2XSJA

Structure of desulforubidin from desulfomicrobium norvegicum
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
436
structure length
436
Chain Sequence
b'AKHATPLLDQLQSGPWPSFVADIKEEAERRHSNQDNVEYQIPVDVCDDLLGILELKYSDGTTHWKHGGIVGVFGYGGGVIGRYCDQPQMFPGVAHFHTVRVAQPAGMYYTTDFLKQLCDLWDMRGSGLTNMHGATGDIVLLGTTTPQLEEFYFELTHKMNNDLGGSGSNLRTPASCLGDSRCEWACYDAQELCYQMTQEYQDELHRPAFPYKFKFKFDGCPNGCVASIARSDMSFIGTWRDDIRIDQEAVAAYVGGEIQPNGGAHSGKDWGAFDIQKEVIDLCPTECMWMEDGKLQINNRECTRCMHCLNVMPRALRIGNDRGLSILVGAKAPILDGAQMGSLLVPFIKVEDPYDEIKEIIEGIWEWWMEEGKNRERLGELIKRQGLAKAIAAVGLTPVPQHVMEPRHNPYIFWKEKDVEGGWDRDIADYRKHHQR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SULFITE REDUCTASE ALPHA SUBUNIT
molecule tags Oxidoreductase
publication title Structural Insights Into Dissimilatory Sulfite Reductases: Structure of Desulforubidin from Desulfomicrobium Norvegicum
pubmed doi rcsb
total genus 119
structure length 436
sequence length 436
chains with identical sequence D
ec nomenclature ec 1.8.99.3: Transferred entry: 1.8.99.5.
pdb deposition date 2010-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01077 NIR_SIR Nitrite and sulphite reductase 4Fe-4S domain
A PF03460 NIR_SIR_ferr Nitrite/Sulfite reductase ferredoxin-like half domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xsjA04
3.30.70.2500 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2xsjA02
3.30.413.10 Alpha Beta 2-Layer Sandwich Sulfite Reductase Hemoprotein; domain 1 Sulfite Reductase Hemoprotein, domain 1 2xsjA03
5CHCB 3HKZD 3MM8B 2V4JA 7GEPA 3MMAB 1FERA 2O01C 2VPZB 1PC4A 2PDAA 1H7XA 2FDNA 3B0GA 4HTRA 1G3OA 2WSFC 3MMCA 1H98A 1BLUA 3EUNA 2VPWB 1IR0A 1ZJ9A 1ZJ8A 3MM7A 3VKQA 5BYSA 2WB1D 3VLZA 1F5CA 1Y4ZB 4OV1A 4G39A 4KT0C 3B0HA 4S3CA 1KQFB 3MM7B 5BYRA 2WSEC 4S39A 2C3MA 2ZVSA 2Z8QA 3MMAA 4XK8C 2VKRA 4OMFG 3C8YA 5FD1A 2AOPA 1SJ1A 1SIZA 3MMBA 3EXYA 2PA8D 2V2KA 3OR1B 1K0TA 1BD6A 2C42A 3LW5C 3IR6B 1C4CA 1FRHA 1DFDA 1H7WA 4L6V3 1DAXA 2FD2A 2C3UA 3PNIA 4GEPA 1FEHA 3VM1A 1FDBA 2VPXB 1DURA 1A6LA 7FDRA 4S3BA 6GEPA 1C4AA 3OR2B 5AOPA 1F5BA 4AOPA 2GMHA 3VLXA 2FJDB 3IR5B 1XERA 3MMCB 3NOYA 3OR1A 5E7OB 3GEOA 4S3AA 3AOPA 3MM6A 7FD1A 4XDDA 2WAQD 4AYBD 4ID8A 5GEPA 3MM5A 1RGVA 1HFEL 2Y0SD 1B0PA 5L8RC 1AOPA 1VJWA 3B0NA 2FGOA 1ROFA 1BQXA 3MM8A 2FJAB 4DHVA 2IVFB 1CLFA 1Y5LB 4S23A 2GMJA 1R27B 2XSJA 2AKJA 1G6BA 1JNZB 2XSJB 4S3EA 1PC5A 3VM0A 1FF2A 1B0VA 1JNRB 1BC6A 3VKTA 1GTEA 4Y28C 2PMZD 3VLYA 4RKUC 1FRKA 3MM9B 1F2GA 2FJEB 3B0JA 1IQZA 3MMBB 4S38A 1KEKA 3B0MA 1GAOA 1SIWB 1JB0C 1Y5IB 3IR7B 6FDRA 1FRXA 1FDNA 2C3PA 6FD1A 1BWEA 1B0TA 2WSCC 1Q16B 2V4JB 3OR2A 1FRMA 2C3OA 4YDDB 1FXDA 4CI0B 3MM6B 4S3FA 2FJBB 1GTHA 1AXQA 1GT8A 3EGWB 5CH7B 1FRIA 5BYQA 3VKPA 1D3WA 1FTCA 1FXRA 2C3YA 3MM9A 4XDCA 2GEPA 3VKRA 1FRLA 1H0HB 2Y0FA 4G38A 3GYXB 1FD2A 1KQGB 2UZAA 1FRJA 4S3DA 3VKSA 2VPYB 1FDDA 3MM5B 1FCAA 1Y5NB 3B0LA 4G9PA 1WTFA 1FDAA 8GEPA
chains in the Genus database with same CATH superfamily
2HFVA 2BR0A 4RLEA 4O0IA 2OD6A 2V4JA 2YKNB 3R3TA 1C0UB 3R97A 4WZQA 4B9LA 2HVIA 3UDEA 1FK9B 2YNFB 5D0GA 3DOLB 2J8AA 2AIRB 2DH9A 4TKTA 1KNZA 3GONA 1JLEB 5ETOA 1IUJA 1EQ0A 1M5HA 2W2MP 2P6SA 4PKDB 2J0WA 2KM8B 3PRDA 3B0GA 2BE7D 2IC3A 3MMCA 2F63A 3PIPQ 3SIPB 2J9CA 1BLUA 3FJ2A 4CTAB 2CJQA 4DCJB 5K8MA 4LF6J 3JQJA 1IBLJ 2IBKA 5C25B 2J6UA 1X9SA 4DPTA 1XTZA 3EGVA 5HJXA 4WFAQ 4O3QA 1TKTA 1KTVA 3AD9C 1S10A 1KQFB 1K47A 5KFLA 4X4NA 1TUWA 1YJUA 2C2MB 2M88A 2C3MA 1S59A 2ZVSA 3ETOA 2PE8A 3DN9A 3EPGA 1MWZA 2BJ9A 4RZRA 3DLHA 2WW8A 3HULA 4Y34A 4Q8FA 4O44B 3GV8B 4RWXA 2G1HA 3DCAA 4WFZA 4RO0A 4ZHRA 2RDIA 3AA8A 3GIJA 1R0CB 3T5JA 4H4OB 4PG5A 1QY7A 2CQDA 3HP6A 1XMBA 4NI2A 4P73A 1B4SA 4DL0C 1OIAA 2Z2YB 4KGMA 4WU3A 2R8HA 2ZM6F 3B82A 2K06A 2OD4A 1N34F 2IFXA 3FSXA 3GSDA 5IXUA 3M32B 2E66A 3DM2B 2PD1A 3FRYA 3ELHA 3MAHA 3MR7A 1WG5A 2WONB 3TI0A 4OJHA 4W90B 3CGIA 2F1FA 4A8OA 4KE5A 3KLGA 3G87A 1ZETA 4W4MA 2E5LF 3GTYX 4DV0F 1C0UA 1XBWA 3W60A 2CQIA 2G13A 1W2IA 2KJWA 2B5JA 1UZHA 3IS9B 1P1TA 2R7VA 4WJBA 2DT9A 1O51A 3FQLA 5KG4A 4LR9A 2ZH2A 3R7BB 5AJ3J 1UVKA 3PTWA 5J2NA 4KGXB 4ATNA 3FNNA 5IC6B 4K4XA 1NDLA 4PYAA 3N0VA 5K5MA 4CM2A 1U45A 3B0NA 1MMLA 3CCWA 3OXLA 2J9DE 2R7WA 1SUQB 1EAYC 1TZ0A 3GG0A 1RWMB 4J7CA 1X4EA 2CJBA 4U8YA 5HVGA 4PQUB 2BOPA 3MUVP 1FKOA 3LOUA 4WP8A 2WOMA 2QA4S 1FESA 3RAQA 3IM9A 4PUOB 3OXGA 4KGZB 4OZ3A 4Q5VA 3HHLB 3LUYA 5HP1B 1GNKA 1UFLA 2XI2A 4LF5F 3VKTA 1F9FA 1FE0A 2E5IA 3EDQB 5JVGQ 3KDOA 4P9SA 1VQMS 2OJ3A 2DISA 4DLEA 1B7FA 2YPYA 1VQPS 1S4EA 2ERRA 4N56A 3VGVA 2KFYA 4QW8A 5HMYA 3VAFA 3MR6A 2VICA 3AY0A 3CCUS 3HHLD 3G4SS 2HNYA 3H2LA 5DZ6A 3A12A 4UY85 1UJ4A 3OSNA 2EK1A 1BWEA 2CPIA 4U7CA 2FVSA 1SH0A 2RRNA 2P9EA 1FJGJ 2ZUGA 2ACMA 3TAMB 4WTYA 1Q86T 1VQ4S 2WONA 2B7BB 5DG8A 4K4WA 1TTHB 4OYWA 3U1MA 1RKJA 1S9EB 3KYLA 2GEPA 1UJ6A 2KZZA 3QRPA 4YB5A 1XNQF 3T3FA 4B9MA 3OL8A 4NCGB 3V6JA 2B7CB 3IN5A 4I4BA 2D69A 2VFRA 3H0PA 2VIHA 3AH6A 2AEJA 2AF6A 2IMOA 3PJWA 2UP1A 4NLRA 1TKZB 4IOBA 5CCLA 1SB6A 2J9EA 1U1PA 1RJJA 2RHQB 2AP6A 4UOGA 2DPJA 1YG0A 1YGYA 1EIYB 4C7QA 2OUGA 2XS2A 3RU0A 2U2FA 1VRUA 2ZJRQ 3HHKA 4JI1F 1N33J 2FC8A 2GAGC 1FFGB 5MAOA 4MK7A 1GX5A 1FTRA 5D4PA 2ALZA 3BZQA 3BBFA 3OL7A 2I0XA 1WC0A 