A 1T0TV 5E33A 3ZXWA 1XMOJ 4DSKA 4C9DA 2L41A 4I67A 2WHOA 1PBUA 3DI6A 4ECSA 1ZAXA 1DTTB 4W90B 2HBQB 2XCAA 4IQXA 3VLXA 4U6PA 4DR1F 2AF6A 2RKIB 1JLAB 4FN5A 4BC7A 3WIVA 2LQJA 1UVNA 2OPPA 4MMOA 3IP0A 1ROFA 2ACMA 2ROEA 2BJ9A 5GAHI 2WONA 5D0RA 1X5TA 3MECA 1NM2A 4QPTA 5AXKA 2E7XA 1BGXT 3I56S 2WBRA 1KKHA 4PG7A 1CJVB 4A47A 1TK8A 1CJVA 1KVKA 2VQFF 2RRBA 1YZ7A 2V4JB 3J7Z5 2QSWA 2XB2D 1TL3A 4FF4A 2HWHA 4EMDA 4URGA 3Q8QB 2RRAA 2E1PA 4O3NA 3KLVA 1CJUB 2HQGA 4EBDA 3DRSB 4AE5A 3KLFB 1SKRA 2UXCF 4R5PA 3Q2SC 3H25A 1UETA 2JFKA 1JXLA 1KHVA 2XSFA 4GMKA 5G4DA 4CO4A 1TUVA 1XK8A 1Q95G 4LRAA 1VQNS 4F02A 1P8GA 4KPYA 4JV5F 5KFUA 5LMNJ 5L8RC 2AYEA 1RCOB 2HS0A 2AZ3A 4NCGB 4CO5A 4EWTA 2ZKTA 4JI4J 1RT2B 2HNZB 3D7SB 2GHPA 3FJ2A 5HQLA 1Y3KA 2MKYA 3IWLA 3UN3A 2VJUA 3CJKA 1MSWD 3IWXA 4KJIA 4CIOA 3GMGA 3PJXA 4TLRA 1ZPVA 1IR0A 2VU5A 4RX6A 2O3DA 2OTLS 3NMAA 4FVCA 3MM8A 3PRDA 5HANA 1S0VA 1NMEB 4HH1A 3SBMA 1NK5A 1D8ZA 3OD2A 3T3FA 2LMIA 4YB1P 2IVFB 4Z2XA 5I3QA 5D4LA 4F4ZA 5E3PA 3DRYA 4OZ5A 3PW7A 3H5XA 1R6VA 3MDFA 2R8GA 2FJXA 4GO5X 2E9RX 1HNXF 2ATCB 3CCES 4LT6A 1FDDA 4QWDA 1JKHA 4UUWA 5IV4A 1H7XA 2VG6A 3SQOP 1YK9A 2DNNA 2KJWA 2VONA 3PKMA 3W9HA 4WKRA 2YWFA 1FHTA 1CJTB 4I2QB 4RNHA 1ZYQA 2EXUA 2JX2A 3THTA 1TK0A 2Q79A 4H4KC 1CQNA 4NZ0A 1Y5IB 3FVYA 5CAAA 5GADI 1HWUA 3Q8SB 2N7CA 4AL7A 3BREA 5B0BA 4TVAB 2UUCJ 2DGQA 5DGAA 3S6EA 5L39A 2EFQA 4H4KA 2G1HA 3RW6A 4NLVA 3CCMS 4WK3A 2Y1IA 2DHSA 4CLUA 1D9AA 3GE9A 2J9EA 1VIXA 1TUGB 5DZ6A 1QDUB 1JLCB 4JUZA 1VOMA 4OX6A 4I1TA 1FERA 1NK0A 3I31A 1EAYC 1HQ2A 4O4GA 4RW8A 5A0YB 1IBKJ 4K4SA 1G1XA 1RKIA 3RRKA 4DPOA 4KGMA 3PIOQ 4N8OA 3V81A 2YKOA 1SUQA 1KDNA 2WVFA 4LF6J 3M32B 2W7OA 3TQEA 2D3O1 2R7RA 2HGNA 2BW7A 3IWNC 4ECVA 2AJ2A 2LQ9A 3TI0A 1CJKA 1RTJB 