2XSJA

Structure of desulforubidin from desulfomicrobium norvegicum
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
436
structure length
436
Chain Sequence
AKHATPLLDQLQSGPWPSFVADIKEEAERRHSNQDNVEYQIPVDVCDDLLGILELKYSDGTTHWKHGGIVGVFGYGGGVIGRYCDQPQMFPGVAHFHTVRVAQPAGMYYTTDFLKQLCDLWDMRGSGLTNMHGATGDIVLLGTTTPQLEEFYFELTHKMNNDLGGSGSNLRTPASCLGDSRCEWACYDAQELCYQMTQEYQDELHRPAFPYKFKFKFDGCPNGCVASIARSDMSFIGTWRDDIRIDQEAVAAYVGGEIQPNGGAHSGKDWGAFDIQKEVIDLCPTECMWMEDGKLQINNRECTRCMHCLNVMPRALRIGNDRGLSILVGAKAPILDGAQMGSLLVPFIKVEDPYDEIKEIIEGIWEWWMEEGKNRERLGELIKRQGLAKAIAAVGLTPVPQHVMEPRHNPYIFWKEKDVEGGWDRDIADYRKHHQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SULFITE REDUCTASE ALPHA SUBUNIT
publication title Structural Insights Into Dissimilatory Sulfite Reductases: Structure of Desulforubidin from Desulfomicrobium Norvegicum
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 119
structure length 436
sequence length 436
chains with identical sequence D
ec nomenclature ec 1.8.99.3: Transferred entry: 1.8.99.5.
pdb deposition date 2010-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01077 NIR_SIR Nitrite and sulphite reductase 4Fe-4S domain
A PF03460 NIR_SIR_ferr Nitrite/Sulfite reductase ferredoxin-like half domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xsjA04
3.30.70.2500 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xsjA02
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 2xsjA03
1B0TA 2WSFC 3MM8A 4Y28C 4AYBD 1Q16B 1Y4ZB 2Z8QA 3B0LA 3B0MA 1H98A 2FGOA 1FRMA 1VJWA 3OR1A 1FDAA 1FD2A 2WSCC 2V4JB 4RKUC 1GT8A 3IR6B 3VLXA 1CLFA 3OR2A 2Y0FA 1DURA 2WB1D 3VM0A 3MMBA 1IQZA 1DFDA 1G3OA 2C3YA 8GEPA 2FJDB 4OMFG 1H0HB 1FTCA 2XSJB 5CH7B 1FERA 2PA8D 1C4CA 1FDBA 2AOPA 3MM9B 1AOPA 3MMCB 2VPYB 1FRKA 4L6V3 3VKTA 1FXDA 2WAQD 1KQFB 2VKRA 2WSEC 1BWEA 1GAOA 1FRXA 2C3PA 1ZJ8A 5AOPA 1FRLA 1FEHA 1FRJA 7FD1A 3VLZA 1GTHA 2VPWB 1SJ1A 3B0JA 2ZVSA 4ID8A 2PMZD 3B0GA 1KQGB 4YDDB 2VPXB 1JNZB 1F2GA 1H7XA 1FXRA 5L8RC 2IVFB 1F5CA 1RGVA 2V4JA 2PDAA 4XK8C 4S3FA 3IR5B 4AOPA 2GMJA 3GYXB 3MM5A 3VLYA 4DHVA 3VKRA 1B0VA 1BLUA 5E7OB 2C3OA 5BYSA 1H7WA 4G9PA 4S3BA 3AOPA 1BC6A 4G39A 2V2KA 1B0PA 1FF2A 3MM6B 2XSJA 6FD1A 3B0NA 3GEOA 3VKPA 4GEPA 4CI0B 6GEPA 3VKSA 4HTRA 2C3UA 1A6LA 3B0HA 3LW5C 1R27B 3MM9A 1Y5NB 3MMAB 3VM1A 5CHCB 1GTEA 2GMHA 4KT0C 1DAXA 1FRIA 1D3WA 1FCAA 4S3AA 1G6BA 5BYQA 1JB0C 1BD6A 1ZJ9A 3MM7B 1PC4A 1Y5IB 2C42A 1K0TA 2AKJA 4G38A 1FRHA 4S3EA 1Y5LB 5FD1A 1JNRB 3MM8B 4S39A 3EGWB 1XERA 2C3MA 1FDDA 1WTFA 2FD2A 2VPZB 2FJAB 2O01C 2FJBB 3OR1B 2FJEB 3VKQA 1HFEL 3MM6A 5BYRA 1SIWB 4XDCA 4S3DA 1PC5A 7FDRA 3HKZD 1F5BA 3OR2B 3NOYA 1ROFA 2Y0SD 3MMCA 3PNIA 3MMBB 3IR7B 4S23A 3MM5B 3MMAA 1FDNA 6FDRA 1AXQA 2GEPA 4S3CA 1C4AA 1IR0A 2UZAA 5GEPA 4XDDA 4OV1A 3C8YA 3EUNA 3MM7A 1BQXA 3EXYA 2FDNA 4S38A 1KEKA 1SIZA 7GEPA
chains in the Genus database with same CATH superfamily
1KVKA 3DLJA 4LUBA 4Y65A 1TKXB 4C11A 2I8EA 4O4RA 1BQNA 2HBRB 4FNHA 1WDDA 2VQFF 1EB0A 1RHJB 1QY7A 1UFLA 2B9YA 1ZOTA 4IG0A 4TKTA 4RWXA 1V3ZA 4UOCA 4ZHRA 3SMZA 2MZQA 1TFWA 3TW0A 2KFZA 1XMQJ 3NWRA 3QIPA 4U6PA 1ZPWX 1W2IA 3Q8PB 1CJKB 4IKAA 1OPZA 4NXNJ 1D3WA 1PC4A 2M5YA 4H4KA 3GWCA 5KAKA 4OLPA 3OR2B 1NZAA 1SQEA 4IO1A 3DLKB 4HR2A 1W26A 1IR0A 2ZOMA 4OHYA 3PEHA 1ICEB 3SQGB 2AEJA 4CO5A 1TV6B 4OZ1A 3HHDA 4YR2A 2CKWA 4OHVA 2N4DA 2Y8YA 1QDUB 2G2YA 1K47A 4HYKA 1PBAA 2ZJRQ 2J6TA 4ENOA 3MCOA 1KQSR 2BE7D 1U1NA 3OW2R 3CJ0A 5ETMA 3J7AN 4L72B 3PW5A 3QWUA 1KQFB 1D9AA 2JFDA 1EETA 1URRA 1TL4A 4Y2IA 3W9IA 2OEJA 1APSA 3NCQA 3NAIA 3NXZA 1PYSB 6FD1A 4DSIA 1TUWA 4NX9A 5KFJA 3NGKA 2PFDA 4OLOA 1LNQA 4B3MF 1SCJB 2NZ4A 5CCLA 2IC3A 3SZ2A 4X66J 5L9XA 2YWGA 2VH7A 4PXBA 4ILMA 2I9SA 4PXCA 4ED6A 4WP9A 2XMKA 1VRUB 4BBYA 5DRKA 1PJ6A 4CRJA 2MZJA 3HXMA 1IBKF 2XWYA 1HQUA 1KLNA 4I4BA 1X5TA 3MAAA 2HK3A 2NQPA 4QYZJ 4M5LA 4RKUC 1GT8A 4NOHA 4LF9F 3Q83A 2MJNA 2YKMB 3NBPB 1EQMA 5H1SV 5T7LA 3CPWR 3VKTA 1RT3B 2VPWB 3MHYA 3TA2A 1BQMA 5J2MB 4LQ9A 1FJ7A 1KP6A 3W3SA 2B9WA 4Y3CA 2L48A 2R2SA 2HHVA 3K2YA 2A6MA 2WHOA 1FVQA 3MFIA 4QR0A 3OTOJ 2B3TB 5J2PB 1VQKS 1S4EA 5L1LA 1U1PA 3TJ8A 4TN2A 2FB0A 3B78A 1WTFA 4O0IA 4O3SA 2VG6B 3KK1B 2EC0A 4CO1A 5JXSA 4WU2A 2MQQA 3Q22A 4UOGA 1WC6A 2ZJQQ 4MJKA 5B7WA 1H2VZ 3KLEB 2E1PA 3K17A 5DLFA 3A13A 2QA1A 2ZM6F 3ILLA 3V6HA 3PW4A 3KHLA 1YJRA 4CTAB 1QD1A 4ZITA 2CQPA 5HROA 4WE1A 3N6NA 5EX0A 1TL7B 4AFFA 4U96A 3VAIA 3CDEA 5KG0A 2MQOA 4OYIA 3BBFA 4C0HA 1WC4A 3BGLA 3PX0A 2OPSB 4A8YA 1HMVB 4KV8B 3PIPQ 3V6DB 2CIMA 5J1PA 4DFMA 2HZAA 2ACYA 3CJTA 5L1JA 4BWJA 3DM2A 2XLIA 4WKYA 4ZPTR 5I3UB 4I6YA 3KNAA 2YH0A 1L5UA 5BYRA 1RBAA 1GH8A 1N56A 3ETMA 1HR0J 1NK6A 3LP0B 3CMQA 2V9WA 5T41A 5J2NB 1D09B 4FYYB 3DKDA 4A8SA 1SV5B 1HD0A 1IBLJ 4O4GB 3NGTA 4DV2F 2LLZA 2MY7A 3C3LA 3CD5A 2APOA 1H0HB 5IOLA 1NRKA 1JLCA 1SQGA 3GYGA 1FRKA 4DSEA 2CJXB 1N33J 4N47A 1YGYA 4QPTA 4AQYJ 4NA1A 2NPFA 2JRSA 1R0AA 4CLTA 1TU0B 2ZZMA 1YI2S 4Y2AA 3N79A 4CO3A 2EFPA 4CNYA 1WOSA 5LXRA 4KYZA 4RW9A 4ES1A 4CM2A 3DOKB 1YRUA 2BE9B 5GAGI 1WF2A 2QLJB 1T7PA 2HNZB 2CA9A 1RDRA 4OJ3A 1XERA 4KO0B 2HBYB 1KFDA 3G8QA 3AJ2A 4IH5A 4G3IA 3D0GE 1VR6A 4H4OA 2CG4A 3Q8UA 5DG9A 4JI1J 5DQGA 1PG5B 4PUOA 2E1AA 2M2BA 1U2RA 1N32F 