3WX8A 1BQNB 2FHJA 2QSFA 2UV8A 3MF5A 4OZ1A 2B8PA 4TN2A 4PZVA 1HQ2A 2ROEA 4F26A 5BR8F 1VYAA 2E1MC 4USIA 4FF3A 4WF9Q 4DV7F 2P6TA 4ZS6A 4OI0A 1B7YB 2V5HG 4HDHA 5KFSA 2OI2A 4DL6A 5CA5A 4U8VA 4NLQA 2L9WA 1T05A 2OSQA 2AU0A 3FSYA 9RUBA 1LQ9A 1HNZF 1BQMA 2F65A 2QA1A 2QLJB 2H51B 1RLCL 4ZVRB 2Z0GA 1HWIA 2UUWA 4CLFA 1OSDA 3HKWA 4ALZA 1N36F 4B3TF 4E0DA 3IP0A 3A3NB 2IDLA 2DH7A 4ZVPB 5THWA 4DR3F 4NLPA 3F73A 1YRUA 2EBGA 3N6NA 1RTJB 1WC4A 1WHYA 1VK8A 4IH7A 2XBPA 4LF7J 4RNMA 4MIBA 2ZNZA 1IR1A 4PRFA 1RWVB 4M95A 3FEZA 5J2PB 3T6BA 5HQLA 2XLIA 2HZVA 1K1SA 3G2XA 4NLUA 3SV4A 3R6LB 1PG5B 3BN4A 4XDDA 3CD0A 2QYGA 2MHEA 3SYZA 5A6PA 4M5IA 1B0PA 3I56S 3CO9A 3M2UB 2MQ8A 1VJWA 1ZM9A 3M30A 3CJKB 5EHHA 3MGJA 4KH1B 2H48B 1LWFB 5A0YA 2ZH9A 3CDBA 1D09B 1Z2LA 3FDSA 2VB6A 2X1BA 4ID5B 4JP8A 2QGFB 3NS5A 3CDAA 4P6QA 4S23A 2NZCA 3TWZA 1Y11A 2BW2A 1OY6A 3J80Y 3NEKA 2CNNB 5U47A 2NR0A 2BKNA 2H9ZA 3VAHA 4ED3A 1C1BB 4RU9A 4CH1A 1N0VC 4L74A 1SKUB 1WHXA 3H20A 1S1UA 1VC5A 4NLGA 4IO1A 1BQMB 1NU4A 2ZC4A 3MMBB 3WX4A 3BGRB 4L73A 5KT2A 4K0KJ 4X66J 4PCQA 2OEMA 4PG4A 4DXLA 4C2MA 2BKPA 3EE3A 2XLKA 5HROA 1QAJA 2WVBA 1FDNA 1X8DA 2R4FA 1TMMA 3JQKA 4J9LA 4N7TA 1VQSA 2OH2A 2ZDPA 1B0TA 3CTRA 2AJ0A 3O44A 5C7PA 4ZA1A 1FHTA 3DKDA 5HROB 1R0AA 4YDDB 2F40A 4NMLA 4E2FB 3UFCX 3SQOP 1GX6A 4DG1B 2FJWA 3BR9A 2BJ8A 3GPAA 3PYGA 4Y2IA 4KY3A 3R2DJ 2XSFA 2ZFHA 5L1KA 5J1PA 3G6VA 3CCES 3EZUA 3GYXB 2VASA 2YPZA 4KB7A 1YJVA 4M5DB 5KFIA 2XG8A 4RNHA 3V5RA 2Y0BB 2D3OR 3C66A 2CPJA 5J2QA 4DV6J 4K50A 3LF0A 3BPDA 1CULB 2BQUA 1FDAA 1TL1A 4KKOA 2FVPA 4Y6IA 4I1TA 2DHSA 1WI6A 2LFVA 2B43A 1RE1B 3HD1A 3JSYA 2QLFB 1Q79A 2FVCA 4HT5A 2LECA 4FF4A 3DI6B 2MLZA 3CJ0A 1EETA 2CFXA 2HZAA 3VCDA 2R9LA 3QSYB 3I55S 4ELTA 2VJUA 5LMUJ 3MTJA 3GP9A 5FDLA 4IRDA 3CUNA 5H9FK 2D3O1 1NBEB 1XMQF 2YWGA 1GEHA 4CTAA 1YJTA 2P2CB 4DV5J 1ZJ8A 1JMTA 1HW9A 2HPUA 2OMLA 3DLKB 3ENVA 1NK7A 3PXGa 2FY1A 2ZKTA 4HACB 3VVTA 3R5DA 3OUYA 4LF8F 2QL7B 3MHYA 2VUGA 1YQHA 2BA9A 1SC6A 3QT8A 4PPZA 4DL3A 1NSPA 2XWYA 1GH8A 2IYGA 4O4GB 3H4DA 2GJ2A 5C24A 1I94J 4ECRA 2J76E 3MMBA 2ZH4A 1S1TA 1OO0B 4J9QA 1KQSR 1BE4A 1TKXA 2E5JA 2C42A 4H54A 3SBMA 2KB2A 2Y3YA 3KFWX 1KDNA 4PABA 4ZHRB 1IWGA 5CZXA 5C42A 3OHBA 2HHSA 3CCJS 1DFDA 2QC3A 3MUMP 4CO4A 3QLHB 4JI7F 1IVZA 4OI1A 2W9BA 3PW2A 5C5JA 1MMNA 1F3VA 2W4DA 3MEGA 1Q82T 3PHTA 4LF4J 4O3SA 2DNYA 2MQPA 4WFBQ 3BGFA 1N5VA 1UWBB 3QWPA 3FCWA 3KK1A 3D6MB 5L9NA 3PHEA 2ASJA 2V68A 3VLXA 3SSQA 4NI2B 1M1KT 4C8YA 2E7XA 1Q95G 3IBCB 3W5ZA 2GQQA 5DQIA 3BO4A 1R6VA 2RNEA 3NGTA 1U6FA 4I64A 5J1EB 2N3OA 1B64A 3AOPA 4YB6A 3R7SB 1S6QA 1RTIB 2E1PA 4ZVTB 1NJYA 1J5EJ 2DYAA 2HSEB 2JNJA 4OHWA 4DV1J 3QT6A 1LW0A 3MEEA 1IBLF 4OX7A 4C0BA 3GFXA 1MLAA 3DRXA 3IWNC 4K8RA 1S48A 3IRWP 2LEBA 2NYIA 4LREA 5HLFB 2HQIA 3QFHA 2RS8A 2AYGA 1WKJA 4PQAA 4LRCA 1TKZA 2Q3PA 2UUBF 3UDCA 1ULRA 1WOOA 4NOHA 2GNKA 5AXNA 1I6JA 3NG8A 3M8QA 1GQEA 1HIYA 5LXRA 1V6HA 3P96A 2L41A 1KBRA 4YP3A 1JJ2R 1FKAF 3DGVA 2CWXA 4KHPF 3R7NB 1LKZA 3NAHA 2DGOA 3J81Y 4C8NA 3K58A 3DLLQ 3CC4S 4LF9J 4HHUA 1XIQA 1T9VA 2BRKA 4H4KA 1KP6A 4R25A 2MHNA 2R7OA 4PG6A 3E8OA 5ETRA 4R8UA 1YRTA 2Y9HA 3H40A 1BQNA 1RYRA 4PWWA 1VQ5S 1HWLA 2WVDA 3HJFA 2HW3A 4DL2A 4ZVUB 3OXFA 1RU2A 1WEYA 1RISA 1F5AA 1YVFA 1N5QA 2VC0A 3LTOA 2ZWPA 5A2QY 2VQEF 4NEZA 2EFOA 3J7A1 4OYOA 2UXCJ 3M1VB 5GADU 2FLNA 3F0NA 2MKHA 3GLJA 2GMLA 3KHGA 4R0JA 4U6PA 1T9WA 1CJUB 1IKWB 4ICLB 5KFPA 4DV0J 1OY8A 2F3JA 1T05B 3RTVA 2QYCA 4JI3J 4UOCA 3GMGA 4OZ2A 1WUUA 1RT6A 2F8EX 4KBIA 2LQBA 3MPDA 4KRWA 2A6OA 1Z4UA 3EGZA 5ETTA 2RRBA 4L76A 5K8PA 1H0HB 2HHHJ 1S7HA 3MR3A 5G4DA 5E0OA 4CM0A 2K7KA 1FKPA 3H5XA 3DLBA 2LQJA 2COLA 1YBAA 2Z30B 3DMJB 4LSLA 2FZCB 3UQSA 1HWJA 5SZTA 2M70A 3T19A 1Q8IA 2IA0A 4M5NA 4Z7CA 4N47A 4JI0F 2XNQA 3KLHB 1QJHA 2CQBA 3ZZUA 1WDDA 1FERA 1T94A 2ZDOA 1TV6A 2WW4A 2EFPA 2AGOA 1SVDA 3DGPB 3P49B 4DQIA 1V9OA 4DLGA 3JSMA 4JV5J 2DNMA 2YBVA 4LQ9A 4CO1A 1H2UX 3DXBA 5KG3A 1WORA 2WSFC 1PCAA 1JKHB 1WELA 5D0RA 4CRJA 3R9LA 1S0VA 5EWFA 3V81B 5BYSA 4DV3J 3W8GA 1AUDA 3IFEA 2OLWA 4KHRA 4YR0A 3G8TA 5KFUA 5HL7Q 4IQMA 4KH0B 4TLQA 1LFPA 3MOJB 3EGNA 2JJ4D 2QO3A 2Z2LA 3FZ2A 3T1HF 1NMEB 4OZ5A 1FK9A 2YNFA 5C2GA 2ZHAA 4MK8A 3KJVA 3ZZYA 5ETNA 3BDEA 4B9SA 5H9FJ 4M5JA 4DR7J 2CUYA 4RW4B 3OLAA 2H4YB 3L3CA 2QZ8A 4I6YA 3WC2A 1CEZA 3X1LB 3MWBA 3M8ZA 3OFEA 3RBXA 1OY9A 3LW5C 2O3DA 5D6GA 2BX6A 1M5OC 1ZAXA 2OTJS 2OPRB 1TFYA 3BQ2A 2CADA 2Y1RI 3GJRB 2GVDB 1RT4A 2ZVIA 4IG3B 1FDBA 1JXEA 3M32A 2GVZB 3CC2S 2KTQA 3JSRA 1Q5VA 3RG6A 2DGUA 1FE4A 2NYHA 4JI1J 4DX7A 2VOOA 2R3VA 4KJIA 4BS2A 3BSNA 4B3MJ 1FJCA 1YBTA 3ZNUA 1UVLA 2DNHA 3FC9A 2WAQD 2X7IA 4OFZA 4EO6A 5GAGI 5CD4H 2RDJA 3ULHA 2SXLA 1S6PB 2BM0A 1ZPVA 3J7ZT 4KC5A 5B0GA 1KRPA 1FD8A 2RF2B 2RKIB 4WIIA 4JUZA 1REVA 4P52A 2XCAA 2DCLA 1UW9A 2FGOA 4WK1A 1ROFA 3QZ8A 4K4TA 2DXDA 1HL6A 4ANCA 4F4KA 2APOA 2G0IA 1CULA 1KKHA 3OTEA 3QIDA 3EVMA 1LK7A 1IKXA 2NSCA 4CZCA 4TU9A 4DQSA 4EFAC 2RAQA 3D67A 1Z2ZA 3VM0A 3TZXA 1YKWA 1S76D 4DX8H 2B9EA 3CJ5A 3NKYA 1S57A 3M9OB 5K8OA 3G9CA 4IDKA 1N52B 3RRHA 4C4WA 3VGUA 4Q2LA 3W9IA 3BDPA 4ZCKA 1O8BA 3W1YC 4I6AA 5EWEA 5KG7A 1QDUB 3NS7B 3POTA 2IIHA 2VF3A 1HHTP 1IXKA 3I87A 2KL8A 4MJKA 3BBCA 2EC0A 2FHOB 3NOCA 1YJ7A 3TJ9A 5A8RB 3TZZA 3C6TA 1U0HA 3VAIA 1U02A 4USVA 