2XSJC

Structure of desulforubidin from desulfomicrobium norvegicum
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
b'AMIEFKGKSFEIDEDGFLLKFEDWGPEWAEYVKESEGISEITEAHQQILDFLQDYYKKNGIAPMVRILSKSTGYKLKQIYELFPSGPGKGACKMAGLPKPTGCV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SULFITE REDUCTASE ALPHA SUBUNIT
publication title Structural Insights Into Dissimilatory Sulfite Reductases: Structure of Desulforubidin from Desulfomicrobium Norvegicum
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 27
structure length 104
sequence length 104
chains with identical sequence F
ec nomenclature ec 1.8.99.3: Transferred entry: 1.8.99.5.
pdb deposition date 2010-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04358 DsrC DsrC like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.370 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2xsjC02
3.30.1420.10 Alpha Beta 2-Layer Sandwich Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 2xsjC01
1SAUA 1YX3A 1JI8A 3OR1C 2XSJC 3OR2C 2A5WA 2V4JC
chains in the Genus database with same CATH superfamily
3CUQB 3AG4H 4ESJA 4C2TA 6PAXA 1YW8A 2X6YA 1MBKA 3D5RC 4B44A 1QZEA 3I4NJ 5FFXA 2PJRA 2DQLA 2O8XA 3LOCA 4EGZA 1XPXA 5EZHA 5J47A 2JMWA 3K70D 1U5TC 2LKXA 2HYJA 3A1YA 4D5FA 1G2HA 2DA3A 1ZGAA 4IHXA 1UB9A 3G4SI 1LDJA 2Y9YA 5FLVA 2P6TA 5TJJA 2HVQA 2O3FA 2RNJA 1UCRA 2M5WA 2P4WA 1O3RA 4B48A 4M71A 4F3QA 1BC7C 1WJAA 2PEXA 2QF7A 4Y15A 4S04A 2W82A 2O9LA 2H6BA 3OWTA 4OMYA 3J81Z 3L9FA 1HW5A 3JRBA 2CS3A 2L2OA 2KMUA 4QLCU 5L3EA 3BTJA 3M8FA 3FM3A 1F1ZA 1P4WA 3ZQIA 2L9SA 4CCNA 4KITB 4RB0A 4U0WA 2X85A 2Q8KA 4E7IA 5LEKA 2WTEA 3PO2J 4CH7A 5C3EJ 1E3PA 3KP6A 3HIFA 3I3LA 1J2XA 2B9SA 4UUSB 1HLVA 3HZJA 3TP0A 2NVUB 1MJAA 2I5UA 4BEHA 2CMPA 2JWTA 2WY7Q 2X0LA 2HPIA 1QU3A 3GF2A 1MSFC 4M6XA 4EJTA 3L2RA 2E1MB 4XOPA 5J40A 4ZYDA 2QENA 2O61A 4IL6C 5KVRA 3I4PA 3AKZA 3BQYA 3WE3A 4MGRA 4Y17A 5HNFA 2FF4A 1T6SA 2NOJB 2DT7B 4XLFA 4Y13A 2NRAC 3S14J 3GTQJ 2QBYA 5IP7J 3BROA 4B47A 2IA1A 3VWBA 1P4XA 3A01A 3I4MJ 5L3CA 2NVXJ 1RNLA 2MYSA 3LA3A 4QWQA 4LLLA 2OJED 5J1UA 2EV0A 2E1NA 2K86A 5TRDA 4BQOA 3S1RJ 5L3DA 3DBLB 3O8HA 3DEWA 2Y0SA 1WRJA 1PVEA 2H6CA 2Z99A 3H3VK 2BYVE 3CJTB 3QODA 1HSTA 2ZCWA 1LE8B 3HOTA 2M4KA 3WTVC 1YJWI 5FRNA 2OD5A 1HBXG 3GMEA 2DA5A 2ZO4A 5FGMA 2MW8A 3SJMA 1MGTA 2JN6A 2EFNA 3V4GA 2OTLI 1TW3A 3HOWJ 1FOYA 4XQFA 4HW0A 4NQWA 2UXNA 3HRMA 4JK1X 1IF1A 2IEKA 1LFBA 1EKEA 1YE9A 1RPWA 3H0DA 2CV2A 2LBFA 1XSVA 1OR7A 5JVGF 3S2DJ 3BY6A 4IJAA 4XKBA 4AUXA 1FMVA 3NEUA 1ZR4A 5GTHC 3ABUA 4FHTA 2ISZA 2HQAA 4RM2A 2IRFG 1UZCA 3E5QA 1M1EB 2X1EA 3GX4X 3CMYA 5FKOA 2DXIA 1DDNA 3VB2A 4AU7A 4PJJA 5H6QA 3RKWA 4OINF 4OMZA 1V54H 4RAGA 3M7GA 3P9CA 2GOMA 3ULQB 2FA5A 3ABKH 5JFRA 1R5HA 3HSEA 3CLQA 4BXXJ 3P9IA 3OMYA 1JI8A 1BI1A 3K4KA 3OYAA 3W2VA 2XHKA 3IRQA 2D45A 5TGTA 3VSKA 4UB8C 3R6SA 4LD5A 1ENHA 3U1DA 5GAGJ 1PP7U 1ONVA 4A3GJ 3ML6A 4EJWA 3MD2A 3HOYJ 3G2BA 3MVPA 4E7HA 2BW3A 4XRSG 4L9NA 3K4NA 1WJCA 2ID3A 3WHCA 3JRAA 1TWHJ 3ABTA 5ILUA 3EUAA 2BE5F 2YR2A 4XKCA 5HDNA 4FQGA 5D5WB 1QPIA 5K5QA 1YS6A 2XSDC 1YJNI 2R5ZA 3KZIC 1KONA 2DJNA 2ADUA 3J7AO 1OCCH 1Z7LA 2KRFA 1OQYA 2DBBA 5GAEJ 3ZXSA 1U78A 4XRMA 2K5CA 2Q1ZB 3AAFA 1TQPA 3UNGC 3CTAA 4I0AA 4JYKA 2XKPA 2W57A 2M1BA 3R0AA 1OLTA 3KE2A 2W1OA 5F64A 1Z3YA 1MMGA 5FD5A 5IP9J 3RZDJ 3GFJA 1LVKA 3HSRA 4A5MA 5LLQA 1UG2A 4E4HA 3EYIA 2VONA 1OR7C 1FBUA 1T95A 3IV5A 2NVTJ 2QA4I 4ITVA 2XVCA 4HQEA 5LHGA 1W5SA 3GTGJ 4EM1A 3RYRA 4C2MJ 5DYMA 3R4KA 1PDNC 4BQQA 4AYBN 4A3JJ 2D2WA 4X6AJ 3VEPA 3IAS2 2K3FA 3QAHA 5FKKA 2K85A 1LKXA 1OCOH 3KP5A 4KN4X 3RQIA 1ITYA 1F4KA 2M7AA 2CUJA 1U0JA 1HXDA 1X2MA 2KIUA 2R7FA 3S1NJ 1X4OA 2EIMH 3HOXJ 2BEOA 1L0OC 5L3GA 1WJ5A 1F36A 4KDPA 4XK4A 1K61A 4ZYAA 3G1MA 3ZMVA 1VQ9I 2IGMA 3Q9SA 4R8HA 1SVMA 4KIFA 1J5YA 1SFKA 4BXUA 5DCMB 2JA6J 4N4OB 1D1AA 4BL0B 1X1PA 4L9JA 1ZG5A 3OOUA 1U2WA 2BHYA 5F1RA 4QTRA 2OPTA 1A6IA 3ELKA 2L5QA 2X48A 1J7KA 1IN4A 1GXQA 1IZ1A 1MJ9A 2L01A 4Y3OA 2IA0A 2F4IA 3JRGA 1XX5A 3F9KA 2HDWA 4Y33A 3DKWA 1J0RA 1FJLA 1RC9A 1K4SA 1AHDP 5DD4A 4KJZA 2UZKA 3HXLA 3WTYC 1Z9CA 5CQEA 2BXZA 2D1HA 2WWYA 3OR1C 3GBGA 1Y0NA 2OCCH 3CCYA 3HL2A 2ZSIB 3L2QA 3TW6A 4LITA 1RUOA 3PIPF 1DP7P 3V7SA 5BQTA 4AIHA 3MZHA 2H8WA 1YW7A 3VPRA 3OYEA 3CUOA 1KQ8A 4ENJA 2QYOA 2W24A 5E8IA 1R71A 4ENKA 3BR6A 3RQ4A 4IRGA 2XGCA 4BE0A 3HUGB 1W7PA 3CUQA 2V1DA 2B0LA 5JLXA 2UWMA 1S6LA 2ZNYA 3H35A 3OL4A 2P7CB 2LNBA 4H4KC 2LREA 3T8TA 2V4JC 4N0BA 2AHQA 5BNGA 1D1CA 3ASNH 2YS9A 1LDDA 2PLYA 2LK2A 3HPHA 4K2EA 4PSWA 2OBPA 3WGHA 2EA4A 2DK5A 3LWFA 2PX9A 5IT3A 1H89C 5D4RA 4P1WA 4LOCA 2VKHA 1SAUA 4LIUA 2DMPA 4D7MA 2DW4A 4RMNA 5DCFA 3SZPA 3GLLA 4NC6A 1G3TA 3F8BA 1P4AA 9ANTA 4RGXA 2GOXB 1SD6A 5FRMA 4PDKA 2JVGA 2RC4A 2BGCA 1FBSA 3CO7C 1K79A 1SMYF 2R7VA 3CCRI 4L5JA 4PGGA 2L54A 3F0CA 3D5LA 1NK2P 3EPZA 2PMZA 3BCBA 2CH0A 3CCSI 3TDZC 1D1BA 1EV7A 1ZLKA 5ILVA 4AWXB 1O7FA 3CMAI 2FNAA 4EJUA 3QWLA 2CWEA 5HLHA 1T2KA 4II2A 3K1PA 3K4JA 2O7OA 2FUG2 1JJ6C 1WJFA 3MCZA 2CV0A 4CYCA 4D7NA 2GA2A 3LSGA 2VQGA 2YX7A 1CQTA 4GCVA 5KAFC 1XGSA 3PNVA 2EK5A 4LFUA 3F22A 4I0BA 4CICA 1G3WA 3A0HC 1LEAA 1O57A 2HTJA 3CUQC 5EEGA 4CCLA 4ZYHA 4FE4A 4KFCA 3LSJA 5C4JJ 2PFBA 4IVNA 1FZPB 4JQFA 5GPCA 4L9VA 3J7ZI 5KK1A 2KRHA 2X1CA 1WKMA 3T0YA 3QPHA 4V19K 2VBYA 3A4CA 4DNCA 3L7WA 1MNDA 3V8LA 1SFUA 1ETWA 1ZK8A 1YLFA 4EEFG 2ZFUA 1LE8A 4D9JA 2FD5A 2E60A 4P96A 2JA8J 1MH3A 1RR8C 3OOPA 2EIKH 2VT2A 5HODA 3JTGA 2DMQA 3NARA 1I5ZA 2D5VA 3JW4A 2XF5A 4MTEA 1CF7B 2GAUA 5AIQA 3RCOA 1Y1WJ 4QPQA 3ZMDA 2H1KA 5FO5A 2CRGA 3FK6A 2HQNA 5D5UB 3F23A 2EZLA 4EJVA 2VXDA 3DTIA 4MTDA 3GCMA 4LG0B 1OMIA 2LY9A 1QO0D 2VJ4A 1R58A 2QKLB 5LGNA 2EFWA 2XGEA 4MFDA 2A6EF 3K0LA 5E1XA 1A04A 3IH3A 3WU0A 1EH6A 3FKJA 3NRVA 1N78A 3MQ0A 2WAQN 1I3QJ 3G1LA 2F4OB 5J4YA 1USTA 4KISA 4HLXA 1MDMB 5J1YA 5KHDA 2ZJRF 2DA4A 3SHFA 1X1AA 2E1MC 2LMDA 3MKLA 4A6DA 1YI2I 5HLGA 1HOMA 4GRIA 1GT0C 1XSDA 4PUSA 2ELKA 1LVAA 2LP0A 3E3VA 1FY7A 3GZ5A 3F6VA 3QPLA 1IO2A 3S3NA 1FIAA 4KNYA 4D1QA 2B7EA 3GXOA 3B02A 3DBHB 2R92J 3OR2C 4I7HA 4U7DA 1DPRA 3CLOA 2FQ4A 2QQAA 5FKLA 1R1TA 4EM2A 2VASA 1I27A 2CJJA 3WTSC 5B1BH 4EJOA 5LBQA 2LF8A 2GXGA 2P5VA 2XF7A 1Z91A 5ILSA 2LR8A 4XLPF 4GFBA 2OUMA 5C4XJ 5DDGA 5M5WJ 3HHGA 3JSPA 2FU4A 4U7BA 2X6XA 1G4DA 2IS2A 5FKMA 5JHFA 4BE2A 1BL0A 2VPLA 1F43A 2M2EA 1BOBA 3CF5F 2CYYA 3BT9A 3HPGA 5HS7A 2ICWG 3H9GA 4NBQA 2V6CA 2IS6A 3KFWX 1FSHA 3BTLA 4LB6B 3K1NA 1YTYA 3K4CA 2DA6A 5CVUA 2HTSA 5E1WA 4PFPA 1R6RA 1ZGWA 2O6GE 2XUBA 3FXKA 3LQRA 2WV0A 2DO7A 3I71A 1TLHB 4UVBA 4FE7A 5DS9A 1OKRA 1IV8A 1IUFA 2DQRA 1YX3A 4BBSJ 3IH2A 2K02A 3FHZA 4HYEA 3TO7A 1ETKA 1TW2A 2OQGA 1O4XA 4UNOA 3HKZN 2GZWA 2G9WA 2RV8A 3U21A 3Q0UA 3DKXA 1BR2A 2LLKA 4MIMA 3L00A 1HQCA 4KICA 5ERIA 1VQPI 3E0JB 3RPUA 4BUPA 3K69A 4BY7J 2GM4A 2BY3A 3FX3A 2E2HJ 5TISC 1RESA 2ZKZA 4E7ZA 5DCMA 4P55A 1AKHB 2WV1A 3NQOA 1OCZH 1MMDA 4HOBA 4YIIA 1HKSA 2ECBA 4AIDA 2M30A 2JRMA 4XKWA 2OF7A 4DOZA 2Q2EB 2GWRA 2YPRA 4P9UA 4NNJA 4DJAA 4DBQA 4EGYA 3IWFA 2BV6A 3DPLC 4II3A 1MMNA 4I6ZA 2PN6A 3QOEA 3BWGA 3D1NI 1KQ9A 3KEYA 4YEJA 1HC8A 2QWWA 1GVJA 3V42A 2P0WA 1HW2A 3SEQA 2DYRH 5ICFA 1OPCA 1KU3A 3J80Z 1P2FA 3DLAA 3PSFA 1VQLI 1MMSA 2NVQJ 1SD7A 2MA3A 2XPUA 2ZB9A 3LSKA 2C6YA 3LAJA 1XCVA 2Y0MA 3HRSA 3I59B 3CZ6A 1XG1A 3KEQA 1RIOH 3BZ6A 3ZQ7A 3BG3A 3ZR8X 1WZ2A 3I54A 1ULYA 2JPCA 3HUGA 2EBIA 3H5RA 4AM3A 2DOFA 1NH3A 4UV9A 2ZNZA 2R7XA 1EF4A 1Z1DA 2F5FA 4XLCA 4Q4ZF 4A3CJ 5E3LA 5IYDJ 4PJMA 1UHMA 4YIFA 2KDZA 1K7AA 5D4SA 4S05A 1USSA 2NOGA 3ZN0A 1D3YA 4BQAA 4RAZA 3ABLH 4OOIA 2CQ7A 