5JVGQ 5LL6d 2BOAA 5LSRA 2P9CA 5JUMA 4X4UA 4NLQA 2HGNA 2J6SA 2N3LA 1F6TA 3MCSA 1FRMA 1UW4A 3H2VE 1JJCB 3VLXA 3NS6A 1U09A 1AYEA 1NLKL 1DJ0A 3N4WA 3TWZA 2UXDJ 3F0NA 2N82B 1BWEA 4DZ6A 2MZRA 4DEZA 2ZVSA 2PFFB 3EVMA 2ZHOA 3DN9A 4NYPA 2NREA 3FSXA 2M88A 2Q43A 3B0NA 5HLFB 2XHCA 2BA9A 1IR1A 2ZH2A 4WZQA 4KKOA 2YVSA 1AFIA 4A46A 1TKXA 1KR4A 2AIRB 3TARA 1Y5LB 1UAWA 4ZVRB 1YKWA 4LBIA 3HVTB 2KU7A 2C2OB 5KTQA 2VC0A 3GILA 2K7JA 1V6HA 5K5MA 3KUHA 4LF4J 2AGPA 4I68A 4DV7F 2B4PA 1RADB 2CJAA 2VDIA 5K8OA 1VRQC 1RTHB 3O6QA 1U4BA 3QGPA 2VZ9A 4G6VB 1T95A 2E5HA 4JI2F 1CJKA 3J81Y 1XWLA 4DPOA 1ELOA 4QJVA 2E1MC 1IBMF 4LF8F 1CQMA 1AOPA 4A8MP 2W4CA 4USIA 3E01A 3CCMS 2YTCA 1E6VB 3B0JA 3I9ZA 3B0GA 1DARA 2KL8A 2R7VA 2R3VA 2IIHA 4S3BA 2IA6A 1LK5A 4LSZB 1KC8T 3PV8A 5D4NA 1G7CB 5I3PA 5CD4H 4LF2A 4NZ0A 4WFAQ 3ET6B 2MSSA 1H74A 2HLTA 5ETSA 5D0RA 1ZAVA 3UD3P 5AE2A 1XMBA 2MJUA 3G6YA 3LWMA 4DR1J 2CPXA 3CJQA 5C24B 2RRNA 3CJ2A 1RAIB 2B4VA 4EK2A 4JP8A 3LA0A 2JH3A 3FBFA 5HVGA 3N5FA 3P8BB 5HO4A 2CQCA 2BQ3A 3TUIC 2AJ4A 1OQ6A 1W2BR 3VZHA 4K8RA 3CC7S 1FTCA 3SEOA 2QO3A 2KO1A 4ZMMA 3BR8A 1N48A 1NEEA 1PIEA 4LSNA 3CDUA 2CG8A 2F40A 4DQRA 5CD4A 3FCHA 2J7KA 5B08A 3IS9A 3BYRA 3DLGB 1IJEB 4YB6A 2E9RX 3CIZA 1B99A 4UTGA 4IOCQ 2KT3A 2FLPA 4G65A 3VQSA 4G9PA 3AOPA 3IO1A 2HRTA 3IRXB 4CWBA 1SH0A 2MQLA 2EFGA 2E7VA 1EJ7L 2BANA 3ZZYA 3QJLA 4WIQA 2AX0A 4OZJA 5F8HA 4EFAC 2MSTA 2CFXA 1TAQA 1VIXA 1CC8A 2J8AA 4UT4A 2W4DA 4NYOA 1K73T 1FX2A 2HNDA 4USWA 2V34A 3WX8A 4NI2A 1O8BA 5DG8A 3K5MA 3Q23A 3RRKA 3WX4A 3H42A 5L1IA 2AV5A 2CJKA 5HVFA 2VFRA 4FKXA 1GQEA 1Q5YA 2CQ1A 5GADI 4Y6IA 1NU4A 4OQJA 3PYGA 1HWKA 2DITA 3PACA 3BDEA 1R6VA 4YOEA 4YEAA 3MUMP 5FLXY 5J2PA 1Y0HA 2HQGA 9RUBA 1EX8A 4B3RF 3M9NB 2GVZB 3HFZB 2RAQA 1RU1A 3EZOA 5L8RC 2V4JA 1T02A 1O0PA 4QIGA 5F8IA 4B08A 4P7VA 2M0GB 2CNLB 1L3UA 3EGZA 4ANEA 2F9JA 1CQNA 4CI0B 3KLEA 1XR7A 1P1LA 3UCGA 4CLUA 5ETOA 3QYYA 1EKSA 4DUZJ 2PMWA 4Q45A 4KH1B 2KFNA 1HYSB 3LUYA 2RU9A 3PRDA 4IFYA 5BYQA 2HS0A 1BD6A 3MZIA 2E1CA 3H90A 5KT3A 2MKIA 3FSIA 3PIOQ 2BJ8A 2C22A 4OZ2A 5HJXA 1LW0B 4ZVTB 3NGSA 4W92B 1KEKA 1C1CA 4CZCA 2R8KA 3HSGA 1HMVA 2IM0A 4KV8A 3IGVA 4RLEA 3L95X 4I2PB 3UN2A 4WYWA 3TI0A 5GAEU 3RB6A 4Y2KA 1RWWB 3Q86A 3GSIA 4NRTA 4N8OA 3OTDA 1RLDA 4FF1A 1X5OA 3I6PA 1IM4A 4ANCA 3WBZA 2C3OA 5BYSA 1SV5A 3LAKA 3NCRA 8AT1B 4O4GA 3NL0A 3JTPA 1X5PA 5LJ5Y 2QA4S 4KR0B 4RUBA 5IT0A 2XC9A 4X4VA 2BOPA 2ALYB 1RWXB 1ZTWA 1KNZA 4P71A 2BUNA 2YNIB 3KKFA 2B51A 3M1VA 4CDIA 3M05A 1M5HA 1S9EA 2EBGA 1OMSA 2CQDA 7GEPA 4B3OB 3PW0A 5M2RA 4USTA 4K2JA 2C2NA 2IPOB 3OV7A 3HHKA 2NS1B 2BE2B 2HIYA 1N52B 1TL1B 4FBUA 2EKYA 1C0UB 2JLGA 3AJDA 3H8YA 1VQMS 2JEGA 4ZOSA 2DPJA 2J7WA 4J9OA 2G1DA 3KK3A 5DO2A 3D1QA 4ECWA 1WG4A 4ATNA 2ZH7A 2HVDA 2XMJA 1L3VA 4KO0A 3GZ7A 1PSDA 2FIUA 4UQGA 1LKZA 1SQFA 2DR9A 4ZVHA 2YNFB 3LP1A 4URSA 1WC5A 2E5LJ 5HP1B 4JI6F 5LMUF 4CYUA 4TNOA 3IG1A 4U7UD 2DISA 3PM9A 2UUCJ 1VBXA 1QUVA 1XTZA 4O3NA 1DTTB 3KJQB 2UU9J 3QRQA 2DNHA 3R1HA 2ASYA 3D1HA 3KLHB 2D69A 3HSZA 2K7KA 3UD4P 3W2WB 1AUSL 1LK7A 3LANA 3RRGA 2BM1A 4GC7A 2G13A 5K8NA 5LMNJ 4PG7A 5F3ZA 5IM0A 1HNWJ 4LF7J 3CXCR 3CIMA 2IYIA 4DFPA 1AB8A 3TQ1A 5HLFA 1ZM2A 2NXNA 1Q7YT 4IO9Q 1BXNA 4Q2MA 2KXFA 2WOMB 2WRMA 2NUUG 1IBCB 2BV3A 3MM9B 1M5SA 2ZZTA 1HNXF 3M32B 1O51A 3W9JA 4TU8A 3L7UA 4IQXA 2YWKA 5KFMA 1WKLA 3CJ4A 3GYXB 3U7JA 4KGVB 1KHVA 2F9DA 1IKYB 2OJ3A 1GMUA 3E3XA 2VG5A 1Q53A 1RHMB 2DHGA 2JLFA 2JWNA 3AB2B 3S6EA 3SV4A 1TKTB 4P9SA 2YNGA 2VFVA 3FGVA 1ZAXA 3MMBB 2VBWA 3D5MA 4P2SA 3KLGB 5CA5A 3HMJG 2YQ0A 3MR5A 2ZJPQ 5BXIA 1ZH5A 3OUYA 3BSNA 4OI6A 3TVZA 4NCGA 2Y0BB 1XK8A 2RHQB 3T1YF 2CJ9A 1TVRA 3ET6A 2W01A 5BR8J 3HK2A 2WAQD 2BEFA 3LP2B 3AJ1A 2F3JA 2C2KB 4UZCA 1FD8A 1MMNA 3QO9A 4OX8A 1RTDB 1EHWA 4S3FA 1J5EJ 1HKAA 3OD2A 5KFEA 4LFAJ 3W2VB 1H3DA 1K0VA 3RB4A 2H5IB 4USJC 2Q6CA 2W2QP 3TA0A 3KG1A 4K0KJ 3DI6B 3UCZP 2WZ1A 2GMLA 4TVAB 3TX8A 2ZD1B 1Q1KA 4AD6A 4UZBA 3QMQA 2OEMA 2OTLS 2IDEA 1SB6A 3HJVA 3MR3A 3DOMA 2YXLA 3DLGA 3DU5A 2UZAA 3C8YA 3UDLA 5KFFA 1SC4B 3TJAA 3KHRA 4BCAA 3B0LA 2BRLA 1N36F 1VJWA 2DH8A 3VAMA 3IWLA 4LR7A 3DRSA 3SSRA 3T6BA 1T3NA 5CH7B 4J9RA 1NHUA 3PFEA 3H5XA 5RUBA 1ZJ8A 3VGVA 2XMUA 1T9WA 2V9KA 3V6JA 1RUSA 4CH0S 4CT9A 2EG1A 2OFHX 1S1UB 4F3OA 1SVDA 3ONQA 3H7HB 3VAHA 4I67A 1RT6B 2UXCF 2GFFA 3HVAA 3MMJA 4I64A 1S10A 4JI4F 4JI8F 2R7TA 3MM7B 1R43A 2BJ7A 2X1BA 4NL5A 1BE4A 1FDDA 2Z2MA 2CPZA 3V2UC 3PNIA 4LFBF 1PJ7A 2V4QA 3DGPA 3I82A 1FESA 5A8RA 3L4BC 3KHHA 1SIZA 4I1TA 3J7YU 1P6TA 1RTJB 4C8LA 4JI5F 1EZZB 1S72S 5D77A 2E9TA 2DHSA 5K14B 1J2VA 4U67Q 1CS4A 3AQOA 4CLWA 5KFPA 2W2NP 4RJVA 2WB1D 2M52A 3KUGA 1SJ4P 1JIHA 3J81j 2O3DA 1HYSA 3OSPA 2HS4A 2CQ0A 1RT2B 1YX2A 3QT7A 2QE5A 3PDNA 2IA0A 2RILA 2JC0A 3BF4A 3CULA 2QLBB 3W60A 2ZH9A 5AE1A 4L76A 2SXLA 2BXJA 2XO6A 4MK8A 3M8ZA 4MKBA 4ZA1A 2ZBIA 4EMDA 3M2UB 5DDPC 1SPBP 1BC6A 4G39A 1FKPB 2BVZA 1FKOB 4AUKA 4YFUA 2FHOB 1GMWA 4J5OA 1RT7A 1O5JA 3MAQA 1VC6A 4I2PA 3W5YA 4USUA 3W7BA 2E44A 4QZVB 3GSDA 4A47A 3M8RA 1HNVA 1EARA 5LXYA 2B56A 3HKZD 5L38A 3UN5A 5LOQA 2VQEJ 2IRYA 2ZUAA 2W2PP 2MKHA 2VB6A 1MU2B 4NMXA 1Q0NA 3M2VA 2BW7A 3AODA 3W9HA 3KJVB 2CWKA 1LWEA 4YDXA 5CZXA 1QE1A 2CPIA 1EQ0A 5IT4A 4P74A 2BKNA 3HHNB 1RT5B 3T5JA 3F41A 3SCIE 4NMLA 5KFAA 