4OIXA 1U0SA 2VC1A 2YNIA 3TEGA 2MZSA 1ZYQA 4LVOP 3C16A 3NMAA 2CPFA 3O2IA 2VBXA 2W01A 2CA9A 3X3UA 3TVYA 4S3FA 2D1CA 4DPYA 3D0HE 1PIEA 3I31A 3JQMA 4Q43A 4ITSA 1H74A 4OI6A 5ETSA 1D3WA 1FTCA 1TR0A 3TX0A 1GXUA 4GVBB 5EGYA 4ECSA 1SJ3P 1D9FA 1NHKL 2EFQA 3EX7B 1FD2A 2KN4A 1VBZA 2UZAA 4M5DA 5B0FA 4UY8T 2HHQA 2R2SA 2GCFA 2IRXA 4F7VA 2UUTA 3VKSA 1KLMB 1XK8A 3RB3A 1Y0HA 1KOHA 1WG4A 3DDNA 3B0LA 1HBNB 3VWSA 4ZPBA 4CLKA 2KZMA 1FVQA 1UVJA 5GAEI 2CQ4A 4X64J 2NPIA 2W7AA 3HZEA 3AOCA 2FHKA 1RAAB 2JZ5A 3CMES 4CLUA 3GZ7A 2Q6BA 3HHEA 4GRSA 2AJ2A 2FPHX 1S6PA 2HNZA 3VZHA 2DGTA 1RABB 1JLFB 4X4TA 2QFIA 2VG7B 4UZBA 3BO2A 2ATLA 1VBYA 1NK6A 3TZWA 2HQ3A 2WRMA 3WQPA 1L3UA 4IUFA 4X66F 1MU2A 4OX8A 2GA7A 4P72A 1CJTA 4OI3A 3KK3A 1SJFA 1IJFB 4Y2CA 1RTHA 5E3AA 4B3RF 4DMZA 2XO6A 2BJ1A 4DBQA 5F8MA 4ECWA 4GVLA 3OBIA 3SSSA 4RW6B 2Q6CA 3CWJA 2KT3A 3DOLA 4RBTA 2HHUA 3HFVA 3CMQA 4LSZB 4HYKA 2HRYA 1N5SA 2AKWB 4CCHA 2W9AA 2YH1A 4LRBA 3OTOF 4HLBA 3CSKA 3MECA 3G96A 5F8GA 3QT5A 1P9YA 4NWBA 2BXJA 2FD2A 4J9SA 1JLBA 2KG0A 2CPEA 2LU1A 3KUEA 4LR7A 1X4HA 5KFNA 3DXSX 2OAUA 3CCTA 3GCWP 5IZHA 2PI5A 1CJKB 1KLMA 2BJEA 2HFSA 1F3FA 3LGHA 1HNWJ 2FZGB 2R7QA 4JI6J 3V2UC 1FWLA 2W4CA 1U26A 1U1MA 1YJWS 2RE1A 5KG0A 4ZLNA 1TK0A 2JLEA 3GSIA 5KFCA 3BO3A 3LWLA 1FX2A 4K4UA 4FXDA 2GO8A 5CYQA 2Z58B 2ZBPA 2L08A 3H2UB 4OI2A 3M9MB 1WSVA 4MT1A 1YLXA 1JLQB 4ID8A 1RGVA 2J0XA 4G1QB 3BH6B 4F4AA 1HLWA 2M52A 3M2UA 4QR0A 2NLWA 5IM0A 1NAQA 3JSBA 3IG1B 3CEDA 2M5YA 4OZJA 2QG9B 5HN0A 4LFAF 3CDEA 3KJFB 1N32F 3TUIC 1S1XA 4OYBA 4OJ1A 2QMWA 2W2OP 3GIMA 2C2ZB 5J1EA 1FJ7A 4Z2XA 1A7GE 2GMJA 5GMKa 4WP9A 3D6FB 2A10A 3H59A 2XC9A 3GB0A 2J7KA 3G8SA 3CJ4A 3V4IA 1N48A 3ZTSA 4RW6A 2HVHA 4RW7A 3UNGC 3RBEA 4CT8A 4HTIA 4DFPA 4JYAJ 2CVIA 5ADZA 4K4VA 2MDAA 3HXMA 4GKJJ 1RTHB 2B51A 2XZTB 5L46A 4B3SJ 3P45B 1TL3B 5D4NA 1NRKA 1ZM2A 1WKLA 2VDHA 1Y7PA 2OO4A 1GAOA 3D9BA 3FQKA 4KFBB 5ETKA 4A8XA 1X9MA 4NXMJ 1QSLA 4LF4F 1DLOB 1SUQA 2CQ1A 6FDRA 1C1CB 3FFIA 2GJFA 2C3PA 3M6XA 4IKAA 4IQXA 2LU2A 2NS1B 1DRZA 1U6ZA 1Q7YT 2F9JA 1Q16B 2MZQA 3LH2S 4TLRA 4G6VB 4DR7F 3RB0A 4IR1A 3KJVB 4IOCQ 5M2PA 4QPTA 2UXBF 3GG1A 4ELVA 2DGWA 2DO0A 3Q24A 4UTGA 4EWTA 1RWNB 5KG2A 3MPUB 3K8VA 1U6BA 4DV1F 4ZVFA 1W26A 2MQQA 1UVNA 1FRLA 4FVCA 2VBWA 2UXDF 2R7RA 2XYHB 4DU8A 2V2VA 1R7IA 2YVSA 2ZKUA 4KPYA 2D9OA 1IKVA 3T9ZA 4PPDA 2YX7A 5FIIA 1LEOA 1VJQA 2DY1A 2IM1A 3KK2B 1XNRJ 4FPRA 3AB4B 4L3KA 4ZCMA 3AODA 3G8QA 4DJBA 2XQCA 3FSIA 4FS1A 3PO4A 3KNAA 3CJRA 1WHVA 5KAKA 2XGQA 1Q7LB 4ECUA 5M2UA 4OI4A 4ZP6A 2ACYA 5FLXU 4X84A 3F56A 4O3RA 3E2EA 2G1DA 2NUHA 3OQ2A 4HI1A 3OTCA 1NSQA 3OHAA 2E9ZA 2VZ9A 4HTRA 2ZEJA 3RZAA 4X62J 1FVSA 3NGUA 4DN0A 4AL5A 4Z37A 2VPWB 1TQLA 1RT3A 1RT2A 1UPPA 3MM7A 3Q8UA 2VQEJ 3MEDB 3DOKB 4QIFA 1F60B 1F9EB 2R7UA 1J27A 3DGPA 3Q23A 3CCMS 1B70B 2JVRA 9ATCB 3B0HA 1AZSA 2JL9A 1RTZA 2WOMB 3JYTB 4OHVA 1NKCA 4OHZA 3M8YA 1HMVA 4O4GA 1QUVA 4QR2A 3AXKA 4EZ6A 4I6WA 3GIIA 1UMJA 3CCVS 3HT3A 1JX4A 3LANA 2W24A 3OR1B 5DRKA 4PYDA 3RB6A 1H3DA 3H8YA 4IDKB 2DD8S 3T1YF 3DLGA 1RACB 2QV6A 2VD3A 1RP5A 5EUHA 1GMWA 2V63A 3DLKA 4WYLA 4XAKA 3IAM9 3H5YA 3KG0A 3C6UA 5CCMA 1LXNA 4N8NA 1HQEB 1VGYA 3HVWA 1HPZB 1GMVA 3S01A 5DDQC 1NPKA 1SL0A 1LXJA 3ETMA 3GYNA 4F2RA 3ILLA 5L39A 5AOPA 4A8MP 1NK9A 4AD6A 4NPOA 3GE9A 5LMNJ 1EP4B 3QT7A 1QTNB 1RWKB 1LK5A 1BUXA 2IYIA 2Q43A 4AQYF 3FZBA 3MEKA 4ED0A 3KMQA 2RJZA 1S0MA 1LW2B 1Q8KA 1JWWA 1RT4B 5SUHA 3HFZB 3CIZA 1PYTA 4DV2J 2QL9B 1UP1A 4OYPA 4KAIA 3LAKA 2F9DA 2RU3A 3RW6A 1VRTB 1AOPA 1WC3A 5MLCV 4ZJOA 2YNGA 3B6BA 3FMWA 3QO9B 4NRTA 4OX9J 1NHVA 4MIAA 2W2NP 3D28A 5CAAA 1RBAA 4DU7A 4DX5A 3L09A 2FGCA 1YI2S 3T1HJ 2PEBA 2HYIB 4MAKA 3MEDA 3MOZA 4DOZA 1KC8T 2CQ3A 2KFNA 3BKUA 3BR8A 4ILLA 1ZAWA 3C46A 3UVJB 5KFEA 2IRUA 5J2PA 3TEHB 2M8DB 3ICLA 2AKJA 1IKYA 4JI5F 1AZSB 1RAEB 4NEYA 1T7PA 1JNRB 5KFDA 4A48A 1U1LA 1HNIA 2OEJA 5JMNA 1F2GA 5I4MA 3NL0A 2RH3A 2LDYA 3M30B 4ZDNA 2YX4A 4B17A 3GFYA 4IOAQ 2ZM6J 4GKKF 4XPCA 1KTQA 2IC3B 3A13A 4ILRA 3Q8QB 2AHOB 1S6OA 3JYTA 3NBPA 3I82A 3GR1A 4BCAA 1U0HB 2H3EB 2VBZA 3L95X 4JI2J 4ZVQB 1RA7A 4K59A 2HWHA 1JLCB 4M63A 1RT5A 1RAHB 3BSCA 3LPEA 3EYZA 3RBDA 4C8OA 1APSA 2XI3A 1NDCA 2LQ9A 1UWAA 2WCXA 3HX9A 3O6QA 3POTB 3R5AA 4AXIA 4QPXA 1KS2A 1GMWD 1GTHA 1LWCB 4USMA 5KFOA 1RT6B 3TO8A 3VAJA 2KH9A 1IBKF 3HSZA 4J9MA 3K5PA 4Q45A 2XY5A 2J8SA 1S79A 2MXYA 5IV3A 3RYLA 3KHHA 3TX8A 2Y0FA 3Q8RB 2DIUA 1W2BR 4LF1A 4ZLPA 1HR0F 2VPYB 2X1GA 1FDDA 2CDQA 2HURA 2XTJP 2V94A 3EVOA 2ZOMA 3GU0A 4LSNB 4USUA 3J7YU 2KRBA 2BVZA 4FXWA 2R8GA 2BRLA 1F0XA 4J91A 5KFBA 3D1HA 1T11A 1LWEB 4QWDA 2EG1A 2M2BA 1TL4A 3H7HB 5AXLA 5KFHA 5JVHQ 2KG1A 1S7IA 1VQOS 2O01C 3VF0B 1BMQB 5DG7A 5KOXA 2B4VA 2PFDA 5KFTA 4F0MA 4EBCA 2OTLS 2HS0A 2WBRA 4FYDA 1X4BA 1Y00A 1NKEA 1HBNA 2B0GA 2H5EA 3MPVA 5T7LB 4ES3A 2CYYA 2OFGX 1TUVA 3CJ3A 1K44A 3DMJA 1MU2B 3KLIA 1O6XA 3QIPA 1S1VA 2B4PA 4LSLB 4USWA 4B3OA 2MPUA 5FDLB 1ACMB 4AE5A 3HT0A 1DTQA 1RQ0A 3J81j 2AJ4A 4WFNQ 1S1XB 3AQOA 2D7SA 5HBMB 4YR3A 3E51A 2ADBA 2CRLA 4KR0B 3MMAA 4EYIB 3W9JA 5IQQA 1U1NA 4DFKA 4OMFG 3ZTPA 3TAPA 1RDRA 1PSDA 4YQWA 1JLCA 1YSJA 1T03B 3W7BA 4N5SA 1K0TA 3O5TB 4Y2KA 5DGAA 2E5GA 2ZHOA 4NYPA 2P9GA 2PI4A 5KFXA 2GZOA 1SPBP 3Q89A 4KGVB 5A8KA 8ATCB 4Q0BA 2ZWOA 1DAXA 1PYSB 2AZ3A 4BC9A 