2XSJC

Structure of desulforubidin from desulfomicrobium norvegicum
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
104
structure length
104
Chain Sequence
AMIEFKGKSFEIDEDGFLLKFEDWGPEWAEYVKESEGISEITEAHQQILDFLQDYYKKNGIAPMVRILSKSTGYKLKQIYELFPSGPGKGACKMAGLPKPTGCV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SULFITE REDUCTASE ALPHA SUBUNIT
publication title Structural Insights Into Dissimilatory Sulfite Reductases: Structure of Desulforubidin from Desulfomicrobium Norvegicum
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 27
structure length 104
sequence length 104
chains with identical sequence F
ec nomenclature ec 1.8.99.3: Transferred entry: 1.8.99.5.
pdb deposition date 2010-09-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF04358 DsrC DsrC like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.370 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2xsjC02
3.30.1420.10 Alpha Beta 2-Layer Sandwich Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 Dissimilatory Siroheme-sulfite Reductase; Chain: A; domain 1 2xsjC01
3OR2C 1SAUA 1JI8A 1YX3A 2A5WA 3OR1C 2XSJC 2V4JC
chains in the Genus database with same CATH superfamily
2H8WA 5H20A 3EUAA 4AU7A 5FB2A 5KAFC 5GAEJ 1YJNI 2H09A 4KFCA 1ZRDA 4M3GA 5ICCA 2E2HJ 2XB0X 4LG3A 5K5OA 2HYFA 2IA2A 2TRTA 2JVGA 1WJDA 4NHJA 3K4JA 2VOOA 1FEXA 3BPXA 1T08B 1JI8A 4EJTA 4A0XA 1AOYA 4MO7A 1RC9A 4RGUA 3F6VA 1H88C 3UNGC 3E6MA 2O5RA 5E3LA 5EGOB 3BR2A 1QU3A 3CLOA 1NG6A 1TZLA 3CMAI 5DTDA 5F1RA 2F4IA 3K70C 5FGMA 1KU9A 2BXZA 2LTPA 3LMMA 2EIMH 1VI0A 3CESA 4XKBA 3WG7H 4ABZA 4DBQA 3PFYA 3CMYA 4OAZA 4BAYA 2VB6A 3LSJA 3AAFA 4BHBA 2K85A 3FHZA 1LFBA 3S3OA 4FETA 4LMYA 3CMEI 5ILSA 5B3SH 4OIOF 1XC5A 1IRXA 2HU9A 5JR3A 1S29A 3GFJA 1IUFA 4UV8A 5JLWA 2HTSA 3V7RA 3MKYB 4HF2A 2XAHA 1ENHA 1TC3C 3OYFA 3H0GJ 4AUXA 2L7FP 5DM7F 2MC4A 3F6OA 4PCQA 1OYWA 3RPUD 3IL2A 4F92B 2RDPA 2XC7A 2LSOA 2Q8KA 5JLXA 1LB2A 1OPCA 4N4NB 2EFNA 1FBSA 4ZC3A 4I6ZA 2PQ8A 6PAXA 9ANTA 4XIDA 5ILUA 2X1DA 2VQLA 2CRGA 2XAFA 1VZ0A 3QPLA 4W97A 2FF4A 3S1QJ 2VE8A 1JKOC 3PM1A 5IP7J 3JTGA 1IRGA 3TGNA 3ZQGA 2A3SA 3E5UA 1QA6A 5J47A 3RKWA 2QA4I 2MABA 5D5WB 2GLOA 2P0WA 3IHUA 3K9TA 4YFNF 2ELHA 4DOZA 2XVCA 3IKVA 3HG9A 5HLTA 5K7HA 3BG3A 3K6GA 4B8XA 4OU0A 3X2QH 3RKYA 3CCLI 1FZPB 3ZMZA 2E1MC 4WXCA 1E2XA 2UUZA 1BC8C 2D1VA 2OCCH 1XCBA 2XSDC 2DT7B 4DIQA 3HRTA 4ON0A 3DWLE 3OS0A 3BTCA 4YELA 4R79A 1LDDA 2BOLA 4XKCA 4XRFA 2CG4A 3I59B 1LE8B 4LG0A 2K40A 1SMYF 2PMHA 1SMTA 4PFOA 2Z16A 3G73A 3K69A 1YW8A 5IYBJ 5DD4A 3PIPF 1IRFA 4C3JJ 3H1CA 3WTYC 1IXCA 3CDHA 2QUFA 2Y9YA 2WV1A 2QKMB 3CCQI 5LHGA 3JCUC 3RKQA 2HVSA 2JA8J 2QKLB 4RAZA 3OMYA 1CF7B 4RB3C 