1Y9OA 3PYFA 3HM9A 1QTMA 4F7VA 2JNJA 4V1Ak 2WK4A 1WKJA 1HI8A 5HQ8A 4DV6J 1F9FA 5LJ3Y 3C15A 5DGAA 5A8WA 3JQKA 4A8WA 2W2MP 1B0PA 2C28A 1SKRA 3TAMA 4FXDA 1Q8KA 5JVHQ 1RZMA 4LF5F 4TQRA 4ED7A 2B7CB 3AT1B 3ZTSA 4RNFA 4OHXA 3GFYA 3T1HJ 1JLGB 2LEAA 1IUJA 2AYMA 4M5HA 4C8YA 2EEYA 5KFGA 1XQIA 4B17A 3MM8A 1RE1B 2X51A 2ZZNA 4OZ0A 2Z8QA 1RWMB 5HP1A 3MD1A 3M30A 3MOJB 3KMQA 1R3NA 1DTTA 4MFBA 3IM8A 4X62J 3T1AA 4PPZA 3MEEB 5IC6B 4FVMA 2V8HA 4JV0A 1GAOA 5AOPA 4HDGA 2V5HG 1HHQA 2DH9A 1Q81T 2F65A 1Y3KA 1WNEA 5C25A 1F3VA 2HQDA 3WC0A 4QYRA 2FQQB 4Q0BA 2L08A 1YJNS 3DHXA 3B0HA 2FZCB 1JLBA 1ZZNA 4USVA 1X5SA 2C42A 2DBBA 4PWUA 1UZHA 3RBXA 2XS7A 2DHHA 2MQPA 1C1BA 4HDHA 5KOXA 4FPIA 3I0RA 4OYMA 1SIWB 5KFCA 3JSMB 4DF4A 1REVA 1I94F 1U1LA 1VK8A 2GVDA 2GHPA 1MN7A 5E2QA 4K59A 1DQ8A 1VGYA 2BACA 2AHOB 2HQCA 4DR5J 4WFXA 2V2VA 4WP3A 4DPTA 1IKYA 3O5TB 1FK9B 3FBEA 2RQMA 3V81B 2OGUA 1N5YB 3MGJA 4J9MA 1HWUA 2JFKA 3QGHA 3HVRA 5KFDA 2PIIA 1KTQA 1UJ5A 5G4DA 2VPYB 1TUGB 3HKWA 1YLXA 4K4SA 2QYGA 3OXFA 2M7SA 1FXRA 3EVWA 3KDNA 4JI3J 4UW2A 4ZCKA 1WORA 4DSJA 2HLUA 2AF6A 3CDWA 1UFWA 3M6VA 3KLGA 2QZ8A 3VVUA 4OI1A 2F8EX 3GIJA 3IBFB 1HQ2A 3OPKA 3BGUA 1DAXA 4EU0A 4K4YA 4FDFA 2N7CA 3KDOA 3I96A 4UQTA 2OPPA 4F26A 1BMQB 4ZVFA 5B0FA 1A9NB 3OR1B 4WTYA 4EO8A 3H5YA 2RS2A 4F25A 4HHJA 3LGNA 1SKWA 1N34F 2GW8A 2UUAJ 3CJKB 5E3AA 2CQ3A 2HG4A 2M70A 1RTDA 1LFPA 4DQPA 3OVBA 4L3KA 1WELA 3D9BA 3CTRA 4ZPBA 1B4SA 2DRAA 5F8NA 2LMIA 3OT9A 1J27A 2ZWPA 3A8KA 2F7VA 3CNQP 3CCUS 4G1IA 1ZS6A 3Q8RB 4ZLLA 4PYDA 3A3OB 1M5VC 2ZBPA 1JLEA 2ZFHA 1PAEX 4DOZA 5B0GA 3VALA 5F0WA 1VYAA 1JKHA 2OMOA 2WONB 2YNHB 3OLAA 2OFGX 2YWEA 2RE1A 4CLYA 4X4SA 3MCMA 3RBDA 2YKNA 3D3CJ 4ETZA 4LREA 4WCEQ 2X1AA 5K8MA 1PC5A 4ZK7M 2VQFJ 2H4YB 4F50A 3ELHA 4KE5A 3J81U 3K8VA 5KFKA 2ZOFA 3MPWA 5AT1B 4P73A 4ZCIA 1CJVB 1RT6A 4URQU 1M5OC 1S1TB 2ZHAA 1NH8A 4ELVA 4X4TA 3UO0A 4L3NA 5KT4A 2KJWA 4FS1A 1ZBTA 3Q89A 1L3SA 1WACA 3JYTA 1SJ1A 4Z37A 2HW3A 4QCLA 4OIXA 1K9MT 3EICA 2FVPA 1R0BG 4IFVB 4C4WA 1JX4A 2BX6A 3MM6B 3VQTA 2R2TA 5A8KA 1Y5NB 4QIVA 3IAS9 1RTJA 3RAXA 3LH2S 2VBYA 1G6BA 3L3CA 3V4IB 3NOCA 3THPA 4ECTA 5CYQA 1Q8BA 4FVCA 4HLBA 3HP6A 4DLEA 3P3DA 2H5EA 4KGZB 3QT6A 4MYTA 1KDNA 4F4AA 3CJ8A 1TKZA 2YPZA 4C0OC 8RUCA 2IM3A 3PR5B 3M2UA 4KRWA 3UVJA 1H98A 1VC0A 4B9TA 1NUEA 2B6AB 3LQVA 2V2ZA 3L7OA 4B3MJ 2COLA 2R7XA 1RA7A 2CZ4A 3HHEA 1FDBA 2AOPA 3FCVA 2HHPA 3S8SA 2WSEC 2QFIA 3J80U 3HX9A 3MECB 3TYTA 3CSKA 3R6GB 1RTIB 2HRUA 2AJQA 4XIUA 2OMLA 5HJYA 3G6VA 1IBKJ 3WC2A 3T9NA 4EGLA 3VKPA 2KG1A 4ECYA 3DFEA 4TYBA 3G87A 1IQTA 2P9GA 1MWZA 2FZGB 2J9CA 2B8QA 1X60A 2DNZA 2GMHA 3N6MA 2L9NA 1PYOB 5I42B 3DCAA 2QA2A 4EYIB 2DNRA 4IDKB 4S3EA 1WWHA 2OEKA 2DR5A 3UE2A 3PTWA 4LF9J 2QL7B 2GHWA 2A2DA 3DHWC 3JSBA 1X4GA 2ZH5A 4NLGA 5M2UA 3PYDA 1VJQA 4RO0A 4N7TA 4KH0B 4A8FA 1D1UA 3MOZA 4PQUA 1TR0A 4RUHA 2PT0A 4U95A 4ES2A 5IZHA 1VBYA 5FLXU 1UZDA 3MWBA 3R97A 1YBTA 3W66A 2FYXA 2LCWA 3ZTRA 4PKDB 1HBOB 4O44B 5KFSA 2Z57B 4QU7A 1T05B 3LGMA 2J8SA 2LQ5A 5L39A 3CJSA 4HACB 5IXUA 2QL5B 5EUHA 2RKIA 2KYXA 2DGQA 1Q95G 1W25A 2A1BA 1FWKA 1XR6A 3K0JA 2X1GA 2DEIA 1NDKA 3M7VA 4QW8A 5HN0A 3CVKA 3TP2A 5CHCB 4ZVEA 2FVRA 3TX0A 1XEZA 3HVWA 1S9GB 1J5OB 3QAUA 2LA4A 4LRDA 4DL7A 4G38A 2G0CA 3FMWA 1XMOJ 5SZTA 1HI0P 3NWGA 2JZ5A 5EGYA 3GJSB 2XMTA 2HGLA 2ROGA 4Q8FA 2VDHA 2LQ9A 5J2QA 3UNGC 3BYPA 5CCMA 3PKYA 4F4YA 4NYZA 2B43A 3OHBA 2Z2LA 4Y2CA 3K5NA 3QSYB 2XCAA 2QRRA 1N0VC 2XI2A 1DTQB 1U1OA 2FJDB 1JJ4A 1EKRA 1N54B 1WSVA 1YBAA 1FFGB 3C16A 1FVSA 4A8QA 3KLIA 1T11A 4IR9A 3B54A 4EUVA 1S0MA 3U1LA 3K57A 2OPQA 2BM0A 2JL9A 1SC6A 4YUDA 4TY9A 3JSMA 4GC6A 2HFOA 2UVUA 4QPXA 3GR0A 4DPYA 2R7SA 2DPIA 5KFUA 2ZNYA 3NY0A 1PKUA 2W7PA 3GPAA 5KFRA 2RVJA 1N0UA 1TL3A 4RW4A 5GVQA 4AL5A 3G4SS 1GEHA 3V81A 2HWTA 2CQIA 1Q8IA 5A76A 2FTRA 1RLCL 3NOYA 1ROFA 2QSFA 1RBLA 3EMTA 1AUDA 1QAJA 5IQQA 3EUNA 1U49A 4YS2A 2DNOA 4DR3J 1WEZA 2D74B 3D0HE 2V50A 2ZVIA 2MZTA 5AE3A 2DGSA 3VGUA 4RUAA 2ZKUA 3LTOA 1VHIA 4M5NA 4KC5A 2ZITA 4RBUA 2BR0A 1Z4UA 1QAIA 3N9UC 3VLZA 7FD1A 1S6OA 4P7TA 3BN4A 4J91A 2AYEA 2VF3A 3GIIA 3EXCX 1HBMB 3CJKA 2XSJA 3G96A 4JI1F 4WBFA 4RW6A 1N32J 1MG7A 3JSYA 3BQ1A 1DLOB 2V67A 3BPSP 2FLLA 2ZOGA 5GMDA 5CYMA 1S48A 4ED5A 3R7SB 4UY85 2AEMA 3AA8A 2B9EA 4LRBA 3FKBA 4DPXA 2V69A 2HFZA 2UXDF 5E5NA 2D9OA 3KTQA 3NNAA 2OLWA 1UVMA 3GP9A 4IYQA 4C7QA 1OPIA 2QJ3A 4C3MA 4PEOA 2Y1JA 2XULA 1FJGJ 3ISZA 3S01A 2DGXA 1KONA 3DC2A 1RAAB 3WIVA 3GMGA 1UPPA 4DL3A 3OTBA 5KG7A 2MLYA 4UOHA 4DPWA 1R7IA 4LFCF 2DRDA 5F8MA 1S12A 3CMES 4Y34A 5KG6A 3IN5A 4MAKA 4JI7F 2J76E 2VPXB 1WTBA 1VBZA 2I38A 4DV7J 2YH1A 1RT1B 3I56S 2QV6A 4B3SF 2Y1RI 4W4MA 3DLEB 1G1XA 4FYXB 4U7UK 1HWLA 1TKDA 1RHUB 3TJ9A 4GKKF 1K0TA 4RNHA 1CJVA 4Q44A 1RAGB 3SSQA 1RBOB 4JI2J 2IRUA 3Q0AA 1KHWA 1S1TA 3UDEA 1DHMA 4DV5F 2UUTA 4X64J 4LF8J 2Z56B 2W7AA 2EWHA 1NXIA 4WZMA 2GHVC 4DV4F 2KVQE 4ZVSB 4LF1A 3S1TA 3KUEA 3C6TA 4IFVA 2RDIA 1MMLA 2MEWA 3EX7B 1D8YA 3PYEA 3QRRA 4DI6A 2GX8A 3V4IA 4NPOA 1RWKB 1DQ9A 5GAHU 3RG6A 3CO9A 2P6TA 3PVXA 4U8YA 2GO8A 5DJBA 4EO6A 2CZVC 1NJIT 4DQSA 1XNQF 1I6JA 1RU2A 3DOLA 1RWPB 3SSSA 4Z2XA 2D3O1 4H4MB 3GQCA 3EM1A 5LM7E 1KOOA 4QWBA 1A0OB 4ZVOB 3CDBA 3J7Z5 3FRYA 1U8SA 3KK2A 2ATLA 2GJFA 2VU5A 1EAYC 2MKJA 2ZE2A 5HQLA 1RT4B 