2W9CA 3LALA 3CDUA 4A8KA 2QEXS 1V3ZA 2C3UA 3CULA 1ZM4A 3SSRA 4DR6F 3ZZTA 1UVMA 4C11A 2XEXA 4X64F 4OLOA 3ISNC 3KJNB 2XMAA 3PY8A 2HFZA 2W8KA 1R0AB 3BSAA 2LA4A 4J37A 1R0BG 3TA0A 4ECVA 3TJ8A 3OLBA 1EZZB 2KT5A 2LEAA 5DGBA 2OSRA 2W2PP 1Y9OA 3M8RA 2MZTA 1TFWA 5KT7A 3OFHA 7FD1A 3G86A 1I51B 3QLHA 1R8AA 2HWTA 4HTJA 4J9UE 4XTTA 5GAHU 1TK5A 5I42B 3OVBA 2RF2A 3MZIA 5AJ3F 3A8JA 2J0QD 4DV7J 1LWEA 3ET6A 2VKZG 3UDLA 2ZUAA 2GIFA 4IG0A 2FJAB 4TQRA 1RBOB 2J5AA 3AJ1A 3DDIA 4AFFA 2LVWA 1XN9A 2HBYB 3C15B 1KFDA 2RS2A 2IJFA 3KXDA 4X4SA 2XSJA 1GK8A 3PYDA 3MCOA 4QIWD 3OTDA 2NREA 4S3EA 1ICEB 1RT1B 1CC7A 2HK3A 3PJXA 4C0HA 2PMZD 2XWXA 2DXEA 3MM9B 4CO0A 2FQQB 4URGA 2LXFA 2CG4A 3V6DA 1JXLA 2JEFA 4W92B 2AYMA 3H98A 5GAEU 4ES1A 2DGSA 3BYPA 2LCWA 2FC9A 1EKSA 2YNHA 3I5BA 4G1PA 4MFBB 3W65A 4CNZA 5DLGA 1FJEB 2QMUB 3P5BP 3FBCA 4AL7A 4KV8A 2MKIA 1L3VA 4M5MA 3UWTA 3MPYA 3THTA 2L9DA 1DQAA 1T03A 4WIQA 3W5YA 1U1OA 4M5KA 3L9ZA 3I9V9 2CNOB 4DDFA 4OJ3A 2ASDA 2UUCF 1QAYA 2CJ9A 2FJBB 2IVMA 4LVNP 2QMXA 2G0JA 3BGUA 1MN9A 3ONQA 3B78A 4RJVA 1UJ5A 1FXRA 1HBUA 1XR5A 2OPSB 3N01A 3S6EA 5LT5A 2FB0A 2AGQA 3U1NA 4FYWB 4G38A 2YKQA 1RAIB 4YHHJ 2HAFA 1N0UA 2HIQA 4UUXA 1R8PA 2PMWA 1QVFR 2B9YA 1U1RA 1FCAA 2G0CA 3PR5B 6AT1B 3H25A 1HQUA 1HQEA 1RSCA 2ALYB 4RR5A 3SV3A 3SXLA 2NSBA 3NNAA 4O44A 3S7RA 2EPIA 3SQGA 2M8HA 3KNGA 1CJUA 5IWAF 3W2VB 4AXJA 2DHHA 2V6AA 3QGGA 3I5CA 3B54A 2E7VA 3HSGA 3UD4P 3HD2A 1EKRA 4X2BA 3TNVA 3Q86A 3KLHA 4FP9A 4R0EA 4GVBA 3NP5A 1VRQC 3K57A 2MTLA 4EI2A 4R5PA 2LA6A 2RVJA 5DO2A 4EZ9A 3EUNA 2XMVA 2JC0A 3CD6S 4LFBJ 3P6YC 4PG7A 5B7WA 3PR4A 3I5AA 2QSWA 1R31A 1R8CA 1Y4ZB 3UD3P 3WHIA 1OJ4A 2KT2A 2MJNA 3AJDA 2R42A 3FBEA 3DRYA 1LWFA 3THVA 1N6QA 3V81A 3DRRA 2UU9J 2WSEC 2VFUA 4CLSA 4S39A 2B3TB 1RB0A 4DL4A 2AX1A 2DR7A 2F7VA 3C8YA 4HT7A 2ZHBA 4K2XA 1D8ZA 3EXYA 1S99A 2HS4A 1ZTTA 3A8EA 4MTPA 2EVZA 4TYAA 2AX0A 4LBPA 1SCJB 4O23A 2HS3A 2ROPA 2RUSA 1KOOA 4FYVB 1DBDA 4NZ0A 4QYRA 4NA2A 3PNIA 4F3QA 5F8HA 1N34J 4ZN1A 3M7VA 1TK8A 1YITS 1IKWA 4ICLA 2EKYA 4QWEA 1U09A 1U4BA 1RT5B 1IQTA 5L1JA 5D15A 2KM8C 3DLJA 4ZP8A 3T5LA 2DHGA 4MKYA 5G0RA 4DN9A 1XERA 2LXUA 4QOTA 4MMOA 2XB2D 1C0TB 1UEKA 2FHMA 4DX6A 2DNGA 2CQCA 1X5SA 1YIJS 1U2FA 4NMXA 2AEFA 3TUZC 2C2EA 3M8PA 1D1UA 5GEPA 1HFEL 2J9DA 5IM0B 3GILA 3EDRB 1VRTA 4B9NA 1YJNS 2FLOA 3MAAB 2PGCA 1FNMA 4LF8J 1YRXA 2HBZB 4DR2J 3N28A 3J7AN 3ZTRA 2KXNB 4OZLA 2B8QA 4ZITA 1JJ4A 3G6YA 4I67A 4JI8J 1JNZB 4RW9A 3UVJA 4UQGA 4DCOB 1PGZA 1N6QB 1HYSA 2X3DA 2RD5C 1BC6A 1GTEA 4Y28C 4AL6A 4A47A 2XMUA 1FRKA 3AOAA 4I56A 5HVFA 1S9EA 2QFJA 5F8NA 1CVJA 2CQ0A 1NB7A 2AW0A 1NKBA 2RKIA 1URRA 2I6WA 2MY8A 2FLLA 3AAWB 4JI7J 2V8PA 3D0IE 4S38A 4P2FA 4K0KF 3CPWR 4F4WA 1QSSA 2DB1A 2A2DA 4YB7A 5F0UA 4ZJLA 2R7TA 4U96A 3SEOA 5H9EK 2QE5A 2FIUA 3QJJA 2O67A 4O3OA 2VODA 2Z2MA 3LP0A 2DNOA 2CG8A 4LIRA 2MQNA 3S1TA 3PKYA 1HNXF 4RW7B 4AQYJ 4WXWA 2IDEA 1FRMA 1T3NA 1AW0A 1CQNA 4G65A 3MM6B 1SI9A 3Q0AA 4E98A 1AXQA 2HVZA 4DSJA 2V50A 3L4BC 4CLTA 4YR2A 1UA0A 4CLPA 5G0RB 2E1AA 3E3XA 1Q53A 3K89A 1XNQJ 3DRPB 3AQPA 5IQ6A 5HO4A 3D68A 3QGIA 3NGRA 3K5LA 3IA0A 4ECXA 4JI4F 5GVQA 3TUJC 2L48A 3CJTA 3MCNA 2ZJPQ 4S3DA 1FEEA 3M8PB 4CLZA 2B4UA 3VR1A 2UUBJ 4C6AA 1J2VA 1IKVB 2H65B 4EMDA 3IAS9 1KLNA 4HKQA 1MW7A 2BV3A 5AE3A 3WC0A 1MROB 1OYDA 5L9XA 1UFKA 2Y8YA 4KHPJ 4Q8EA 2VJVA 1M0SA 4J90A 4DWIA 1PYOB 4TU8A 4NLWA 4HL9A 3I4PA 1PC4A 2PDAA 3A3PB 4USTA 4F25A 1H7XA 4DR4F 2XLJA 5F0WA 1ZZNA 5E3CA 3NWRA 3DHXA 1HYSB 3M2RA 3H2VE 4GKKJ 3PRVA 1FNXH 1SBRA 1XMQJ 2XHWA 1FXLA 8AT1B 3BGLA 4ZPVR 4ZVEA 5T41A 5BR8J 1N5YA 2FTRA 3VALA 3UW1A 2OPPB 2A3JA 1E6VA 3VLZA 2D3ZA 5D78A 5GADI 4RL1A 1X0FA 1HD0A 2GO9A 4IG0B 4MKBA 1SC4B 2OIHA 3VGTA 2B6AA 3BGOP 1PAUB 2BQRA 2QLXA 2EWHA 4DF4A 3F44A 4JI3F 3Q2TC 2OGUA 1PAEX 4UZCA 1XR6A 2GIQA 1HARA 1NDPA 4QR1A 4J9OA 2B56A 2MKSA 3V6DB 2R8KA 4FNIA 1TP7A 3W2WA 5KG5A 2XNRA 2GHWA 1NJIT 1RTDA 2D41A 3HCXA 3FKBA 4C48A 2CJXB 1ZA1B 2VBYA 3DRPA 1S49A 2HQGA 2W4PA 1RK8A 3DU6A 3ISND 3M8QB 2KHDA 3HHDA 3ZTQA 1HPZA 4B9UA 2DY9A 4N77A 2DGVA 4PQUA 1MN7A 2L9NA 3RR8A 3ZZZA 1EB0A 1JLBB 4EO8A 3MAQA 1FT8A 4HHJA 5HK4A 6GEPA 4C9DA 2BE2A 3HVTA 3BEGB 3NGSA 1MSWD 5B0AA 1PBAA 5ETLA 1CJKA 1JJCB 1MROA 2KU7A 3WZ0A 2VQFJ 2CJKA 3B4DA 4E8UA 3FMBA 3ADAC 4RX6A 4DUTA 3DOMB 1M5VC 5F9NA 1NEEA 3MUTP 2VA2A 4V19X 1E6YA 1OMSA 4DFMA 4NYOA 1F6TA 4DL7A 5L8RC 4CP5A 4FF1A 3MI7X 1RWUA 1UKUA 3RJMB 4LRAA 1JLQA 1CS4B 2IRYA 2H5IB 2HNDA 2PSZA 4ZN3A 1ZOTA 1S9GA 3I0SB 3ILJA 2ZOGA 4NLVA 2OPPA 1Y5LB 4BHQA 2Z57B 4LR8A 4ED8A 2K1RB 3NY0A 4USHA 4KO0B 2XSJB 4LQ3A 5IV4A 2B6AB 2ZH6A 2J6TA 2AYEA 1FF2A 2GV1A 1XJWB 3PW5A 3K17A 4KQZA 4DSKA 1NZ8A 1U8SA 4N76A 1V3RA 2ABYA 4GO5X 4CH0S 1VIOA 5KFRA 1EETB 2CWKA 2N4CA 3UR3C 1D0EA 1NLKL 1QSYA 2EG2A 5D3GB 4MKVA 2W1BA 1HA1A 3W61A 1XMOJ 1HD1A 3OW2R 1TL5A 4KIAA 3SCLE 2RHSB 4NLTA 2GQCA 4ZLLA 2VONA 2DNZA 1RTDB 1RXOB 1NCLA 5I3UB 2V34A 5HMZA 2XMMA 3PEHA 1Y3KA 5IC4B 3ZZ0A 7GEPA 4KV8B 3KLVA 3OFFA 3L7PA 4X65F 3OUYB 5KFYA 4QJVA 4NCBA 3D66A 3ITHA 3OR2A 4PUOA 2C3OA 1M1HA 3PM9A 4DR1F 4CI0B 5GAGU 1SV5A 5CH7B 4QWBA 1NK0A 2BANA 2YWFA 2WHOA 4HACA 2PIIA 3MD1A 4DR5J 3K0JA 8RUCA 4HR2A 2DH8A 2VDIA 3M6VA 1HHSA 4DSLA 1G1XA 1HNVB 2HEKA 1TELA 2R8JA 4GC7A 4G9PA 2ZBIA 5CHCB 3M8SA 1S72S 5GMDA 1X9WA 3U02A 