3JRCA 4F7ZA 2OQGA 3ASOH 3D0SA 3SEZA 1T33A 2R5ZA 4EMSA 1JKQC 4R8HA 1ITYA 1JKRC 4HW0A 1Z77A 2HOEA 3GLXA 4P1WA 2LMDA 4R1HA 2K3PA 3TO9A 2OF7A 1WSUA 2V9PA 3CO6C 1R49A 2E5ZA 1SVOA 2HKOA 2V6CA 2XB5A 5B1AH 1I1GA 4OMYA 2A5YB 4BQAA 5J4YA 3SDBA 2LBFA 3HBLA 4NDLA 1IF1A 3IAM2 2JSPA 2ESNA 2KJBA 4UUVA 1QZZA 5C4JJ 1R58A 1IAWA 3ZQQA 2DOAA 2LRDA 2Y0MA 3WGIA 5CVUA 3ZCOA 4B48A 1IDYA 4I2OA 5LHHA 3JR9A 2LF8A 3E6BA 2F48A 4HNVA 1LFPA 1QNTA 2R7TA 3JSPA 2OTLI 2OTJI 1IN7A 5EYRA 1W5SA 4CO8A 2Z9OA 2VE9A 2KRCA 2M1BA 2B7EA 1E3HA 1HDPA 3Q9SA 2D45A 2X6YA 3ZQIA 2DPDA 3MEXA 1MD0A 2LVSA 2OD5A 4RAFA 1RPWA 1DGRM 3F9KA 2P5KA 3CUQB 1ZQ3P 3DPTA 3Q3SA 3W6KB 1T39A 5JHFA 5CPRB 2NNYA 3OYAA 1W36C 2JVHA 3LQRA 3LNQA 1IUYA 4P96A 1FP1D 1WWXA 2Y2ZA 3I55I 2R5YA 4AIJA 3HOWJ 1G2HA 2ZXIA 1V54H 2E5NA 3K4KA 4AD9A 5GAGJ 2FSWA 3ZQFA 5M5XJ 3WTVC 1IDZA 3RDIA 1YQAA 2ETHA 2Q1ZB 2A68F 2DA4A 1FNNA 3I71A 2P5VA 3W2VA 1GXQA 3S2WA 5E1XA 1YRNB 1BR1A 4EJWA 1I5ZA 5HLGA 3CCJI 1BOAA 4D5CA 1G4DA 2WB1A 1HQCA 4BXUA 4F55A 1JT0A 2CJJA 1OCOH 4IL6C 5FD6A 3I0TA 4BNCA 3K4NA 5FLVA 1N75A 5CQGA 4RGXA 4B43A 4U88A 4WXHA 2EPFA 4IVNA 2H6BA 2VONA 4K2EA 3OYJA 2VJIA 1LDJA 3U2RA 5HDKA 2BYVE 2L01A 2FOKA 1XGMA 3LL7A 1BJZA 2MH2A 3BDDA 2X48A 2YX7A 2DK5A 3C2BA 4L9TA 3FXQA 2EFPA 3L2UA 1UAAA 4BE1A 1TNSA 4LB5A 3ZOBA 4YEJA 1O3TA 3T8TA 2AS5F 1QHHD 1IRZA 3CDLA 1TQPA 4I0BA 3CDIA 2C6YA 1B59A 2OPTA 4JX4A 3NWSA 4EJOA 2HQ5A 2VXZA 3GFIA 3HPGA 3A1YA 3JRDA 3TO6A 2JA2A 4IHYA 1ETQA 2DN0A 4BBSJ 2LKPA 3N4MA 3WU1B 2JA7J 2MW8A 4X0GA 3I56I 4CXFA 1PYVA 1I3QJ 2JSCA 4HQMA 3FMQA 1B72A 3AKZA 4OIQF 1QZEA 2P81A 1ZG5A 4FE4A 2GWRA 4XLNF 2ZC2A 2DU9A 3J81K 1Y1WJ 1STZA 3MCZA 4OOIA 2NVUB 1ZK8A 3ZMSA 2O7OA 3M8EA 2JWTA 5L3BA 1YFHA 2W85A 2KMUA 5E3OA 1MMSA 4BXXJ 2DMUA 3L2CA 3J80Z 4KJZA 3PO2J 2CWEA 2OQRA 2RAEA 2QLZA 3ZMVA 3F8NA 5F04A 2KPMA 3GLLA 1PP7U 4CDGA 2DFHA 1VQ6I 5IT3A 1LE8A 2FMLA 1ZELA 3ZMTA 5FLMJ 4MGRA 2E1MB 4KUMA 4FX0A 3O6BB 3ZN1A 4G7HF 3L2VA 2X4HA 1WRJA 1QGPA 3GWZA 1W36D 3UR3C 2GIZA 3GX4X 5HDGA 2NVQJ 4XONA 2XASA 3CD6I 2D2WA 1ZN2A 2XAJA 3D1NI 4L5JA 3BQYA 3U9GA 5IOZA 1MMDA 1EH7A 4M6YA 1K78B 1JGGA 1TL8A 3BP8A 4BS9A 2HQNA 3OSFA 2ECCA 2QM3A 3AG3H 1SD4A 2M0CA 2WB1N 5IPAA 2D5VA 3PFIA 4YIIA 4CH7A 1RNLA 5D4RA 2DFIA 4QPOA 5IY5H 2MFZA 4WWCA 2DA3A 3IC7A 4RAGA 2XRNA 4HNUA 3M3YJ 2VJ5A 3R61A 2EQRA 3C2GA 2D1HA 1WJEA 4KNYA 1VQ9I 1LQ1A 5GTIC 4HDUA 5LRSA 3DCFA 4XKVA 2L4AA 2EBIA 2DYSH 2L7MP 3Q0WA 1Z21A 5KVRA 2XPWA 1G8XA 4B4CA 2PJRA 2DW4A 5E20A 1RI7A 3L2QA 5CQEA 1G3YA 2Z99A 4ZYDA 1XPXA 3JREA 5BOXA 3FIWA 2DFEA 2OAZA 4BBRJ 2H94A 1FSEA 4EQQA 3DEUA 3OL3A 3B73A 2VPLA 1WCMJ 3PUBA 1U0JA 1Z3XA 1Y8RB 3M1EA 1KGSA 2IVMA 3LOCA 3I53A 3A4CA 2LD5A 3UKGA 4A3IJ 3QP5A 5F27A 