3VAKA 3JTNA 3A4TA 1HNIB 3BBCA 1ZM4A 4K4TA 4GVBA 4DUTA 2XZWA 2NUHA 2J0SD 1JLQB 3ENVA 2AGQA 1TK8A 2CDRB 3GV5B 1RCOB 5GEPA 2VJUA 4C6AA 2I5JB 2V6AA 4CO4A 2HMIA 2JEJA 4ZIWA 5B0AA 3MD3A 1XC9A 1CPZA 1DRZA 1T9TA 3VAFA 3BM7A 2MKYA 1E6YB 2XYPB 1RHRB 4WJBA 4IRKA 4ZJLA 1WHYA 1YJVA 3QJJA 2WVCA 5I42A 2CPYA 2DKOB 5D3GB 1CEZA 2E29A 5B0CA 2H4WB 4RW7A 5JMNA 4OYAA 1HNZJ 3M2RB 2M4MA 1U6FA 5ETRA 1NAQA 1Y10A 4YR3A 2HQIA 1F3FA 4WXOA 1H38A 2DNYA 2BJ9A 9ATCB 3TR5A 1P27B 4L74A 1ZJ9A 3V5RA 2OHDA 1S57A 1FFSB 4QR2A 4M5KA 3T5HA 5MLCV 1VRTA 1T05A 2MKSA 4C8KA 2PN6A 2MYFA 4HHUA 1S99A 4PPDA 3POTA 5A0YB 2JEIA 2A18A 1EP4A 3I4PA 4PWDB 4D3HA 1YITS 3UD5A 4ED3A 1OS5A 1TUVA 1VS3A 1T03A 3SXLA 2B9XA 1J5OA 4R5PB 1FO1A 4DUZF 1Y7PA 2E7WA 2BBEA 2X7IA 2BKOA 2KFYA 4KIAA 2G4BA 4OZNA 3ETOA 2JEFA 4DX8H 2E5GA 4JYAJ 5HBMA 2IAJB 3DRRA 2H3EB 1B7FA 4X84A 3THVA 4C2MA 3R6LB 2XBPA 1OQ3A 3EPIA 3DRPB 5K8PA 1VQLS 2A3JA 1IKVA 1SJFA 4NLDA 3G71S 3T3FA 3I55S 2BYCA 2FJEB 2HHSA 3MUVP 4X4OA 4X2BA 3OL6A 4LIRA 2XTJP 5D4OA 2OD6A 2WB4A 4RX6A 4RU2A 1FT8A 1KLMA 2LDIA 2V8GA 1GX5A 4KHRA 3WHIA 4OI3A 4EI2A 2OSRA 4ZP9A 2ABYA 4LR8A 3K8WA 2ZUGA 4LRFA 1D9DA 1IKWB 4ZJQA 4YB1P 1SL0A 4DCPB 1S1WA 3Q8SB 1HW9A 3T6JA 3DLBA 4LBPA 1MMDA 2DT9A 2PMZD 4WWSA 4C48A 4M5JA 3I5AA 1HL6A 3QFWA 4KGXB 4DHVA 3HHLB 3CMAS 3VKRA 3M8PB 1WG1A 1AROP 1U0HB 4OX7A 3UDCA 2XEXA 1RAEB 1VQNS 1KN6A 1X4CA 4FS2A 2W25A 1GXUA 3ZZRA 3QWPA 4FNIA 1Y00A 3U02A 4DPUA 1SKUB 2QMWA 1RCXB 4TLQA 2B4OA 1RAFB 1NKEA 1TK5A 4JV2A 2KZMA 2FD2A 3UDVA 4M5DB 5G0RB 3LOUA 3J7A1 3W1YC 4GKJJ 4J7CA 5DM7Q 4S3CA 2DVIA 2PO4A 4DCJB 1B70B 7AT1B 5AXLA 2WSFC 3MPVA 4PABA 5K20B 1HBMA 4F36A 5HSPA 1YZ7A 5IQ6A 1DZ5A 1NK7A 4JI6J 5LMUJ 4OYXA 4PZVA 1IQZA 3HHLC 2NPIA 4I7FB 1DLOA 4I6WA 2LU2A 3VAJA 1NKCA 2UUCF 3BSOA 1OYEA 1RI7A 2RHSB 2KTQA 4BWMA 3H4BA 4ZP6A 2X3GA 2XS5A 1SL1A 3ITHB 2K8GA 3HD1A 1N88A 4G1QA 2HHQA 2HVHA 2VASA 5B0DA 2RQCA 4X65J 3FVYA 2GQCA 1IWAA 4W98A 3MI7X 1SUQB 4LF7F 2JDJA 1FRHA 1S6QA 3U27A 4DU8A 2N4CA 2H48B 2AKWB 2CRLA 2BDPA 2WVEA 3M8QA 3GR1A 1HNXJ 2OD4A 1AXQA 4DS5A 2P9EA 3SFGA 2GV1A 3SCLE 4K2XA 2VG7A 1WOPA 2VKZG 4QIEA 1D0EA 3HULA 2QEXS 1DURA 4ZLPA 2FJVA 3RUBL 3WDOA 1WHWA 5E3RA 1GMVA 3MMCB 2J9DA 1FRXA 2DGOA 1LWFB 3GIKA 3QQCD 2IM1A 4BLGA 4HI1A 5HMWA 2AQ4A 3MURP 3IGNA 2VONA 2RB7A 1ZZFA 4PR6A 3GEOA 4FYDA 2IMOA 2CJBA 2HNYA 5DZ7A 3NNHA 2NSCA 3VAGA 3FSYA 4RU9A 3NLCA 2K2PA 4S3AA 5M2PA 4USHA 2DR7A 2V94A 4DBQA 1C2PA 4MKVA 5E3QA 3GJQB 2RD5C 4F0HA 2CQ4A 5I4MA 4CLFA 4S23A 3ZFVA 4OYWA 1BQXA 3ENQA 5HI7A 3QZ8A 1Q16B 4H4MA 1J5EF 1HIYA 2GAGC 3QATA 4WFBQ 4DS4A 1BUXA 1JLFA 1RKJA 4RBVA 3NGDA 1R0CB 2CPJA 1NB2A 2WVFA 2O1PA 3QJPA 4OJHA 4USMA 2BABA 1NK8A 4DSKA 1RT4A 4DZDA 3HZEA 2CJQA 3HD2A 2PMHA 3V4MA 3SDEA 3BQ0A 3US5A 1VQ8S 1PJ5A 1JLQA 2HQ3A 4QR1A 3H20A 1TMMA 3FJ2A 3GYNA 1VQYA 3W64A 5AXNA 2OPRA 4M94A 5C2GA 1JLAB 3MMAB 4DQIA 2R4FA 2OO4A 1N36J 1CSJA 2D1CA 3DDKA 5AXMA 3QT8A 3OTEA 3G82B 4P72A 4XAKA 3BH7B 2DXEA 4LF6F 1CC7A 1NK5A 4X4PA 1MLAA 1QAYA 1BQNB 4CO0A 3IR7B 2EK1A 1HBUA 2GJIA 3BB5A 1OJ4A 2QL9B 2ZH1A 4P2XA 2ZDOA 3VWSA 4IG0B 1CG2A 2UXBF 1AZSA 4DR6F 1H73A 4ZHRB 3ULHA 4KQZA 4KGKA 2GGPA 3IR6B 4EBCA 2UXCJ 2MTLA 3QIPB 2M8DB 4B02A 4CLZA 2HQFA 3FBBA 4JI4J 4JI8J 3CF5Q 4PG6A 4OZ5A 4EYHB 3B4DA 4NLXA 4ID8A 2ROEA 2ROPA 2KT5A 1XNRF 2BRKA 1VQSA 1A7GE 4LFBJ 3PZPA 2QSWA 5A0YA 1YZ6A 3D28A 5EX3A 4L73A 4ALZA 3QAEA 3OL7A 5HK4A 4JI5J 4DMZA 2ASLA 1S0NA 3U1MA 2YX7A 2MKKA 1GK8A 3QPIA 3R5JB 1MWYA 1GFWB 5B0BA 4R5PA 1GNKA 4PAAA 3AXKA 2C2ZB 3DXBA 2HHUA 2V0NA 2XY5A 2F4VF 2VC1A 1HWIA 2HHHF 3TVYA 4CCHA 3GCXP 1XBWA 3NGUA 3EXYA 1JXEA 3TOQA 3OXGA 2HFNA 4CQ1A 2RF2B 5KT2A 3OR2A 4H4KC 3DLKA 3N5BA 3MEDB 3GE9A 3GONA 4N77A 1UMJA 3DRPA 3RRHA 1M1GA 3SQGA 2H9ZA 1TV6A 2D9PA 2VBXA 1KVIA 2IC3B 2RQ4A 4YHHJ 2EK6A 3JTOA 4LVOP 2VUGA 1LOUA 4DQQA 4OI0A 2FC8A 4WFNQ 1H7WA 4FF2A 3ZNJ1 3T5LA 2NCKL 4GEPA 3PG9A 3T5KA 1GTEA 1F9HA 5GAEI 3EDQB 2W7OA 1HQUB 1MWQA 2KRRA 2VL1A 2Y9HA 3QNWB 1TELA 1IKWA 1U2CA 2M8HA 4ED8A 4ID5B 3VV2B 4MT1A 2OSQA 5KFBA 5ETNA 1S97A 4ANDA 1N5SA 1YJ9S 2DIUA 3C2PA 5T7LB 2K3IA 1N6QB 2AW0A 2RUGA 3FZBA 1U47A 1WUUA 2RJZA 1YK9A 3GFXA 1VRUA 3HFVA 4X4QA 3N28A 1SH2A 2J9EA 1V3RA 2JX2A 1N4LA 2I1RA 2W9CB 4LF5J 3I31A 3R7NB 2PA8D 1NPRA 3J80Y 4ETXA 3M9OB 2D3OR 1HLWA 2CQBA 5G0RA 1VFJA 3KLFB 3HSJA 3B8HA 2JOQA 1REGX 3AD8C 2LECA 3GV8B 2ZHBA 4Y00A 1VLYA 2CPHA 2MQNA 2YKMA 3NBPA 2R7UA 1RT3A 2GO9A 4DN9A 1RWUA 5HATA 2OIHA 5J2MA 2E7XA 4OI4A 4AE5A 4MK7A 1WJ9A 5IS2A 5J1NA 4I7FA 4DX6A 1NSAA 1FXLA 4NCAA 3W8PA 1IJFB 5HROB 1MSWD 4WE1B 4XO0A 1V5IB 1R8BA 4EBDA 2XLKA 2BJ3A 3HF5A 1TZ0A 5B09A 1DY3A 1RWOB 4EZ9A 5KFVA 3HHLD 2VG6A 2MHEA 3KK1A 1PGZA 2D3UA 1R8PA 2LKZA 2NLWA 4OFZA 2AJ0A 4MH8A 5C5JA 4XPCA 2D41A 3A8JA 3BGOP 2HEKA 5D8HB 1Q78A 2HVEA 2A0FB 5IT9U 3DM2B 1JNZB 2FVSA 4M5GA 4CTAA 2RRBA 4KBIA 4QIFA 5D0GA 3NS7B 1I94J 1RP5A 1ZETA 1NSKL 1TL7A 1SJ3P 4OZ3A 1Q5VA 1WF0A 1KBRA 4E0DA 4N76A 1F5AA 2CQ2A 3VR1A 3MCNA 2C1EB 1NSQA 3CJ3A 4PG4A 4DR5F 3R8YA 2OPSA 4ECZA 4S3DA 3V6DA 5EWFA 1M1HA 1G4CA 3MMCA 4NLUA 2CVEA 2CQGA 4B9MA 2AYGA 3FC9A 5C42B 1JLCB 2FDNA 4ECUA 4BC9A 5HANA 5I3UA 3B0MA 2EVZA 4JI3F 4QWAA 4NLTA 3LP0A 4ZP7A 4K4ZA 3QFHA 5J2NA 3ZC4A 2W8LA 5ETPA 2XO7A 1UEVA 3OFHA 4RW9B 2IMWP 2C3PA 2UUBF 