4M1KA 4FVMA 4U7UK 1TAUA 3P3DA 2JX2A 2VPZB 1AFIA 5BXIA 3T41A 4PWUA 3PX0A 5LXYA 1IR2A 4J9PA 1O5JA 1TUGB 1UTAA 2O1PA 2YKMB 2FVQA 1S1TB 3SDEB 4K5SA 4CYUA 5KTQA 4YY3J 2YKPA 4JOUA 4WFYA 3QZ7A 4S0MA 2YQ1A 4CNYA 4A8WA 3W5XA 4U67Q 3V6HA 1BY9A 4IG3A 2VU5A 4U7UD 2MSTA 2MKCA 3DU5A 4DSIA 2R7SA 4QBUA 5ETMA 3IRXA 3QRRA 3NCQA 1LOUA 2HQFA 4ZKAA 2HRUA 4FS2A 2MKJA 3JAMY 4DZ6A 2AMCB 2XULA 2PT0A 3BPSP 2WTFA 1RTJA 4M94A 1WG1A 4C3MA 3M2VA 1YBUA 1RT2B 3LPYA 2DHAA 3MM7B 3PFOA 4YMEA 1AT1B 2GHPA 2V4RA 2XMJA 2M3DA 1U25A 3GJQB 3VVUA 4OYIA 1RBLA 2CPDA 1SKSA 2XYPB 2UUCJ 3SZ2A 1SIZA 2Y1JA 2GIRA 2E7WA 2PA8D 1L3SA 2Z56B 5DM6Q 1DJ0A 4DCPB 1G7CB 1REVB 4I7FA 4YHHF 2YQ0A 3IR6B 4F50A 5I3UA 2HVDA 1U1QA 2GGPA 4P10A 2KXFA 3DRSA 2N4DA 1W7WA 4U95A 5JJBA 2MKKA 3NAIA 4NXNJ 2ASLA 3JTOA 4GEPA 2DEJA 3IWLA 4QWAA 2FJXA 1CQMA 4C11B 2HFNA 2OPQA 4CLLA 1RCXB 3QPIA 3CXCR 1B99A 2GAHC 2DR9A 2WBMA 4F4ZA 3I9ZA 5HANA 1Q8BA 3IC1A 4PG8A 3W8PA 1BWVA 1WOSA 1HHQA 3BB5A 4FKXA 5DZ7A 2DBBA 1PILA 2AQ4A 1VC6A 5IFMA 3NLCA 1WI8A 4QZVB 3PYEA 2LXIA 3PVXA 3KKFA 5IOLA 2JLGA 1J5EF 1R43A 3L7UA 3CCLS 2VG5A 3O8WA 1K0VA 4IRKA 1X31C 1SXLA 3NCPA 1VQLS 1PJ7A 5AXKA 3IGNA 4UW2A 2Z4PA 2Q1LA 4MKAA 2FY8A 3LP1A 2IVFB 4ELUA 2MGZA 3QYYA 4YB1P 4C8ZA 2Y1IA 4BLGA 1NJWA 2XO7A 3RR7A 1KONA 2BUNA 2CZ9A 2EC2A 2ILZA 4OZNA 3TA1A 5LJ5Y 3GV5B 4J9KA 5CD4A 1Y3JA 4H4OA 4LF5J 4F02A 4NLOA 3FK4A 3AFGA 1K73T 2OMOA 2EEYA 3IRXB 4UOHA 3RUBL 3B0JA 1OWXA 1RT3B 2KVIA 2KDOA 3LWMA 5I42A 4IR9A 3B0MA 5J2MA 2P8IA 1X7VA 2K8GA 2YNHB 4NLYA 5E2QA 1JB0C 1L3KA 1Y5IB 2KI2A 5KFJA 2DTJA 4BWMA 5E33A 1RU1A 4ILMA 3MFIA 3BSOA 2MZJA 1H6KX 2UVRA 3W63A 5CXTA 1FJGF 2A1BA 1JLAB 2KJVA 1KHWA 3R5GA 1D9AA 4DS5A 1JKHA 3TP2A 1CSJA 3IM8A 3TANA 2RUGA 4C3LA 3QFWA 1PJ5A 3DDKA 1WACA 1S9FA 3HLUA 1M90T 2HHHF 1T8EA 2O66A 2FZKB 4MH8A 4Q7AA 4YDXA 2HHPA 4WE1B 5KFMA 1A9NB 1XR7A 3DLEB 3H4BA 2WZ1A 2C1EB 2QLWA 4M5GA 1T02A 4P2MA 4OHXA 3ZXWA 3TUPA 2WK4A 2ZZMA 4JI0J 3AA9A 3M05A 1NH8A 3QSIA 1S77D 5CZVA 2HHWA 2K3IA 2XMWA 2EFVA 3QNWB 4QIEA 5A8WA 5HSPA 1TKDA 5DG9A 2PMHA 1NJXA 3HVTB 1QD1A 1FO1A 1N33F 4JV5F 1OQ6A 2FHJD 1YDLA 3FUYA 3OFGA 3AD7C 3T9NA 1UCNA 4FXVA 3M6UA 5F8IA 1UPMB 4X4OA 4DV5F 1TL7A 3NS6A 3BKFA 4P74A 4K4YA 4IFVA 1RAFB 2V0NA 1ZJ9A 2OPRA 3KUGA 2HAIA 2V67A 4HEA9 5E3QA 2MZRA 3WBZA 2DJWA 5BJRA 4UQTA 4A8FA 1CS4A 1VISA 2HNDB 3DHWC 2GVZA 4S3CA 2CZVC 1NB2A 1RHRB 4EBEA 1S1VB 1NZAA 2D3UA 5KFVA 4EEYA 1UA1A 1HNXJ 4YS2A 2EFGA 2Z8QA 3CC7S 3LA0A 3M2RB 3B8HA 2DIVA 2VKRA 4HH1A 2CXEA 4YEAA 2AOPA 4PWDA 1NNDA 1OSCA 2NXUA 2NXNA 4WKRA 4P71A 5D77A 5KFKA 1KVIA 2V2KA 4TY8A 2CKWA 5B0EA 2NQPA 3KOAA 1NDKA 3IG1A 1R89A 2KYZA 4JI4J 2DRDA 2XMTA 4USJC 4KYZA 3EXCX 2YXLA 1IBMF 2YWKA 3BM7A 2VFSA 5B08A 1TL3A 5DDOC 2B4OA 2QL5B 5H9EJ 4RU2A 1WEZA 4L72B 1B3TA 5HBMA 4AUKA 2AYBA 3VM1A 5HQ8A 5CYMA 2J6SA 2LQ8A 4J9RA 3NMRA 3OJUA 4ED2A 3I4HX 1RCOB 5F41A 4JI6F 1HNWF 1CBKA 1VRUB 4OQJA 2JOQA 1EHWA 4OYAA 3KLFA 1RA6A 2IA6A 4ECZA 2LKZA 2DNQA 4FNHA 4YUDA 4DR4J 5F9LA 3CCZA 3MMCB 5E7OB 2AT1B 5F3TA 3UDVA 4C97A 3RRGA 2E1RA 4S3AA 1C0TA 1IWAA 3DOMA 2IY5B 3N5FA 1U7LA 4DUZF 3DLEA 2VOPA 1WF0A 1OYEA 3GCXP 2YY3A 3PFEA 1RADB 5IT0A 2BE2B 2W7OA 3GIKA 2DNNA 1QLNA 3KWMA 4G3IA 1BQXA 3HO1A 2J0SD 2YQ3A 1U48A 1WNEA 3VV2B 4F0KA 1ZS6A 2YX1A 2ZNYA 4O3NA 2AJ1A 3G82A 3L7OA 1R27B 3J80U 4EYHB 2JVOA 4NCAA 3EJMA 3UI3A 1WC6A 2A18A 4RW8A 3C15A 2ZJQQ 2LQ5A 1YX2A 4WYWA 1Q78A 1T9YA 2D9PA 3C19A 3CW2C 5D0EA 2YKMA 2ZE2A 3DYAA 4P2XA 2HNZB 5B0CA 5RUBA 3T1YJ 2FJEB 3G71S 3KLIB 3MURP 3PYFA 3WIUA 1EARA 4DS4A 2AD9A 1RT7A 1R8BA 4NXMF 3ENWA 2CAJA 4LMZA 3KK2A 3IS9A 4C8KA 1P8GA 1FRXA 4X4RA 3PJ9A 2VFTA 3ILOA 1T3OA 2EW9A 1UEUA 2GHVC 3KDNA 4B02A 2DRAA 2LLZA 5IT4A 2X1FA 3BQ0A 4KPCA 4PR6A 1RT1A 2ZOFA 2V9WA 3C14B 4ER8A 1JK9B 2BEFA 2V4QA 2JH3A 3A4TA 3IGVA 1XC9A 4PXCA 3FEYB 4HHHA 5L38A 3TW0A 3I32A 1JLFA 1T9XA 3DOKA 3HHLA 3S8SA 3I96A 1CJVA 4NX9A 3CF5Q 1KQGB 3CD7A 1AA1B 2GGPB 4D3GA 3PW7A 2C2RA 4URSA 2UXDJ 3DLGB 4DSFA 4X4VA 1HBOA 1VBXA 3MM5B 3HSJA 3TOQA 1U49A 3HM9A 1KD1T 3C6UB 2GJIA 1JLGB 3AD8C 4J5OA 3V4MA 4BC7A 1U2RA 3BQ1A 4I68A 1JJHA 3KG1A 2CQPA 2E5HA 4RNFA 1FWKA 2M4MA 3QAEA 2F4VJ 2BE9B 2GX8A 4O0NA 1S1UB 1NK4A 1DTTB 1VHIA 2OFHX 3HDSA 3HFKA 4TYBA 2XCPA 4CQ1A 1G4CA 4X62F 2HQDA 5IT9Y 5E41A 5D4OA 3AT1B 2V8DA 4R5PB 2WB1D 2P5VA 2QIFA 4OV1A 1IN0A 1I5OB 3CDWA 5KT6A 3ZZPA 4FPIA 3CD5A 4X65J 4G39A 3BV8A 3MR2A 2RQCA 3PW4A 2BKOA 4DUYF 3W9HA 3HVRA 5K8NA 5EX0A 1L5UA 2XZWA 1Q1KA 5HJYA 1NSKL 2KRRA 3M4XA 4HVZA 1HBMB 1YZ6A 3CJ8A 2DPIA 3DRRB 1U24A 1KWMA 4PXDA 2YWEA 1I3OB 4I2QB 1RWWB 3MXHP 1AROP 4ZPDA 4B3TJ 2CPXA 2BZ2A 2MQLA 1MG7A 4MFBA 4XIUA 1VCTA 1HR0J 3U7JA 1ZZFA 3FCVA 2VA3A 2QT7A 1VBKA 1TL1B 4KKOB 4M5LA 3TAQA 2GW8A 1NPRA 2VPXB 5H1SV 3K8WA 3TVKA 5KFGA 3QJLA 4KSEB 7FDRA 2ADCA 4LF7F 2MJUA 2MLXA 2HMIA 3QJPA 1VQ8S 1WOPA 4AOPA 2DITA 2GMHA 4F2SA 2AJFE 4MYTA 3SMZA 1T0TV 3V4IB 4HI2A 4FZVA 4DV4F 3UE2A 4DQPA 3K5NA 4LFCJ 5K14B 2R2TA 3VAMA 2ASYA 4DFJA 1DLOA 5I3QA 1JLEA 1H38A 1R8HA 2FUG9 1DTTA 5C24B 2MQOA 3EZOA 3MM5A 4DV2F 3HI9A 7AT1B 2JEGA 1TVRB 4KFBA 4K4ZA 1NHUA 4F36A 2VG5B 3V6KA 2I9SA 4OX9F 2R7XA 5K20B 4UOFA 1J5OA 3N5BA 1ZH5A 1C1CA 5ETVA 3OV7A 1UWBA 2V8HA 3PKMA 4LRFA 5AE1A 2B9WA 4BWJA 1CLFA 4LSNA 2ZH7A 3KLEA 5L1IA 2W9BB 3VAKA 1RHJB 