5F41A 1GMUA 1JIHA 1REVB 2AT1B 2MZQA 2H65B 3LP2A 2AGOA 1T05A 2DTJA 1NK9A 1WHXA 2UXDF 4FXDA 3K7RA 1RAGB 3I5BA 3VVUA 3W64A 3WC0A 3DC2A 5HK4A 3WQPA 4DQSA 1OQ3A 2XS5A 3EZUA 1CJUA 3PVXA 4M5GA 3HFZB 4KY3A 1AYEA 4OZ2A 2VICA 2DNLA 4X4UA 4I4BA 3AXKA 4ZMMA 1HWIA 4HT5A 4LSLB 3R1HA 3E01A 2MEWA 2OFHX 4KQZA 4O3QA 1UP1A 3KLIB 5B0AA 2MKSA 4URQU 2XGPA 1GAOA 3QAUA 2HVDA 5HI7A 3JYTA 2HMIB 4X4TA 3IN5A 3PW4A 1LXNA 3NCPA 3W5YA 3J7YU 1RT7A 3V6DB 3VR1A 1JMTA 4H54A 1FESA 1EP4A 3C15A 2GVDB 1HLWA 5KFAA 4K4XA 1R8CA 1YHQS 3PFOA 2YKAA 3VKRA 4V19X 1KOHA 3TZYA 4C8YA 2RS8A 1CBKA 1WEXA 1KBRA 3K59A 2CDRB 1E6YB 2E5IA 3KNAA 2PFDA 4G1QA 8ATCB 3Q22A 1EJ7L 3HD1A 3Q2TC 3N6MA 4QR0A 3NGDA 2ZH3A 3ULHA 5HSPA 1XR5A 3RB3A 3DLLQ 4QPXA 4OYPA 1HIYA 1OPIA 3KK3B 4S3DA 3CMES 3KUGA 2XMKA 1VLYA 2Y1LB 4U96A 2VQFJ 2HWIA 3NEKA 2OPQA 4ZKAA 2JJ4D 3MGJA 3MFHA 2XY5A 4Q5VA 1K8AT 1VGYA 5D4PA 1HYSA 4DR2J 1KVJA 1JX4A 1DZ5A 1SUQB 1TTHB 2EBGA 4FVMA 3D1HA 1LXJA 2QL9B 2HQCA 4WE1A 2HLTA 1QUPA 2BW2A 3DOLB 3QWUA 5MAOA 2DR5A 5LSRA 3DOLA 4LF4F 3NXZA 5KG1A 1RZMA 1S99A 3WX4A 1X4CA 4ZP9A 5M2RA 1B64A 1T05B 2DEIA 3ZTRA 5H9EK 2KFNA 3FSXA 3PHEA 2ERRA 3FQKA 3O3LA 4JYAJ 2C42A 2NYHA 1Y00A 1HBUA 2L48A 1I1GA 2KM8B 4TQRA 2K8GA 2AX0A 1V6HA 2R42A 2XC9A 1K9MT 4L3KA 1YDLA 2OEMA 4S3CA 1K0TA 2K1RB 3JTNA 2YNFB 4A48A 1RBLA 2VODA 1JJ2R 4QIFA 4RW7A 4JI3J 1S1TB 4CLLA 3US5A 4LR8A 4LF9F 3QMQA 3NGSA 2YPZA 2ZC4A 2Z56B 2FGCA 2Q1LA 2VASA 3IBFB 3ZTOA 4CYUA 3H40A 1FJ7A 1EP4B 1NPPA 4OI4A 2KT2A 3C2PA 4S39A 2GVDA 3TWZA 3NY0A 2KKHA 4E0DA 1XR6A 4URSA 3CC2S 2FD2A 4N8NA 3DU5A 2E5JA 5ETLA 2OFGX 4KKOA 5E2QA 3LP0A 2B8QA 4ZITA 3DLBA 5T14A 3KOAA 2VKRA 4WYWA 4F4AA 4Q45A 1RHQB 2OPRB 3BDEA 1S1XB 4OX7A 4QIVA 2J7KA 3DLEA 2NUUG 1MROB 1UW4A 2K7JA 