3G6EI 4Y7NJ 1XB4A 4OIRF 4NC7A 2QF7A 1YJ9I 3REOA 4IQJA 4BJTA 1K6OA 2P7CB 1N77A 3QYFA 2AQFA 3K10A 2UXXA 3BR6A 4CCNA 1JGSA 1S3JA 4GYIA 4PUSA 4BYYA 4NB5A 1D1CA 4NC6A 2XKPA 3S93A 2EFOA 5L3EA 2QBYA 3LSMA 4XOPA 1BW5A 4YIFA 4AC0A 1D8KA 4A0YA 2YSRA 3B02A 1ON1A 1XSVA 2K9SA 5F0FA 3I3LA 2VUMJ 4X6AJ 3S2HJ 2PMUA 3IH4A 4M71A 3SZTA 2HFHA 2HWVA 3S8PA 3QPTA 2KLOA 1WJCA 2VI6A 5J8FA 2XROA 1ETVA 1SFUA 2EB7A 4HNTA 1Z7UA 4M74A 1LVKA 1ETOA 1FWZA 2BXYA 2X1EA 3KFWX 3GFMA 2MH9A 3DP7A 3CC4I 2IA0A 1REPC 1QRYA 2W57A 3ZQ7A 1JTYA 3I58A 3FKIJ 3JRBA 4LIUA 3IWFA 4CCMA 3F8CA 3J7YJ 3MZHA 3S2DJ 1ZG3A 1MJAA 4PFPA 3LWFA 3NRVA 3DPUA 5H6QA 3S15J 3E6DA 4ZDLA 3H36A 4CSWA 4KITB 3V8LA 2ZBKA 1EV7A 2R0QC 2VQGA 3HRUA 1TLHB 4PJ0C 5EZGA 4Y52J 1UHSA 2CQQA 3MMYB 4LLGF 4Y13A 1GUUA 4ZDOA 3B6AA 2QQAA 4LIVA 1I1SA 4I01A 4DZPA 2JA6J 5BNGA 2O8KA 2P4WA 1MSEC 4N9HA 4EM1A 2P8TA 2R92J 2LREA 4BXFA 1USTA 3Q0VA 3ECOA 3FF5A 4LD5A 2XSJC 1MBKA 1H0MA 1R4NB 1BA5A 1Z67A 3OS1A 4E7SA 3CJTB 4DZJA 1AWCA 1SD7A 2ZFWA 2QSHX 2LNBA 3FISA 3CP8A 3VSLA 3FDYA 3OYCA 2TCTA 4B3XA 5JHUA 2RNJA 1MMGA 3WHBA 4NNJA 2ZO4A 2R7OA 1MBJA 2DODA 2E71A 4A3JJ 1X3WB 3QQAA 3ABLH 1VQMI 2P5LC 4G6TB 1G59A 3DEEA 3BLYA 4BH9A 2IPQX 4Z6YA 3WTTC 2HQAA 4PGHA 1ZG1A 4BDYA 1POGA 5GTHC 1H89C 2EZHA 3KZZA 1WQ2A 3T8RA 1XDUA 4JOMA 4UUSB 2X9DA 3FBIB 4AVZA 1MMNA 2R5ZB 4KMFA 3BZKA 1IN8A 2LK2A 3H5NA 4HF0A 2CSOA 2GXBA 3JW4A 2LY9A 2LY1A 1UJ8A 4RAYA 5M5YJ 2CUFA 3OV8A 1RIOH 4XQFA 1HDDC 4C2TA 5DUKA 4I7HA 3TEDA 2CH0A 4GFBA 4V19K 3HXLA 3HOYJ 2V26A 3EPZA 4Y33A 4ZYGA 2DAOA 1HW1A 2IAIA 2OV7A 1JHFA 5LFAA 4ANJA 2DCEA 3DU5A 1YS6A 1BR4A 1ZGJA 1SVLA 2F4MB 1HOMA 2QWWA 1J75A 3D5SC 5J6XA 3PSIA 2PJPA 4WX9A 5JVGF 4HLYA 1LEAA 3S14J 4BY7J 2G0EA 4HLXA 1YTYA 2PFBA 4OWRB 5BQTA 3M07A 1EH8A 1LVAA 4PK4A 4DW6A 2BZTA 2Q2EB 2DT6A 5KK1A 2QZ8A 3FXKA 4HSRA 4A12A 1V5FA 4QIWN 2DMNA 1K61A 4E7ZA 2KISA 2L7KA 3MKWB 2ZJQF 2YPRA 1WGXA 2NRAC 4II3A 3ZPLA 2VJJA 3KP3A 2V7FA 2K9MA 1FX7A 3FXOA 3I4NJ 2UWMA 4CYDA 1VQPI 5D8KB 2ZSIB 2A5WA 3ZN0A 3OIPA 1GXPA 2RREA 4MFDA 4G6QA 3IKTA 3KX2A 2OZUA 2ID6A 2L9RA 1ETKA 2RNGA 3PNYA 5HLIA 3OYNA 2CQXA 2VBYA 5CJ9A 1WJAA 1YI2I 1KQ0A 4GRIA 2R5YB 1PUEE 4RS8A 4HA8A 1YHQI 3FXRA 3M1CA 3L7WA 3BWGA 1CGPA 3H5AA 3CCEI 4RA2A 1RKWA 4BEHA 1JUMA 5FFXA 3I64A 4RB1A 2Z3YA 3F22A 4MEXF 1FT9A 3BR0A 3CZ6A 4YFKF 3A02A 4IO9F 3ROUA 1V4RA 3HOSA 2VKHA 2JUGA 1RR8C 4DGWB 1VQLI 5LEKA 2XGEA 1YX5A 1W4MA 4MNUA 4WF2A 3SEQA 3OIOA 3G71I 2WADA 2G7UA 1YIJI 2CV0A 2E7WA 2XF6A 2XRLA 3GTLJ 3O3KA 5CYVA 1ZYRF 2OZ6A 1R00A 2EA4A 2G7HA 5JI6A 3FWEA 3H5RA 3OYIA 3J7AY 3FZVA 1F5TA 2RQPA 2YR2A 1D8JA 2WAEA 1OR7C 1R6RA 2BEOA 2I8DA 4EVIA 4ZYEA 2EZIA 1U9NA 1CQTA 1P4XA 1QO0D 3W6JB 1FJLA 1J59A 3I5UA 2XIGA 3L9FA 