3M8WA 4P7VA 4C3KA 4CLYA 4D3HA 3J81U 2XHCA 3C16B 4QW9A 3GV7B 3VAGA 3PZPA 4B9TA 1VIXA 4JI5J 4LFCF 2BBEA 4ZOSA 4ERDA 1XWLA 2H5JB 3R5BA 3KK1B 4HH0A 4ECTA 3UCUP 3JTNA 4LF9F 3GIRA 1RKIA 4WKYA 2IMWP 3J7YI 4CLWA 1VI7A 1K9MT 3R2CJ 1IQZA 3AXMA 3IWXA 3T5HA 2F8MA 3GFHA 1QE1A 3PEJA 1MMDA 3UPFA 2HGLA 3M9NB 1EQMA 4NXNF 2JDJA 5T7LA 5J2MB 5A2QU 2FJVA 5LSOA 3QAUA 1RTIA 2BJDA 4FKYA 2NXJA 2YTCA 3QBCA 2VG6A 3A1YG 3BYRA 3U27A 4IO9Q 3NWGA 3SCJE 2MMYA 3PACA 1DTQB 1HBMA 2KO1A 4NYZA 1UEVA 2HKEA 1YZ7A 3N9UC 4MK9A 2V4JB 2HMIB 2UXBJ 4Y65A 2B9XA 2I38A 3KTQA 1S5ZA 4ED5A 1HNZJ 2VG7A 2ZC3A 4C8LA 1UZDA 2C2KB 5T14A 1IBKJ 1XEZA 3UR0A 4WCEQ 4ECYA 2IAJB 5A0YB 1RWPB 1N36J 1CJTB 3K7RA 3KK3B 3C3LA 4B3MF 2Q66A 3W3SA 1KVKA 4FYXB 3D2WA 1RYSA 1WTFA 2I5JA 2CNLB 2LP4A 2HG4A 2RSQA 3THPA 4F0HA 3B4MA 1J5OB 5K14A 3BH7B 2YNIB 1S4FA 1SC3B 5A8WB 3KLFB 2CJYB 4NLDA 4ZPTR 3Q2SC 4RUCA 2VHGA 2IVYA 2HLUA 3HHLC 2BANB 3UO0A 5HP1A 1FI4A 2CVEA 5C25A 1R6YA 2VL1A 4F04B 3SCKE 4DG1A 1H98A 1SQFA 4URQU 2AGPA 1HNVA 2HBRB 5EDWA 1PJ6A 1K8AT 2RDDA 2H4WB 4ZVHA 5KT4A 1R3NA 2HGNA 1F5CA 1UW4A 4WBFA 3MR5A 4DV3F 3M1VA 3A8IA 3EICA 4ECQA 2XY7A 4ETZA 4RNNA 3CIMA 4J9VA 3R5CA 2VG6B 2X3GA 4CDIA 3PW0A 3CJ2A 5J1NA 3HPOA 1N5YB 3TA2A 4P7TA 2ROGA 1YHQS 2DXFA 3QWUA 4ZPWR 3MTKA 1SJ1A 1VR6A 5KT3A 5D0HA 2W2QP 1U8WA 3SDEA 3AB2B 3JSMB 3FBFA 2BYCA 2N3LA 1SJRA 5CYQB 1S97A 1BD6A 1V5IB 1RAGB 3TZYA 2ZE2B 3DYAB 4ZPCA 4LBHA 5J2QB 3NNCA 2VH7A 5FJ4A 2HIYA 5LJ3Y 3Q8YA 1CC8A 4G1QA 3TRGA 1RWOB 3IO1A 4F67A 3PIOQ 4CO5A 3QQCD 2HFUA 1U47A 4UF4A 2NXCA 1ZPWX 2ZH3A 1NK8A 5ETQA 3G6XA 1X4FA 3NRBA 4EUVA 1RHQB 2YH0A 3EPIA 1RHUB 1S1WB 2CNKB 3ZZRA 5LMNF 3PX4A 4I2PA 2V9KA 2I8EA 2QN6B 4ZCLA 2V8GA 3Q83A 1HWKA 4LJMA 4WPAA 3NOYA 3JB9k 1ZM3A 2ATCB 4DPUA 4ED7A 1BHNA 3NNHA 2RT3A 4AYBD 2GS8A 4Y2MA 3HF5A 4IYQA 5LSRA 3GR0A 2ZH5A 4DQRA 1QAXA 4O4RA 1D8YA 3OJSA 2RIJA 5GAHI 1N88A 2C2OB 4NRUA 4IFYA 1E6YB 1RAOA 2AEMA 3FFIB 4DV6F 3NBPB 4CWBA 2IM0A 5E3RA 1HWUA 4F4XA 4WXOA 1LWCA 3CO0P 3UN2A 2KVQE 3MEGB 4NZ6A 2GVDA 3MMJA 4RBVA 5DETA 1ZTWA 1QTMA 2KXHA 1REGX 2E9RX 4K4SA 3ZNJ1 3JAMU 1TAQA 3N4WA 3IMQJ 5C42B 1F1BB 2LMIA 2QLBB 4NASA 5DDPC 1F9HA 1ZA2B 3NGDA 2JEIA 5LMUF 3PDNA 3D0GE 2MZ1A 2IHR1 3JXOA 1N4LA 5D4LA 4OHYA 3G82B 2ZD1B 4OZ0A 3R27A 2WVFA 3SQGB 2QA4G 4L75A 3IR7B 1EJ7L 1S9GB 1VFJA 1GXLA 2DNKA 4C0OC 5DDRC 3H5UA 1Q8LA 4FBTA 2UXCF 2J7UA 2DGXA 5DJBA 3R8YA 3TR5A 2JFDA 2WSCC 2WVEA 2ILYA 3OSPA 2HVEA 2HZCA 3FRZA 2YKNA 3D1OA 3OPKA 5B09A 5E5NA 1S1WA 1RT7B 1FXDA 1S6QB 2YWWA 2UVVA 1I94F 5B0DA 3BJYA 4WWSA 1IKXB 2HQCA 4M5HA 1HW8A 3VQTA 4DUZJ 4F3OA 2XS5A 2UUAJ 3VKRA 5F3ZA 4GO7X 1VOMA 2K7JA 5KFAA 5HLFA 3AJ2A 5KFWA 5A8KB 4B3OB 1UL3A 4Q0BB 2R2UA 4OLPA 2RB7A 3KHRA 4CT9A 4K7QA 4H4MA 1Y5NB 3K5MA 4DR2F 2PC6A 4A46A 2C22A 1C2PA 1KFSA 4BBYA 4TQSA 4OL8A 3P5TL 4ID5A 3Q8SB 3D4JA 2MEWA 2IM3A 2W25A 5DQHA 3OVSA 1NXIA 1P9QC 4TVAB 1T9UA 4RPFA 4N41A 4K2JA 1VMBA 2MB0B 1BXNA 2E29A 2A2CA 5KFFA 3QGPA 5FLXY 3W62A 4RNOA 3PCOB 4GMKA 1G3OA 4EU0A 2UVUA 1AUSL 5B0BA 1S6UA 1BGXT 1TL7B 2M7SA 1IR0A 2NUUG 4ZK7M 2XGPA 4DPOA 1G2EA 2W9CB 4B3RJ 4WTOB 3PX6A 1SJ4P 3LGNA 3I0SA 3VGSA 5A6WA 4UT4A 2K3KA 2W7PA 4KT0C 3ET6B 3G6ES 4EBDA 2CDRB 4RWWA 4B08A 1NPPA 4KTQA 1X4GA 3H42A 2BJ3A 3UCGA 3BKTA 4WK3A 3KLEB 5FD1A 1AYEA 4DL5A 1VHFA 4V1Ak 1S0NA 1IM6A 1LW2A 1X5TA 4YOEA 3IXQA 3OTOJ 2EKNA 1TV6B 2GFFA 3MAAA 2I2YA 2HBQB 2DO4A 3NGKA 4JV0A 3GEOA 2O5DA 4ZP9A 3KJQB 4CO3A 2DR5A 5KG1A 2BDPA 5CABA 4ANEA 5DQGA 4X4QA 4IH6A 1KQKA 3ILIA 1RHKB 3SFUA 4ZMMA 5IS2A 1MNEA 3RAMA 1ZBTA 2WVCA 4NLSA 1C4AA 1HI8A 2CQGA 1PKUA 3D3CJ 3MCMA 3BF4A 3OR2B 3ZFVA 1M5SA 3A8KA 2G2YA 1IKYB 2F4VF 1FKOB 1X0PA 5L1LA 4LF2A 2OPQB 4H4KC 4PAAA 4TY8B 2OELA 1X4CA 2LEPA 2A6MA 1LNQA 1P1LA 3OD2A 4PXEA 1S0OA 1URNA 4JV2A 3HHNB 3DRSB 2Q79A 4H4MB 4C8MA 3WIVA 4JB8B 2Y0SD 4JBCA 1TVRA 3OT9A 3LP0B 3FEXB 1MWQA 2N7YA 5KG6A 4DI6A 5CYJA 1VC0A 4XO0A 1GXTA 3MM8A 3R1LA 1KN6A 1OS5A 2HNYB 3ENQA 1FNOA 2CPYA 2Y1LB 1C1BA 4DUYJ 4DQQA 2DNLA 1WJ9A 2IJRA 1P27B 2CPHA 4QQBA 1RI7A 4JI8F 1PC5A 3UD5A 3TAMA 1EX8A 5IT9U 4USKA 4JYAF 3AHPA 3VLYA 4QYZK 2JRSA 3UNYA 2DNRA 4MIWA 3U1LA 5JUMA 2XZDB 2EBEA 1M1GA 2N7CA 2V2QA 3EMTA 1SH3A 3E01A 2DRBA 4XPEA 3EWGA 4FDFA 2JHEA 4LBIA 1SIWB 3EZ5A 4LF6F 4QWCA 1LWXA 3M2VB 2G4BA 1YJRA 4ENOA 1DQ8A 2CQ2A 1HI1A 3JTPA 4ZPAA 2AZ1A 3HZGA 3T1AA 4RBUA 3N79A 1VLOA 3W2VA 1VLYA 4DV4J 1SKWA 5DLFA 2HHXA 2AV5A 2XYGB 1QE1B 2OP5A 2VQFF 4O3PA 1OPIA 4LT6A 3PV8A 2PFFB 3LP2A 3EGWB 3H5SA 2DEIA 5BYQA 2W8LA 2CPZA 2RQMA 1HNIB 3IBWA 5I3PA 2C3YA 4DZDA 3HVAA 3BS9A 4NL5A 1KHVA 1FFSB 1E6VB 1JLAA 1N54B 3DFEA 3OTBA 4U9RA 4NCGA 1CJVB 4RUHA 4F4YA 2CIMA 2IAJA 1GMUA 1FRJA 3CJQA 1LW0B 3MEEB 1YWXA 3PRBA 1WSRA 4FYYB 5HATA 3O3LA 4Z7YA 1OQ3A 3CT9A 3FBBA 3K5OA 4P75A 4NA1A 5LL6d 3DC2A 2I5JB 3FVYA 3MM8B 1KR4A 5IWAJ 1VQNS 2VFVA 3CVKA 1UETA 3MMAB 4ZVOB 3HMJG 3OVAA 2Z2ZA 2V69A 4I2PB 4OV6A 3W2WB 3Q8PB 2XM3A 2F8HA 4QYZJ 1NK5A 2ZITA 2E5LJ 3HJVA 1WF1A 1VS3A 3I6PA 2LYVA 2FDNA 2MQMA 5ITHA 1SJQA 1WHWA 2JFKA 2V2ZA 5DM7Q 1HI0P 4CH7A 2FVRA 5HAOA 4OX6A 4WFXA 5EX3A 3O1LA 3UN3A 1M5PC 1VQ9S 3I0RB 4WP3A 1V5VA 4WE1A 2C2DA 3ZTOA 2FLPA 4LFBF 2BOAA 2NZ4A 3NCRA 4Y00A 5F8JA 2HK2A 3TJAA 3J7Z5 1V3SA 3LP1B 3P4UB 4LRDA 3SI8A 2QX0A 4OYXA 3A3OB 5K9FA 1H73A 1QVGR 1DHMA 