5HDGA 4OIPF 2HWVA 2E2JJ 3EUKL 2F5EA 3J7YJ 3PIOF 1FIPA 3EDPA 1S9HA 3DFGA 5HS8A 1W0UA 4G9YA 3CDHA 4ESFA 1XSXA 5GADJ 4C3JJ 1A5JA 4I09A 5A2QZ 4D5CA 3MAJA 4BJ6C 3QU3A 2LY2A 1Y1VJ 1YX5A 2EILH 1S3JA 4RLFA 4A0YA 3M1CA 5E18F 5CVRA 5M3FJ 3M4OJ 1TQMA 3QYEA 1XGOA 3BR3A 4PZJA 4BJTA 4ESBA 1QBJA 2EINH 3HM5A 2Y69H 1I3AA 1MKMA 1KYZA 2HZDA 3PQKA 3GTOJ 2QLZA 5CYVA 3LA2A 2JUGA 1O3QA 4ZC3A 1TWAJ 3CCVI 3N97A 1OISA 4XLAA 1Y6IA 3BR0A 3WTWC 3VSLA 3CCMI 5EF6A 1VQ8I 2P81A 4O3MA 5DD8A 4CYDA 1T98A 1S7AA 3ASOH 3OYBA 3GTMJ 4A3IJ 2FOKA 1YG2A 3AG1H 2EB7A 3G1OA 2JSCA 4XSXF 2A05A 3H36A 5J4VA 4HX4A 5FROA 1PP8F 3H5NA 4J00A 4B4CA 3OYHA 3JRHA 2K7LA 1FP1D 3GTLJ 2RN7A 1JT6A 1DU0A 3K70C 1HDDC 5DUKA 1S29A 3K10A 1QZZA 1B9MA 4WCGA 3KP3A 2CQKA 2NAZA 5GTIC 5IYBJ 2P8TA 3DQVC 2R7OA 3ZQQA 3HOSA 2VQCA 3OYCA 1Q1VA 2Z2SB 1V4RA 3WGIA 2QSHX 1FOXA 2WBMA 1W5TA 4BHCA 4L18B 1CGPA 4BNCA 2L4AA 2DDAA 4M73A 3WE2A 5EJCA 4A3BJ 1WSUA 2AQFA 3HDDA 4XORA 3T1BA 1POGA 1U9OA 1U6GA 4DZJA 1CF7A 4ANJA 3M07A 3ZP5A 5H6RA 4WWCA 5K7ZA 1IJWC 3W2AA 3CCEI 1D8JA 4F7ZA 4B3XA 4G7OF 3DU6A 4LG0A 3MWMA 3OYKA 1JTXA 2M45A 1PUEE 3S2HJ 2XAQA 2OQRA 1ZYRF 2QM3A 2XPVA 2Z3YA 3B73A 2EH3A 4XN3A 4KIGA 4EM0B 2DOEA 1I1GA 2ELJA 2QUFA 2Y0SN 3NAUA 1JXSA 4PJ0C 4G94A 1IAWA 2HDCA 1HW1A 4QPOA 1F5TA 4YFXF 2ISYA 2OZUA 1MDMA 2F4MB 2HFHA 3I56I 3A2KA 3KYDB 1R1VA 1MNEA 1IGNA 2AXLA 3IHUA 5DM7F 3KETA 5EEHA 4IHYA 1DGRM 3VOEA 5D8LB 1MJBA 1IN6A 1X1CA 1YHQI 2EPFA 4B09A 1LJ9A 4NC8A 4A3MJ 2V26A 1MW7A 2E36A 4BS9A 2GXAA 2A61A 5JI6A 3BDDA 2A5YB 3SXYA 1MSEC 4GXOA 3IUOA 3LFUA 1Z3XA 3HHHA 4DIQA 3OYFA 2RAEA 2VXZA 3BG5A 2G7UA 3FBNB 4KT5C 3BR1A 5A2QK 4PSXA 2K9LA 5M5YJ 3J81K 2NXNB 2ECCA 1WHUA 3RDIA 2F5DA 3D0SA 3VYRB 1XC5A 4I01A 4A2UA 2LSOA 4V2GA 3S2WA 3NWSA 2EZIA 4IF4A 4FISA 4PCQA 4IHSA 3R0JA 3V7RA 4I76A 3LSTA 2RDPA 1X19A 4BDYA 3AL0B 1G6NA 5BPIA 1K6YA 5E8GA 5ED4A 4ENMA 2NVYJ 4BGDA 3DLLF 3QP6A 2FNPA 3J7AY 5LGTA 5M5XJ 1JKOC 4GYGA 2GIVA 2LKSA 2E1OA 4IHTA 2EFQA 4XSZF 1ON2A 4M6YA 3ROUA 4I98B 3L2WA 1FC3A 3L2CA 4M3EA 1SFXA 4OIOF 1TWGJ 1GDTA 3FXJA 1TTYA 2VOPA 1ACIA 3CDLA 2XGXA 2DU9A 1XGMA 4RGRA 4BBRJ 3AG2H 1YW9A 5CQGA 3NWTA 1W4MA 1X58A 2FBIA 1TNSA 2HGCA 2Y48A 3H1CA 4P5OA 5B1AH 1HF0A 5IP6A 1B4AA 4NHJA 3S8PA 3HB9A 1TWCJ 3K4MA 4JOMA 3DEEA 2IGNA 4U87A 2R7DA 2M8GX 3QQAA 5LFAA 4IHVA 1GUUA 3CC2I 2KL4A 2XC7A 1UHWA 5E17F 2K3PA 2G0EA 1T08B 3WTXC 1AKHA 1Z67A 3GFMA 3X2QH 2DYSH 1R23A 3FWEA 4A3LJ 3PUBA 3E5UA 1SVOA 1U3EM 2Q2EA 4G8XA 4M72A 2QCOA 2DAOA 3JRCA 1E3OC 2ID6A 2CUFA 2BY2A 4E7KA 3I53A 5IYCJ 3SZGA 1IXCA 3BPXA 4XONA 4HX8A 5F1JA 2NS0A 2MC3A 1K83J 2CU7A 3DKYA 3OL3A 2R7UA 1YS7A 1OJLA 1YOVB 2DMUA 1IRZA 2PMUA 2MH2A 4HBLA 3A0BC 2Y9ZA 4I99C 3PUFA 4NC7A 2Z9OA 4GYIA 3E6MA 3CCLI 3MKZA 2HKXA 4M3FA 4MEXF 3ZMUA 5D6EA 3UR3C 4QSHA 2FX0A 3B6CA 1ZRCA 3IRRA 2V7FA 3JRDA 3BG6A 2MLKA 1D8KA 3K6GA 3FXUA 5L3BA 4FX4A 2R7TA 2ZFWA 4PK4A 2L02A 4OWRB 1RRJA 1VQ4I 2A07F 3CO6C 4H0EA 1QRYA 2H27A 3U9GA 1Y56A 4V2FA 2ZC2A 4MO7A 4KMUX 1QGPA 4HA8A 3ZQFA 3LMMA 1A6QA 3BTIA 4UHTA 3Q0WA 3IAM2 3JRIA 3ERED 2K9NA 2KIMA 3M8EA 3CC4I 1IN8A 2KJBA 1R5ID 2B63J 3C1DA 3KYLA 1JUSA 2IBDA 1IN7A 2PG4A 2WB1A 4CZCA 3UKGA 2ZJ2A 4HAMA 1MZBA 2LC2A 2VBXA 2QSGX 4ZZDA 4DYCA 4E7SA 2VBZA 4IPAA 1UAAA 1FP2A 1XDUA 1D0XA 3F8MA 2V9VA 3IKTA 3C18A 2PI0A 2WAEA 3ISPA 4PJNA 5HOOA 3W6KB 1PYVA 2DJIA 5JHUA 4HPQA 2JT1A 3OYMA 5AIPA 5GP9A 4BDZA 1R00A 4E7JA 1R22A 5M3MJ 4MHGA 1RETA 2GA1A 1W7PD 3KX2A 4XLHA 2CW7A 3WTTC 2O8KA 4MQVA 4O5VA 5BOXA 1YIOA 4XNFA 2CFOA 1YIJI 4MQ9F 2DLLA 4EQQA 3V7CA 2PJRB 2Q0OA 1X3UA 4LGWA 4ZYEA 1F9NA 1JUMA 4I2OA 1XB4A 2Y2ZA 1H9GA 5LD2C 1SFOJ 3ZN1A 4UUSA 1I6HJ 2LTPA 3E6CC 1I6XA 3E7LA 4A0ZA 1H88C 3GWZA 2CW0F 2HDDA 1MBHA 4CHUA 2DT6A 2L7MP 1XMXA 1NK3P 2KFDA 3K4LA 2LD5A 4XICA 2M87A 2KIFA 1DQUA 2MSYA 3S3MA 2CQXA 3GUDA 4JX5A 5D6FA 2XRLA 2XAGA 1ETYA 1EA3A 1TZLA 1WGXA 2LFBA 1X3WB 1B6AA 2HXIA 3C2HA 1O3TA 5EYRA 4G6QA 3SDGA 4C9YA 4ETSA 4R79A 5HDKA 2BXYA 1SVLA 5H2FC 2DFFA 1BI3A 2PMZN 1TC3C 2DPUA 2E5NA 3DP7A 1XD7A 4M3GA 3R61A 2FRHA 4L5IA 3U2RA 2EJRA 3JRFA 1ZG1A 2CV1A 3PM1A 3GW2A 5DTDA 1WI9A 3CCUI 2JVHA 3FIWA 3LSHA 2TDXA 1Y8RB 1SD4A 3Q3SA 2VQHA 3VYSB 2QBYB 2X4HA 2HOAA 4XL9A 3K1MA 4AIKA 3BR5A 3MZYA 3CJRB 3L2VA 2Y31A 1KYWA 3QOPA 3RYPA 4JP0A 3CCJI 2DMNA 3MMYB 2IPQX 4BKXA 2IP2A 1SAXA 2ZBKA 4ZDOA 2JA7J 1R1UA 1QHGA 4AVZA 2IGKA 2GXBA 2VQLA 1IUYA 2Y30A 1HA8A 4AD9A 3V8KA 5EDNA 2X1DA 1BR4A 4CZZA 1T0FC 2K9MA 3FMRA 4C3IJ 2HPMA 4ENNA 3K9TA 3WODF 4R1HA 3VYTB 2I8DA 1BN5A 1GV5A 2LH9A 4FETA 3PL8A 1T8IA 3HRUA 3I55I 4KT6A 3HYIA 1A36A 2XRNA 3HTSB 4GO1A 1QHHD 2F6CA 2KDOA 2XAUA 2A6HF 5LRRA 2ZJPF 3OS0A 3GTPJ 1KGSA 2RGVA 2VJ5A 5CJ9A 3TL4X 5D5VB 2OTJI 4YFKF 2ZMEC 5K7HA 1ZH5A 3IL2A 1D0YA 4GGGA 1VFCA 1MBFA 2DOAA 1HCRA 3BJ6A 3CESA 3OS1A 2MG4A 2NYXA 4YG2F 2FBKA 4N9HA 3M3YJ 2BY1A 1WFXA 5DUIA 2IS4A 4EVIA 2JJ7A 1IG7A 3GTKJ 1UHSA 3BCAA 1ETOA 3TOBA 3ZQHA 5F04A 3CC7I 2RKHA 3COAC 3CP2A 2CUZA 3TW7A 4Y4RA 2H8RA 1W36D 5EZGA 2AQEA 5D8KB 3G73A 2IGOA 3WTUC 2TRTA 3O8GA 1WJBA 1R5GA 3REOA 1YRNB 3SFZA 3RI4A 2V1XA 1U8BA 3TO9A 3DPTA 1R9TJ 3FZVA 5GPAA 3ZGKA 4CCJA 2PMHA 2JK3A 4Z6YA 1B9NA 2KHMA 2NNNA 1Z6TA 4DW6A 5H20A 2FJ1A 2RNGA 4XLEA 1BM9A 4EMSA 1BIAA 1BI2A 2FXAA 3DXJF 2UXXA 2DMTA 2ACJA 4XRSA 2QEXI 1WCMJ 3O2PE 3IWZA 4RB2C 2WA0A 4MEYF 2MD5A 5K7FA 2MBFA 2X9DA 3E6BA 1JHFA 2BVMA 4A5NA 1FOKA 4KYWA 1E3HA 3KP4A 2VODA 3KPHA 1EJ9A 4WK8F 4OU0A 4DQ2A 3I64A 2ZXWH 3IC7A 2KJCA 4WXCA 3BR2A 5F0FA 1MBJA 3L2UA 3I58A 1J59A 3LAPA 1ZGJA 2RVCA 2YU9J 2JZYA 2P7VB 4G7HF 4RM3A 4W97A 2DK8A 2YUSA 3T5XA 3OSGA 3FXQA 2LG4A 2RREA 5EEAA 2M0CA 2JTVA 4ZJZA 2A3SA 2CG4A 4F92B 2VE9A 4CCMA 2L9NA 3AL0C 2OA4A 2HU9A 3GTJJ 4F91B 3MFKA 3EUHC 2COMA 5F6FA 3K2AA 1SFEA 1V55H 2BY0A 2FEZA 2H94A 2YU3A 4B3AA 2O5RA 2GIZA 3OIOA 4Z2YA 2FE3A 4RDUA 2LDUA 2K9SA 1MH4A 2XB5A 4BYYA 1REPC 5LGUA 5GAHJ 5CKTA 2QKMB 3DPUA 3H0GJ 1N75A 1JGSA 3LNQA 5J6XA 1E2XA 3PFYA 4MLOA 4LIVA 2R4GA 4XLNF 3KCCA 4LLNA 3HGGA 2XASA 1NHAA 3FXOA 2HYGD 2ZSHB 2M8EA 4BJ5C 3IKVA 2E35A 1ERDA 2ME6A 2L7KA 1ZAOA 2WC2A 2W85A 3H92A 5J8FA 3GVAA 4JBAA 2QVOA 2L3DA 3CF2A 3GZNB 1ZRDA 3KZZA 3GO5A 1UG0A 4RB3C 2W00A 2IVMA 3OYGA 1T39A 4KIBA 3W2WA 3SZTA 4LB5A 3G71I 1JKRC 1RKWA 2KRCA 1N77A 2OC6A 2V6EA 3FXRA 5IPAA 4ZTJA 2FMLA 5JVTA 2EWNA 2KZVA 4LMYA 1RUNA 4BACA 5E3MA 3P5JA 4JX4A 4L9TA 2KKOA 2KIQA 4BHBA 4Q47A 5CPRB 1P7IA 4AIJA 3S3OA 2O03A 4N4NB 4U0YA 5KAIC 3F3XA 2MGQA 3H5AA 5BPDA 3WTZA 5HVQC 2A68F 1B8IB 1SC7A 3WU1B 1R4MB 5BMZA 3TQNA 1K6OA 2EFPA 1W7PB 3ZMSA 1BC8C 2R7WA 1TBXA 5IOYA 2VT3A 1TP4A 4M74A 1BW6A 1OYWA 1V5FA 1G8XA 5JLWA 2HVRA 2DA1A 2G7HA 4IXAA 3DF8A 4IRHA 4RS8A 2JSPA 2CO5A 4D0PA 1VQ6I 3KEOA 3H3UA 4W1UA 1V5EA 3TDUC 3W6JB 2XAJA 5L3FA 5HLTA 3RKXA 3ZMZA 1IXRC 4HSTA 2M0MA 3S1MJ 2KPMA 4CXFA 4WX9A 1HDPA 5AONA 1UFMA 1KU9A 1MNMC 2CW8A 2DTZA 3WU2C 1A31A 1FWZA 2EZHA 4C2UA 3DTKA 4NB5A 2MC4A 2LVSA 4DBRA 2Z1DA 5FJ8J 3L1PA 1FYLA 1ETQA 2XAFA 4L0ZB 3CQZJ 2Y75A 2HKOA 4ABZA 3JAMZ 3TEDA 2W48A 4HRIA 4A69C 2Z5UA 1KQ0A 4KN7X 1BI0A 1GLNA 1VF9A 1DPUA 3LSMA 1XS9A 4WXDA 2L0KA 2ETHA 3B6AA 3RIRA 1HKTA 2FBHA 1S72I 4OAYA 5BS6A 2ZMEB 3KYCB 1XMAA 3QYBA 2NS8A 2VI6A 1QQIA 3GLXA 3I5UA 4YRVA 1ORKA 4RAYA 2D1VA 2KLOA 1VQMI 5J1RA 2R7ZJ 2GLOA 1XMKA 3MKWB 1R7JA 2DA2A 2E2IJ 2K4BA 1DP3A 1FLIA 2F48A 3VYUB 1X3ZB 1LNWA 2XPWA 2HI3A 4CYCB 3J80K 2FSWA 4AVPA 3KLNA 1X4PA 1W1WE 1S5LC 2COBA 2BOLA 3LFKA 2RQQA 2ESNA 3HOZJ 3MZ8A 2KT0A 3PJRA 2CUEA 4FT8A 2MLGA 2VIXA 4IOAF 4ASNA 1E17A 3E6DA 1B72B 3HOUJ 5EG0B 4KMFA 3P7NA 1I50J 1QZYA 4WXHA 1KZHA 1WVRA 3KP2A 4I02A 1ZRFA 2P5LC 4M3BA 2VBWA 3JSOA 