3FBNB 4IHSA 2F5VA 2IGMA 4D0PA 5TISC 5K5RA 3OYBA 2R7ZJ 4XORA 1PP8F 1UCRA 4L5IA 1PDNC 4UB8C 4O6JA 2ACJA 4HX7A 3KETA 3H35A 2M5WA 3BG5A 2LKXA 1TQMA 3NQOA 5L3GA 2DPUA 2VQHA 3LSGA 2V1UA 4F91B 1Z6RA 1GT0C 2VBXA 1B8IB 2DDBA 2NS7A 3SJMA 1YOVB 2DMPA 1KQ9A 1KA8A 2JT1A 4PSWA 1B72B 1O3RA 4A3DJ 1WH5A 1GDTA 2BY3A 3KLNA 2PMZA 3P9CA 2IS2A 3GTJJ 1F1ZA 4FT8A 4B09A 4C30A 5GADJ 2PLYA 2X85A 3C3WA 2ZJRF 4G7OF 3CO7C 1FBQA 3NAUA 3AL0B 1YG2A 2EA2A 2DMTA 3K2ZA 4I98B 3VYTB 2YU9J 3W6VA 4KT5C 5J1UA 4L0ZB 3E5QA 1FOWA 3AG2H 4CHUA 1SANA 1Q1HA 3C7JA 5FD5A 5EEHA 2GOMA 2CO5A 3M7GA 2OC6A 3I54A 4LFUA 3KEOA 4ESFA 2W48A 4BJ6C 4Q4ZF 2NOJB 5ILVA 2MC3A 4O5VA 3MZYA 5K7FA 3ERMA 3HGYA 4KMUX 4UUSA 5LEJA 1R7JA 1T56A 5IYDJ 2ZMEA 4A6DA 5ED4A 3R6SA 4D7NA 3H3VK 4BE0A 4CZCA 4OMZA 2KIUA 1T6SA 5D6FA 1HSJA 3HSRA 2I5UA 4E7KA 2K7LA 1AKHA 5HOOA 5FKNA 2JTVA 1A6IA 2X0LA 3ZQHA 3OSGA 2WA0A 3E1SA 3K70D 2E35A 1D5VA 2NAZA 4Q48A 1OISA 2FU4A 4S05A 3LAJA 1ETWA 1C0WA 1IV8A 3P9KA 4CYCB 2PJRB 3WHCA 1L0OC 3CJNA 2IJLA 1TW2A 3CC2I 5EF6A 2DA6A 2HDCA 2CUZA 2HTJA 2XGCA 4RDUA 1ZR4A 2O8XA 2HS5A 1S7AA 1JT6A 1MBFA 3S16J 3BZCA 4A3LJ 2DOFA 2EILH 1YW7A 2Q2EA 3O8GA 1XTAA 3S1MJ 4LGWA 1VQKI 1FIPA 3DFGA 5J40A 2LR8A 5FROA 3D5RC 1O3QA 2L9NA 2ZB9A 4ZYHA 1A6QA 4KA4A 4CZZA 2AO9A 3IH2A 4YFXF 3HOUJ 1SFKA 1LEBA 1GHCA 1SAXA 2QBYB 2B63J 2EIJH 4GCVA 5HNFA 3TP3A 3WTXC 1OMIA 3E7LA 4C3IJ 2NS0A 4XN0A 1UG2A 3K4MA 5F08A 3CCVI 3W2WA 1H9TA 2ZSHB 5FFZA 4CUGA 1D1BA 3CCRI 2PMZN 5J8CA 2RN7A 2XUBA 3OWTA 4XMYA 4D7MA 2BY1A 1P2FA 1P7JA 5CLSA 1R5HA 1FC3A 2FA5A 4LITA 2Y30A 4XN3A 1FBUA 2E7XA 1UHMA 3RYRA 5CVVA 2V1DA 4U0WA 4XL9A 1WZ2A 4ASNA 5FRMA 1FMWA 3KE2A 2EFWA 4AIKA 5IYCJ 4WXDA 4HDVA 1VF9A 2L2OA 4HEA2 5IT9K 4E7LA 4IOAF 4UV9A 5E79C 4E6KG 1TWCJ 3GCMA 1KQ8A 2FRHA 3P7NA 4PJJA 2LY2A 3V8JA 1TTYA 3IWZA 1XGSA 5IP9J 1P92A 4HV5A 3WTWC 1FLIA 1BIBA 2FMYA 5EJCA 2EH3A 2HNHA 4E7IA 1RR7A 3KYCB 1OLTA 3VPRA 4ZJZA 4I0AA 3BPVA 4DYRA 3C18A 1D0XA 4N4OB 3QOEA 2VPRA 2EZLA 4P9FA 3IUOA 3BTJA 2GM4A 4HSTA 4CCOA 1R1TA 1E3PA 1IC8A 1P4WA 3TKYA 1I27A 3MWMA 2NVTJ 1H8AC 2GA1A 3HIFA 4Y4RA 2V4JC 2R7WA 1HBXG 2J5OA 4A3MJ 3QRFF 1D0YA 1FY7A 3HC7A 1FIAA 1A31A 3QYBA 3QAHA 2JPBA 4RGSA 3BJAA 1MZBA 1ZTRA 3ISPA 3QP6A 2H6CA 2YUSA 1VQ4I 2BW3B 4AYBA 2HYGD 2ESHA 3PUFA 3S32A 4BKXA 4XK4A 2A61A 4U87A 2CW0F 2CQKA 2IXSA 4M3BA 1B8IA 5FKLA 2KZGA 4QWQA 4A3GJ 2KP6A 5GPAA 1DU0A 2Y31A 2OUMA 4A5MA 4FTHA 3SXYA 2F2EA 2K27A 3KP4A 3TQNA 5HS8A 3OYDA 4ZZDA 2ZMEC 3HOVJ 4IHXA 5KNLA 2V9KA 1F43A 3U1DA 3GF2A 3EUHC 2BE5F 1EA3A 1Y1VJ 1HC8A 1P4AA 3QU6A 1GLNA 3K1NA 2XKOA 3TOBA 1Y56A 2V79A 3KP6A 4RM3A 4A5NA 4DYCA 3BJ6A 2IW5A 3QWLA 1W5TA 3I4MJ 1XN7A 2W84A 1LUJB 2WY7Q 1T98A 4AIHA 5J1RA 4U7DA 1Z6TA 2A69F 