2Y3YA 2LYVA 5U47A 2PD1A 3UQSA 1F5CA 5AJ3J 4YY3J 2NYIA 4DR7F 1BY9A 1N34J 1D9FA 1UVIA 4KB7A 4H4OB 3QGIA 4I69A 2YX1A 5FIIA 3G2XA 1LXJA 4PUOB 1UWBB 2LEPA 1VCTA 2L3MA 2AGOA 2YBVA 2RUSA 1FX4A 2BZ2A 4Q43A 4O3PA 2CPFA 2XMAA 1YIJS 5F9LA 3OL9A 3IM9A 3ZZTA 3THTA 3T9ZA 2EFVA 2W1BA 1LWCB 2A10A 3DOKA 3CCQS 4OV1A 3PJWA 5C7PA 2FHJA 4S38A 2HNZA 2ASDA 4ZP8A 4Y28C 1Y4ZB 5FJ4A 4KFBB 2J0WA 4DSFA 3WQPA 3NNCA 2B4UA 5J1EB 2V8VA 1X9SA 2MLZA 5F8JA 2EKNA 4C3KA 4F2RA 5D0EA 2AJFE 3G82A 4F0MA 4L6V3 4ZS6A 1FNXH 1T94A 4C0BA 4KKOB 4WYLA 2R7QA 3VCDA 1F2GA 1NDLA 3IR5B 3ILJA 2GAHC 4O0NA 3TA1A 3D54A 2YWFA 5H9FK 1ITPA 2EFOA 2UVRA 3PJXA 1L3TA 2RRAA 4J37A 2E1RA 2DEJA 2XB2D 4YR0A 3D68A 3CW2C 3Q8YA 3M6XA 3NCPA 4B9UA 4OI2A 2E9ZA 4DR2F 2VJVA 1U2FA 4WU3A 1RKIA 4DR4F 4WKRA 4GO7X 3AH6A 3TANA 1OSCA 4J9SA 1Q79A 2XZTB 4OHWA 3K59A 2V8PA 4H54A 1X0FA 1UW9A 2QN6B 3H5SA 5IV4A 3E01B 3KWMA 4DUYJ 5KG4A 3M6UA 2FHJD 4J9UE 2MGZB 3HVTA 4Y0FA 2H65B 4JI0J 2HVIA 1TTHB 1MROB 1UVNA 3UI3A 2NZCA 1RTHA 2HURA 3A12A 3HFKA 4UUXA 4ECSA 1FJEB 3E51A 1UWAA 1KKHA 2Q66A 3J7YI 1S1VB 4LIWA 2J0XA 5HMYA 4Z7YA 2J5AA 3J7ZT 4NLVA 5KFLA 2CYYA 1AW0A 3PCOB 5KG1A 3G6XA 1RYSA 3O1LA 2Q6BA 1E6VA 3V6KA 2KT2A 4GVLA 2RF2A 5KG5A 4S39A 3MEDA 2C2EA 4J9KA 1SL2A 1OY9A 1VQ6S 3BKTA 4ILRA 2VODA 1R31A 4DV0J 5KFXA 1D8ZA 1CJUB 2F4FA 3LALA 1R8CA 2DNLA 2KXNB 4LSNB 4PQAA 3SFUA 2I0XA 1P1TA 3F56A 2XGQA 3IS9B 1YWXA 4OJGA 3OLBA 4YP3A 4C8OA 4MKAA 2KB2A 5D0HA 5C24A 2WBRA 1Q8LA 2BANB 2ZH3A 2VIHA 2DXDA 5L46A 4ID5A 2FHKA 1H6KX 2IYGA 1S4FA 3D2WA 3VLYA 4UOFA 2HNDB 3FK4A 1UA0A 2DNNA 4RL1A 1S0OA 5KFYA 5E33A 3PRVA 4NI2B 3MPYA 2PGCA 1A6LA 2KI2A 3UWTA 1TFYA 1N6QA 1R27B 4IQMA 2EPIA 2LP4A 4N41A 3D6TB 5H9EJ 3E2EA 2W9CA 4DL0C 3OSNA 3H98A 3IRXA 4ZIVA 3RR8A 3G6ES 5EN1A 4OL8A 4DN0A 1C4AA 3KLFA 1IKXB 3LWLA 4X4RA 4NXMF 2IRXA 2XY6A 2CQHA 4DX5A 4W90B 4ZVPB 4FKYA 1O6XA 2V4JB 4ZVGA 1QJHA 3G8TA 1QVFR 3KG4A 4ZVQB 2R8HA 1NSPA 5KFIA 4P75A 1RYRA 3OFGA 2HZCA 1L3KA 3AOAA 3LGHA 4IFYB 4OX9F 5D78A 1N5TA 2BJDA 1KFSA 4ED2A 1XMOF 1JK9B 3EZ5A 3C14B 4LJMA 3ILIA 5E0OA 5IC4B 4U7CA 2PA3A 2HBZB 1EIYB 2GS8A 3KJFB 4DV3J 3R5AA 2JJ4D 2ATCB 1UFKA 2GVZA 4WK1A 1N5VA 3BQ2A 3DDNA 2F63A 3DXSX 4IH7A 4QBUA 2GQ2A 1C1CB 1M5PC 1FFWB 2YKPA 5THWA 5E3PA 3HI9A 2FJBB 1Q4RA 2FVCA 4F04B 4URGA 2F8HA 2J9DE 4OV6A 1P9YA 4B3TJ 1WEXA 3BGRB 2QMXA 2IBOA 2RU3A 2B7BB 2XCPA 3AAWB 1WD6A 2RMLA 1V9OA 4F3QA 2LDYA 2WSCC 3N0VA 3FEXB 1GXTA 1OY8A 4PG8A 2ZKTA 1R8AA 1VC5A 2NXEA 1U6ZA 1LW0A 3JXOA 3MR7A 2EC2A 4NLPA 3MFHA 4C8ZA 2MPUA 4DCOB 3KNGA 5JJBA 5IV3A 3H25A 4DX7A 2DNMA 1NJZA 2V4RA 2UVVA 1KQGB 3P45B 1MW7A 4KTQA 2VOOA 4NLOA 4PG5A 4BHQA 1FWPA 3MXHP 1BHNA 2D7SA 2HKEA 4ZDNA 5C42A 4F2SA 3UFCX 1MNEA 2ZBCA 3W63A 2I6WA 2OI2A 2C3UA 1VQ9S 3M1VB 3W5ZA 1S9EB 4V19X 4HTJA 4O3QA 4DR3F 3BJYA 4YN3B 2DO0A 4K4VA 3TEHB 1U1KA 1NDCA 4PCQA 4HKQA 4NA3A 2HFVA 1U48A 3IMQJ 3KK3B 2G1HA 4RPFA 4HH0A 2HVZA 4HI2A 2ZBRA 1ZA2B 2XHWA 4OYZA 3DMJB 4CLLA 2KH9A 2DHXA 3EGVA 3B6BA 3FEZA 3O44A 3NMAA 4OHZA 3BEGB 5KFTA 3CCES 2QIFA 2Y0FA 2YNIA 3LP1B 1G3OA 5A6PA 4GRSA 8GEPA 4C8NA 1UWBA 4OJ1A 3HJFA 1QAXA 4CYUB 3IG1B 2OUGA 3R5DA 4X4NA 4B3OA 2DYAA 4KHPJ 1FJCA 1DBDA 3GFHA 2QGFB 4I6AA 2FZKB 4ECQA 2BE2A 1NK0A 4KPCA 4AOPA 1TL1A 1LWCA 1C0UA 2LQ8A 3E8OA 4O3RA 4IUFA 4O23A 2XYHB 3TZXA 5DDOC 3ZTOA 2PI4A 3FEYB 3R7BB 5IM0B 1K1QA 1ZA1B 4KFBA 1PILA 2MKCA 2O66A 2AKJA 2YNFA 2DB1A 5J1EA 1FJGF 1TP7A 5ETQA 4LFCJ 2QTWA 1Q82T 3BPDA 3R3TA 2KDOA 2MMYA 4K4XA 4WK3A 4JI7J 2FUG9 3KLHA 4P6QA 4S0MA 3DNCA 5DETA 1M90T 3EVOA 3F73A 1S77D 2VFUA 2FGOA 4U8VA 5HMZA 4MKYA 3W2WA 3IBWA 3BN7A 1URNA 4B3SJ 1IR2A 4DDFA 1FWLA 3GG0A 2RQKA 2YWHA 1KS2A 4LQ3A 4M8LA 4OMFG 5L9NA 2R7RA 4GKKJ 2DNKA 2VG5B 3EWGA 3BR9A 1FEHA 1NK4A 2CPDA 1XN9A 5IWAJ 4YB5A 3N6LA 4DV5J 2YY3A 1T0TV 3P96A 3JS9A 1HARA 2YNGB 4WFZA 2WOMA 4X64F 4DV4J 3GFZA 1WI6A 3VVTA 2DNPA 1S1XB 3MM9A 2R2RA 1QLNA 1WHXA 3M32A 2MGZA 3I9V9 3HT0A 3TO8A 2AYBA 4M63A 1FE0A 2XMVA 3RBEA 4DV1F 2PC6A 3OUYB 2C2DA 3TZWA 1HQEB 4F02A 3ENWA 3VGTA 2G0IA 2ZDPA 3MEGB 1MROA 4NCGB 2LQBA 3FFIB 1UTAA 3CD6S 3CJRA 2KN4A 2RIJA 1TVRB 1X4DA 1Z2LA 1S1VA 4OX6A 4NEYA 1S7IA 3D67A 1XNQJ 3QO9B 1QTNB 3NKYA 1U24A 1TKTA 3KG0A 1ZM3A 2MLXA 2QLXA 1OIAA 4CNZA 4F3MA 3JSRA 5LSLA 3EDRB 2X1FA 2HRYA 3MMBA 1HBNB 3CCRS 2N3OA 3VF0B 2DGVA 4O3OA 4DL4A 5F0UA 3CCTA 1F60B 3DGVA 1X0PA 2VBZA 3O3LA 1GX6A 1YHQS 2RSQA 4Q7AA 3CCWA 5GAGU 2LXUA 3DU6A 1GXLA 2DNQA 2AZ3A 4PYAA 2R7WA 2VOPA 1U26A 2ADBA 2AEFA 4P52A 2ACMA 2R9LA 1CJUA 4ILLA 2YKOA 2OAUA 4AL7A 3ZTQA 4JV5F 3DOMB 2EXUA 5D15A 3LP2A 1Q86T 3GJTB 5EWGA 2J6UA 1NH7A 3MDFA 4LR9A 3VZIA 3K7RA 1QUPA 3HPOA 1ACMB 1U25A 2Z30B 2VPZB 3W2VA 5KFOA 3CCVS 3BO4A 3DRSB 2YQ3A 2Z2ZA 4JUZA 2NSBA 3DI6A 3RW7A 2VFTA 4HEA9 1HNZF 1K1SA 2ZD1A 1TMJA 3PW7A 3DRXA 4NRUA 5CZVA 2AD9A 2CPEA 3JAMU 2FJXA 5ITHA 2E5IA 2DY9A 1VDHA 2P5VA 4RNOA 4P2MA 3HLUA 2HK2A 4BS2A 5KFNA 3Q2TC 4HVZA 1R8HA 3R2CJ 1KWMA 2FGCA 2XG8A 3ZTPA 4ECVA 1IKXA 4TQSA 4G1PA 3TNVA 2LA6A 3W61A 3TVKA 2Y8WA 4BDPA 3IXQA 2X3DA 3DGPB 3MR6A 5A8RB 2H5JB 3UPFA 2XY7A 4QWDA 3MPDA 2B5JB 2CZ9A 3HT3A 1VK3A 1VOMA 1YDLA 1S1UA 1CS4B 3HSDA 4MTPA 2IJFA 4HT5A 2HFSA 1XMQF 2IHR1 1FDNA 4NLWA 2GEPA 1VIOA 3G86A 2YKAA 2IVYA 3MM7A 3CJ5A 2HAIA 1F1BB 4NXNF 3C14A 3QLHB 3S7RA 