3CE8A 2UU9F 2AWZA 5DS7A 2RMLA 3TARA 4CIOA 3PO5A 1X5OA 4XK8C 3LO3A 3ZC4A 2DK2A 4DPWA 2HRTA 1Q0NA 4ZVSB 5HVHA 3GJTB 3HK2A 1LFWA 5JXSA 2JSXA 1FRHA 2ZBCA 4AT1B 4A4JA 5HMWA 1H7WA 4PWDB 2GC8A 2NXEA 2G2ZA 3NOGA 4IH5A 1U1KA 3QIPB 4B9VA 1PO6A 4P2SA 5D3GA 3IBFB 2B5JB 3QGHA 1A0OB 2BW7A 1DQ9A 2M0GB 2M9KA 2PO4A 3DM2A 4QU6A 1A6LA 1UFWA 3LGMA 5KFZA 1CG2A 1U2CA 3C2PA 3JS9A 4FF2A 3KLGB 4LUBA 2IJNA 4ZIVA 2IM2A 2RILA 4KGKA 4RW9B 5M2RA 1FWPA 3R1HA 2HLTA 2VV5A 1NO8A 4OYZA 3TQ1A 3OR1A 4Q2MA 2R2RA 2UVWA 3D6TB 3R5JB 1WWHA 2MKYA 3MM6A 5ETPA 1T95A 3RGIA 1YTYA 2RU9A 4NZ7A 1WC1A 3D54A 2MY7A 2EFNA 1Q4RA 3DNCA 3P8BB 3RAXA 1SL1A 2KKHA 1VQKS 1RHMB 2J7WA 2V8VA 3BGRA 4LFAJ 1FX4A 1HKAA 4RUBA 4Y0FA 1OPZA 1P6TA 2PEHA 3MECB 3VHQA 2YKOA 1SQGA 1N32J 3FGVA 1TKTB 5AT1B 2HFOA 5HMXA 2KHCA 1JIHA 2P9CA 4FN5A 3Q22A 3KMSA 4NE9C 1SV5B 3UCZP 5LOQA 4ZIWA 4DPXA 5E3PA 1EP4A 4R8UB 1L3TA 1ZAVA 4NLXA 2OHDA 2LDIA 5HQMA 2ZBQA 2HGMA 1VK3A 2BJ7A 2G9OA 3MPWA 3LQVA 1WC5A 1FFWB 3AOBA 4RKUC 4V19J 1N5TA 2OPSA 4IFYB 4QU7A 3RBZA 4X4PA 4B3SF 1H72C 4IFVB 4I0WA 3SFGA 4LIWA 2JLFA 4IRCA 1KEKA 3N6LA 3CMAS 1RWXB 2QA2A 5GMEA 5AE2A 2DHXA 2N82B 3W66A 1Q81T 3D1QA 4ETXA 2L3MA 1SL2A 1HQUB 1SC1B 2DR6A 2C28A 4ED1A 5EWGA 3EVWA 1YK9A 2YNGB 2CJAA 1NJZA 4HDGA 4RW8B 1Y10A 4I69A 3ENAA 2QRRA 2K2PA 3N6MA 3UN5A 1FRIA 2BACA 3VKPA 1IBCB 1RLDA 3MM9A 3VTIA 1ITPA 2IBOA 2YWHA 1KSPA 1X4DA 3LAMA 1Z1ZA 3CCSS 1D9DA 2GQ2A 4DEZA 5J2NB 1X5PA 2R8IA 3WDOA 1ELOA 5CYMB 1JXVA 4DR3J 3QATA 2KYXA 1CPZA 1X4AA 2DGQA 1FA0A 1XNRF 1QAIA 4X4UA 3M6WA 3SCIE 3HKZD 1XQIA 1NSAA 2DCUB 3MDFA 4TU7A 1HBOB 3BBBA 3NXZA 4WU2A 4Y3CA 1N56A 4JV1A 2BM1A 2E1CA 2QJ3A 1VDHA 4I7FB 1VQ7S 1AFJA 1IM4A 2OEKA 3KUHA 4YN3B 4ZVGA 1DZ5A 2F4FA 4C98A 1SQEA 3MFHA 3BREA 2EK6A 4RW4A 1HBUB 4YY3F 1XMOF 3HSDA 2HHTA 5A76A 4K5RA 5LSLA 3RW7A 2H54B 3QRQA 3FCHA 3VKQA 2IPOB 3CB4A 4J9NA 4TXSA 4ZLJA 2XY6A 2ZH1A 1UAWA 3KG4A 3C6TB 5BYRA 2BABA 2PA3A 4A8QA 4YFUA 2OKQA 3D6HB 3MD3A 4F8RA 2MGZB 3CCRS 1Q5YA 1H2TZ 4KHMA 1AB8A 1RUSA 2UUAF 3D5MA 1TKXB 4A8YA 3KHLA 3D7SB 2MSSA 4TNOA 1NM2A 1C4CA 3EM1A 3K2YA 5AXMA 3GQCA 2NCKL 4L6V3 3Q8VA 2U1AA 4QIVA 3GJSB 2CQHA 1JQGA 2X1AA 4A8SA 4W98A 3ISZA 4BDPA 2K1RA 2X51A 2ZZTA 4DR6J 2HHVA 1FEHA 1W25A 2BMBA 2D74B 4OYMA 1DURA 1RZMA 4ZJQA 4S3BA 4ZCIA 2WB4A 4FBUA 2KFZA 3GFZA 3C14A 3OL6A 1F5BA 2Y8WA 4QIGA 2FJDB 3T6JA 3IR5B 2MLYA 1SH2A 2F5GA 4KO0A 2A0FB 1O0PA 3US5A 1RAJA 4ES2A 1QUPA 1WDTA 4I2QA 2RQ4A 5F8LA 1WKKA 2E9TA 3LP2B 3PG9A 4PXBA 5KOWA 5LM7E 1KVJA 4ZP7A 1MWYA 1I1GA 2E44A 1DARA 1H2VZ 2H1YA 1IJEB 2DR8A 1S12A 5KT5A 3VZIA 1YJ9S 4PEOA 2AJQA 1TMJA 2CZ4A 4NA3A 3RB4A 4N8OA 1JLGA 4DHVA 2FYXA 4G1IA 4MYUA 2XS7A 3CNQP 5C2CA 3MCSA 1HMVB 1X60A 4F3MA 2UV8G 1GFWB 4WZMA 1SKRA 3H90A 1G6BA 2POKA 2XMKA 3CJSA 3GYGA 3ITHB 4ANDA 1UVIA 3R6GB 4DSEA 2ZZNA 4QCLA 1B0VA 1T9TA 5D8HB 2QTWA 4TY9A 1TU0B 1NH7A 3BN7A 5A8RA 3ZO7A 1N8RT 1IBMJ 3OL9A 4Q44A 4ED6A 1DY3A 2MYFA 3GWCA 3I0RA 4CO2A 3TQEA 4M8LA 1WEXA 2ZD1A 2I1RA 4DF8A 4ED4A 2C2NA 2YKAA 2ZH8A 4UUWA 2JEJA 5EN1A 3F41A 3VQSA 6FD1A 2DKOB 4JI2F 1NUEA 3QO9A 5HI7A 2DVIA 2EXUA 1PBUA 2JC1A 4Y2AA 5KFQA 3RRKA 1M5KC 4EK2A 4DR1J 3E01B 2JWNA 2HWIA 1F2HA 4EGLA 1GT8A 1VQ6S 1K1QA 2RRAA 1WF2A 4XDCA 5CQGA 4CYUB 4RUAA 4GKJF 2ZBRA 3ZZOA 4DR5F 1FKPB 1VQYA 3K59A 3D3BJ 3DI6A 3CJKA 1WTBA 4OJGA 2G2OA 2EI5A 2BQ3A 3QMQA 2PN6A 1QM9A 3TVZA 3CCQS 1LV5A 1WD6A 3TYTA 3T5KA 2RQKA 2NPFA 4GC6A 4L3NA 2DNPA 3W64A 8GEPA
chains in the Genus database with same CATH topology
2BR0A 4RLEA 4O0IA 2OD6A 2V4JA 2YKNB 3R3TA 1C0UB 4WZQA 4B9LA 2HVIA 1FK9B 2YNFB 3DOLB 2J8AA 2DH9A 4TKTA 1KNZA 1JLEB 1IUJA 3B0GA 1M5HA 4PKDB 2P6SA 2KM8B 2J0WA 3PRDA 3PIPQ 2IC3A 3MMCA 2J9CA 1BLUA 3FJ2A 4CTAB 2CJQA 5K8MA 2IBKA 5C25B 2J6UA 1X9SA 1XTZA 4O3QA 1TKTA 1KTVA 1S10A 1KQFB 4X4NA 5KFLA 1YJUA 2M88A 2C3MA 2ZVSA 3ETOA 3EPGA 2PE8A 3DN9A 4IUFA 1MWZA 4RZRA 3DLHA 2WW8A 4Y34A 4Q8FA 4O44B 3GV8B 4RWXA 3DCAA 4WFZA 4ZHRA 2RDIA 3AA8A 3GIJA 3T5JA 4H4OB 4PG5A 1QY7A 2CQDA 3HP6A 1XMBA 4DL0C 1OIAA 4KGMA 4WU3A 2ZM6F 3B82A 2OD4A 1N34F 2IFXA 3FSXA 3GSDA 5IXUA 3M32B 2E66A 3DM2B 2PD1A 3FRYA 3MAHA 3TI0A 1WG5A 2WONB 4OJHA 4W90B 3CGIA 2F1FA 4A8OA 4KE5A 3KLGA 1ZETA 2E5LF 4DV0F 1C0UA 1XBWA 2CQIA 2G13A 1W2IA 2KJWA 2B5JA 3IS9B 1P1TA 2R7VA 4WJBA 2DT9A 1O51A 3FQLA 5KG4A 2ZH2A 1UVKA 5J2NA 4ATNA 3FNNA 4K4XA 3B0NA 3N0VA 5K5MA 1U45A 1MMLA 3CCWA 3OXLA 2J9DE 2R7WA 1SUQB 4PQUB 1TZ0A 3GG0A 1X4EA 2CJBA 2BOPA 3MUVP 1FKOA 3LOUA 2WOMA 2QA4S 1FESA 3RAQA 4PUOB 3OXGA 4Q5VA 3HHLB 3LUYA 5HP1B 1GNKA 1UFLA 2XI2A 4LF5F 3VKTA 1F9FA 1FE0A 2E5IA 5JVGQ 2OJ3A 1VQMS 2DISA 4DLEA 1B7FA 1VQPS 2ERRA 4N56A 3VAFA 2KFYA 4QW8A 5HMYA 3MR6A 3AY0A 3CCUS 3HHLD 3G4SS 2HNYA 3H2LA 1UJ4A 3OSNA 2EK1A 1BWEA 2CPIA 4U7CA 2FVSA 1SH0A 2RRNA 2P9EA 2ZUGA 3TAMB 1Q86T 4WTYA 1VQ4S 2WONA 2B7BB 5DG8A 3U1MA 1RKJA 1S9EB 3KYLA 2GEPA 1UJ6A 2KZZA 4YB5A 1XNQF 3T3FA 4B9MA 3OL8A 4NCGB 3V6JA 2B7CB 3IN5A 4I4BA 2VFRA 3AH6A 2AF6A 2IMOA 3PJWA 2UP1A 4NLRA 1TKZB 4IOBA 5CCLA 1SB6A 2J9EA 1U1PA 1RJJA 2DPJA 2AP6A 1YG0A 1YGYA 4C7QA 2XS2A 3RU0A 2U2FA 1VRUA 2ZJRQ 3HHKA 4JI1F 2FC8A 5MAOA 4MK7A 1GX5A 1FTRA 5D4PA 2ALZA 3BZQA 3OL7A 2I0XA 1BQNB 2FHJA 2QSFA 2UV8A 3MF5A 4OZ1A 4TN2A 2ROEA 4F26A 5BR8F 2E1MC 4USIA 4FF3A 4WF9Q 4DV7F 2P6TA 4ZS6A 4OI0A 