2EIJH 3BG9A 1IN5A 3EETA 3SYTA 3OYJA 3G6EI 1O3SA 2MABA 4HF0A 4UXNA 1UMQA 3ESWB 2F5VA 3DV8A 3CCQI 1BR1A 4HNTA 1HSJA 2QQBA 1TNTA 4UUTA 1Z0XA 4DGWB 2W7NA 2M34A 3DTEA 3F8CA 4LJZF 2AS5F 2DA7A 4A93J 2Z33A 3FF5A 2HXOA 3W3CA 3OYLA 3PNYA 3OIPA 3OYNA 2VB6A 2UV1A 4FASD 2MH9A 3GEZA 1MBEA 3E97A 2UUZA 1QNTA 3FMSA 1QVTA 1AWCA 1LFPA 2LY1A 3QPSA 4ZH4F 2XROA 1WH7A 2E7WA 1X2NA 3CDIA 2QQ9A 1AOYA 2FOWA 3GYHX 2XAHA 2LKPA 2AO9A 1ZG3A 5B5EC 4ZTFA 4F52A 3TO6A 1NG7A 3SQNA 3BTCA 2VJIA 5K1YA 3IH4A 5FLXZ 1OYIA 1FX7A 2J5OA 2L4MA 3JREA 1K4TA 3V8JA 4QIWN 1VQOI 2HVSA 3BPVA 4A3DJ 3MN2A 2K9QA 4L5EA 4CA0A 1YRNA 4M9ZA 1G3SA 3S1QJ 2VPRA 4BE1A 1KU7A 2HYFA 3VDXA 1ZN2A 1D0ZA 2E5ZA 2E71A 3JAMK 2XF6A 4HNUA 1Y39A 5E3NA 1ZKGA 4BH9A 1H0MA 1ZARA 3FBIB 3FMQA 4RB1A 3M1EA 2OAZA 1PUFB 4UB6C 3OY9A 4M3DA 4XKVA 1YFHA 2HOSA 2IAIA 2VOOA 4DYQA 1JUPA 4AYBA 2VE8A 1OFCX 3ERMA 4HZFA 2ZJQF 3CMMA 2STTA 1WI3A 5EGOB 3GFIA 1ODDA 4M9SA 2JA5J 2JPBA 1WJDA 2LOOA 3TP3A 1Z21A 3TMOA 2VJJA 3FK7A 4X0GA 1P9QC 1T56A 4N9IA 3L09A 1WPKA 3QP5A 4ZDLA 2V9PA 1T38A 1V5GA 2I10A 1V3FA 1I39A 2NS7A 3FDYA 1TT0A 4BQNA 1RZ4A 2X51A 1B1BA 3ECOA 1Z7UA 1UELB 4IO9F 4A3EJ 5ICCA 1TT5B 1A35A 3ZQCA 2VUMJ 2M7BA 2K4JA 2DFHA 4CCOA 2W25A 1EH8A 4ZZLA 1IXSB 3ZMTA 1U5TB 1ZREA 1P6RA 4CCKA 5CVVA 2F2EA 4U0VA 3A03A 4HG2A 4G6TB 4HDUA 3F8FA 3OS2A 2PQ8A 2L9RA 2STWA 2BVLA 3I59A 4TV7A 5FFZA 5DV5A 1OCRH 1JHHA 1LPQA 3HGYA 3F72A 5E20A 1FYMA 2EFOA 4JX6A 2XDVA 2E7XA 1TL8A 2CGPA 4NDLA 3WG7H 1FYKA 4HSRA 3TGNA 4ZDPA 5FLMJ 1K78B 2VLAA 1KA8A 2XB0X 3ZCOA 1Y0UA 1VTNC 4BHPA 2XSJC 3HSFA 1ZLJA 4Y52J 2CQQA 4GDFA 1GVDA 3GZ6A 2XKOA 2EA2A 5HLIA 5IT9Z 3FM5A 3GFLA 5LHHA 2R5YB 1W0TA 2MFZA 5FLXK 2HNHA 5FB2A 4U88A 2ELHA 1ON1A 1Y8QB 2QZ8A 4HF1A 3T8RA 1MIJA 4ON0A 3M8JA 5HS9A 1WWXA 5K5OA 1G3YA 5FKNA 2DODA 4A0XA 1JE8A 2Z16A 1OCPA 2CFXA 1B8IA 2DDBA 2H09A 3QRFF 1H9TA 5LHIA 5CVIA 3LSRA 2P6SA 4HV6A 3RPQA 1B59A 1UJ8A 3FXLA 2EV5A 1P92A 2IA2A 3BG7A 1VZ0A 1VQKI 2WB1N 3U1KA 2FQ3A 3HBLA 1YJ9I 1L3LA 2DPDA 3EQLF 3O3KA 2J5PA 3QYFA 1FTTA 2AXTC 1JTYA 1O7LA 2R7RA 1Z77A 3CJNA 2BZTA 4LK0F 4B8XA 1D5YA 1T0FA 2E34A 3N4MA 2R93J 1IRGA 3IP4B 3BJOA 4B1RA 2R0QC 4UUVA 3DBRB 3OSFA 2XV4S 4YFNF 4FCYA 1ETVA 3K4BA 3BZCA 4C30A 3Q0VA 1IRXA 4M9XA 4J19A 5CLSA 2YSRA 1X1DA 3Q9VA 3VODA 3OYDA 1I1SA 3JR9A 1TWFJ 5C44J 5CVJA 1LQ1A 2LF7A 3FHNA 2H1LA 4OIQF 3DCFA 4IQJA 4CDGA 1VQ5I 1ZQ3P 2DI3A 2VC0A 4OAZA 2ME0A 1BA5A 3FISA 3AG3H 3KLOA 3ZQLA 4RGUA 4F93B 4HX7A 3AFHA 4O6JA 5D5XB 3DU5A 2V9KA 2ZMEA 3S17J 1S7OA 2A5WA 2L9VA 5HNHA 4BEHB 3LSIA 4FTHA 1MBGA 3S93A 4XRFA 2YX4A 3LQQA 3PSIA 1SEUA 2HOTA 2DT5A 4EV0A 4WF2A 2PJPA 4XM3A 1RI7A 2IW5A 3H3ZA 2JA2A 5E79C 5F0HA 3QPTA 1VNDA 2EQRA 1JT0A 4Q5SF 1D5VA 1AA7A 1VQ7I 4HDVA 1W5CC 2PBIA 1RR7A 2BBYA 3BZKA 4C3HJ 3A01B 4A6EA 3F21A 1BJAA 4DZPA 1B72A 2F5CA 5EG0A 1IRFA 1STZA 2QGUA 3G3ZA 3TOAA 5F0CA 3ZPLA 3K7AJ 1ETXA 1H8AC 3SFIA 3JTHA 3R60A 2DFEA 3LL7A 4L0YB 5F27A 4CO8A 3A02A 2M4GA 4XR6A 5ICEA 1U8RA 5J8CA 1S8NA 3W6VA 1IV6A 4M6VA 4MNUA 2WAQA 1X1BA 4YELA 3HC7A 4XIDA 3ZOBA 3E5XA 2K40A 5IT9K 1J75A 2NNYA 1R4NB 3I9V2 3C2GA 1WQ2A 1FOWA 4RLQA 5B66C 3H9JA 3HJEA 3KP7A 1ZTRA 2VKDA 4PGHA 1SD5A 4UVCA 2V1UA 2DFIA 3F8NA 2ZXJA 3ZQGA 4UY8I 3HOVJ 1OCTC 1FT9A 1Q1HA 2OV7A 4UV8A 4NUBA 4HF2A 4NQWB 3BQZA 4PJLA 2M3AA 4AC0A 2LBFB 4IX7A 3F6OA 4IOCF 1Z6RA 1LUJB 1XN7A 5IOZA 1FTZA 1PJRA 1DGWY 3N05A 4A12A 5K5RA 1YO5C 4FX0A 3ECHA 1WJEA 1U9NA 4HNVA 2M9HA 4Q48A 2HS5A 2JRTA 1FSEA 3BOQA 3MKYB 4B43A 1WH5A 2LYCA 5B3SH 3Q5FA 2JQ7A 5JR3A 4YIRX 2L7ZA 1YQAA 2E1CA 4BAYA 3EUHA 2VL8A 3PQJA 1BBYA 1MD0A 1LDKB 1J09A 4BY1J 2IS1A 4HV5A 1QPMA 3C2BA 3DEUA 3E1SA 1R49A 4CGZA 2R7QA 1G59A 3RKQA 2IT0A 2CSOA 3S15J 1FPQA 1S7EA 2W4SA 2DCEA 4XMYA 4XOTA 3LSPA 3KIOA 2P5KA 4UVAA 1FMWA 2KISA 3HTUA 4CUGA 5E3OA 3RKYA 2BW3B 1GV2A 3O6BB 3HRTA 4RBOA 2GBYA 2ESHA 1JKQC 3PNTA 3RSNA 1T33A 3OIQA 4EATA 3SDBA 2OCEA 2VKEA 1PUFA 4PFOA 1IW7F 1FEXA 1JGGA 1BOAA 1FBQA 2R5ZB 3HKZA 2VKVA 3M9AA 4A3KJ 2TCTA 2OU2A 3CD6I 2FMYA 1QVUA 2X6OA 3K2ZA 4E70A 3WHBA 3VFZA 2V1NA 2W84A 1JJ8C 2QSFX 3C3WA 5EGOA 1KU2A 3D5SC 4G7ZF 1MMAA 1ZR2A 4IHWA 3CP8A 1XGNA 2OZ6A 2X6WA 1ZELA 3RZOJ 1XDSA 2XGDA 2N8GA 3LA7A 1IDZA 1J9IA 3BJAA 3RTRA 3BLYA 3MEXA 3OYIA 2O0YA 3I0TA 1QA6A 4MFEA 4F55A 1C0WA 2A69F 3S32A 4LK1F 3CJQB 1P7JA 1JKPC 3DWLE 4LG3A 1FNNA 2IJLA 3CMEI 5LRSA 1GXPA 2DN0A 4P9FA 4OIRF 1W36C 3WG9A 1VQNI 1DUXC 1SMTA 1U5TA 2CQNA 3RPUD 4DYRA 2BHZA 2HZTA 3P9KA 3JCUC 4BXFA 3PO3J 3C7JA 4X1EA 1SANA 1ZHFA 2EZKA 3ONQA 4CSWA 4IZZA 1YYVA 1DU6A 3H9QA 1IDYA 4XBFA 3EYYA 3SEZA 1IC8A 1APLC 4S0HB 1LB2A 1LFUP 3PFIA 2R7SA 1OYYA 3KZYA 2KQRA 1NTCA 2E19A 5DM6F 4G6DA 2VC1A 2HEOA 2VN2A 1Z05A 2R3SA 3TBIA 4E7LA 2V79A 4BU2A 1R36A 2HQRA 4HLYA 3WGGA 5ICGA 2DTRA 2KP6A 4E6KG 2K27A 1RKTA 5KNLA 1K78A 2GQQA 1YITI 1BW5A 2HQ5A 4XN0A 4Y7NJ 1LEBA 4IRIA 1BIBA 3HG9A 5KCMA 2JUCA 3QU6A 3FKIJ 1XCBA 2WADA 4KA4A 4IQ4A 3ZRGA 2A6TA 2R5YA 1AU7A 3HEFA 5F08A 2ZXHA 5E1ZB 2ZXIA 4G12A 2QQ8A 4RGSA 3FXMA 1BJZA 4J01A 1N25A 3TKYA 4IKFA 5IY5H 3S16J 2L7FP 1E0EA 4ZYGA 4A3FJ 2WY8Q 2LRDA 2WAFA 5DEQA 4HQMA 1XTAA 1NG6A 2EV6A 3BP8A 2XIGA 3ABMH 2RQPA 5J3LA 1EH7A 1HKQA 5LEJA 2HR3A 2IXSA 1TQIA 4HEA2 4LLGF 4RAFA 2KZGA 2MD0A 3OV8A 5FD6A 3BC8A 4KUMA 1GHCA 2HOEA 4IEJA 3RJPA 1VI0A 4RA2A
chains in the Genus database with same CATH topology
4F52A 1UAAA 4C2TA 1NG7A 2VJIA 2X6YA 3D5RC 1D0XA 4B44A 2PJRA 2WAEA 2XF7A 4PJNA 5HOOA 3K70D 1PYVA 2DJIA 4HPQA 2HVSA 2OUMA 3A1YA 3OYMA 4U7BA 2X6XA 4BDZA 2IS2A 4E7JA 5JHFA 4BE2A 2VPLA 4CA0A 1BOBA 2HVQA 3KX2A 4XLHA 2CW7A 4XNFA 4B48A 2CFOA 3HPGA 4F3QA 4BE1A 3H9GA 1WJAA 2PJRB 3VDXA 2IS6A 1D0ZA 2E5ZA 2XF6A 2W82A 4HNUA 5LD2C 3K4CA 3OWTA 4PFPA 1R6RA 2CS3A 2L2OA 2KMUA 3FBIB 2DT6A 2L9SA 4CCNA 4KITB 3OY9A 4XKVA 2X85A 3K4LA 4E7IA 1YX3A 4CH7A 1DQUA 3S3MA 3I3LA 4AYBA 3U21A 4BEHA 1EA3A 1TZLA 2CMPA 2WY7Q 3CMMA 3DKXA 1BR2A 2HPIA 1QU3A 3C2HA 2E1MB 3L2RA 4XOPA 1WJDA 2LOOA 1Z21A 3TMOA 2VJJA 3E0JB 4C9YA 3AKZA 4R79A 4X0GA 4BUPA 1P9QC 5HNFA 2E5NA 2NOJB 2DT7B 4XLFA 4ZDLA 1V5GA 4B47A 3VWBA 2CV1A 3FDYA 1TT0A 4BQNA 4E7ZA 2MYSA 2X51A 2JVHA 3LSHA 1MMDA 1UELB 4BQOA 4XKWA 4DOZA 2Q2EB 2VQHA 2M7BA 4NNJA 3VYSB 4DJAA 4DBQA 4XL9A 4CCOA 3DPLC 4II3A 2Y0SA 3CJRB 1MMNA 3L2VA 3QOEA 4CCKA 3MMYB 3QODA 3KEYA 4YEJA 4HG2A 4G6TB 4ZDOA 3OS2A 3HOTA 1QHGA 2M4KA 4AVZA 2IGKA 2VQLA 2P0WA 3V42A 2BVLA 5FRNA 3SEQA 1HA8A 2X1DA 1BR4A 1T0FC 2K9MA 3DLAA 2HPMA 3PSFA 4XQFA 2XDVA 3LSKA 3VYTB 2I8DA 4HSRA 2CV2A 1YE9A 3H0DA 4ZDPA 2LBFA 3CZ6A 2VLAA 2LH9A 4FETA 3ZCOA 3PL8A 2XSJC 4XKBA 4KT6A 1FMVA 3ZR8X 1QHHD 2F6CA 2KDOA 2HQAA 2XAUA 4RM2A 2MFZA 3H5RA 2HNHA 3OS0A 2R7XA 4XLCA 2X1EA 2VJ5A 2DXIA 3TL4X 4PJMA 3M8JA 4PJJA 4AU7A 1D0YA 2GOMA 2Z16A 2DOAA 3CESA 3OMYA 3OS1A 3K4KA 3OYAA 1JI8A 3W2VA 5TGTA 1WFXA 3EUKL 2IS4A 3VSKA 1S9HA 3BCAA 3BG7A 1VZ0A 3MD2A 3G2BA 4E7HA 2BW3A 3CP2A 3K4NA 1WJCA 3QYFA 2CUZA 4Y4RA 3EUAA 2R7RA 4BJ6C 4XKCA 2LY2A 1YX5A 1W36D 2AQEA 4RLFA 3IP4B 3M1CA 2IGOA 1KONA 1WJBA 3QYEA 1Z7LA 4BJTA 3K4BA 4C30A 3DPTA 3ZXSA 1IRXA 3ZGKA 1X1DA 4CCJA 2K5CA 2Q1ZB 3UNGC 3OYDA 2HZDA 2KHMA 2JUGA 4ZC3A 2RNGA 4XLEA 3FHNA 1OLTA 2W1OA 4XLAA 1Y6IA 1MMGA 1Z3YA 4IQJA 3VSLA 4OAZA 1LVKA 4E4HA 1OR7C 1T95A 2WA0A 4F93B 3OYBA 3AFHA 4ITVA 3DU5A 2V9KA 2BVMA 2A5WA 5HNHA 5FROA 4BEHB 3LSIA 3H5NA 4J00A 3OYHA 3S93A 3PSIA 4BQQA 3L2UA 3IAS2 3K70C 1LKXA 4XM3A 2JA2A 2CUJA 1U0JA 2M7AA 3K10A 4RM3A 1AA7A 1X4OA 1WJ5A 3DQVC 2R7OA 3ZQQA 3HOSA 2LG4A 2RREA 2VQCA 2Z2SB 4ZYAA 3OYCA 2IGMA 4ZJZA 2WBMA 1SFKA 4F92B 4N4OB 1D1AA 4CCMA 2L9NA 4BL0B 3AL0C 2HU9A 2AQFA 4F91B 4XORA 3EUHC 3OOUA 