4II2A 3DKWA 3CCYA 2IGKA 2MD0A 4DNCA 3RTRA 3FM3A 5D4SA 4M3DA 1XX5A 1Z1DA 2VN2A 4J19A 1SAUA 3J81Z 5HVQC 3A03A 2N8GA 4H4KC 3WTSC 2E2JJ 5DCFA 4CICA 4QLCU 3ZQLA 4JX5A 4BQQA 2BGCA 1BI3A 4IJAA 2CUEA 3NARA 1O3SA 1K7AA 5F0CA 3OYGA 5GAHJ 4EATA 2HPIA 1BL0A 3EYYA 1N78A 1MH3A 4UB6C 1J09A 2M7BA 4A93J 4UXNA 2R7VA 4XNFA 4H0EA 2QQBA 2PI0A 3C2HA 2RKHA 3PQKA 2VBZA 2W4SA 4CYCA 4M3FA 2HOTA 2L0KA 3KYDB 1Y6IA 2DA2A 3TL4X 3FHNA 3LA2A 4IRIA 2OJED 3S1RJ 3RQ4A 1T0FC 1U8RA 1TP4A 2DO7A 1W7PA 1FOXA 4M6XA 2VIXA 3DTKA 4M9XA 2L02A 4D1QA 2JRMA 2R7RA 5D5UB 2AHQA 1ZR2A 4LB6B 1G3TA 1Z3YA 2IS1A 3FK7A 3CF2A 1X19A 1I3AA 2KIFA 1BC7C 1UG0A 4L5EA 3OIQA 1LPQA 4IHVA 3K4LA 1U3EM 4UNOA 4AYBN 1JUPA 2OA4A 1YITI 3HOZJ 5GPCA 4XSXF 3L1PA 4OINF 5BPDA 2JN6A 4BEHB 5BPIA 3JTHA 2LG4A 5ICEA 2EV6A 1R1VA 2XPVA 1BW6A 4ENMA 3MZ8A 4KYWA 2VQCA 4KIBA 3HOTA 3IAS2 1LNWA 3V7SA 4RGRA 4EM0B 1WKMA 5M5WJ 4KIFA 4PJNA 2GAUA 1KYWA 1V55H 2A6TA 2EV0A 2GQQA 3VYUB 4XLPF 4NC8A 2COMA 1IN6A 1YE9A 2KIQA 3V42A 2JZYA 2R7FA 1X4PA 2WBMA 2KKOA 1ZGAA 3OOUA 5AONA 4BQNA 3WE2A 2O61A 4IPAA 1X1CA 3J7AO 1ZAOA 1L3LA 3RQIA 1R5GA 4UVAA 4FCYA 3PNTA 2OBPA 2V9VA 3G4SI 2ICWG 4XRSA 4EJVA 2WAFA 1Z91A 1R36A 2UV1A 4EGYA 1NHAA 3GUDA 3KIOA 1K4SA 2M87A 2JA5J 5ICGA 1EH6A 2VT3A 3GTMJ 3G1OA 2VXDA 3NEUA 3R4KA 3BQZA 4HRIA 3FKJA 2K9LA 2M7AA 2NS8A 3GTQJ 1LFUP 1YYVA 3RJPA 2E2IJ 3BROA 5CVRA 4UY8I 3LQQA 4XOTA 1HLVA 1TWAJ 3B6CA 3H0DA 1BBYA 5J4VA 5FKMA 1DUXC 2IRFG 5CKTA 4F3QA 4HV6A 5FKKA 4V2FA 2DYRH 2BVLA 2YX4A 1J2XA 3ELKA 5E17F 1OR7A 1PUFA 1B4AA 2AQEA 3HTSB 5FJ8J 2LC2A 1UZCA 3VSKA 4G9YA 2LDUA 2W1OA 2V1XA 4QPQA 1R9TJ 1SFOJ 1D5YA 1IZ1A 1R4MB 2J5PA 4ZYAA 2BW3A 4FQGA 3CF5F 5DDGA 4IKFA 3VYRB 3V4GA 2Q0OA 1EJ9A 2LOOA 4LJZF 4N0BA 4HPQA 1FTZA 1I50J 4IX7A 3DBRB 3ECHA 3K1MA 2EJRA 1RZ4A 1X3ZB 1UHWA 4P9UA 3ERED 1F4KA 1DDNA 1Z7LA 2JQ7A 1U6GA 1ZLJA 1LJ9A 4XRSG 3JRGA 2K3FA 3RSNA 3A0HC 3EQLF 3F8FA 1XD7A 4JYKA 3KZYA 1TW3A 3WODF 1TWFJ 2IP2A 1X2MA 2EK5A 1YIOA 3GO5A 4KN7X 5BS6A 4DBRA 3DLLF 1X2NA 3AG1H 1S7EA 1XSDA 4G12A 2PG4A 2XPUA 3OR2C 2KZVA 2ZMEB 1MIJA 1PJRA 1SFXA 2DOEA 1QHGA 1SD6A 2Y75A 4XBFA 3V7CA 3GZNB 2BBYA 1JJ8C 1Z9CA 3QOPA 5DS9A 4C2UA 1AKHB 3E5XA 3RCOA 1TQIA 1AHDP 3G1LA 2E1CA 3A0BC 2CW8A 2VKDA 4FASD 1BN5A 5H6RA 3J7ZI 3ONQA 4GXOA 1T2KA 5C44J 2G9WA 3GYHX 2LYCA 4DJAA 1IN5A 2A07F 2Y0SA 1SC7A 1IXRC 4C3HJ 2L7ZA 1IW7F 3HZJA 4XLAA 1NK2P 1ZRFA 2FD5A 3IH3A 3Q9VA 1WI3A 3F8BA 5KAIC 2MBFA 1FYKA 3VODA 3BG7A 4KT6A 5HLHA 3F8MA 1GV5A 3EUKL 1O7LA 1QBJA 3SZGA 1Y8QB 1XG1A 2QENA 3WGHA 3ZR8X 4D9JA 3O2PE 2FEZA 5L3DA 2FUG2 2TDXA 4BY1J 2BHZA 3HOXJ 3WGGA 4IOCF 3G2BA 1HF0A 3EETA 1S5LC 4G8XA 3E97A 1UFMA 1HKSA 2FXAA 2P6TA 1EF4A 1BI1A 1WVRA 2KFDA 1WH7A 1ETYA 1OJLA 4I09A 2O9LA 