2V5HG 4HDHA 5KFSA 4DL6A 5CA5A 4NLQA 2L9WA 1T05A 2OSQA 2AU0A 3FSYA 1LQ9A 1HNZF 1BQMA 2QA1A 2Z0GA 1HWIA 2UUWA 1N36F 1OSDA 3HKWA 4ALZA 4B3TF 4E0DA 2DH7A 5THWA 4DR3F 4NLPA 3F73A 1YRUA 2EBGA 3N6NA 1RTJB 1WHYA 1VK8A 4IH7A 2XBPA 4RNMA 4MIBA 2ZNZA 4PRFA 4M95A 3FEZA 5J2PB 3T6BA 2XLIA 1K1SA 4NLUA 3SV4A 4XDDA 3BN4A 3CD0A 2MHEA 3SYZA 5A6PA 3I56S 1B0PA 3CO9A 3M2UB 3TAPA 1VJWA 1ZM9A 3M30A 3CJKB 5EHHA 3MGJA 1LWFB 5A0YA 2ZH9A 3CDBA 1Z2LA 3FDSA 2VB6A 2X1BA 4ID5B 3NS5A 3CDAA 4P6QA 4S23A 2BW2A 3J80Y 5U47A 2NR0A 3VAHA 2H9ZA 4ED3A 1C1BB 4RU9A 4CH1A 1N0VC 1VC5A 1WHXA 3H20A 1S1UA 4NLGA 4IO1A 1BQMB 1NU4A 2ZC4A 3MMBB 3WX4A 3BGRB 5KT2A 4PCQA 4PG4A 4C2MA 2XLKA 1QAJA 1FDNA 1X8DA 2R4FA 4J9LA 1VQSA 2OH2A 2ZDPA 1B0TA 3CTRA 2AJ0A 3O44A 4ZA1A 1FHTA 5HROB 1R0AA 4YDDB 2F40A 4NMLA 3UFCX 4DG1B 1GX6A 2FJWA 3BR9A 4Y2IA 2XSFA 2ZFHA 5L1KA 5J1PA 3G6VA 3CCES 3EZUA 3GYXB 2VASA 4KB7A 4M5DB 1YJVA 3V5RA 5KFIA 2XG8A 4RNHA 4WFAQ 2D3OR 3C66A 2CPJA 5J2QA 4K50A 3LF0A 2BQUA 1FDAA 1TL1A 4KKOA 2FVPA 4Y6IA 4I1TA 2DHSA 1WI6A 3JSYA 2B43A 4HT5A 4ZPVR 5E41A 1Q79A 2FVCA 2LECA 4FF4A 3DI6B 3CJ0A 1EETA 2CFXA 3VCDA 2R9LA 3I55S 4ELTA 3MTJA 5FDLA 4IRDA 3CUNA 1XMQF 2YWGA 4CTAA 1ZJ8A 1YJTA 1JMTA 1HW9A 2HPUA 2OMLA 3DLKB 3ENVA 1NK7A 3PXGa 2FY1A 2ZKTA 3R5DA 3OUYA 4LF8F 3MHYA 2VUGA 1YQHA 2BA9A 1SC6A 4PPZA 4DL3A 2XWYA 1GH8A 2IYGA 4O4GB 3H4DA 2GJ2A 5C24A 4ECRA 2J76E 3MMBA 2ZH4A 1S1TA 1OO0B 4J9QA 1KQSR 2E5JA 1TKXA 2C42A 4H54A 4ZHRB 4QYZJ 2KB2A 3KFWX 3OHBA 5C42A 5CZXA 1DFDA 2HHSA 3CCJS 3MUMP 4CO4A 3QLHB 4JI7F 4OI1A 2W9BA 3PW2A 5C5JA 1MMNA 2W4DA 3MEGA 1Q82T 4O3SA 2DNYA 2MQPA 4WFBQ 3BGFA 1N5VA 1UWBB 3QWPA 3KK1A 5L9NA 3PHEA 2ASJA 3VLXA 3SSQA 1M1KT 4C8YA 2E7XA 2GQQA 5DQIA 3BO4A 2RNEA 1U6FA 4I64A 5J1EB 2N3OA 1B64A 3AOPA 4YB6A 1S6QA 1RTIB 1NJYA 4OHWA 1LW0A 3MEEA 1IBLF 4OX7A 4C0BA 3GFXA 3DRXA 1S48A 3IRWP 2LEBA 2NYIA 5HLFB 2HQIA 2RS8A 2AYGA 4PQAA 1TKZA 2Q3PA 2UUBF 3UDCA 1ULRA 4NOHA 5AXNA 2GNKA 1I6JA 3NG8A 3M8QA 1GQEA 5LXRA 1V6HA 3P96A 2L41A 4YP3A 1JJ2R 1FKAF 4KHPF 3J81Y 1LKZA 3NAHA 2DGOA 4C8NA 3K58A 3DLLQ 3CC4S 2BRKA 4R25A 4H4KA 2MHNA 2R7OA 4PG6A 3E8OA 4R8UA 1YRTA 3H40A 1BQNA 1RYRA 1VQ5S 1HWLA 3HJFA 2HW3A 4DL2A 3OXFA 1WEYA 2VC0A 1RISA 1F5AA 1YVFA 1N5QA 5A2QY 2VQEF 2EFOA 3J7A1 3M1VB 5GADU 2FLNA 2MKHA 2GMLA 3KHGA 4R0JA 4U6PA 5KFPA 4UY85 1IKWB 4ICLB 1T05B 2F3JA 3RTVA 2QYCA 4UOCA 3GMGA 1RT6A 2F8EX 4KBIA 2LQBA 3EGZA 4KRWA 1Z4UA 2RRBA 5K8PA 1H0HB 1S7HA 3MR3A 5G4DA 5E0OA 3H5XA 2K7KA 1FKPA 3DLBA 2LQJA 2COLA 1YBAA 3DMJB 4LSLA 3UQSA 1HWJA 5SZTA 2M70A 3T19A 1Q8IA 2IA0A 4N47A 4JI0F 2XNQA 3KLHB 1QJHA 2CQBA 3ZZUA 1FERA 1T94A 2ZDOA 1TV6A 2EFPA 2AGOA 3P49B 4DQIA 1V9OA 4DLGA 3JSMA 2DNMA 4LQ9A 4CO1A 1H2UX 3DXBA 5KG3A 2WSFC 1JKHB 1WELA 1S0VA 5EWFA 3V81B 5BYSA 1AUDA 3IFEA 2OLWA 4KHRA 4YR0A 3G8TA 5KFUA 5HL7Q 4IQMA 4TLQA 1LFPA 3MOJB 3EGNA 2JJ4D 2QO3A 2Z2LA 3FZ2A 3T1HF 4OZ5A 1FK9A 2YNFA 2ZHAA 4MK8A 3KJVA 3ZZYA 3BDEA 4B9SA 5H9FJ 4RW4B 3OLAA 3L3CA 2QZ8A 4I6YA 3WC2A 1CEZA 3X1LB 3MWBA 5D6GA 3OFEA 3LW5C 2O3DA 1M5OC 1ZAXA 2OTJS 2OPRB 1TFYA 2Y1RI 1RT4A 4IG3B 1FDBA 1JXEA 3M32A 3CC2S 2KTQA 3JSRA 2DGUA 1FE4A 2VOOA 4KJIA 4BS2A 3BSNA 1FJCA 1UVLA 2DNHA 4OFZA 2WAQD 4EO6A 5GAGI 5CD4H 2RDJA 3ULHA 2SXLA 1S6PB 2BM0A 1ZPVA 3J7ZT 4KC5A 5B0GA 1KRPA 1FD8A 2RF2B 2RKIB 4WIIA 4JUZA 1REVA 2XCAA 2DCLA 2FGOA 4WK1A 3QZ8A 1ROFA 4K4TA 4F4KA 4GKJF 1HL6A 2APOA 3OTEA 3QIDA 1LK7A 1IKXA 2NSCA 4CZCA 4TU9A 4DQSA 4EFAC 1Z2ZA 3VM0A 1S76D 4DX8H 3M9OB 3CJ5A 3NKYA 3G9CA 5K8OA 4IDKA 1N52B 3RRHA 4Q2LA 3BDPA 4ZCKA 1O8BA 5EWEA 4I6AA 5KG7A 3POTA 1HHTP 1IXKA 3I87A 4MJKA 2EC0A 2FHOB 5A8RB 3C6TA 3VAIA 4OIXA 2VC1A 2YNIA 1ZYQA 2MZSA 4LVOP 3NMAA 2CPFA 3O2IA 2VBXA 3X3UA 3TVYA 4S3FA 2D1CA 3D0HE 4Q43A 3I31A 4ITSA 4OI6A 4ECSA 1D3WA 1FTCA 1TR0A 5EGYA 1GXUA 1D9FA 1SJ3P 2EFQA 3EX7B 1FD2A 2KN4A 1VBZA 2UZAA 4M5DA 5B0FA 4UY8T 2HHQA 2R2SA 2GCFA 2IRXA 3VKSA 2UUTA 1KLMB 1XK8A 3RB3A 1Y0HA 1KOHA 1WG4A 3DDNA 3B0LA 1HBNB 3VWSA 4ZPBA 2KZMA 1FVQA 1UVJA 5GAEI 2CQ4A 2NPIA 2W7AA 3HZEA 2FHKA 2JZ5A 3CMES 3GZ7A 2Q6BA 3HHEA 2FPHX 1S6PA 2HNZA 3VZHA 2DGTA 3BO2A 1JLFB 4X4TA 2VG7B 1NK6A 2ATLA 1VBYA 2HQ3A 2WRMA 1L3UA 4X66F 1MU2A 4OX8A 2GA7A 4OI3A 3KK3A 1SJFA 4B3RF 1IJFB 4Y2CA 1RTHA 5E3AA 4DMZA 4DBQA 5F8MA 4ECWA 3OBIA 3SSSA 4RW6B 2Q6CA 3CWJA 2KT3A 3DOLA 4RBTA 2HHUA 4HYKA 2HRYA 1N5SA 4CCHA 2W9AA 2YH1A 3OTOF 4HLBA 3CSKA 3MECA 3G96A 5F8GA 4NWBA 2BXJA 2FD2A 4J9SA 1JLBA 2KG0A 2CPEA 2LU1A 1X4HA 5KFNA 3DXSX 2OAUA 3CCTA 2PI5A 5IZHA 1KLMA 2BJEA 2R7QA 3V2UC 2W4CA 1U26A 1U1MA 1YJWS 2RE1A 5KG0A 1TK0A 2JLEA 3BO3A 5KFCA 3LWLA 4K4UA 4FXDA 2GO8A 5CYQA 3H2UB 2L08A 4OI2A 3M9MB 1JLQB 4ID8A 1RGVA 2J0XA 4G1QB 2M52A 3M2UA 4QR0A 2NLWA 5IM0A 1NAQA 3JSBA 3IG1B 3CEDA 2M5YA 4OZJA 5HN0A 4LFAF 3CDEA 1N32F 3TUIC 1S1XA 4OJ1A 2QMWA 3GIMA 5J1EA 1FJ7A 4Z2XA 1A7GE 2GMJA 5GMKa 3H59A 2A10A 3GB0A 2J7KA 3G8SA 3CJ4A 3V4IA 1N48A 2HVHA 4RW6A 4RW7A 3UNGC 3RBEA 4CT8A 4HTIA 4DFPA 2CVIA 5ADZA 4K4VA 2MDAA 3HXMA 1RTHB 2B51A 1TL3B 5D4NA 1NRKA 1ZM2A 4KFBB 1Y7PA 2OO4A 1GAOA 3FQKA 1X9MA 4A8XA 1QSLA 4LF4F 1DLOB 1SUQA 2CQ1A 6FDRA 1C1CB 3FFIA 2C3PA 3M6XA 4IKAA 4IQXA 2LU2A 2NS1B 1DRZA 1U6ZA 1Q7YT 2F9JA 1Q16B 2MZQA 3LH2S 4TLRA 4G6VB 3RB0A 4IR1A 3KJVB 4IOCQ 5M2PA 4QPTA 2UXBF 3GG1A 4ELVA