2LXIA 3KK3A 2ZD1A 4LFCJ 4TY9A 1HNIB 3RAMA 5HBMB 3V4IA 1X4GA 3FCVA 2GCFA 1QY7A 2W7AA 2X7IA 4KFBA 4CLZA 4DZ6A 4B9LA 2W24A 2Q66A 1WOOA 4DF8A 2LQ5A 4HACA 2WVCA 4J37A 1YJRA 1QLNA 2VL1A 2DGUA 4Q44A 2XG8A 4AT1B 2EFOA 5KFZA 5JMNA 1AB8A 3FSYA 3P5BP 3ZZTA 4DLGA 1I51B 2G4BA 4K0KJ 1WDTA 3MCSA 3HVRA 2BE2A 3BO3A 3M05A 4QWBA 4IG0B 2J6UA 3CIMA 4WIIA 4CDIA 3GONA 3IR7B 1LWEB 4PG5A 4LMZA 1PJ6A 2W4CA 4ZVGA 3BPDA 2NXNA 1FXLA 1UVJA 3N6LA 3HP6A 4NRUA 2LLZA 3HFVA 3DLHA 2GVZB 2R7SA 1Q8KA 3I96A 4CLFA 3U02A 1TP7A 2G13A 3LGMA 2AV5A 2AIRB 4JP8A 2MQQA 2IM2A 3PO5A 2OPQB 2UUTA 3A8IA 4DX5A 5HMYA 1HW9A 1RLCL 2LA4A 3UDVA 4NZ7A 3GB0A 3MECB 4V19J 3QJLA 4WF9Q 4IO1A 2IA0A 2RF2B 1XWLA 1D1UA 5EHHA 1IKVA 5C42B 2VQEF 1IR1A 1EB0A 2PA8D 1IKVB 1FCAA 1HBNB 3ET6B 3TYTA 4CP5A 5C42A 1KFSA 1FNOA 2C2DA 2J0WA 3R5DA 2CQ0A 4NLSA 2HG4A 4GRSA 3RGIA 4GKJF 5J2QB 3SYZA 2CQGA 2RH3A 5ETRA 1HR0J 3S7RA 5FIIA 3RU0A 3H2UB 4DCOB 2EC2A 2J9DA 2YNIA 5ETNA 3UI3A 4F04B 5J2PA 4JI2J 3OSNA 2VOOA 1PGZA 2LA6A 4DR1J 1JLCA 4MIWA 3SV4A 4DR6F 5GMDA 4XK8C 5K5MA 4O4GB 2FHKA 2G2OA 1HQUB 3E8OA 2AYGA 3FSIA 5KFOA 1WSRA 1F60B 4HVZA 5A8KB 5KFDA 3CJSA 4ECQA 2AD9A 1R8AA 2HHPA 1VYAA 3MHYA 4XAKA 3BV8A 2FUG9 4YR2A 2ZHAA 2WSEC 3K0JA 3MM9A 1N34F 5CD4H 3GG0A 2ZH4A 2CQ1A 2I2YA 3JQJA 6GEPA 3N0VA 3LWLA 4W98A 2DNGA 2C3MA 1W7WA 4OLOA 5E5NA 1ITPA 3HDSA 3M7VA 1REVA 2JVOA 3QT5A 2G1DA 2FTRA 3M2VB 4RW4B 1S9GA 2ADBA 1AUSL 3M2VA 4C4WA 1B70B 2KT5A 4GC6A 2ZD1B 3G9CA 1DBDA 1RAAB 4FYYB 1MROA 2KB2A 3OTDA 2QLWA 1B7FA 3M8QA 3AOAA 3EVWA 1T11A 4IFYA 5KT6A 1S6OA 3S1TA 4DV1F 2XZWA 2ZC3A 3SDEA 5K8NA 4HL9A 4PAAA 3JYTB 3TAQA 1RLDA 3HK2A 3UQSA 4WYLA 4EO6A 2B8PA 4F0HA 5DDRC 3MZIA 2IYIA 2CADA 1HPZA 3C15B 3M6VA 1JLEA 3FKBA
chains in the Genus database with same CATH topology