1OKRA 2F5FA 5HS7A 3SYTA 1T95A 1RKTA 3DBHB 4ESBA 1J7KA 1D3YA 1Z05A 4IXAA 2DMQA 1QQIA 2VL8A 3K0LA 1R23A 1TBXA 2HOAA 2M8EA 2ZNYA 4I02A 1E3OC 1MKMA 1MBHA 3CUQC 1MGTA 2ME6A 3DF8A 2UZKA 1IGNA 2JUCA 4GYGA 3ULQB 3HDDA 3ESWB 2NVXJ 1U5TC 4FX4A 4PZJA 3TMOA 1NG7A 2DLLA 2GOXB 2JRTA 4KDPA 1G6NA 2DA1A 2R4GA 3HSEA 4PJLA 3O8HA 3E0JB 1NH3A 4EV0A 4NQWA 1YW9A 2R7DA 2W82A 5D5XB 2H8RA 1N25A 3U21A 3WU2C 1FOYA 2KL4A 3MVPA 5FRNA 5DCMB 1VNDA 2HVQA 4M73A 4YIRX 3ZP5A 4KN4X 1QPMA 1XS9A 2R7XA 1XGNA 2ELKA 1X58A 3OYHA 2CW7A 2HEOA 1Y0UA 3SFZA 3C1DA 2DTZA 2MLGA 1X1AA 2DQLA 3CCMI 3SDGA 2VT2A 4XKWA 4U7BA 4B44A 4BU2A 5HODA 4XR6A 5K1YA 4BL0B 1YLFA 2ME0A 3CP2A 3GFLA 2B0LA 4RM2A 4M9SA 2R7QA 3FXLA 1NTCA 4GO1A 5M3FJ 2Z1DA 1BJAA 2HI3A 3QPSA 5E3NA 1WPKA 2PBIA 3PSFA 4A3EJ 2VOPA 2EZKA 2Y69H 5TGTA 4CGZA 1T38A 1B9MA 4S0HB 5H2FC 1MDMB 4KICA 1XCVA 4J01A 3KPHA 3QU3A 4A69C 1BIAA 1MNDA 1DPUA 1U78A 1R1UA 2MA3A 3HM5A 2Y0SN 4OIPF 2Z2SB 2STTA 1W7PD 3T1BA 4WCGA 1OCPA 1YX3A 2HGCA 4X1EA 3F72A 4UVCA 4ENKA 2EWNA 3QPHA 3F21A 3AFHA 3WE3A 4XLFA 1ZKGA 5IP6A 3FXUA 3H92A 1I6HJ 2FX0A 4NUBA 1BI2A 5B66C 2NYXA 2M3AA 3R0AA 2ADUA 4NBQA 3GTGJ 4A6EA 2KDZA 2HDDA 5TRDA 2O6GE 3A01A 1K6YA 4QTRA 2M45A 2B9SA 2HZDA 1W5CC 3QODA 2KJCA 3PQJA 3P5JA 4E7HA 1FYMA 3HSFA 4E70A 2CV1A 3TOAA 1I6XA 2LF7A 5DM6F 1G3WA 1GVDA 4EEFG 5EEAA 3HTUA 3BZ6A 1KONA 3CLQA 3SHFA 3MKZA 3TP0A 1HSTA 1TWGJ 5KHDA 2Y9ZA 2XF7A 5EZHA 1WJ5A 2ZJ2A 1FSHA 2HKXA 3L09A 2F6CA 5E1WA 2BY0A 4A0ZA 1NK3P 1KU2A 2AXLA 3SQNA 4ENJA 3HYIA 3IV5A 2DFFA 3DLAA 4MTDA 2EFQA 2K5CA 4EGZA 1KU7A 3LSKA 5EDNA 3WG9A 1SFEA 2DTRA 1VQOI 4UHTA 3H3UA 1FTTA 3JRAA 4GDFA 4BACA 4ZTFA 2HVRA 3KEYA 4WK8F 4FE7A 3CJQB 4M9ZA 3IP4B 5DD8A 3W3CA 4M72A 1O7FA 3ABUA 5HS9A 2RQQA 3K4BA 1U8BA 3OYKA 3FK6A 5AIQA 3BOQA 3LFUA 1DQUA 3RKXA 4XICA 2IS6A 3BCBA 4C9YA 4AVPA 3EUHA 2DK8A 2HPMA 5K7ZA 2L3DA 3LSHA 3BJOA 3ML6A 3CCSI 3HPHA 4ZTJA 2FQ3A 3DU6A 3GZ5A 1X1PA 2W25A 3MN2A 2IGOA 2X6WA 4XLEA 2F5CA 3LAPA 1FP2A 1D1AA 4HQEA 3CTAA 3HJEA 3AG4H 5EG0B 1HXDA 2LH9A 1W1WE 4XM3A 1GV2A 1W7PB 2VASA 2WWYA 1X1DA 1JHHA 2XAQA 4E7JA 4L18B 1FPQA 1VTNC 3OR1C 1X1BA 3LA3A 1K83J 2IBDA 3GVAA 4PDKA 4TV7A 4L0YB 5ERIA 5C3EJ 3VWBA 3M8FA 5LGTA 3P9IA 1PVEA 3CUOA 1IV6A 2E1NA 3FXMA 5D6EA 1USSA 1UB9A 2ZJPF 3HUGA 2E19A 1APLC 1E17A 2WC2A 2DXIA 2NOGA 2R7UA 4JX6A 4BQOA 4F93B 1EKEA 2ZXWH 1YS7A 3GBGA 2OCEA 3DEWA 1BOBA 3KP2A 2MD5A 3BY6A 2A6EF 3MKLA 4MQVA 4IRGA 2M8GX 5LGNA 3M8JA 1O57A 1T0FA 1E0EA 2H27A 2BV6A 2DA7A 3GMEA 2KHMA 1ZHFA 5F0HA 3KZIC 4S04A 2FNAA 2E60A 2A05A 2PEXA 1DP7P 4CA0A 3BTLA 4YRVA 2CS3A 5F64A 3JAMK 3G3ZA 4G94A 2GXGA 3VYSB 4LLNA 4RLFA 1BR2A 2PN6A 4LLLA 1Q1VA 3WU0A 3DTIA 4A3BJ 3F0CA 4A3FJ 2XV4S 3OL4A 4A3CJ 1OCTC 4HF1A 