4ANJA 3LL7A 3W2AA 2L5QA 2O5RA 4B3XA 2M4GA 4XR6A 3DU6A 3OYKA 4Y3OA 2WAQA 1X1BA 4YELA 3HC7A 2F4IA 5CKTA 2QKMB 3DPUA 1N75A 3F9KA 2HDWA 4XN3A 2ELJA 4Y33A 3I9V2 3C2GA 4RLQA 4MLOA 3H9JA 3PFYA 4LIVA 2R4GA 4QPOA 2VKDA 4KJZA 3HXLA 2ZSHB 3A2KA 4BJ5C 5CQEA 1MNEA 1ERDA 2L7KA 3GBGA 3OR1C 3HL2A 2OV7A 2ZSIB 3L2QA 4NUBA 4NQWB 1DGRM 3CF2A 4PJLA 4LITA 1X1CA 1UG0A 2M3AA 2W00A 2LBFB 4IX7A 4NC8A 2V26A 1MW7A 3OYGA 4BS9A 3W2WA 3OYEA 1PJRA 1DGWY 3N05A 2KRCA 3RQ4A 3IUOA 3LFUA 1N77A 1Z3XA 2OC6A 1WJEA 4DIQA 3OYFA 3HUGB 4BE0A 2V6EA 2UWMA 2VXZA 4ZTJA 3FBNB 3H35A 2KZVA 4PSXA 3OL4A 4BACA 4H4KC 3MKYB 2K9LA 2LREA 5CPRB 2LYCA 4B43A 3S3OA 4N4NB 2V4JC 3H5AA 3VYRB 1D1CA 2VL8A 5HVQC 1LDKB 1J09A 2IS1A 2R7WA 3NWSA 3E1SA 3HPHA 2R7QA 1G59A 1V5FA 4PSWA 1G8XA 2W4SA 1X19A 2DCEA 4XMYA 4XOTA 2HVRA 4BDYA 3AL0B 1K6YA 2JSPA 1FMWA 4CUGA 4BGDA 4P1WA 2BW3B 3J7AY 2VKHA 1SAUA 4LIUA 3PNTA 3RSNA 1V5EA 3OIQA 4EATA 4RMNA 3SDBA 5HLTA 4HSTA 2M0MA 2KPMA 4PFOA 3L2WA 3HKZA 2CW8A 2GOXB 5FRMA 2JVGA 4C2UA 3DTKA 2MC4A 2V1NA 4DBRA 2R7VA 2Z1DA 3D5SC 5CQGA 3D5LA 3NWTA 1MMAA 4P5OA 3EPZA 2PMZA 3BCBA 3CP8A 4HRIA 2CH0A 1D1BA 3S8PA 2X6WA 3K4MA 4JOMA 1GLNA 3DEEA 1ZELA 2IGNA 3LSMA 4U87A 5LFAA 4II2A 3K4JA 2KL4A 2FUG2 3RTRA 2XC7A 1WJFA 3BLYA 2CV0A 2K3PA 3OYIA 3LSGA 2VQGA 3PNVA 4F55A 4OAYA 3S32A 3QYBA 3CJQB 4CCLA 4YRVA 2KLOA 3PUBA 3MKWB 3DWLE 4JQFA 4LG3A 1DP3A 2KRHA 2X1CA 3VYUB 1W36C 3A4CA 3RPUD 4E7KA 1X4PA 1MNDA 4BXFA 2BOLA 2ZFUA 2RQQA 3ONQA 4CSWA 4IZZA 3SZGA 4XONA 3H9QA 4D9JA 2E60A 3DKYA 3OL3A 3PJRA 2R7UA 2VIXA 3SEZA 2R7SA 2KQRA 4NC7A 2XF5A 3MKZA 3RCOA 4QPQA 3TBIA 4E7LA 4BU2A 2KP6A 2VXDA 3UR3C 3DTIA 4E6KG 5KNLA 3SYTA 3OYJA 4XN0A 2V7FA 2VJ4A 2QKLB 3BG6A 3HG9A 2MABA 5KCMA 2F5VA 2WADA 4IQ4A 3FKJA 1BR1A 3K6GA 1N78A 3ZRGA 4HNTA 2R7TA 2A6TA 4KISA 4PK4A 4DGWB 2ZXHA 4OWRB 5KHDA 2ZXIA 1X1AA 2W7NA 2E1MC 4J01A 4IKFA 3DTEA 1Y56A 1E0EA 2WY8Q 2LRDA 2WAFA 3W3CA 3OYLA 3LMMA 4GRIA 3PNYA 3OIPA 3OYNA 2VB6A 2UV1A 3IAM2 4FASD 1NG6A 4PUSA 2UUZA 1LFPA 2LY1A 3KYLA 3S3NA 2IXSA 4HEA2 4D1QA 2WB1A 4CZCA 2MD0A 2LC2A 3BC8A 3OR2C 4ZTFA 4E7SA 2VASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SAU A;  1YX3 A;  1JI8 A;  3OR1 C;  2XSJ C;  3OR2 C;  2A5W A;  2V4J C; 
#chains in the Genus database with same CATH topology
 3CUQ B;  3AG4 H;  4ESJ A;  4C2T A;  6PAX A;  1YW8 A;  2X6Y A;  1MBK A;  3D5R C;  4B44 A;  1QZE A;  3I4N J;  5FFX A;  2PJR A;  2DQL A;  2O8X A;  3LOC A;  4EGZ A;  1XPX A;  5EZH A;  5J47 A;  2JMW A;  3K70 D;  1U5T C;  2LKX A;  2HYJ A;  3A1Y A;  4D5F A;  1G2H A;  2DA3 A;  1ZGA A;  4IHX A;  1UB9 A;  3G4S I;  1LDJ A;  2Y9Y A;  5FLV A;  2P6T A;  5TJJ A;  2HVQ A;  2O3F A;  2RNJ A;  1UCR A;  2M5W A;  2P4W A;  1O3R A;  4B48 A;  4M71 A;  4F3Q A;  1BC7 C;  1WJA A;  2PEX A;  2QF7 A;  4Y15 A;  4S04 A;  2W82 A;  2O9L A;  2H6B A;  3OWT A;  4OMY A;  3J81 Z;  3L9F A;  1HW5 A;  3JRB A;  2CS3 A;  2L2O A;  2KMU A;  4QLC U;  5L3E A;  3BTJ A;  3M8F A;  3FM3 A;  1F1Z A;  1P4W A;  3ZQI A;  2L9S A;  4CCN A;  4KIT B;  4RB0 A;  4U0W A;  2X85 A;  2Q8K A;  4E7I A;  5LEK A;  2WTE A;  3PO2 J;  4CH7 A;  5C3E J;  1E3P A;  3KP6 A;  3HIF A;  3I3L A;  1J2X A;  2B9S A;  4UUS B;  1HLV A;  3HZJ A;  3TP0 A;  2NVU B;  1MJA A;  2I5U A;  4BEH A;  2CMP A;  2JWT A;  2WY7 Q;  2X0L A;  2HPI A;  1QU3 A;  3GF2 A;  1MSF C;  4M6X A;  4EJT A;  3L2R A;  2E1M B;  4XOP A;  5J40 A;  4ZYD A;  2QEN A;  2O61 A;  4IL6 C;  5KVR A;  3I4P A;  3AKZ A;  3BQY A;  3WE3 A;  4MGR A;  4Y17 A;  5HNF A;  2FF4 A;  1T6S A;  2NOJ B;  2DT7 B;  4XLF A;  4Y13 A;  2NRA C;  3S14 J;  3GTQ J;  2QBY A;  5IP7 J;  3BRO A;  4B47 A;  2IA1 A;  3VWB A;  1P4X A;  3A01 A;  3I4M J;  5L3C A;  2NVX J;  1RNL A;  2MYS A;  3LA3 A;  4QWQ A;  4LLL A;  2OJE D;  5J1U A;  2EV0 A;  2E1N A;  2K86 A;  5TRD A;  4BQO A;  3S1R J;  5L3D A;  3DBL B;  3O8H A;  3DEW A;  2Y0S A;  1WRJ A;  1PVE A;  2H6C A;  2Z99 A;  3H3V K;  2BYV E;  3CJT B;  3QOD A;  1HST A;  2ZCW A;  1LE8 B;  3HOT A;  2M4K A;  3WTV C;  1YJW I;  5FRN A;  2OD5 A;  1HBX G;  3GME A;  2DA5 A;  2ZO4 A;  5FGM A;  2MW8 A;  3SJM A;  1MGT A;  2JN6 A;  2EFN A;  3V4G A;  2OTL I;  1TW3 A;  3HOW J;  1FOY A;  4XQF A;  4HW0 A;  4NQW A;  2UXN A;  3HRM A;  4JK1 X;  1IF1 A;  2IEK A;  1LFB A;  1EKE A;  1YE9 A;  1RPW A;  3H0D A;  2CV2 A;  2LBF A;  1XSV A;  1OR7 A;  5JVG F;  3S2D J;  3BY6 A;  4IJA A;  4XKB A;  4AUX A;  1FMV A;  3NEU A;  1ZR4 A;  5GTH C;  3ABU A;  4FHT A;  2ISZ A;  2HQA A;  4RM2 A;  2IRF G;  1UZC A;  3E5Q A;  1M1E B;  2X1E A;  3GX4 X;  3CMY A;  5FKO A;  2DXI A;  1DDN A;  3VB2 A;  4AU7 A;  4PJJ A;  5H6Q A;  3RKW A;  4OIN F;  4OMZ A;  1V54 H;  4RAG A;  3M7G A;  3P9C A;  2GOM A;  3ULQ B;  2FA5 A;  3ABK H;  5JFR A;  1R5H A;  3HSE A;  3CLQ A;  4BXX J;  3P9I A;  3OMY A;  1JI8 A;  1BI1 A;  3K4K A;  3OYA A;  3W2V A;  2XHK A;  3IRQ A;  2D45 A;  5TGT A;  3VSK A;  4UB8 C;  3R6S A;  4LD5 A;  1ENH A;  3U1D A;  5GAG J;  1PP7 U;  1ONV A;  4A3G J;  3ML6 A;  4EJW A;  3MD2 A;  3HOY J;  3G2B A;  3MVP A;  4E7H A;  2BW3 A;  4XRS G;  4L9N A;  3K4N A;  1WJC A;  2ID3 A;  3WHC A;  3JRA A;  1TWH J;  3ABT A;  5ILU A;  3EUA A;  2BE5 F;  2YR2 A;  4XKC A;  5HDN A;  4FQG A;  5D5W B;  1QPI A;  5K5Q A;  1YS6 A;  2XSD C;  1YJN I;  2R5Z A;  3KZI C;  1KON A;  2DJN A;  2ADU A;  3J7A O;  1OCC H;  1Z7L A;  2KRF A;  1OQY A;  2DBB A;  5GAE J;  3ZXS A;  1U78 A;  4XRM A;  2K5C A;  2Q1Z B;  3AAF A;  1TQP A;  3UNG C;  3CTA A;  4I0A A;  4JYK A;  2XKP A;  2W57 A;  2M1B A;  3R0A A;  1OLT A;  3KE2 A;  2W1O A;  5F64 A;  1Z3Y A;  1MMG A;  5FD5 A;  5IP9 J;  3RZD J;  3GFJ A;  1LVK A;  3HSR A;  4A5M A;  5LLQ A;  1UG2 A;  4E4H A;  3EYI A;  2VON A;  1OR7 C;  1FBU A;  1T95 A;  3IV5 A;  2NVT J;  2QA4 I;  4ITV A;  2XVC A;  4HQE A;  5LHG A;  1W5S A;  3GTG J;  4EM1 A;  3RYR A;  4C2M J;  5DYM A;  3R4K A;  1PDN C;  4BQQ A;  4AYB N;  4A3J J;  2D2W A;  4X6A J;  3VEP A;  3IAS 2;  2K3F A;  3QAH A;  5FKK A;  2K85 A;  1LKX A;  1OCO H;  3KP5 A;  4KN4 X;  3RQI A;  1ITY A;  1F4K A;  2M7A A;  2CUJ A;  1U0J A;  1HXD A;  1X2M A;  2KIU A;  2R7F A;  3S1N J;  1X4O A;  2EIM H;  3HOX J;  2BEO A;  1L0O C;  5L3G A;  1WJ5 A;  1F36 A;  4KDP A;  4XK4 A;  1K61 A;  4ZYA A;  3G1M A;  3ZMV A;  1VQ9 I;  2IGM A;  3Q9S A;  4R8H A;  1SVM A;  4KIF A;  1J5Y A;  1SFK A;  4BXU A;  5DCM B;  2JA6 J;  4N4O B;  1D1A A;  4BL0 B;  1X1P A;  4L9J A;  1ZG5 A;  3OOU A;  1U2W A;  2BHY A;  5F1R A;  4QTR A;  2OPT A;  1A6I A;  3ELK A;  2L5Q A;  2X48 A;  1J7K A;  1IN4 A;  1GXQ A;  1IZ1 A;  1MJ9 A;  2L01 A;  4Y3O A;  2IA0 A;  2F4I A;  3JRG A;  1XX5 A;  3F9K A;  2HDW A;  4Y33 A;  3DKW A;  1J0R A;  1FJL A;  1RC9 A;  1K4S A;  1AHD P;  5DD4 A;  4KJZ A;  2UZK A;  3HXL A;  3WTY C;  1Z9C A;  5CQE A;  2BXZ A;  2D1H A;  2WWY A;  3OR1 C;  3GBG A;  1Y0N A;  2OCC H;  3CCY A;  3HL2 A;  2ZSI B;  3L2Q A;  3TW6 A;  4LIT A;  1RUO A;  3PIP F;  1DP7 P;  3V7S A;  5BQT A;  4AIH A;  3MZH A;  2H8W A;  1YW7 A;  3VPR A;  3OYE A;  3CUO A;  1KQ8 A;  4ENJ A;  2QYO A;  2W24 A;  5E8I A;  1R71 A;  4ENK A;  3BR6 A;  3RQ4 A;  4IRG A;  2XGC A;  4BE0 A;  3HUG B;  1W7P A;  3CUQ A;  2V1D A;  2B0L A;  5JLX A;  2UWM A;  1S6L A;  2ZNY A;  3H35 A;  3OL4 A;  2P7C B;  2LNB A;  4H4K C;  2LRE A;  3T8T A;  2V4J C;  4N0B A;  2AHQ A;  5BNG A;  1D1C A;  3ASN H;  2YS9 A;  1LDD A;  2PLY A;  2LK2 A;  3HPH A;  4K2E A;  4PSW A;  2OBP A;  3WGH A;  2EA4 A;  2DK5 A;  3LWF A;  2PX9 A;  5IT3 A;  1H89 C;  5D4R A;  4P1W A;  4LOC A;  2VKH A;  1SAU A;  4LIU A;  2DMP A;  