2HNYB 3VF0B 4NRTA 5D6GA 4OI0A 1Q8IA 4JI0F 3KG0A 4IFVA 4RNFA 4EBCA 4H4MB 4ICLB 3BGUA 2RQCA 2RQKA 1LWEA 3D5MA 1GXTA 4PKDB 4J9OA 2R7XA 4ELUA 2KG0A 3QGPA 3RB6A 1C1BA 2EWHA 2YX7A 1HQUA 4XDCA 3I32A 4PG6A 1S1TA 1UMJA 1H2VZ 3VAHA 4RWWA 5AE3A 3ICLA 3DLKB 2UVRA 5F9LA 4LF5F 4UW2A 2U1AA 4C2MA 4PR6A 2B5JA 3GFYA 3H4DA 2K7KA 1C4AA 4LFAF 5AE2A 1MWZA 3CEDA 1QAJA 3FMWA 2LEBA 1SJFA 4UQTA 5D78A 5KFPA 3CMAS 3Q0AA 1VQLS 2OPRA 3NRBA 3M1VA 3MTJA 2KTQA 4ZPTR 3RW7A 1SXLA 1RA6A 4ZVEA 2JC1A 4WFZA 5AXNA 3TVKA 3OTOF 2CQ4A 4TKTA 1NJYA 2RDJA 1RTIB 3KTQA 1RTIA 3B8HA 4M8LA 3UCUP 1R3NA 3V6KA 1X5SA 1RT7B 1RA7A 2CPJA 2WSCC 4I7FA 4A46A 1VBZA 3MM9B 4GKKF 3B78A 1N5TA 2ZVSA 4NYPA 4DFPA 1Y9OA 1SJRA 1KQKA 4A8XA 1KRPA 1OSCA 4EYIB 3HXMA 1A7GE 3GR1A 4H4OB 3R1LA 4IR1A 1JLFB 1QE1A 1JLFA 3LALA 3I9ZA 4Q7AA 4KBIA 1G7CB 3ISND 1B0PA 1UVLA 4FXDA 2APOA 1RT6A 3SFUA 2RU3A 3PKYA 3O2IA 1XBWA 1GT8A 1TVRA 1TK5A 4JYAF 2QMXA 5KTQA 3CXCR 3DN9A 3C6UB 3K5OA 5THWA 1B0TA 2NPIA 1LW2A 3M8QB 1CC8A 4FF1A 3CCJS 4DQIA 1GNKA 1P27B 2UZAA 2ZM6F 3I0RA 5KG7A 4WU2A 4OHXA 3G86A 5KFWA 3L3CA 4DS5A 1N5QA 2AW0A 3EGNA 3IAM9 2OKQA 1A9NB 4O4RA 3B0LA 2NLWA 2XULA 3FEXB 2BV3A 3GIKA 3QGIA 2MZJA 4MIAA 2RRNA 3EZ5A 3ISNC 4DFJA 2HNDB 1D0EA 1LKZA 4WCEQ 1KTQA 2DNMA 4U67Q 4DSEA 3CCVS 3DMJB 1C0UA 3CT9A 1ZZNA 5K14A 2LCWA 3MAHA 4A8SA 4HI2A 4ZP7A 1S49A 2R8JA 1HNWF 3I0SA 3CCSS 4QCLA 4RW7B 2J5AA 3P49B 4ELVA 5K8PA 1FK9A 5GAEI 2O1PA 3GYXB 4A8MP 1W2BR 3GV8B 1N33F 2VB6A 2KO1A 2OP5A 2QIFA 1GH8A 4ZP6A 1YRXA 2IM1A 3M1VB 1R0AB 1R27B 5KOWA 4PWDA 4XPEA 4ZLPA 4LF6F 4ETZA 2MKIA 4KRWA 4Y2MA 5HLFA 2OIHA 2LECA 3OSPA 3OFFA 2FDNA 3OTCA 2X1FA 4ZCLA 5J1EB 1OIAA 2N3OA 4NL5A 4O3SA 1U2FA 4ED7A 4DOZA 2HLUA 5GAEU 4EFAC 3V6DA 3G6YA 