4AYBD 4JYAF 2Z58B 2CXEA 1NMEB 3CCSS 1KVJA 1FEEA 2XSFA 1PBUA 4MIWA 1NJXA 4TU9A 2AJ2A 2UV8A 1FRLA 1RT7B 1XIQA 5K14A 3NOGA 4YDDB 2IM2A 3CEDA 3LPEA 2DJWA 5KG3A 4EBEA 1BLUA 1HNVB 1B64A 3ZZUA 2AT1B 3IWNC 1RT2A 3BGRA 1UKUA 4NZ6A 1C0TB 4ZCMA 3PRBA 3M2VB 1Z2ZA 4ICLB 3KYLA 1LWEB 1QE1B 1I3OB 3AQPA 4FP9A 1FKPA 4XDCA 1FKOA 1YRTA 2LU1A 2M3DA 2MXYA 2W2OP 5HMXA 1TAUA 1SJQA 5DG7A 1HPZB 1CJTB 4DF8A 3D1OA 3C15B 5A8WB 3GIMA 4FF3A 4X66F 2YKQA 3NGRA 2D3ZA 3RTVA 4LVNP 2C3YA 4ZPDA 1W7WA 2E66A 3TAMB 4JV1A 3GB0A 1NPPA 1MU2A 2BJ1A 3VHQA 2M9KA 5HAOA 2BQUA 3KJVA 2ZWOA 1ZAWA 4LRCA 1X8DA 4P2FA 1YSJA 5KFZA 2PDAA 1RT5A 1S5ZA 4UUWA 5E7OB 5EDWA 4PRFA 1NM2A 4GKJF 2O67A 5H9FJ 5EWEA 2DIVA 3DMJA 2VD3A 1M0SA 3C46A 1JB0C 3I5CA 5DQIA 5GADU 2IJNA 3M8YA 3OFFA 3MM8B 2VFSA 3RB0A 3AOBA 1ZTTA 4TYAA 3M30B 1HFEL 1P8GA 5KFHA 2RDJA 1HA1A 5D6GA 3FMBA 3K5OA 4MFBB 3MM5B 2Z2YB 2W24A 2EG2A 5I3QA 3DRYA 2EFQA 3MAHA 3OTOF 3L09A 1F9EB 3N01A 4D3GA 5C25B 2RT3A 3R5BA 1JLGA 4Q0BB 4DFKA 2AX1A 1S49A 4L75A 4X65F 1JLBB 3UN3A 3CGIA 2P2CB 6AT1B 1FRJA 4ZCLA 2ZM6J 2XMMA 3NS5A 4BC7A 3BS9A 2IVFB 2A6OA 2P8IA 1I5OB 1LW2B 4MYUA 5KOWA 4F4XA 1C1BB 4OZLA 4TU7A 3I0RB 2Q79A 2F8MA 2KYZA 1CBKA 1JXVA 3MEEA 5ETTA 1REVB 4DJBA 2GVDB 3IP0A 3UCUP 3TUPA 4PWWA 2HZVA 2G2ZA 2ILYA 3TZZA 1JQGA 3PR4A 3G9CA 2GNKA 1FNOA 3A8EA 4ZN3A 3VGSA 3ZZPA 3BSAA 4FYVB 4DFJA 1LEOA 5BJRA 3PY8A 3DYAB 1YJ7A 3W65A 4ES3A 5EHHA 2WVBA 4B9NA 4CH7A 1S1XA 3SBMA 4LMZA 1C4CA 3FBCA 4CLPA 1HR0F 5IT9Y 5FDLB 3ZZZA 1FKAF 1HQEA 2K1RB 3MEGA 4DV2J 3FFIA 2VA3A 2OPPB 1TL5A 1FK9A 1IBLF 3DLLQ 3R27A 5ETKA 1N5YA 3OHAA 4ZPAA 2V2KA 4KSEB 3L9ZA 3C6UB 3IRWP 3PX6A 2DCLA 4MMOA 3A3NB 4MIAA 1N5QA 5GAHI 1HHTP 1Y5IB 2KHDA 2ZH4A 2ASJA 2MB0B 1N33F 1HBNA 3L7PA 2XMWA 4AQYF 3GG1A 2FJAB 4CLSA 2QC3A 3AFGA 3CC2S 4QU6A 3VKQA 3TZYA 2XLJA 3I5BA 4C8MA 4FXVA 2DHAA 3UR0A 2Z4PA 2DR8A 4WIIA 4ED4A 1VI7A 2POKA 1S0VA 4JBCA 4LSLB 3M8WA 2XZDB 2DRBA 3OR1A 4Z7CA 2OELA 1CLFA 1JLEB 4M1KA 3GCWP 4WXWA 3EJMA 3R5GA 4UF4A 1JKHB 3P4UB 5A2QY 2U1AA 2LXFA 4A8KA 2ZC4A 5KT7A 2R42A 4LF6J 5F3TA 1QSSA 5F8LA 3G8SA 4TY8B 2YKNB 3QRPA 2VICA 1MN9A 2VV5A 2G2OA 1JJHA 3SV3A 4ELTA 3QT5A 1XR5A 4ITSA 4DU7A 2UXBJ 4HL9A 4NEZA 4DR6J 1ZPVA 1UJ6A 2KZZA 3RAMA 1VMBA 3DDIA 2GIRA 4K5RA 1YRXA 3PHEA 3RAQA 2MQMA 4N56A 2V8DA 3BV8A 3AHPA 2ADCA 2WONA 2RDDA 3VTIA 2YNHA 1X4HA 1RISA 1SI9A 2LXIA 4C3LA 2QFJA 3ISNC 2PEHA 4DL6A 2QG9B 3OQ2A 1RAOA 1XNRJ 1SJRA 2NYHA 2RS8A 3JYTB 3GTYX 4R8UB 1UCNA 4NLSA 2LQJA 3IAM9 3QZ7A 3P6YC 1N8RT 1UJ4A 2CDQA 3OTCA 2EI5A 3AD9C 2OH2A 5A8KB 3MTJA 4EWTA 2AMCB 2ZH8A 2JC1A 2B5JA 4LF4F 1S76D 3ENAA 4I2QB 2QLWA 5CYQB 2F4VJ 2G9OA 1FF2A 3ICLA 2IFXA 2HHHJ 1RK8A 3A1YG 4PXDA 4HTRA 1SC1B 2ZNZA 1IBMJ 1UVJA 3QLHA 1VQ7S 1TKZB 3MUTP 3P5BP 1T9VA 3PJ9A 5DLGA 5KFQA 4ED1A 3BH6B 3UVJB 3ZZ0A 3BO2A 3MM6A 3PXGa 5KFWA 3B82A 5CYJA 4TXSA 1VBKA 3C66A 4NASA 5T14A 3I0SB 2ZBQA 2LFVA 4XTTA 3P5TL 3BSCA 2PSZA 1JWWA 1WF1A 1CULB 4YHHF 4YQWA 2HWHA 1FD2A 3RYLA 1IM6A 1WDTA 4M5MA 1C0TA 4ZLNA 4ICLA 3K58A 3OXLA 4DR1F 4CM0A 4E98A 3O2IA 2BW2A 3IFEA 1HD1A 2KVIA 4NA2A 3PKMA 2B6AA 1YG0A 2ZH6A 2CNNB 1FA0A 2HBQB 1IVZA 1HPZA 3VKSA 4ZN1A 1K8AT 2ZC3A 1LV5A 1CJTA 3SI8A 2W9AA 2LEBA 1RACB 4CLKA 2ALZA 4PQUB 1WHVA 1UVKA 2QLFB 3BKUA 3MECA 1RTIA 2MY8A 1QM9A 3AD7C 1Y11A 2DY1A 2R8IA 1U1RA 2Y1IA 4WTOB 1YVFA 4J9VA 3SQOP 1X9MA 1GMWD 1NCLA 3RU0A 4KJIA 1HWJA 1SXLA 4DWIA 5HL7Q 4IDKA 2J0QD 2DD8S 4ZPWR 2N7YA 1KD1T 3CDAA 1FDAA 3NAHA 2RKIB 2IVMA 4A4JA 2GZOA 1JJ2R 4HT7A 3RJMB 1T3OA 4ZPCA 3QBCA 4M5IA 1YQHA 2DCUB 3FZ2A 1GTHA 2FJWA 4ZKAA 3CC4S 1RHKB 1I51B 3H5UA 3D4JA 1UA1A 3MM5A 2DTJA 1S79A 2C2MB 2RNEA 1RQ0A 1HBOA 1NNDA 4O44A 3ADAC 2HFUA 2CADA 1V5VA 1VQPS 2ERRA 4B3RJ 3D6FB 5DS7A 5J2QB 4HACA 1KTVA 1QSLA 5FD1A 5MAOA 2MZSA 5F8GA 2O01C 4YMEA 1QVGR 3I4HX 3P49B 4RW8B 4DG1B 3RGIA 1S9GA 4DSLA 2OTJS 3C16B 2PI5A 3MF5A 1NB7A 1LW2A 1T8EA 3CCZA 3KLIB 4GMKA 3X1LB 2FVQA 2OPQB 4Y2MA 5ETVA 4FXWA 1NHKL 4USKA 3B4MA 5IFMA 3AB4B 2H54B 1AFJA 1Z1ZA 4FF4A 2QT7A 1ZYQA 4R25A 3SIPB 2FY8A 2R8GA 1IN0A 2FY1A 1TL3B 4FBTA 2BJEA 4RW4B 2GMJA 1YJUA 4TLRA 1DTQA 3GV7B 1JXLA 3IBCB 2KM8B 3FQKA 4F0KA 3DYAA 4Q8EA 5DDRC 4ERDA 3RB3A 1R89A 4XPEA 1IXKA 2W9BB 1Y3JA 2FLOA 4IG3B 5FDLA 3UNYA 2K3KA 4RNNA 2FPHX 2K1RA 2UUBJ 3FQLA 5DQHA 4IOAQ 4DR7J 1RAJA 3CD7A 2KRBA 5AJ3F 1M1KT 4YY3F 3FRZA 3C6UA 4B9LA 2DH7A 2HS3A 2AZ1A 2BMBA 3H2LA 4DL5A 3R5CA 2XSJB 2JLEA 2GJ2A 2CJYB 3D3BJ 2CUYA 2GCFA 2KM8C 4RW6B 2DGUA 2QYCA 1OWXA 2P6SA 2E5JA 1WC1A 4CIOA 2EFNA 1U1MA 2L41A 1U6BA 1PO6A 3OJSA 3IC1A 4F4KA 1KQKA 5CYMB 3K5LA 1JMTA 4QQBA 3D6MB 2DK2A 5KT5A 4LRAA 3CCLS 3AXMA 3ZZOA 2VA2A 4WF9Q 1ULRA 4LSLA 4Q2LA 1LFWA 3MEKA 1M5KC 4QW9A 4NWBA 4RZRA 3KHGA 1S6PB 2MDAA 1NJYA 1WOOA 3KMSA 1F5BA 4AL6A 5E3CA 4YB7A 1YJTA 2WW4A 1F0XA 2E5LF 3TQEA 5ADZA 3RBZA 4TY8A 1I1GA 2KKHA 2UU9F 1KOHA 4QYZK 1V3SA 3BZQA 4F8RA 3UW1A 3TAQA 2YPYA 2DNGA 2WVDA 2QX0A 2NXUA 3PX4A 4GO5X 4E2FB 2CNKB 1KSPA 5LMNF 2V2QA 1HNWF 2KHCA 4DR2J 3NEKA 1NBEB 1OO0B 5H9EK 3U1NA 4DR4J 4KGMA 1HW8A 2FC9A 1X4AA 3LW5C 5ETLA 4QWEA 4R8UA 3KOAA 1U7LA 1P9QC 3ZO7A 1WI8A 4M95A 3F44A 3EZUA 3EE3A 4QWCA 4DUYF 1JNRB 4C98A 1HHSA 3C6TB 1NJWA 4JI0F 4C97A 5LSOA 3FDSA 1FNMA 1F2HA 1RT1A 1B7YB 3ISND 4J9PA 1H2UX 3DLEA 5SUHA 2FHMA 5HVHA 1X4FA 4FN5A 