4D7M A;  2DW4 A;  4RMN A;  5DCF A;  3SZP A;  3GLL A;  4NC6 A;  1G3T A;  3F8B A;  1P4A A;  9ANT A;  4RGX A;  2GOX B;  1SD6 A;  5FRM A;  4PDK A;  2JVG A;  2RC4 A;  2BGC A;  1FBS A;  3CO7 C;  1K79 A;  1SMY F;  2R7V A;  3CCR I;  4L5J A;  4PGG A;  2L54 A;  3F0C A;  3D5L A;  1NK2 P;  3EPZ A;  2PMZ A;  3BCB A;  2CH0 A;  3CCS I;  3TDZ C;  1D1B A;  1EV7 A;  1ZLK A;  5ILV A;  4AWX B;  1O7F A;  3CMA I;  2FNA A;  4EJU A;  3QWL A;  2CWE A;  5HLH A;  1T2K A;  4II2 A;  3K1P A;  3K4J A;  2O7O A;  2FUG 2;  1JJ6 C;  1WJF A;  3MCZ A;  2CV0 A;  4CYC A;  4D7N A;  2GA2 A;  3LSG A;  2VQG A;  2YX7 A;  1CQT A;  4GCV A;  5KAF C;  1XGS A;  3PNV A;  2EK5 A;  4LFU A;  3F22 A;  4I0B A;  4CIC A;  1G3W A;  3A0H C;  1LEA A;  1O57 A;  2HTJ A;  3CUQ C;  5EEG A;  4CCL A;  4ZYH A;  4FE4 A;  4KFC A;  3LSJ A;  5C4J J;  2PFB A;  4IVN A;  1FZP B;  4JQF A;  5GPC A;  4L9V A;  3J7Z I;  5KK1 A;  2KRH A;  2X1C A;  1WKM A;  3T0Y A;  3QPH A;  4V19 K;  2VBY A;  3A4C A;  4DNC A;  3L7W A;  1MND A;  3V8L A;  1SFU A;  1ETW A;  1ZK8 A;  1YLF A;  4EEF G;  2ZFU A;  1LE8 A;  4D9J A;  2FD5 A;  2E60 A;  4P96 A;  2JA8 J;  1MH3 A;  1RR8 C;  3OOP A;  2EIK H;  2VT2 A;  5HOD A;  3JTG A;  2DMQ A;  3NAR A;  1I5Z A;  2D5V A;  3JW4 A;  2XF5 A;  4MTE A;  1CF7 B;  2GAU A;  5AIQ A;  3RCO A;  1Y1W J;  4QPQ A;  3ZMD A;  2H1K A;  5FO5 A;  2CRG A;  3FK6 A;  2HQN A;  5D5U B;  3F23 A;  2EZL A;  4EJV A;  2VXD A;  3DTI A;  4MTD A;  3GCM A;  4LG0 B;  1OMI A;  2LY9 A;  1QO0 D;  2VJ4 A;  1R58 A;  2QKL B;  5LGN A;  2EFW A;  2XGE A;  4MFD A;  2A6E F;  3K0L A;  5E1X A;  1A04 A;  3IH3 A;  3WU0 A;  1EH6 A;  3FKJ A;  3NRV A;  1N78 A;  3MQ0 A;  2WAQ N;  1I3Q J;  3G1L A;  2F4O B;  5J4Y A;  1UST A;  4KIS A;  4HLX A;  1MDM B;  5J1Y A;  5KHD A;  2ZJR F;  2DA4 A;  3SHF A;  1X1A A;  2E1M C;  2LMD A;  3MKL A;  4A6D A;  1YI2 I;  5HLG A;  1HOM A;  4GRI A;  1GT0 C;  1XSD A;  4PUS A;  2ELK A;  1LVA A;  2LP0 A;  3E3V A;  1FY7 A;  3GZ5 A;  3F6V A;  3QPL A;  1IO2 A;  3S3N A;  1FIA A;  4KNY A;  4D1Q A;  2B7E A;  3GXO A;  3B02 A;  3DBH B;  2R92 J;  3OR2 C;  4I7H A;  4U7D A;  1DPR A;  3CLO A;  2FQ4 A;  2QQA A;  5FKL A;  1R1T A;  4EM2 A;  2VAS A;  1I27 A;  2CJJ A;  3WTS C;  5B1B H;  4EJO A;  5LBQ A;  2LF8 A;  2GXG A;  2P5V A;  2XF7 A;  1Z91 A;  5ILS A;  2LR8 A;  4XLP F;  4GFB A;  2OUM A;  5C4X J;  5DDG A;  5M5W J;  3HHG A;  3JSP A;  2FU4 A;  4U7B A;  2X6X A;  1G4D A;  2IS2 A;  5FKM A;  5JHF A;  4BE2 A;  1BL0 A;  2VPL A;  1F43 A;  2M2E A;  1BOB A;  3CF5 F;  2CYY A;  3BT9 A;  3HPG A;  5HS7 A;  2ICW G;  3H9G A;  4NBQ A;  2V6C A;  2IS6 A;  3KFW X;  1FSH A;  3BTL A;  4LB6 B;  3K1N A;  1YTY A;  3K4C A;  2DA6 A;  5CVU A;  2HTS A;  5E1W A;  4PFP A;  1R6R A;  1ZGW A;  2O6G E;  2XUB A;  3FXK A;  3LQR A;  2WV0 A;  2DO7 A;  3I71 A;  1TLH B;  4UVB A;  4FE7 A;  5DS9 A;  1OKR A;  1IV8 A;  1IUF A;  2DQR A;  1YX3 A;  4BBS J;  3IH2 A;  2K02 A;  3FHZ A;  4HYE A;  3TO7 A;  1ETK A;  1TW2 A;  2OQG A;  1O4X A;  4UNO A;  3HKZ N;  2GZW A;  2G9W A;  2RV8 A;  3U21 A;  3Q0U A;  3DKX A;  1BR2 A;  2LLK A;  4MIM A;  3L00 A;  1HQC A;  4KIC A;  5ERI A;  1VQP I;  3E0J B;  3RPU A;  4BUP A;  3K69 A;  4BY7 J;  2GM4 A;  2BY3 A;  3FX3 A;  2E2H J;  5TIS C;  1RES A;  2ZKZ A;  4E7Z A;  5DCM A;  4P55 A;  1AKH B;  2WV1 A;  3NQO A;  1OCZ H;  1MMD A;  4HOB A;  4YII A;  1HKS A;  2ECB A;  4AID A;  2M30 A;  2JRM A;  4XKW A;  2OF7 A;  4DOZ A;  2Q2E B;  2GWR A;  2YPR A;  4P9U A;  4NNJ A;  4DJA A;  4DBQ A;  4EGY A;  3IWF A;  2BV6 A;  3DPL C;  4II3 A;  1MMN A;  4I6Z A;  2PN6 A;  3QOE A;  3BWG A;  3D1N I;  1KQ9 A;  3KEY A;  4YEJ A;  1HC8 A;  2QWW A;  1GVJ A;  3V42 A;  2P0W A;  1HW2 A;  3SEQ A;  2DYR H;  5ICF A;  1OPC A;  1KU3 A;  3J80 Z;  1P2F A;  3DLA A;  3PSF A;  1VQL I;  1MMS A;  2NVQ J;  1SD7 A;  2MA3 A;  2XPU A;  2ZB9 A;  3LSK A;  2C6Y A;  3LAJ A;  1XCV A;  2Y0M A;  3HRS A;  3I59 B;  3CZ6 A;  1XG1 A;  3KEQ A;  1RIO H;  3BZ6 A;  3ZQ7 A;  3BG3 A;  3ZR8 X;  1WZ2 A;  3I54 A;  1ULY A;  2JPC A;  3HUG A;  2EBI A;  3H5R A;  4AM3 A;  2DOF A;  1NH3 A;  4UV9 A;  2ZNZ A;  2R7X A;  1EF4 A;  1Z1D A;  2F5F A;  4XLC A;  4Q4Z F;  4A3C J;  5E3L A;  5IYD J;  4PJM A;  1UHM A;  4YIF A;  2KDZ A;  1K7A A;  5D4S A;  4S05 A;  1USS A;  2NOG A;  3ZN0 A;  1D3Y A;  4BQA A;  4RAZ A;  3ABL H;  4OOI A;  2CQ7 A;  5HDG A;  4OIP F;  2HWV A;  2E2J J;  3EUK L;  2F5E A;  3J7Y J;  3PIO F;  1FIP A;  3EDP A;  1S9H A;  3DFG A;  5HS8 A;  1W0U A;  4G9Y A;  3CDH A;  4ESF A;  1XSX A;  5GAD J;  4C3J J;  1A5J A;  4I09 A;  5A2Q Z;  4D5C A;  3MAJ A;  4BJ6 C;  3QU3 A;  2LY2 A;  1Y1V J;  1YX5 A;  2EIL H;  1S3J A;  4RLF A;  4A0Y A;  3M1C A;  5E18 F;  5CVR A;  5M3F J;  3M4O J;  1TQM A;  3QYE A;  1XGO A;  3BR3 A;  4PZJ A;  4BJT A;  4ESB A;  1QBJ A;  2EIN H;  3HM5 A;  2Y69 H;  1I3A A;  1MKM A;  1KYZ A;  2HZD A;  3PQK A;  3GTO J;  2QLZ A;  5CYV A;  3LA2 A;  2JUG A;  1O3Q A;  4ZC3 A;  1TWA J;  3CCV I;  3N97 A;  1OIS A;  4XLA A;  1Y6I A;  3BR0 A;  3WTW C;  3VSL A;  3CCM I;  5EF6 A;  1VQ8 I;  2P81 A;  4O3M A;  5DD8 A;  4CYD A;  1T98 A;  1S7A A;  3ASO H;  3OYB A;  3GTM J;  4A3I J;  2FOK A;  1YG2 A;  3AG1 H;  2EB7 A;  3G1O A;  2JSC A;  4XSX F;  2A05 A;  3H36 A;  5J4V A;  4HX4 A;  5FRO A;  1PP8 F;  3H5N A;  4J00 A;  4B4C A;  3OYH A;  3JRH A;  2K7L A;  1FP1 D;  3GTL J;  2RN7 A;  1JT6 A;  1DU0 A;  3K70 C;  1HDD C;  5DUK A;  1S29 A;  3K10 A;  1QZZ A;  1B9M A;  4WCG A;  3KP3 A;  2CQK A;  2NAZ A;  5GTI C;  5IYB J;  2P8T A;  3DQV C;  2R7O A;  3ZQQ A;  3HOS A;  2VQC A;  3OYC A;  1Q1V A;  2Z2S B;  1V4R A;  3WGI A;  2QSH X;  1FOX A;  2WBM A;  1W5T A;  4BHC A;  4L18 B;  1CGP A;  4BNC A;  2L4A A;  2DDA A;  4M73 A;  3WE2 A;  5EJC A;  4A3B J;  1WSU A;  2AQF A;  3HDD A;  4XOR A;  3T1B A;  1POG A;  1U9O A;  1U6G A;  4DZJ A;  1CF7 A;  4ANJ A;  3M07 A;  3ZP5 A;  5H6R A;  4WWC A;  5K7Z A;  1IJW C;  3W2A A;  3CCE I;  1D8J A;  4F7Z A;  4B3X A;  4G7O F;  3DU6 A;  4LG0 A;  3MWM A;  3OYK A;  1JTX A;  2M45 A;  1PUE E;  3S2H J;  2XAQ A;  2OQR A;  1ZYR F;  2QM3 A;  2XPV A;  2Z3Y A;  3B73 A;  2EH3 A;  4XN3 A;  4KIG A;  4EM0 B;  2DOE A;  1I1G A;  2ELJ A;  2QUF A;  2Y0S N;  3NAU A;  1JXS A;  4PJ0 C;  4G94 A;  1IAW A;  2HDC A;  1HW1 A;  4QPO A;  1F5T A;  4YFX F;  2ISY A;  2OZU A;  1MDM A;  2F4M B;  2HFH A;  3I56 I;  3A2K A;  3KYD B;  1R1V A;  1MNE A;  1IGN A;  2AXL A;  3IHU A;  5DM7 F;  3KET A;  5EEH A;  4IHY A;  1DGR M;  3VOE A;  5D8L B;  1MJB A;  1IN6 A;  1X1C A;  1YHQ I;  2EPF A;  4B09 A;  1LJ9 A;  4NC8 A;  4A3M J;  2V26 A;  1MW7 A;  2E36 A;  4BS9 A;  2GXA A;  2A61 A;  5JI6 A;  3BDD A;  2A5Y B;  3SXY A;  1MSE C;  4GXO A;  3IUO A;  3LFU A;  1Z3X A;  3HHH A;  4DIQ A;  3OYF A;  2RAE A;  2VXZ A;  3BG5 A;  2G7U A;  3FBN B;  4KT5 C;  3BR1 A;  5A2Q K;  4PSX A;  2K9L A;  5M5Y J;  3J81 K;  2NXN B;  2ECC A;  1WHU A;  3RDI A;  2F5D A;  3D0S A;  3VYR B;  1XC5 A;  4I01 A;  4A2U A;  2LSO A;  4V2G A;  3S2W A;  3NWS A;  2EZI A;  4IF4 A;  4FIS A;  4PCQ A;  4IHS A;  3R0J A;  3V7R A;  4I76 A;  3LST A;  2RDP A;  1X19 A;  4BDY A;  3AL0 B;  1G6N A;  5BPI A;  1K6Y A;  5E8G A;  5ED4 A;  4ENM A;  2NVY J;  4BGD A;  3DLL F;  3QP6 A;  2FNP A;  3J7A Y;  5LGT A;  5M5X J;  1JKO C;  4GYG A;  2GIV A;  2LKS A;  2E1O A;  4IHT A;  2EFQ A;  4XSZ F;  1ON2 A;  4M6Y A;  3ROU A;  4I98 B;  3L2W A;  1FC3 A;  3L2C A;  4M3E A;  1SFX A;  4OIO F;  1TWG J;  1GDT A;  3FXJ A;  1TTY A;  2VOP A;  1ACI A;  3CDL A;  2XGX A;  2DU9 A;  1XGM A;  4RGR A;  