1TL1B 1NH7A 4O0IA 2M88A 2MY7A 2OPSA 3C46A 1CC7A 1K0VA 4OMFG 4LF7F 4LIRA 1A6LA 4IG0A 4H4OA 5KG4A 2GFFA 1BD6A 2HNDA 1S6PB 4ATNA 2QA4G 4ICLA 4OZ1A 2FLNA 5C24A 3PM9A 5J2MA 1G3OA 3BQ1A 3KHRA 3SZ2A 3OVBA 1KVIA 1RTHB 2WW8A 4BDPA 1HR0F 3QPIA 2IMOA 1YJTA 1IKXB 3HO1A 3OFHA 1TV6A 3MEGB 4PG4A 4IR9A 4DLEA 3N4WA 3I0RB 2JLEA 5GAGI 3U1NA 2HVZA 2XI3A 2DHGA 2MKKA 3NBPB 3MOJB 1W25A 4M94A 4IH5A 4DV4F 4FBUA 3GQCA 2B9WA 3POTB 4EBEA 4Y0FA 2A18A 2ZH1A 3HLUA 5J2QA 3TRGA 3LW5C 4LUBA 3VAJA 2YKMA 2DK2A 1V3ZA 3S01A 2B9YA 2QV6A 4YDDB 1XNRF 2I5JB 3BS9A 2JSXA 2FHJD 4BHQA 4F26A 4ES1A 2PI5A 2ZJQQ 3KHLA 2FHMA 2FJEB 3KG4A 1Q8LA 2KM8C 1U1RA 2VFTA 4C3MA 2B4OA 4TLQA 4ZCKA 2NZ4A 5KG0A 2EG1A 1AW0A 4B3SF 4WJBA 2V8VA 4KIAA 4PUOA 1XEZA 4GEPA 2WOMA 5E41A 5L9NA 4FXWA 5K8OA 4IOAQ 4K5RA 2DISA 1BQMA 4RW9A 3LP0B 3VQSA 2J0SD 2BQRA 5KFKA 3HHNB 3M9MB 2ZHBA 1RT6B 2V9KA 1NK8A 3SXLA 3M9OB 5L1IA 5CYMA 3OTEA 1XNQF 2DVIA 1D3WA 5HLFB 3VQTA 4K4ZA 4F3MA 3GIJA 4TQSA 2KYXA 5DLFA 1YJNS 4ERDA 1Y3JA 1HI8A 2F8MA 4ED5A 2XLIA 3SDEB 4DWIA 2YWEA 1C4CA 4G6VB 3CC4S 2EBEA 3PFEA 3C8YA 3KFWX 4C8ZA 1N36F 3S8SA 3KHHA 3IO1A 3ITHA 1KD1T 3CDUA 1RWUA 4CO1A 4ZPWR 5DM7Q 3DOKB 2ZITA 4CCHA 1T94A 4YB7A 4H4MA 4N47A 3RYLA 4RNOA 1S72S 2V94A 3CGIA 2VD3A 3V6JA 1U2RA 1U1KA 4ED8A 1HHSA 3IBWA 3FFIA 5KG2A 2PI4A 2V8HA 1TV6B 5CQGA 2GEPA 2FC9A 5D77A 4EO8A 3MEGA 3J81Y 2F40A 5IT9Y 2JH3A 3N9UC 1M0SA 1WD6A 4KR0B 4ED3A 3IAS9 1K1QA 4KT0C 3FQLA 3HX9A 3SQGB 2KHDA 5EN1A 2JVRA 3G8SA 1KTVA 5J1PA 2R8HA 4PXDA 4Q0BA 2EFNA 5KFYA 3OLAA 1WHVA 3OL7A 5DDOC 1FDBA 3X1LB 5L1LA 1FDAA 3POTA 4O44B 2RQ4A 4PWDB 2YKMB 2ZOGA 3EPGA 1N32F 1RK8A 3CCZA 1HHTP 2RQMA 1N54B 3FZBA 4LVNP 4PQAA 3PW5A 3NL0A 4J9LA 4KE5A 1RGVA 2LQBA 3K8VA 1RT4A 4C0OC 5J1EA 2MKHA 2XHWA 