2KIMA 3I4PA 5BMZA 3S1NJ 4HYEA 1U5TB 2RV8A 3S3NA 5FLXK 1K4TA 5DCMA 3HRMA 5K5QA 4BHPA 3BG9A 4L9JA 1TWHJ 5DEQA 3ZGKA 4C2MJ 4HBLA 1RRJA 1MSFC 2HQRA 1G3SA 2QVOA 4M6VA 1XDSA 1IXSB 2CQ7A 2DA5A 3VB2A 1ZGWA 3ZXSA 2LLKA 2CFXA 5E8GA 2BVMA 3ASNH 3W2AA 5A2QK 4O3MA 1XGOA 2CQNA 4XSZF 2CGPA 4N9IA 1VQ8I 1M1EB 3ZMDA 2WV0A 5EGOA 2F5EA 2W24A 2XAGA 2K9QA 3H9QA 3HRSA 4BJ5C 4PJMA 1DGWY 2HDWA 2RC4A 2ZCWA 4AWXB 4CCJA 2LP0A 3JAMZ 2QSGX 1IG7A 1V5EA 2DQRA 1MDMA 3GW2A 3DBLB 2XGDA 1B9NA 1PUFB 4JBAA 3BG6A 3T5XA 1OCZH 1ON2A 2MGQA 2HOSA 5E18F 5FLXZ 1B6AA 5IT9Z 3Q0UA 4G7ZF 3RYPA 3S3MA 3NWTA 4E4HA 3FX3A 1LKXA 3LFKA 3N97A 3E3VA 2V1NA 1QPIA 1VQ7I 1X4OA 2ISYA 2NVYJ 2V6EA 2H1LA 4L9VA 3J80K 1P9QC 2LKSA 3JSOA 2VLAA 4IHTA 2GA2A 3K1PA 4BE2A 2BY2A 5A2QZ 2GIVA 2E36A 1A35A 5E8IA 2NNNA 2FBKA 4FHTA 4MFEA 2IGNA 3ABKH 4B1RA 1S7OA 3GEZA 1P6RA 2FBIA 3HB9A 2DDAA 4EJUA 1HKTA 1IO2A 1MNMC 4I99C 4ITVA 1X3UA 2JPCA 4LG0B 1B1BA 4U0VA 2YU3A 3PJRA 4JK1X 4U0YA 2E1OA 2K4BA 4RLQA 3DXJF 5B1BH 2RVCA 1VFCA 3RZOJ 2VKVA 4JP0A 1YO5C 2Y48A 4HX8A 3S17J 3KEQA 1ETXA 2WAQA 3VEPA 3KYLA 3CJRB 1S8NA 3CC7I 4LK0F 1R5ID 3HKZA 2M4GA 4IF4A 3TW6A 3RPQA 3R0JA 5F1JA 1A04A 1HW5A 3I59A 4DQ2A 5JFRA 1QVTA 4HOBA 2X6OA 1RUOA 2FBHA 3TO7A 4Y3OA 1VQ5I 3SFIA 4HX4A 4BGDA 1DP3A 3HHHA 2W00A 2CYYA 3R60A 3TBIA 1JTXA 1HCRA 4JQFA 5J3LA 1HA8A 1ZLKA 1WJBA 3HHGA 2EV5A 4KISA 2IT0A 4KIGA 1ONVA 2GBYA 1GVJA 4AIDA 2MG4A 4RB2C 1R71A 5D5VB 2QQ9A 1CF7A 4XLHA 5D8LB 4IZZA 2FOWA 5KCMA 2L9SA 2COBA 2MSYA 5LD2C 3BR1A 3LSTA 3LA7A 5EG0A 2R3SA 1ULYA 3VFZA 2O0YA 4FISA 2VODA 1S6LA 1WJFA 1KYZA 1SEUA 1OQYA 1JE8A 4HZFA 3JRHA 1R22A 4G6DA 2YS9A 1OCCH 3BT9A 4L9NA 4Y15A 3JRFA 1ACIA 1ORKA 5IOYA 1MBEA 3V8KA 3PL8A 1S9HA 3RPUA 3RZDJ 4MHGA 5C4XJ 2CMPA 1AU7A 2CUJA 1MNEA 2XF5A 4UVBA 1W0UA 5DYMA 5B5EC 3MFKA 3M4OJ 2FE3A 1WFXA 3U1KA 2GXAA 4BHCA 4NQWB 2VKEA 3DTEA 3EDPA 3H9JA 3PNVA 5HDNA 3ZQCA 2ZKZA 2QGUA 3LSIA 4MLOA 2OU2A 4B47A 4M3EA 1TT5B 2KDOA 2QQ8A 2EIKH 1OYYA 4AM3A 3FMSA 2DJIA 1RUNA 4B3AA 2H1KA 4MEYF 2STWA 4ZH4F 4BDZA 4OAYA 4DYQA 1W0TA 4PSXA 4PGGA 2Z5UA 4ETSA 2ZXJA 4D5FA 2HR3A 1MJ9A 2M30A 3CUQA 3I9V2 4W1UA 3CQZJ 2ZXHA 3VOEA 2KRHA 1Y0NA 5EEGA 2M4KA 4XLCA 2K4JA 2MLKA 1U5TA 1SVMA 2O03A 4QSHA 3MQ0A 4RMNA 2L5QA 1IN4A 1TNTA 2A6HF 1O4XA 4MIMA 2WY8Q 3GTPJ 2WAQN 1WHUA 3GXOA 5M3MJ 3ABTA 3H3ZA 4RB0A 5JVTA 2DI3A 1RETA 3HKZN 4EM2A 1RESA 1SD5A 2M9HA 3KCCA 2MYSA 4LOCA 1JKPC 3L00A 4ESJA 5FO5A 3K2AA 1OYIA 5E3MA 1YRNA 3Q5FA 2JMWA 3KP5A 2IEKA 3OY9A 3L2WA 5CVIA 3K7AJ 3WTZA 3RI4A 2I10A 2IS4A 2GZWA 5AIPA 2WTEA 3BCAA 3DKYA 2VJ4A 4Y17A 4BUPA 1MJBA 2FNPA 4V2GA 2P7VB 3A01B 1AA7A 3KLOA 4LK1F 3F3XA 3ZMUA 2PX9A 3GTOJ 2CV2A 4P55A 4CCLA 2HZTA 4J00A 1WI9A 2ZFUA 1A5JA 1P7IA 4XRMA 