4BBR J;  3AG2 H;  1YW9 A;  5CQG A;  3NWT A;  1W4M A;  1X58 A;  2FBI A;  1TNS A;  2HGC A;  2Y48 A;  3H1C A;  4P5O A;  5B1A H;  1HF0 A;  5IP6 A;  1B4A A;  4NHJ A;  3S8P A;  3HB9 A;  1TWC J;  3K4M A;  4JOM A;  3DEE A;  2IGN A;  4U87 A;  2R7D A;  2M8G X;  3QQA A;  5LFA A;  4IHV A;  1GUU A;  3CC2 I;  2KL4 A;  2XC7 A;  1UHW A;  5E17 F;  2K3P A;  2G0E A;  1T08 B;  3WTX C;  1AKH A;  1Z67 A;  3GFM A;  3X2Q H;  2DYS H;  1R23 A;  3FWE A;  4A3L J;  3PUB A;  3E5U A;  1SVO A;  1U3E M;  2Q2E A;  4G8X A;  4M72 A;  2QCO A;  2DAO A;  3JRC A;  1E3O C;  2ID6 A;  2CUF A;  2BY2 A;  4E7K A;  3I53 A;  5IYC J;  3SZG A;  1IXC A;  3BPX A;  4XON A;  4HX8 A;  5F1J A;  2NS0 A;  2MC3 A;  1K83 J;  2CU7 A;  3DKY A;  3OL3 A;  2R7U A;  1YS7 A;  1OJL A;  1YOV B;  2DMU A;  1IRZ A;  2PMU A;  2MH2 A;  4HBL A;  3A0B C;  2Y9Z A;  4I99 C;  3PUF A;  4NC7 A;  2Z9O A;  4GYI A;  3E6M A;  3CCL I;  3MKZ A;  2HKX A;  4M3F A;  4MEX F;  3ZMU A;  5D6E A;  3UR3 C;  4QSH A;  2FX0 A;  3B6C A;  1ZRC A;  3IRR A;  2V7F A;  3JRD A;  3BG6 A;  2MLK A;  1D8K A;  3K6G A;  3FXU A;  5L3B A;  4FX4 A;  2R7T A;  2ZFW A;  4PK4 A;  2L02 A;  4OWR B;  1RRJ A;  1VQ4 I;  2A07 F;  3CO6 C;  4H0E A;  1QRY A;  2H27 A;  3U9G A;  1Y56 A;  4V2F A;  2ZC2 A;  4MO7 A;  4KMU X;  1QGP A;  4HA8 A;  3ZQF A;  3LMM A;  1A6Q A;  3BTI A;  4UHT A;  3Q0W A;  3IAM 2;  3JRI A;  3ERE D;  2K9N A;  2KIM A;  3M8E A;  3CC4 I;  1IN8 A;  2KJB A;  1R5I D;  2B63 J;  3C1D A;  3KYL A;  1JUS A;  2IBD A;  1IN7 A;  2PG4 A;  2WB1 A;  4CZC A;  3UKG A;  2ZJ2 A;  4HAM A;  1MZB A;  2LC2 A;  2VBX A;  2QSG X;  4ZZD A;  4DYC A;  4E7S A;  2VBZ A;  4IPA A;  1UAA A;  1FP2 A;  1XDU A;  1D0X A;  3F8M A;  2V9V A;  3IKT A;  3C18 A;  2PI0 A;  2WAE A;  3ISP A;  4PJN A;  5HOO A;  3W6K B;  1PYV A;  2DJI A;  5JHU A;  4HPQ A;  2JT1 A;  3OYM A;  5AIP A;  5GP9 A;  4BDZ A;  1R00 A;  4E7J A;  1R22 A;  5M3M J;  4MHG A;  1RET A;  2GA1 A;  1W7P D;  3KX2 A;  4XLH A;  2CW7 A;  3WTT C;  2O8K A;  4MQV A;  4O5V A;  5BOX A;  1YIO A;  4XNF A;  2CFO A;  1YIJ I;  4MQ9 F;  2DLL A;  4EQQ A;  3V7C A;  2PJR B;  2Q0O A;  1X3U A;  4LGW A;  4ZYE A;  1F9N A;  1JUM A;  4I2O A;  1XB4 A;  2Y2Z A;  1H9G A;  5LD2 C;  1SFO J;  3ZN1 A;  4UUS A;  1I6H J;  2LTP A;  3E6C C;  1I6X A;  3E7L A;  4A0Z A;  1H88 C;  3GWZ A;  2CW0 F;  2HDD A;  1MBH A;  4CHU A;  2DT6 A;  2L7M P;  1XMX A;  1NK3 P;  2KFD A;  3K4L A;  2LD5 A;  4XIC A;  2M87 A;  2KIF A;  1DQU A;  2MSY A;  3S3M A;  2CQX A;  3GUD A;  4JX5 A;  5D6F A;  2XRL A;  2XAG A;  1ETY A;  1EA3 A;  1TZL A;  1WGX A;  2LFB A;  1X3W B;  1B6A A;  2HXI A;  3C2H A;  1O3T A;  5EYR A;  4G6Q A;  3SDG A;  4C9Y A;  4ETS A;  4R79 A;  5HDK A;  2BXY A;  1SVL A;  5H2F C;  2DFF A;  1BI3 A;  2PMZ N;  1TC3 C;  2DPU A;  2E5N A;  3DP7 A;  1XD7 A;  4M3G A;  3R61 A;  2FRH A;  4L5I A;  3U2R A;  2EJR A;  3JRF A;  1ZG1 A;  2CV1 A;  3PM1 A;  3GW2 A;  5DTD A;  1WI9 A;  3CCU I;  2JVH A;  3FIW A;  3LSH A;  2TDX A;  1Y8R B;  1SD4 A;  3Q3S A;  2VQH A;  3VYS B;  2QBY B;  2X4H A;  2HOA A;  4XL9 A;  3K1M A;  4AIK A;  3BR5 A;  3MZY A;  3CJR B;  3L2V A;  2Y31 A;  1KYW A;  3QOP A;  3RYP A;  4JP0 A;  3CCJ I;  2DMN A;  3MMY B;  2IPQ X;  4BKX A;  2IP2 A;  1SAX A;  2ZBK A;  4ZDO A;  2JA7 J;  1R1U A;  1QHG A;  4AVZ A;  2IGK A;  2GXB A;  2VQL A;  1IUY A;  2Y30 A;  1HA8 A;  4AD9 A;  3V8K A;  5EDN A;  2X1D A;  1BR4 A;  4CZZ A;  1T0F C;  2K9M A;  3FMR A;  4C3I J;  2HPM A;  4ENN A;  3K9T A;  3WOD F;  4R1H A;  3VYT B;  2I8D A;  1BN5 A;  1GV5 A;  2LH9 A;  4FET A;  3PL8 A;  1T8I A;  3HRU A;  3I55 I;  4KT6 A;  3HYI A;  1A36 A;  2XRN A;  3HTS B;  4GO1 A;  1QHH D;  2F6C A;  2KDO A;  2XAU A;  2A6H F;  5LRR A;  2ZJP F;  3OS0 A;  3GTP J;  1KGS A;  2RGV A;  2VJ5 A;  5CJ9 A;  3TL4 X;  5D5V B;  2OTJ I;  4YFK F;  2ZME C;  5K7H A;  1ZH5 A;  3IL2 A;  1D0Y A;  4GGG A;  1VFC A;  1MBF A;  2DOA A;  1HCR A;  3BJ6 A;  3CES A;  3OS1 A;  2MG4 A;  2NYX A;  4YG2 F;  2FBK A;  4N9H A;  3M3Y J;  2BY1 A;  1WFX A;  5DUI A;  2IS4 A;  4EVI A;  2JJ7 A;  1IG7 A;  3GTK J;  1UHS A;  3BCA A;  1ETO A;  3TOB A;  3ZQH A;  5F04 A;  3CC7 I;  2RKH A;  3COA C;  3CP2 A;  2CUZ A;  3TW7 A;  4Y4R A;  2H8R A;  1W36 D;  5EZG A;  2AQE A;  5D8K B;  3G73 A;  2IGO A;  3WTU C;  2TRT A;  3O8G A;  1WJB A;  1R5G A;  3REO A;  1YRN B;  3SFZ A;  3RI4 A;  2V1X A;  1U8B A;  3TO9 A;  3DPT A;  1R9T J;  3FZV A;  5GPA A;  3ZGK A;  4CCJ A;  2PMH A;  2JK3 A;  4Z6Y A;  1B9N A;  2KHM A;  2NNN A;  1Z6T A;  4DW6 A;  5H20 A;  2FJ1 A;  2RNG A;  4XLE A;  1BM9 A;  4EMS A;  1BIA A;  1BI2 A;  2FXA A;  3DXJ F;  2UXX A;  2DMT A;  2ACJ A;  4XRS A;  2QEX I;  1WCM J;  3O2P E;  3IWZ A;  4RB2 C;  2WA0 A;  4MEY F;  2MD5 A;  5K7F A;  2MBF A;  2X9D A;  3E6B A;  1JHF A;  2BVM A;  4A5N A;  1FOK A;  4KYW A;  1E3H A;  3KP4 A;  2VOD A;  3KPH A;  1EJ9 A;  4WK8 F;  4OU0 A;  4DQ2 A;  3I64 A;  2ZXW H;  3IC7 A;  2KJC A;  4WXC A;  3BR2 A;  5F0F A;  1MBJ A;  3L2U A;  3I58 A;  1J59 A;  3LAP A;  1ZGJ A;  2RVC A;  2YU9 J;  2JZY A;  2P7V B;  4G7H F;  4RM3 A;  4W97 A;  2DK8 A;  2YUS A;  3T5X A;  3OSG A;  3FXQ A;  2LG4 A;  2RRE A;  5EEA A;  2M0C A;  2JTV A;  4ZJZ A;  2A3S A;  2CG4 A;  4F92 B;  2VE9 A;  4CCM A;  2L9N A;  3AL0 C;  2OA4 A;  2HU9 A;  3GTJ J;  4F91 B;  3MFK A;  3EUH C;  2COM A;  5F6F A;  3K2A A;  1SFE A;  1V55 H;  2BY0 A;  2FEZ A;  2H94 A;  2YU3 A;  4B3A A;  2O5R A;  2GIZ A;  3OIO A;  4Z2Y A;  2FE3 A;  4RDU A;  2LDU A;  2K9S A;  1MH4 A;  2XB5 A;  4BYY A;  1REP C;  5LGU A;  5GAH J;  5CKT A;  2QKM B;  3DPU A;  3H0G J;  1N75 A;  1JGS A;  3LNQ A;  5J6X A;  1E2X A;  3PFY A;  4MLO A;  4LIV A;  2R4G A;  4XLN F;  3KCC A;  4LLN A;  3HGG A;  2XAS A;  1NHA A;  3FXO A;  2HYG D;  2ZSH B;  2M8E A;  4BJ5 C;  3IKV A;  2E35 A;  1ERD A;  2ME6 A;  2L7K A;  1ZAO A;  2WC2 A;  2W85 A;  3H92 A;  5J8F A;  3GVA A;  4JBA A;  2QVO A;  2L3D A;  3CF2 A;  3GZN B;  1ZRD A;  3KZZ A;  3GO5 A;  1UG0 A;  4RB3 C;  2W00 A;  2IVM A;  3OYG A;  1T39 A;  4KIB A;  3W2W A;  3SZT A;  4LB5 A;  3G71 I;  1JKR C;  1RKW A;  2KRC A;  1N77 A;  2OC6 A;  2V6E A;  3FXR A;  5IPA A;  4ZTJ A;  2FML A;  5JVT A;  2EWN A;  2KZV A;  4LMY A;  1RUN A;  4BAC A;  5E3M A;  3P5J A;  4JX4 A;  4L9T A;  2KKO A;  2KIQ A;  4BHB A;  4Q47 A;  5CPR B;  1P7I A;  4AIJ A;  3S3O A;  2O03 A;  4N4N B;  4U0Y A;  5KAI C;  3F3X A;  2MGQ A;  3H5A A;  5BPD A;  3WTZ A;  5HVQ C;  2A68 F;  1B8I B;  1SC7 A;  3WU1 B;  1R4M B;  5BMZ A;  3TQN A;  1K6O A;  2EFP A;  1W7P B;  3ZMS A;  1BC8 C;  2R7W A;  1TBX A;  5IOY A;  2VT3 A;  1TP4 A;  4M74 A;  1BW6 A;  1OYW A;  1V5F A;  1G8X A;  5JLW A;  2HVR A;  2DA1 A;  2G7H A;  4IXA A;  3DF8 A;  4IRH A;  4RS8 A;  2JSP A;  2CO5 A;  4D0P A;  1VQ6 I;  3KEO A;  3H3U A;  4W1U A;  1V5E A;  3TDU C;  3W6J B;  2XAJ A;  5L3F A;  5HLT A;  3RKX A;  3ZMZ A;  1IXR C;  4HST A;  2M0M A;  3S1M J;  2KPM A;  4CXF A;  4WX9 A;  1HDP A;  5AON A;  1UFM A;  1KU9 A;  1MNM C;  2CW8 A;  2DTZ A;  3WU2 C;  1A31 A;  1FWZ A;  2EZH A;  4C2U A;  3DTK A;  4NB5 A;  2MC4 A;  2LVS A;  4DBR A;  2Z1D A;  5FJ8 J;  3L1P A;  1FYL A;  1ETQ A;  2XAF A;  4L0Z B;  3CQZ J;  2Y75 A;  2HKO A;  4ABZ A;  3JAM Z;  3TED A;  2W48 A;  4HRI A;  4A69 C;  2Z5U A;  1KQ0 A;  4KN7 X;  1BI0 A;  1GLN A;  1VF9 A;  1DPU A;  3LSM A;  1XS9 A;  4WXD A;  2L0K A;  2ETH A;  3B6A A;  3RIR A;  1HKT A;  2FBH A;  1S72 I;  4OAY A;  5BS6 A;  2ZME B;  3KYC B;  1XMA A;  3QYB A;  2NS8 A;  2VI6 A;  1QQI A;  3GLX A;  3I5U A;  4YRV A;  1ORK A;  4RAY