4MFBB 1U26A 3BN4A 3VZHA 4JI3F 3GEOA 4ED2A 3OLBA 1RTDA 3NNHA 4F25A 3BO4A 3HJFA 4DR4F 1SJ3P 4ZP8A 1TKTB 2LXUA 1BQMB 1LFWA 3IR5B 4RW9B 1FXRA 3DOKA 2M70A 4I2PA 4DQPA 1D9DA 4AOPA 4LSNB 1TZ0A 2QRRA 2XI2A 5F8NA 1S9GB 5J2MB 4OI3A 3LWMA 2ADCA 3I4HX 4NLTA 5CYMB 1VC6A 4RWXA 4NCAA 3CF5Q 5CXTA 3EYZA 1RT1B 1IKXA 4B08A 2ZNYA 2HZCA 3LF0A 1LW0B 2D9OA 3QJJA 1XMQF 2WBMA 2JDJA 1JLQB 3MMCB 4ZCMA 2NYIA 3TUJC 1MU2B 5KFRA 5A8WA 3MTKA 1LWFA 3V5RA 1IBKF 2F8EX 2FHJA 3OR1B 1QSSA 4CT8A 1YG0A 2HW3A 4RNMA 4NXMF 2C28A 3GSDA 1FRXA 3MEEA 4R0JA 4DV6F 3VKQA 2CIMA 3ZFVA 2UU9F 3AQPA 3N6NA 2AQ4A 1WELA 3V6HA 2RD5C 1N88A 4JV2A 4DBQA 2VPXB 2W9BB 2IHR1 3I4PA 1G6BA 4L72B 1N6QA 1L3SA 4I64A 5H9FJ 1JK9B 2YKNA 3HF5A 5IWAF 4BWMA 3SV3A 1UEUA 3NGKA 2LDYA 3VWSA 4PCQA 1FTCA 1JNRB 1CG2A 4EGLA 5HROB 4WFNQ 2AGPA 3T19A 2M9KA 5KFLA 1H2UX 4K4YA 3RRHA 1SL1A 4HDHA 2KXNB 3UW1A 1M1KT 1F0XA 2KRRA 2YQ3A 5BR8F 3JSMB 1IKWA 2NXUA 2WTFA 1X9MA 3M8RA 4B3OA 2RT3A 1UVIA 1WTBA 3G4SS 1QM9A 1GTHA 1RYSA 5KT5A 3TUZC 3F73A 3LP1A 2CVIA 3T5HA 1YQHA 2BRKA 4A8OA 1FJEB 2E29A 2I38A 4ZA1A 2KFZA 2HHQA 2B6AB 1PILA 2W9AA 2D41A 3QIDA 1RT4B 3G6VA 3JSBA 4MAKA 4DX8H 4B9VA 1V3SA 4XO0A 4N41A 2K3IA 1S1WA 4C8OA 2IC3A 4J5OA 3OXFA 1PC4A 4XPCA 3W2VB 3W7BA 3B4DA 1YBAA 2VBXA 2VV5A 2XS2A 1UVMA 1CPZA 2DNRA 1UWBB 5AXLA 1NAQA 2EFGA 3KK1A 3HZEA 5CH7B 5HL7Q 4NLGA 4DUZF 3WDOA 2SXLA 5B0GA 5DG7A 1TVRB 1O8BA 3LOUA 3DM2B 1RISA 2VH7A 2RJZA 1M5VC 4C8MA 1IJFB 4ECYA 3BSOA 4DV0F 4Y2CA 1SKSA 2M2BA 5IT0A 2XMVA 1WG1A 3PV8A 1LWFB 2XSJB 3MEDB 4J9PA 1S1VA 4WFAQ 2MYFA 3T5JA 5AXMA 2ZDPA 1DRZA 5J1NA 5I42A 3OBIA 1N5VA 1SQEA 4WKYA 2DGVA 2J76E 3QGGA 4CO3A 5C5JA 4LF8F 2HHUA 3DLGA 2JLGA 1RTJA 1NB7A 2GIRA 3QZ7A 3MMBA 5I3UA 3TARA 1IBLF 3FRZA 3T1HF 4KHPF 3CJ0A 