2NXJA 4I2QA 1G2EA 4WP8A 2BQRA 1BWVA 2RH3A 5GMKa 1VISA 2G0JA 3LAMA 3ZXWA 2U2FA 3KFWX 3BDPA 4A48A 4U9RA 2O5DA 3DOLB 4J9LA 4HTIA 2GIQA 4RNMA 2VKRA 3EYZA 3KK2B 1X7VA 1UEKA 3CUNA 2Q3PA 3BO3A 3W5XA 1X31C 2ZE2B 2V68A 3R9LA 2W8KA 4N8NA 4GVBB 3I0SA 3Q2SC 3T1YJ 4DV0F 1S7HA 1CULA 2HSEB 3BGFA 3OL8A 5BR8F 2A2CA 2HMIB 1LQ9A 2MZ1A 5F41A 4WFYA 2F1FA 4MIBA 4NCBA 1VQ4S 5GMEA 3MR2A 3CD0A 2H51B 4CP5A 2WW8A 1NO8A 4LFAF 2UV8G 1LXNA 3A8IA 3H59A 3AOCA 3DLHA 1RJJA 2OKQA 2DGTA 1WEYA 2R7OA 1U45A 3SYZA 4RW7B 4OYBA 4K0KF 3M9MB 1HNIA 2JVRA 3KJNB 4ZLJA 3VM0A 2ZEJA 2HHXA 5AXKA 4RBTA 5K9FA 4E8UA 2I5JA 5KT6A 5CXTA 5B0EA 1PCAA 3TUZC 3UR3C 3H40A 1E6YA 2HYIB 3OBIA 3GJRB 2XQCA 4F4WA 5DZ6A 3BKFA 1R6YA 3TEGA 1WC0A 3D0IE 2I2YA 3NMRA 1VRTB 4NLYA 4KY3A 4C11B 3H4DA 1OY6A 2DGWA 4NXMJ 5D3GA 2XNRA 3POTB 1OSDA 1RHQB 1T9XA 1EP4B 3M2RA 1S59A 3D7SB 2W4PA 4J9QA 1ZM9A 2LVWA 2KJVA 3FNNA 1U0SA 1T03B 3Q8QB 1Q7LB 4AXJA 3M6WA 3SCJE 2XWXA 4OX9J 4EZ6A 1X4BA 3QSIA 2JVOA 5C2CA 3KXDA 3JAMY 1OYDA 1RXOB 4DXLA 3OJUA 2R2UA 5HBMB 4KPYA 3DRRB 3OVAA 4WPAA 1FI4A 5CQGA 4N5SA 4JOUA 3OVSA 3D66A 2IBKA 3JQJA 1NPKA 4FYWB 3IWXA 4DV3F 4PWDA 3LO3A 4AT1B 1RWVB 3Q8VA 2GQQA 2NR0A 1IKVB 3CO0P 4ZVUB 3M8SA 4RW8A 4DG1A 3IA0A 4EEYA 2ILZA 2V63A 1H72C 2HWIA 3JQMA 1FTRA 4ZPVR 4IOBA 4K7QA 1U1QA 4ED0A 2L9DA 4B3TF 1SC3B 1KLMB 1HI1A 3KLVA 2B8PA 1FCAA 4V19J 4B9SA 2IAJA 1EETB 3T41A 1VQOS 3SCKE 4QIWD 1T9UA 4R0JA 2HIQA 2BKPA 1S1WB 2B0GA 3FCWA 4K4UA 4AXIA 1CVJA 2WCXA 2UVWA 3HO1A 1TK0A 3GIRA 4LT6A 5CAAA 1YJWS 4P10A 3ILOA 3QGGA 3PO4A 4MK9A 2YWWA 1QSYA 2HHWA 1RB0A 3CWJA 2VQEF 4B9VA 3PW2A 1B3TA 2UP1A 3RR7A 3PEJA 3LPYA 4OYPA 2Q1LA 2XYGB 4I0WA 2W9BA 1H7XA 1SKSA 4IG3A 1RGVA 3C19A 3MTKA 3MAAB 4ER8A 3HCXA 4F67A 2C2RA 2MQ8A 1WKKA 6GEPA 1H2TZ 4CT8A 2HHTA 5D4LA 4KT0C 2YX4A 5A6WA 4DV6F 2IY5B 1YBUA 4FZVA 3HHLA 3M8PA 1U0HA 1BQMB 7FDRA 4K4WA 3RZAA 2Y0SD 3HZGA 3EPGA 2H1YA 3NP5A 1LWXA 4ECXA 4KHPF 2HPUA 2K06A 1B0TA 3PHTA 5LT5A 2XM3A 3QIDA 5E41A 4A8OA 1DQAA 4HH1A 1WG5A 4M5DA 1UPMB 4IR1A 1RAHB 4J90A 2KXHA 1DFDA 1UL3A 1NHVA 3PO5A 3AY0A 1FHTA 4G1QB 3CCJS 2IJRA 1U8WA 1FERA 3H0PA 3T1HF 3PFOA 1S6PA 1SBRA 2L9WA 4XK8C 1S6QB 4A8XA 1X9WA 1UP1A 1B0VA 2GA7A 2Y1LB 1U02A 2Z0GA 1UVLA 3X3UA 3M8QB 4IRCA 3VM1A 5HQMA 1RABB 2UUWA 4KHMA 4X62F 1SH3A 2AJ1A 3K5PA 2VHGA 1VQ5S 3WZ0A 2MHNA 2VG7B 3ITHA 2C3MA 2NXCA 3WIUA 2JSXA 2R8JA 1RWNB 2DR6A 4IH6A 3H2UB 1NZ8A 4Q5VA 5D4PA 1S9FA 4XDDA 1SUQA 1VHFA 4PXEA 5IWAF 4NZ7A 3CB4A 2AP6A 2KG0A 1TQLA 2QMUB 1FE4A 1RTZA 3W8GA 2F5GA 1PYTA 2HGMA 2XI3A 3NG8A 5KG2A 4C9DA 3NRBA 1NKBA 2CVIA 2HNYB 1FXDA 2OP5A 3D6HB 4DV1J 4CH1A 4DLGA 1YTYA 3M4XA 2CAJA 4RR5A 1T9YA 5F9NA 2WBMA 2DXFA 5L1KA 2PEBA 2IDLA 4NE9C 1VLOA 3TAPA 2YQ1A 4OYOA 3BBBA 4IRDA 2GIFA 4ELUA 2AWZA 4RWWA 1AT1B 4K5SA 4FPRA 1LWFA 4F4ZA 1FRIA 3AA9A 3OFEA 4R0EA 3JB9k 3K89A 1X4EA 1RSCA 1UEUA 3EGWB 2EW9A 4ECRA 3O8WA 1R0AB 1JLFB 3MPUB 2CWXA 2QA4G 1IWGA 3R1LA 6FDRA 2GC8A 1S6UA 1NDPA 4NLRA 2XGPA 3GLJA 3T19A 4ZJOA 3CE8A 4J9NA 5CABA 3I87A 3SDEB 2PE8A 5A2QU 1KRPA 2JHEA 3RW6A 4JV5J 2AU0A 3LF0A 3CT9A 4KAIA 2OPRB 8ATCB 2XNQA 2UUAF 4CO2A 1K44A 4LBHA 3EGNA 4K50A 4UY8T 1BGXT 4JB8B 2HAFA 3HDSA 1HBUB 1RA6A 4HHHA 4DL2A 1NK9A 2DO4A 1XJWB 3BREA 2CNOB 3I32A 3ZNUA 2EBEA 5DM6Q 1WC3A 1AZSB 3A3PB 1UETA 3W62A 2FLNA 1AA1B 2GGPB 3R2DJ 4I56A 1PAUB 4RUCA 1JLAA 3MMAA 4QOTA 2XS2A 2WTFA 3Q24A 3TUJC 3GU0A 3TRGA 5DGBA 3FUYA 2J7UA 5DDQC 1WSRA
chains in the Genus database with same CATH topology
5KFGA 5I3QA 3DRYA 4B17A 2UXBF 3MM8A 2X51A 2ZZNA 4DR6F 4OZ0A 2Z8QA 4ZHRB 3ULHA 2EFQA 4KQZA 3MAHA 4KGKA 3OTOF 5HP1A 3MD1A 3DLJA 2GGPA 3L09A 3M30A 3MOJB 4LUBA 4Y65A 1TKXB 3N01A 4C11A 3KMQA 2I8EA 4O4RA 3IR6B 4D3GA 5C25B 2RT3A 1BQNA 4EBCA 1R3NA 1DTTA 4MFBA 3R5BA 3QIPB 4FNHA 1JLGA 2M8DB 4Q0BB 4DFKA 4B02A 2AX1A 1S49A 2VQFF 3T1AA 4PPZA 1QY7A 1UFLA 3CF5Q 4PG6A 4X65F 2B9YA 1ZOTA 3MEEB 1JLBB 2V8HA 4FVMA 4JV0A 4IG0A 3CGIA 1GAOA 4OZ5A 5AOPA 4TKTA 1FRJA 4HDGA 1V3ZA 4RWXA 4ZCLA 4EYHB 2V5HG 3B4DA 4UOCA 4NLXA 4ID8A 4ZHRA 2ROEA 2ROPA 2XMMA 3NS5A 2DH9A 4BC7A 2KT5A 3BS9A 1Q81T 2IVFB 3SMZA 1XNRF 2MZQA 1TFWA 3TW0A 1Y3KA 1VQSA 2BRKA 5C25A 1WNEA 1A7GE 3PZPA 1LW2B 3WC0A 2KFZA 2QSWA 5A0YA 4MYUA 4QYRA 5KOWA 4F4XA 1C1BB 4OZLA 3QIPA 4TU7A 3I0RB 4U6PA 2L08A 4Q0BA 2Q79A 3DHXA 1YJNS 2F8MA 2KYZA 3B0HA 1ZPWX 3D28A 1W2IA 3Q8PB 3MEEA 5EX3A 1REVB 1JLBA 4DJBA 4IKAA 1OPZA 4ALZA 3QAEA 3OL7A 1ZZNA 4DMZA 2ASLA 1D3WA 1S0NA 1X5SA 3U1MA 1PC4A 2C42A 2YX7A 2MKKA 2DBBA 4PWUA 2M5YA 3UCUP 3QPIA 4H4KA 1MWYA 5B0BA 4R5PA 2XS7A 1GNKA 2MQPA 1C1BA 3GWCA 4HDHA 5KOXA 3I0RA 3DXBA 5KAKA 1SIWB 4OLPA 2ILYA 2HHUA 3OR2B 5KFCA 1NZAA 1SQEA 4IO1A 2V0NA 3JSMB 4DF4A 3DLKB 2XY5A 2F4VF 2VC1A 1REVA 3PR4A 1HWIA 1I94F 1IR0A 2ZOMA 1U1LA 3G9CA 2HHHF 4OHYA 3PEHA 2GNKA 3SQGB 1VK8A 1FNOA 3TVYA 4CO5A 4CCHA 1TV6B 2GHPA 4OZ1A 1XBWA 3A8EA 3HHDA 3EXYA 1JXEA 3ZZPA 3BSAA 3TOQA 4DFJA 5BJRA 4YR2A 3OXGA 3PY8A 3DYAB 5E2QA 2HFNA 2CKWA 4K59A 4ES3A 1DQ8A 1VGYA 2BACA 4OHVA 5EHHA 2N4DA 4CQ1A 4B9NA 4CH7A 2RF2B 4WFXA 1IKYA 3O5TB 4HYKA 1S1XA 3OR2A 5KT2A 2ZJRQ 4H4KC 1FK9B 3DLKA 2RQMA 3N5BA 3V81B 3MEDB 1N5YB 3GE9A 3MGJA 2J6TA 1KQSR 4N77A 4J9MA 1U1NA 4LMZA 3OW2R 1UMJA 3CJ0A 3DRPA 3RRHA 1HWUA 2JFKA 3QGHA 2H9ZA 4L72B 3SQGA 5KFDA 3QWUA 3HVRA 