A;  2D1V A;  2KLO A;  1VQM I;  5J1R A;  2R7Z J;  2GLO A;  1XMK A;  3MKW B;  1R7J A;  2DA2 A;  2E2I J;  2K4B A;  1DP3 A;  1FLI A;  2F48 A;  3VYU B;  1X3Z B;  1LNW A;  2XPW A;  2HI3 A;  4CYC B;  3J80 K;  2FSW A;  4AVP A;  3KLN A;  1X4P A;  1W1W E;  1S5L C;  2COB A;  2BOL A;  3LFK A;  2RQQ A;  2ESN A;  3HOZ J;  3MZ8 A;  2KT0 A;  3PJR A;  2CUE A;  4FT8 A;  2MLG A;  2VIX A;  4IOA F;  4ASN A;  1E17 A;  3E6D A;  1B72 B;  3HOU J;  5EG0 B;  4KMF A;  3P7N A;  1I50 J;  1QZY A;  4WXH A;  1KZH A;  1WVR A;  3KP2 A;  4I02 A;  1ZRF A;  2P5L C;  4M3B A;  2VBW A;  3JSO A;  2EIJ H;  3BG9 A;  1IN5 A;  3EET A;  3SYT A;  3OYJ A;  3G6E I;  1O3S A;  2MAB A;  4HF0 A;  4UXN A;  1UMQ A;  3ESW B;  2F5V A;  3DV8 A;  3CCQ I;  1BR1 A;  4HNT A;  1HSJ A;  2QQB A;  1TNT A;  4UUT A;  1Z0X A;  4DGW B;  2W7N A;  2M34 A;  3DTE A;  3F8C A;  4LJZ F;  2AS5 F;  2DA7 A;  4A93 J;  2Z33 A;  3FF5 A;  2HXO A;  3W3C A;  3OYL A;  3PNY A;  3OIP A;  3OYN A;  2VB6 A;  2UV1 A;  4FAS D;  2MH9 A;  3GEZ A;  1MBE A;  3E97 A;  2UUZ A;  1QNT A;  3FMS A;  1QVT A;  1AWC A;  1LFP A;  2LY1 A;  3QPS A;  4ZH4 F;  2XRO A;  1WH7 A;  2E7W A;  1X2N A;  3CDI A;  2QQ9 A;  1AOY A;  2FOW A;  3GYH X;  2XAH A;  2LKP A;  2AO9 A;  1ZG3 A;  5B5E C;  4ZTF A;  4F52 A;  3TO6 A;  1NG7 A;  3SQN A;  3BTC A;  2VJI A;  5K1Y A;  3IH4 A;  5FLX Z;  1OYI A;  1FX7 A;  2J5O A;  2L4M A;  3JRE A;  1K4T A;  3V8J A;  4QIW N;  1VQO I;  2HVS A;  3BPV A;  4A3D J;  3MN2 A;  2K9Q A;  4L5E A;  4CA0 A;  1YRN A;  4M9Z A;  1G3S A;  3S1Q J;  2VPR A;  4BE1 A;  1KU7 A;  2HYF A;  3VDX A;  1ZN2 A;  1D0Z A;  2E5Z A;  2E71 A;  3JAM K;  2XF6 A;  4HNU A;  1Y39 A;  5E3N A;  1ZKG A;  4BH9 A;  1H0M A;  1ZAR A;  3FBI B;  3FMQ A;  4RB1 A;  3M1E A;  2OAZ A;  1PUF B;  4UB6 C;  3OY9 A;  4M3D A;  4XKV A;  1YFH A;  2HOS A;  2IAI A;  2VOO A;  4DYQ A;  1JUP A;  4AYB A;  2VE8 A;  1OFC X;  3ERM A;  4HZF A;  2ZJQ F;  3CMM A;  2STT A;  1WI3 A;  5EGO B;  3GFI A;  1ODD A;  4M9S A;  2JA5 J;  2JPB A;  1WJD A;  2LOO A;  3TP3 A;  1Z21 A;  3TMO A;  2VJJ A;  3FK7 A;  4X0G A;  1P9Q C;  1T56 A;  4N9I A;  3L09 A;  1WPK A;  3QP5 A;  4ZDL A;  2V9P A;  1T38 A;  1V5G A;  2I10 A;  1V3F A;  1I39 A;  2NS7 A;  3FDY A;  1TT0 A;  4BQN A;  1RZ4 A;  2X51 A;  1B1B A;  3ECO A;  1Z7U A;  1UEL B;  4IO9 F;  4A3E J;  5ICC A;  1TT5 B;  1A35 A;  3ZQC A;  2VUM J;  2M7B A;  2K4J A;  2DFH A;  4CCO A;  2W25 A;  1EH8 A;  4ZZL A;  1IXS B;  3ZMT A;  1U5T B;  1ZRE A;  1P6R A;  4CCK A;  5CVV A;  2F2E A;  4U0V A;  3A03 A;  4HG2 A;  4G6T B;  4HDU A;  3F8F A;  3OS2 A;  2PQ8 A;  2L9R A;  2STW A;  2BVL A;  3I59 A;  4TV7 A;  5FFZ A;  5DV5 A;  1OCR H;  1JHH A;  1LPQ A;  3HGY A;  3F72 A;  5E20 A;  1FYM A;  2EFO A;  4JX6 A;  2XDV A;  2E7X A;  1TL8 A;  2CGP A;  4NDL A;  3WG7 H;  1FYK A;  4HSR A;  3TGN A;  4ZDP A;  5FLM J;  1K78 B;  2VLA A;  1KA8 A;  2XB0 X;  3ZCO A;  1Y0U A;  1VTN C;  4BHP A;  2XSJ C;  3HSF A;  1ZLJ A;  4Y52 J;  2CQQ A;  4GDF A;  1GVD A;  3GZ6 A;  2XKO A;  2EA2 A;  5HLI A;  5IT9 Z;  3FM5 A;  3GFL A;  5LHH A;  2R5Y B;  1W0T A;  2MFZ A;  5FLX K;  2HNH A;  5FB2 A;  4U88 A;  2ELH A;  1ON1 A;  1Y8Q B;  2QZ8 A;  4HF1 A;  3T8R A;  1MIJ A;  4ON0 A;  3M8J A;  5HS9 A;  1WWX A;  5K5O A;  1G3Y A;  5FKN A;  2DOD A;  4A0X A;  1JE8 A;  2Z16 A;  1OCP A;  2CFX A;  1B8I A;  2DDB A;  2H09 A;  3QRF F;  1H9T A;  5LHI A;  5CVI A;  3LSR A;  2P6S A;  4HV6 A;  3RPQ A;  1B59 A;  1UJ8 A;  3FXL A;  2EV5 A;  1P92 A;  2IA2 A;  3BG7 A;  1VZ0 A;  1VQK I;  2WB1 N;  3U1K A;  2FQ3 A;  3HBL A;  1YJ9 I;  1L3L A;  2DPD A;  3EQL F;  3O3K A;  2J5P A;  3QYF A;  1FTT A;  2AXT C;  1JTY A;  1O7L A;  2R7R A;  1Z77 A;  3CJN A;  2BZT A;  4LK0 F;  4B8X A;  1D5Y A;  1T0F A;  2E34 A;  3N4M A;  2R93 J;  1IRG A;  3IP4 B;  3BJO A;  4B1R A;  2R0Q C;  4UUV A;  3DBR B;  3OSF A;  2XV4 S;  4YFN F;  4FCY A;  1ETV A;  3K4B A;  3BZC A;  4C30 A;  3Q0V A;  1IRX A;  4M9X A;  4J19 A;  5CLS A;  2YSR A;  1X1D A;  3Q9V A;  3VOD A;  3OYD A;  1I1S A;  3JR9 A;  1TWF J;  5C44 J;  5CVJ A;  1LQ1 A;  2LF7 A;  3FHN A;  2H1L A;  4OIQ F;  3DCF A;  4IQJ A;  4CDG A;  1VQ5 I;  1ZQ3 P;  2DI3 A;  2VC0 A;  4OAZ A;  2ME0 A;  1BA5 A;  3FIS A;  3AG3 H;  3KLO A;  3ZQL A;  4RGU A;  4F93 B;  4HX7 A;  3AFH A;  4O6J A;  5D5X B;  3DU5 A;  2V9K A;  2ZME A;  3S17 J;  1S7O A;  2A5W A;  2L9V A;  5HNH A;  4BEH B;  3LSI A;  4FTH A;  1MBG A;  3S93 A;  4XRF A;  2YX4 A;  3LQQ A;  3PSI A;  1SEU A;  2HOT A;  2DT5 A;  4EV0 A;  4WF2 A;  2PJP A;  4XM3 A;  1RI7 A;  2IW5 A;  3H3Z A;  2JA2 A;  5E79 C;  5F0H A;  3QPT A;  1VND A;  2EQR A;  1JT0 A;  4Q5S F;  1D5V A;  1AA7 A;  1VQ7 I;  4HDV A;  1W5C C;  2PBI A;  1RR7 A;  2BBY A;  3BZK A;  4C3H J;  3A01 B;  4A6E A;  3F21 A;  1BJA A;  4DZP A;  1B72 A;  2F5C A;  5EG0 A;  1IRF A;  1STZ A;  2QGU A;  3G3Z A;  3TOA A;  5F0C A;  3ZPL A;  3K7A J;  1ETX A;  1H8A C;  3SFI A;  3JTH A;  3R60 A;  2DFE A;  3LL7 A;  4L0Y B;  5F27 A;  4CO8 A;  3A02 A;  2M4G A;  4XR6 A;  5ICE A;  1U8R A;  5J8C A;  1S8N A;  3W6V A;  1IV6 A;  4M6V A;  4MNU A;  2WAQ A;  1X1B A;  4YEL A;  3HC7 A;  4XID A;  3ZOB A;  3E5X A;  2K40 A;  5IT9 K;  1J75 A;  2NNY A;  1R4N B;  3I9V 2;  3C2G A;  1WQ2 A;  1FOW A;  4RLQ A;  5B66 C;  3H9J A;  3HJE A;  3KP7 A;  1ZTR A;  2VKD A;  4PGH A;  1SD5 A;  4UVC A;  2V1U A;  2DFI A;  3F8N A;  2ZXJ A;  3ZQG A;  4UY8 I;  3HOV J;  1OCT C;  1FT9 A;  1Q1H A;  2OV7 A;  4UV8 A;  4NUB A;  4HF2 A;  4NQW B;  3BQZ A;  4PJL A;  2M3A A;  4AC0 A;  2LBF B;  4IX7 A;  3F6O A;  4IOC F;  1Z6R A;  1LUJ B;  1XN7 A;  5IOZ A;  1FTZ A;  1PJR A;  1DGW Y;  3N05 A;  4A12 A;  5K5R A;  1YO5 C;  4FX0 A;  3ECH A;  1WJE A;  1U9N A;  4HNV A;  2M9H A;  4Q48 A;  2HS5 A;  2JRT A;  1FSE A;  3BOQ A;  3MKY B;  4B43 A;  1WH5 A;  2LYC A;  5B3S H;  3Q5F A;  2JQ7 A;  5JR3 A;  4YIR X;  2L7Z A;  1YQA A;  2E1C A;  4BAY A;  3EUH A;  2VL8 A;  3PQJ A;  1BBY A;  1MD0 A;  1LDK B;  1J09 A;  4BY1 J;  2IS1 A;  4HV5 A;  1QPM A;  3C2B A;  3DEU A;  3E1S A;  1R49 A;  4CGZ A;  2R7Q A;  1G59 A;  3RKQ A;  2IT0 A;  2CSO A;  3S15 J;  1FPQ A;  1S7E A;  2W4S A;  2DCE A;  4XMY A;  4XOT A;  3LSP A;  3KIO A;  2P5K A;  4UVA A;  1FMW A;  2KIS A;  3HTU A;  4CUG A;  5E3O A;  3RKY A;  2BW3 B;  1GV2 A;  3O6B B;  3HRT A;  4RBO A;  2GBY A;  2ESH A;  1JKQ C;  3PNT A;  3RSN A;  1T33 A;  3OIQ A;  4EAT A;  3SDB A;  2OCE A;  2VKE A;  1PUF A;  4PFO A;  1IW7 F;  1FEX A;  1JGG A;  1BOA A;  1FBQ A;  2R5Z B;  3HKZ A;  2VKV A;  3M9A A;  4A3K J;  2TCT A;  2OU2 A;  3CD6 I;  2FMY A;  1QVU A;  2X6O A;  3K2Z A;  4E70 A;  3WHB A;  3VFZ A;  2V1N A;  2W84 A;  1JJ8 C;  2QSF X;  3C3W A;  5EGO A;  1KU2 A;  3D5S C;  4G7Z F;  1MMA A;  1ZR2 A;  4IHW A;  3CP8 A;  1XGN A;  2OZ6 A;  2X6W A;  1ZEL A;  3RZO J;  1XDS A;  2XGD A;  2N8G A;  3LA7 A;  1IDZ A;  1J9I A;  3BJA A;  3RTR A;  3BLY A;  3MEX A;  3OYI A;  2O0Y A;  3I0T A;  1QA6 A;  4MFE A;  4F55 A;  1C0W A;  2A69 F;  3S32 A;  4LK1 F;  3CJQ B;  1P7J A;  1JKP C;  3DWL E;  4LG3 A;  1FNN A;  2IJL A;  3CME I;  5LRS A;  1GXP A;  2DN0 A;  4P9F A;  4OIR F;  1W36 C;  3WG9 A;  1VQN I;  1DUX C;  1SMT A;  1U5T A;  2CQN A;  3RPU D;  4DYR A;  2BHZ A;  2HZT A;  3P9K A;  3JCU C;  4BXF A;  3PO3 J;  3C7J A;  4X1E A;  1SAN A;  1ZHF A;  2EZK A;  3ONQ A;  4CSW A;  4IZZ A;  1YYV A;  1DU6 A;  3H9Q A;  1IDY A;  4XBF A;  3EYY A;  3SEZ A;  1IC8 A;  1APL C;  4S0H B;  1LB2 A;  1LFU P;  3PFI A;  2R7S A;  1OYY A;  3KZY A;  2KQR A;  1NTC A;  2E19 A;  5DM6 F;  4G6D A;  2VC1 A;  2HEO A;  2VN2 A;  1Z05 A;  2R3S A;  3TBI A;  4E7L A;  2V79 A;  4BU2 A;  1R36 A;  2HQR A;  4HLY A;  3WGG A;  5ICG A;  2DTR A;  2KP6 A;  4E6K G;  2K27 A;  1RKT A;  5KNL A;  1K78 A;  2GQQ A;  1YIT I;  1BW5 A;  2HQ5 A;  4XN0 A;  4Y7N J;  1LEB A;  4IRI A;  1BIB A;  3HG9 A;  5KCM A;  2JUC A;  3QU6 A;  3FKI J;  1XCB A;  2WAD A;  4KA4 A;  4IQ4 A;  3ZRG A;  2A6T A;  2R5Y A;  1AU7 A;  3HEF A;  5F08 A;  2ZXH A;  5E1Z B;  2ZXI A;  4G12 A;  2QQ8 A;  4RGS A;  3FXM A;  1BJZ A;  4J01 A;  1N25 A;  3TKY A;  4IKF A;  5IY5 H;  3S16 J;  2L7F P;  1E0E A;  4ZYG A;  4A3F J;  2WY8 Q;  2LRD A;  2WAF A;  5DEQ A;  4HQM A;  1XTA A;  1NG6 A;  2EV6 A;  3BP8 A;  2XIG A;  3ABM H;  2RQP A;  5J3L A;  1EH7 A;  1HKQ A;  5LEJ A;  2HR3 A;  2IXS A;  1TQI A;  4HEA 2;  4LLG F;  4RAF A;  2KZG A;  2MD0 A;  3OV8 A;  5FD6 A;  3BC8 A;  4KUM A;  1GHC A;  2HOE A;  4IEJ A;  3RJP A;  1VI0 A;  4RA2 A; 