3OVAA 3TVYA 2CZ4A 3SSQA 5CYJA 5DM6Q 2CPYA 1HQEB 4DUYF 3FEYB 3VKPA 2CQCA 1M5OC 3VM0A 2QYCA 3FNNA 5KFIA 3VALA 4X84A 4RUAA 3U1MA 5CYQB 2K3KA 1NKCA 1E6VA 3MPYA 4DL0C 2B4VA 3PIPQ 3IRWP 5DLGA 5KFMA 2CYYA 4X4QA 2ATLA 2DHXA 2KZMA 2UVVA 1Z1ZA 4P7VA 2GMLA 1F5AA 4Y3CA 4A8FA 5EUHA 2KVIA 3U1LA 4HLBA 2IRXA 2IYGA 2XY6A 1JB0C 4O44A 1U47A 4P7TA 1VIOA 3OFEA 1Q4RA 3JTOA 4LVOP 2PT0A 1RT3A 4K50A 2PD1A 2VPZB 1VQ4S 3GFZA 3K57A 1U45A 3OL6A 2EPIA 5C25A 4RBUA 4D3GA 2DNQA 1ZPWX 2OD6A 3OUYA 1VRUB 2OPPB 2OD4A 4U7UK 3DCAA 5L9XA 4X4SA 5KT3A 1Q82T 1S9FA 4YR3A 3UPFA 5F8HA 1P1TA 1X9SA 4F2RA 3NNCA 2J7WA 3P96A 4QIEA 4F67A 5DQHA 1HWLA 2XMUA 3LH2S 2L9DA 1TL4A 1UWBA 1FEHA 1OQ6A 1S6QB 5F8JA 1GXLA 3I5CA 4Z37A 3CDBA 3BSAA 2J9DE 1FKPA 2D3UA 2JRSA 1TAUA 3ZZPA 4DN0A 2AJ1A 2IRUA 2HHVA 2DPJA 2F9DA 2QLXA 1URNA 1J5OA 1NJIT 3FMBA 1RT1A 4WK1A 3GFHA 5HQ8A 5SZTA 5GADU 4X4NA 4QW9A 4EEYA 1DHMA 4X4VA 5JVGQ 2BOPA 1T8EA 1SB6A 5SUHA 4C0HA 2H9ZA 3DFEA 4R8UA 4A8WA 4Q0BB 2AJQA 5D4OA 1S76D 3CDWA 1BQXA 3DLJA 1H0HB 1U1QA 1CQMA 3GIIA 2AKJA 3ZZYA 4QW8A 2JL9A 3VTIA 1KNZA 4DFMA 3N28A 4YQWA 1HBOB 1FJCA 3I5AA 3QGHA 3OHAA 1TAQA 2HVIA 3U27A 3EGWB 2DIUA 5H1SV 1HQEA 5AJ3F 2RDIA 2BQUA 3D0HE 3H8YA 2VZ9A 5HBMA 3HHEA 4MH8A 2FVQA 2VG6B 1UKUA 3IXQA 3DRRB 4NYOA 3OVSA 4N5SA 3DRRA 4X2BA 3UD3P 3TAMB 2I1RA 2OMLA 1WF2A 4OZLA 2YKQA 1FE0A 2D9PA 4ZCIA 1NK4A 4C8KA 2VPYB 1S6QA 3OTBA 3KYLA 2CJQA 3KLEB 2GHVC 2CVEA 2ASJA 3HM9A 1SI9A 3L95X 2V8GA 3VAGA 1KQSR 3D1OA 2KZZA 4TU8A 1ZAVA 1FRHA 2HS3A 5F8MA 4B3OB 1X8DA 3FCHA 3KHGA 5DJBA 4USHA 3G8QA 5F3ZA 3AA8A 4NYZA 2DNHA 1RI7A 1BQNB 4ZVHA 5A8RB 2O67A 2LU1A 1HMVB 1JJHA 2C2RA 3MUVP 2YWGA 3M8SA 1HYSB 1FDNA 2V8DA 5EX3A 1Y5LB 3M6WA 3BSCA 4DDFA 4CZCA 4DQRA 1VBYA 3N01A 2YWKA 2J6TA 2HAIA