1C4CA 1TV6A 3PW5A 2PIIA 1HR0F 5IT9Y 1KTQA 1UJ5A 5G4DA 5FDLB 2VPYB 1KQFB 3ZZZA 1D9AA 2JFDA 1FKAF 2D9PA 3HKWA 1HQEA 2VBXA 1EETA 1KVIA 2IC3B 2K1RB 1URRA 3MEGA 2RQ4A 4K4SA 3OXFA 2M7SA 1TL4A 4Y2IA 2EK6A 3JTOA 1FXRA 1APSA 3FFIA 4LVOP 2VUGA 1LOUA 3NCQA 4DQQA 2VA3A 4OI0A 2OPPB 3NAIA 1TL5A 4UW2A 4ZCKA 2FC8A 4WFNQ 1FK9A 1IBLF 3DLLQ 4DSJA 2HLUA 2AF6A 3R27A 1H7WA 1N5YA 4FF2A 3CDWA 4ZPAA 1UFWA 3M6VA 3OHAA 3KLGA 2V2KA 6FD1A 2QZ8A 4DSIA 3T5LA 4GEPA 4NX9A 5KFJA 4KSEB 4OI1A 3NGKA 2F8EX 3GIJA 3C6UB 3IRWP 3PX6A 4OLOA 3T5KA 4B3MF 1GTEA 2DCLA 4MMOA 5GAEI 2NZ4A 3OPKA 3BGUA 1DAXA 4EU0A 4K4YA 5CCLA 2IC3A 2W7OA 3SZ2A 4MIAA 1N5QA 5GAHI 1HHTP 1Y5IB 2N7CA 1HQUB 2KRRA 5L9XA 2KHDA 2ZH4A 2VL1A 3I96A 2ASJA 4UQTA 2YWGA 2MB0B 1N33F 1HBNA 3L7PA 2OPPA 2VH7A 2XMWA 4F26A 4PXBA 4AQYF 4ILMA 2I9SA 3GG1A 1IKWA 4PXCA 4ED6A 2FJAB 2XMKA 4ZVFA 2M8HA 5B0FA 3CC2S 3OR1B 4ED8A 4QU6A 1A9NB 3VKQA 4ID5B 4WTYA 2XLJA 1VRUB 2OSQA 4BBYA 3I5BA 5DRKA 4EO8A 4C8MA 3H5YA 4FXVA 2DHAA 5KFBA 2RS2A 4F25A 4HHJA 2MZJA 3HXMA 1S97A 3LGNA 1SKWA 3UR0A 1N34F 2GW8A 1IBKF 1N5SA 2Z4PA 3CJKB 5E3AA 2CQ3A 2HG4A 2M70A 2DIUA 2XWYA 1YJ9S 1RTDA 2DR8A 4WIIA 3C2PA 5T7LB 1HQUA 2K3IA 1KLNA 1LFPA 1VI7A 4I4BA 1N6QB 2AW0A 2RUGA 1X5TA 3FZBA 2POKA 1U47A 1S0VA 2NQPA 4DQPA 4JBCA 4LSLB 3OVBA 2RJZA 2DRBA 3OR1A 4QYZJ 1WELA 3GFXA 1VRUA 4RKUC 1GT8A 4NOHA 4X4QA 1CLFA 1JLEB 3N28A 1SH2A 2J9EA 4M1KA 3CTRA 4LF9F 4WXWA 4ZPBA 2DRAA 5F8NA 1V3RA 2JX2A 2LMIA 1N4LA 2I1RA 2MJNA 2W9CB 3I31A 2YKMB 3NBPB 1JKHB 2PA8D 5H1SV 5A2QY 3J80Y 2U1AA 2LXFA 5T7LA 3CPWR 4ETXA 4A8KA 3VKTA 3M9OB 1RT3B 2ZC4A 2D3OR 2F7VA 5KT7A 2VPWB 2CQBA 3MHYA 5G0RA 1VFJA 1BQMA 3TA2A 4LQ9A 5J2MB 3CCUS 4G1IA 3KLFB 1FJ7A 3B8HA 2JOQA 3Q8RB 5F3TA 2LECA 1M5VC 3GV8B 3W3SA 1QSSA 2ZHBA 1JLEA 5F8LA 3G8SA 4TY8B 4Y00A 2ZFHA 2YKNB 4DOZA 2B9WA 4Y3CA 2L48A 5B0GA 2R2SA 3VALA 1VLYA 5F0WA 2CPHA 2MQNA 2VV5A 2YKMA 2HHVA 3NBPA 1JJHA 1JKHA 2OMOA 3SV3A 3K2YA 2WONB 2WHOA 1FVQA 2YNHB 3MFIA 4ELTA 1XR5A 4ITSA 2R7UA 4QR0A 1RT3A 2GO9A 4DN9A 1RWUA 2OIHA 4HL9A 1ZPVA 3OLAA 1CPZA 5J2MA 2E7XA 2OFGX 4OI4A 1UJ6A 2B3TB 5J2PB 2KZZA 1VQKS 4AE5A 3RAMA 1VMBA 4MK7A 5L1LA 2YWEA 1U1PA 2RE1A 5IS2A 4TN2A 5J1NA 4X4SA 3RBDA 2GIRA 2FB0A 4I7FA 4K5RA 1YRXA 3PHEA 2YKNA 3B78A 4ETZA 1WTFA 1FXLA 3RAQA 2MQMA 4WCEQ 4N56A 4NCAA 4O0IA 2V8DA 2X1AA 4O3SA 5K8MA 2VG6B 1PC5A 4ZK7M 3KK1B 3AHPA 2ADCA 2EC0A 2WONA 1IJFB 3VTIA 2YNHA 1X4HA 4CO1A 5HROB 4Q8EA 1MSWD 4WE1B 1RISA 4XO0A 4F50A 1SI9A 2LXIA 5JXSA 4C3LA 2QFJA 4WU2A 2MQQA 3Q22A 1R8BA 3ISNC 2ZJQQ 2PEHA 4MJKA 4EBDA 5B7WA 1H2VZ 4DL6A 4KE5A 3KLEB 3OQ2A 2XLKA 3K8VA 3HF5A 5DLFA 1SJRA 1TZ0A 2QA1A 5B09A 2ZM6F 2RS8A 5KFKA 3JYTB 2ZOFA 4R8UB 4EZ9A 3V6HA 3PW4A 4NLSA 3MPWA 3KHLA 2LQJA 1YJRA 3IAM9 5KFVA 3HHLD 3QZ7A 4CTAB 3P6YC 2VG6A 4ZCIA 1UJ4A 2CDQA 2MHEA 3KK1A 2D3UA 1PGZA 1N8RT 1R8PA 2LKZA 3OTCA 1RT6A 2CQPA 2EI5A 5HROA 2NLWA 4OFZA 4WE1A 2AJ0A 3N6NA 4URQU 1M5OC 1S1TB 2ZHAA 1NH8A 4MH8A 5EX0A 5C5JA 4ELVA 4AFFA 2OH2A 4X4TA 4XPCA 2D41A 4L3NA 5KT4A 3VAIA 3CDEA 2KJWA 5A8KB 5KG0A 4FS1A 5D8HB 2MQOA 3MTJA 4EWTA 1ZBTA 1L3SA 1Q78A 2JC1A 2ZH8A 1WACA 2B5JA 3JYTA 4C0HA 4LF4F 1S76D 1SJ1A 3DM2B 4Z37A 2HW3A 3BGLA 1JNZB 2FVSA 4I2QB 3PX0A 4QCLA 4CTAA 2QLWA 2RRBA 4KBIA 4OIXA 4QIFA 5CYQB 1K9MT 2FVPA 2G9OA 4IFVB 1RP5A 2OPSB 4A8YA 1JX4A 4C4WA 1HMVB 1ZETA 1FF2A 3ICLA 3MM6B 2IFXA 1SJ3P 4KV8B 3PIPQ 1RK8A 3V6DB 3A1YG 4PXDA 1WF0A 4HTRA 2CIMA 4N76A 2ZNZA 3VQTA 4E0DA 1F5AA 2R2TA 5J1PA 5A8KA 2CQ2A 4DFMA 2ACYA 1Y5NB 4QIVA 3IAS9 1RTJA 3QLHA 3VR1A 5L1JA 1UVJA 1VQ7S 3RAXA 1TKZB 3LH2S 4BWJA 2VBYA 3MUTP 3DM2A 1G6BA 2XLIA 3L3CA 4WKYA 3V4IB 3THPA 3CJ3A 5DLGA 4ZPTR 5KFQA 4PG4A 4ECTA 4ED1A 5CYQA 1Q8BA 5I3UB 4DR5F 4I6YA 4FVCA 3ZZ0A 2OPSA 2YH0A 3BO2A 3KNAA 4HLBA 4ECZA 3MM6A 3PXGa 3HP6A 5BYRA 1L5UA 1GH8A 4S3DA 1N56A 3V6DA 5EWFA 4DLEA 3P3DA 5KFWA 3MMCA 2H5EA 3B82A 4NLUA 5CYJA 4TXSA 1NK6A 3LP0B 2CVEA 2V9WA 3C66A 2CQGA 4B9MA 2AYGA 5T41A 5T14A 4MYTA 5J2NB 3I0SB 5C42B 1TKZA 4A8SA 1JLCB 1SV5B 3P5TL 2FDNA 3BSCA 4C0OC 2PSZA 4ECUA 1JWWA 2IM3A 3PR5B 1HD0A 4BC9A 3M2UA 4KRWA 4O4GB 4DV2F 5I3UA 1WF1A 4YHHF 3B0MA 1H98A 1VC0A 4YQWA 2EVZA 4JI3F 2HWHA 2LLZA 2MY7A 4B9TA 1FD2A 3C3LA 4QWAA 3RYLA 4NLTA 2B6AB 3LQVA 3LP0A 4ZP7A 3L7OA 4K4ZA 1C0TA 3CD5A 2APOA 2COLA 2R7XA 1H0HB 1RA7A 3ZC4A 5J2NA 2CZ4A 2W8LA 3HHEA 4ICLA 1NRKA 2XO7A 1FDBA 1JLCA 1UEVA 3OFHA 2AOPA 3K58A 3OXLA 4DR1F 4RW9B 1FRKA 2HHPA 4DSEA 3S8SA 4E98A 2WSEC 2IMWP 2C3PA 4N47A 1YGYA 4QPTA 2UUBF 4NA1A 2NPFA 2LYVA 5U47A 2JRSA 3O2IA 2BW2A 3IFEA 1R0AA 1HD1A 2PD1A 3HX9A 2KVIA 4NA2A 3UQSA 2ZZMA 1F5CA 3PKMA 3MECB 3TYTA 3CSKA 1RTIB 2HRUA 1YI2S 2AJQA 2NYIA 4DR7F 2B6AA 4Y2AA 1YG0A 1BY9A 4XIUA 3N79A 2OMLA 2ZH6A 3G6VA 1FA0A 1D9FA 3WC2A 3T9NA 1UVIA 4EGLA 4KB7A 3VKPA 2KG1A 1HPZA 4ECYA 4CO3A 3VKSA 2EFPA 4H4OB 3DFEA 4CNYA 4TYBA 1K8AT 3QGIA 5LXRA 2ZC3A 1LV5A 1IQTA 4I69A 2P9GA 1MWZA 3SI8A 2W9AA 4RW9A 2YX1A 5FIIA 4ES1A 2J9CA 2DNZA 2LEBA 2GMHA 3DOKB 1LXJA 1YRUA 2L9NA 3N6MA 1UWBB 2ALZA 4PUOB 2LEPA 5I42B 4PQUB 5GAGI 1WF2A 3DCAA 2QA2A 1WHVA 2L3MA 1UVKA 4EYIB 2AGOA 1T7PA 2DNRA 2HNZB 3MECA 4IDKB 4S3EA 1RDRA 1RTIA 1WWHA 2DR5A 4OJ3A 3UE2A 1XERA 2BZ2A 2MY8A 4KO0B 4O3PA 4Q43A 2CPFA 1KFDA 3G8QA 1QM9A 3AJ2A 4IH5A 1YIJS 5F9LA 4G3IA 3OL9A 2GHWA