#chains in the Genus database with same CATH homology
 4F52 A;  1UAA A;  4C2T A;  1NG7 A;  2VJI A;  2X6Y A;  3D5R C;  1D0X A;  4B44 A;  2PJR A;  2WAE A;  2XF7 A;  4PJN A;  5HOO A;  3K70 D;  1PYV A;  2DJI A;  4HPQ A;  2HVS A;  2OUM A;  3A1Y A;  3OYM A;  4U7B A;  2X6X A;  4BDZ A;  2IS2 A;  4E7J A;  5JHF A;  4BE2 A;  2VPL A;  4CA0 A;  1BOB A;  2HVQ A;  3KX2 A;  4XLH A;  2CW7 A;  4XNF A;  4B48 A;  2CFO A;  3HPG A;  4F3Q A;  4BE1 A;  3H9G A;  1WJA A;  2PJR B;  3VDX A;  2IS6 A;  1D0Z A;  2E5Z A;  2XF6 A;  2W82 A;  4HNU A;  5LD2 C;  3K4C A;  3OWT A;  4PFP A;  1R6R A;  2CS3 A;  2L2O A;  2KMU A;  3FBI B;  2DT6 A;  2L9S A;  4CCN A;  4KIT B;  3OY9 A;  4XKV A;  2X85 A;  3K4L A;  4E7I A;  1YX3 A;  4CH7 A;  1DQU A;  3S3M A;  3I3L A;  4AYB A;  3U21 A;  4BEH A;  1EA3 A;  1TZL A;  2CMP A;  2WY7 Q;  3CMM A;  3DKX A;  1BR2 A;  2HPI A;  1QU3 A;  3C2H A;  2E1M B;  3L2R A;  4XOP A;  1WJD A;  2LOO A;  1Z21 A;  3TMO A;  2VJJ A;  3E0J B;  4C9Y A;  3AKZ A;  4R79 A;  4X0G A;  4BUP A;  1P9Q C;  5HNF A;  2E5N A;  2NOJ B;  2DT7 B;  4XLF A;  4ZDL A;  1V5G A;  4B47 A;  3VWB A;  2CV1 A;  3FDY A;  1TT0 A;  4BQN A;  4E7Z A;  2MYS A;  2X51 A;  2JVH A;  3LSH A;  1MMD A;  1UEL B;  4BQO A;  4XKW A;  4DOZ A;  2Q2E B;  2VQH A;  2M7B A;  4NNJ A;  3VYS B;  4DJA A;  4DBQ A;  4XL9 A;  4CCO A;  3DPL C;  4II3 A;  2Y0S A;  3CJR B;  1MMN A;  3L2V A;  3QOE A;  4CCK A;  3MMY B;  3QOD A;  3KEY A;  4YEJ A;  4HG2 A;  4G6T B;  4ZDO A;  3OS2 A;  3HOT A;  1QHG A;  2M4K A;  4AVZ A;  2IGK A;  2VQL A;  2P0W A;  3V42 A;  2BVL A;  5FRN A;  3SEQ A;  1HA8 A;  2X1D A;  1BR4 A;  1T0F C;  2K9M A;  3DLA A;  2HPM A;  3PSF A;  4XQF A;  2XDV A;  3LSK A;  3VYT B;  2I8D A;  4HSR A;  2CV2 A;  1YE9 A;  3H0D A;  4ZDP A;  2LBF A;  3CZ6 A;  2VLA A;  2LH9 A;  4FET A;  3ZCO A;  3PL8 A;  2XSJ C;  4XKB A;  4KT6 A;  1FMV A;  3ZR8 X;  1QHH D;  2F6C A;  2KDO A;  2HQA A;  2XAU A;  4RM2 A;  2MFZ A;  3H5R A;  2HNH A;  3OS0 A;  2R7X A;  4XLC A;  2X1E A;  2VJ5 A;  2DXI A;  3TL4 X;  4PJM A;  3M8J A;  4PJJ A;  4AU7 A;  1D0Y A;  2GOM A;  2Z16 A;  2DOA A;  3CES A;  3OMY A;  3OS1 A;  3K4K A;  3OYA A;  1JI8 A;  3W2V A;  5TGT A;  1WFX A;  3EUK L;  2IS4 A;  3VSK A;  1S9H A;  3BCA A;  3BG7 A;  1VZ0 A;  3MD2 A;  3G2B A;  4E7H A;  2BW3 A;  3CP2 A;  3K4N A;  1WJC A;  3QYF A;  2CUZ A;  4Y4R A;  3EUA A;  2R7R A;  4BJ6 C;  4XKC A;  2LY2 A;  1YX5 A;  1W36 D;  2AQE A;  4RLF A;  3IP4 B;  3M1C A;  2IGO A;  1KON A;  1WJB A;  3QYE A;  1Z7L A;  4BJT A;  3K4B A;  4C30 A;  3DPT A;  3ZXS A;  1IRX A;  3ZGK A;  1X1D A;  4CCJ A;  2K5C A;  2Q1Z B;  3UNG C;  3OYD A;  2HZD A;  2KHM A;  2JUG A;  4ZC3 A;  2RNG A;  4XLE A;  3FHN A;  1OLT A;  2W1O A;  4XLA A;  1Y6I A;  1MMG A;  1Z3Y A;  4IQJ A;  3VSL A;  4OAZ A;  1LVK A;  4E4H A;  1OR7 C;  1T95 A;  2WA0 A;  4F93 B;  3OYB A;  3AFH A;  4ITV A;  3DU5 A;  2V9K A;  2BVM A;  2A5W A;  5HNH A;  5FRO A;  4BEH B;  3LSI A;  3H5N A;  4J00 A;  3OYH A;  3S93 A;  3PSI A;  4BQQ A;  3L2U A;  3IAS 2;  3K70 C;  1LKX A;  4XM3 A;  2JA2 A;  2CUJ A;  1U0J A;  2M7A A;  3K10 A;  4RM3 A;  1AA7 A;  1X4O A;  1WJ5 A;  3DQV C;  2R7O A;  3ZQQ A;  3HOS A;  2LG4 A;  2RRE A;  2VQC A;  2Z2S B;  4ZYA A;  3OYC A;  2IGM A;  4ZJZ A;  2WBM A;  1SFK A;  4F92 B;  4N4O B;  1D1A A;  4CCM A;  2L9N A;  4BL0 B;  3AL0 C;  2HU9 A;  2AQF A;  4F91 B;  4XOR A;  3EUH C;  3OOU A;  4ANJ A;  3LL7 A;  3W2A A;  2L5Q A;  2O5R A;  4B3X A;  2M4G A;  4XR6 A;  3DU6 A;  3OYK A;  4Y3O A;  2WAQ A;  1X1B A;  4YEL A;  3HC7 A;  2F4I A;  5CKT A;  2QKM B;  3DPU A;  1N75 A;  3F9K A;  2HDW A;  4XN3 A;  2ELJ A;  4Y33 A;  3I9V 2;  3C2G A;  4RLQ A;  4MLO A;  3H9J A;  3PFY A;  4LIV A;  2R4G A;  4QPO A;  2VKD A;  4KJZ A;  3HXL A;  2ZSH B;  3A2K A;  4BJ5 C;  5CQE A;  1MNE A;  1ERD A;  2L7K A;  3GBG A;  3OR1 C;  3HL2 A;  2OV7 A;  2ZSI B;  3L2Q A;  4NUB A;  4NQW B;  1DGR M;  3CF2 A;  4PJL A;  4LIT A;  1X1C A;  1UG0 A;  2M3A A;  2W00 A;  2LBF B;  4IX7 A;  4NC8 A;  2V26 A;  1MW7 A;  3OYG A;  4BS9 A;  3W2W A;  3OYE A;  1PJR A;  1DGW Y;  3N05 A;  2KRC A;  3RQ4 A;  3IUO A;  3LFU A;  1N77 A;  1Z3X A;  2OC6 A;  1WJE A;  4DIQ A;  3OYF A;  3HUG B;  4BE0 A;  2V6E A;  2UWM A;  2VXZ A;  4ZTJ A;  3FBN B;  3H35 A;  2KZV A;  4PSX A;  3OL4 A;  4BAC A;  4H4K C;  3MKY B;  2K9L A;  2LRE A;  5CPR B;  2LYC A;  4B43 A;  3S3O A;  4N4N B;  2V4J C;  3H5A A;  3VYR B;  1D1C A;  2VL8 A;  5HVQ C;  1LDK B;  1J09 A;  2IS1 A;  2R7W A;  3NWS A;  3E1S A;  3HPH A;  2R7Q A;  1G59 A;  1V5F A;  4PSW A;  1G8X A;  2W4S A;  1X19 A;  2DCE A;  4XMY A;  4XOT A;  2HVR A;  4BDY A;  3AL0 B;  1K6Y A;  2JSP A;  1FMW A;  4CUG A;  4BGD A;  4P1W A;  2BW3 B;  3J7A Y;  2VKH A;  1SAU A;  4LIU A;  3PNT A;  3RSN A;  1V5E A;  3OIQ A;  4EAT A;  4RMN A;  3SDB A;  5HLT A;  4HST A;  2M0M A;  2KPM A;  4PFO A;  3L2W A;  3HKZ A;  2CW8 A;  2GOX B;  5FRM A;  2JVG A;  4C2U A;  3DTK A;  2MC4 A;  2V1N A;  4DBR A;  2R7V A;  2Z1D A;  3D5S C;  5CQG A;  3D5L A;  3NWT A;  1MMA A;  4P5O A;  3EPZ A;  2PMZ A;  3BCB A;  3CP8 A;  4HRI A;  2CH0 A;  1D1B A;  3S8P A;  2X6W A;  3K4M A;  4JOM A;  1GLN A;  3DEE A;  1ZEL A;  2IGN A;  3LSM A;  4U87 A;  5LFA A;  4II2 A;  3K4J A;  2KL4 A;  2FUG 2;  3RTR A;  2XC7 A;  1WJF A;  3BLY A;  2CV0 A;  2K3P A;  3OYI A;  3LSG A;  2VQG A;  3PNV A;  4F55 A;  4OAY A;  3S32 A;  3QYB A;  3CJQ B;  4CCL A;  4YRV A;  2KLO A;  3PUB A;  3MKW B;  3DWL E;  4JQF A;  4LG3 A;  1DP3 A;  2KRH A;  2X1C A;  3VYU B;  1W36 C;  3A4C A;  3RPU D;  4E7K A;  1X4P A;  1MND A;  4BXF A;  2BOL A;  2ZFU A;  2RQQ A;  3ONQ A;  4CSW A;  4IZZ A;  3SZG A;  4XON A;  3H9Q A;  4D9J A;  2E60 A;  3DKY A;  3OL3 A;  3PJR A;  2R7U A;  2VIX A;  3SEZ A;  2R7S A;  2KQR A;  4NC7 A;  2XF5 A;  3MKZ A;  3RCO A;  4QPQ A;  3TBI A;  4E7L A;  4BU2 A;  2KP6 A;  2VXD A;  3UR3 C;  3DTI A;  4E6K G;  5KNL A;  3SYT A;  3OYJ A;  4XN0 A;  2V7F A;  2VJ4 A;  2QKL B;  3BG6 A;  3HG9 A;  2MAB A;  5KCM A;  2F5V A;  2WAD A;  4IQ4 A;  3FKJ A;  1BR1 A;  3K6G A;  1N78 A;  3ZRG A;  4HNT A;  2R7T A;  2A6T A;  4KIS A;  4PK4 A;  4DGW B;  2ZXH A;  4OWR B;  5KHD A;  2ZXI A;  1X1A A;  2W7N A;  2E1M C;  4J01 A;  4IKF A;  3DTE A;  1Y56 A;  1E0E A;  2WY8 Q;  2LRD A;  2WAF A;  3W3C A;  3OYL A;  3LMM A;  4GRI A;  3PNY A;  3OIP A;  3OYN A;  2VB6 A;  2UV1 A;  3IAM 2;  4FAS D;  1NG6 A;  4PUS A;  2UUZ A;  1LFP A;  2LY1 A;  3KYL A;  3S3N A;  2IXS A;  4HEA 2;  4D1Q A;  2WB1 A;  4CZC A;  2MD0 A;  2LC2 A;  3BC8 A;  3OR2 C;  4ZTF A;  4E7S A;  2VAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...