2RGVA 2DBBA 3H9GA 3EYIA 4Z2YA 2KRFA 4A2UA 2NXNB 2KT0A 2QSFX 4HAMA 3FMRA 3KP7A 2K86A 1JUSA 5LLQA 2L9VA 1ZARA 3OYLA 1F36A 1HW2A 1U9OA 3CMMA 3GTKJ 3DKXA 3AL0C 1I39A 3TDZC 1S72I 1XMXA 2IA1A 4IQ4A 4ENNA 2HXIA 2VC0A 5LBQA 1A36A 1ZREA 1MH4A 4P5OA 5ICFA 2L4MA 4RBOA 2ELJA 3L2RA 1FMVA 4UUTA 2M34A 2KQRA 1TT0A 3TW7A 2X6XA 4I76A 3ZRGA 1ERDA 1FOKA 1T8IA 4HG2A 2LFBA 1LDKB 4IRHA 3F23A 5DUIA 1BM9A 4F52A 1H9GA 4MTEA 1K79A 2HYJA 1U2WA 1QZYA 5E1ZB 2QEXI 1BI0A 1ODDA 2F4OB 3MAJA 4ZDPA 3WTUC 1ZRCA 3RIRA 2VBWA 3M9AA 4A3KJ 1MMAA 3D5LA 3FM5A 1V5GA 2DT5A 3DQVC 3PIOF 2UXNA 3HEFA 1Y39A 2FJ1A 1J0RA 3OYEA 1ZH5A 1KU3A 2ECBA 1QVUA 5CVJA 3G1MA 3BR3A 2K9NA 2ZNZA 3MD2A 3CCUI 5LRRA 1XSXA 2ID3A 2QCOA 5HNHA 1YJWI 1VQNI 5FKOA 4CCKA 1OFCX 3ABMH 2CU7A 5L3FA 5LGUA 3N05A 2L54A 3COAC 1KZHA 1DU6A 2XDVA 5DV5A 2XAUA 3JRIA 1OCRH 1UELB 1HKQA 3BTIA 4GGGA 3VDXA 1K78A 2JJ7A 2AXTC 3E6CC 3FXJA 1Z0XA 1MBGA 2LBFB 2JK3A 2X51A 3HUGB 1DPRA 3QYEA 2R7SA 2P6SA 3LSPA 5TJJA 2R93J 3A2KA 2M2EA 3IRQA 2EINH 2ISZA 1MW7A 5LHIA 3BR5A 2BHYA 3IRRA 2VC1A 1XMAA 2QYOA 1IJWC 3DV8A 2HXOA 4MQ9F 3GZ6A 3TDUC 3T0YA 3OOPA 1FYLA 1J5YA 4Q47A 4IEJA 1J9IA 2XGXA 4IHWA 4Q5SF 3OS2A 3OYMA 5F6FA 5GP9A 3K4CA 2FQ4A 5L3CA 2O3FA 2Z33A 1JXSA 1V3FA 2DJNA 5J1YA 3PO3J 1D0ZA 2E34A 3HL2A 2K02A 1F9NA 2CFOA 2F5DA 1XMKA 2X1CA 3BC8A 3DPLC 3HGGA 2M0MA 4ZZLA 3LSRA 1UMQA 2XHKA 2W7NA 4YG2F 1JJ6C 3SZPA
chains in the Genus database with same CATH topology
4CCMA 1D1AA 5KNLA 2V9KA 4PFPA 3EUAA 4AU7A 3DPUA 2LH9A 3EUHC 4ZDLA 4XM3A 1EA3A 2VASA 4CSWA 4KITB 1X1DA 1GLNA 1Y56A 4E7JA 3OR1C 2VQGA 1X1BA 4RM3A 4LG3A 3MMYB 3VWBA 4ZDOA 2JVGA 1WJDA 3K4JA 2WY7Q 4LIVA 4II2A 1JI8A 2LREA 4BXFA 2DXIA 2IGKA 2R7UA 2MD0A 4BQOA 3UNGC 4F93B 2O5RA 1QU3A 3RTRA 3GBGA 1NG6A 1TZLA 2XSJC 1BOBA 2F4IA 3K70C 1SAUA 3OS1A 3LMMA 4DBQA 3CESA 4XKBA 4E7SA 3PFYA 5HVQC 4OAZA 4H4KC 2VB6A 3M8JA 4BQQA 3CP8A 1E0EA 3VSLA 3FDYA 3OYCA 3S3OA 4FETA 4B3XA 2KHMA 1MMGA 3OYGA 4EATA 1IRXA 2HPIA 2E60A 4NNJA 2HU9A 1N78A 2R7VA 1J09A 2M7BA 2R7OA 4CA0A 4YRVA 2CS3A 4XNFA 3VYSB 1G59A 3C2HA 1BR2A 3DEEA 2W4SA 4G6TB 4RLFA 3BLYA 3MKYB 3DTIA 2HQAA 1Y6IA 4BDYA 3OYFA 3TL4X 3FHNA 3OL4A 2MC4A 3RPUD 3RQ4A 1T0FC 4F92B 3S3NA 2XC7A 4N4NB 4JOMA 2VIXA 4ZC3A 3DTKA 3FBIB 4AVZA 4D1QA 1MMNA 2X1DA 2R7RA 3ZGKA 2VQLA 1VZ0A 3H5NA 1Z3YA 2LY1A 2IS1A 3CF2A 1X19A 3ZXSA 1UG0A 3OIQA 4XQFA 3K4LA 4C2TA 2BVMA 3W2AA 2CH0A 2MABA 2P0WA 3HXLA 2V26A 3EPZA 4Y33A 4DOZA 4BEHB 3HG9A 5HLTA 2LG4A 3H9QA 2OV7A 4BJ5C 3K6GA 1DGWY 2HDWA 4PJMA 2VQCA 4CCJA 5LFAA 3HOTA 4ANJA 3IAS2 1V5EA 2DCEA 3DU5A 1BR4A 2E1MC 2UUZA 3D5SC 2DT7B 4PJNA 3PSIA 3BG6A 4DIQA 3DWLE 2A6TA 3OS0A 3VYUB 4YELA 4R79A 2BOLA 4NC8A 4OWRB 4XKCA 3S3MA 3NWTA 1YE9A 4PK4A 4E4HA 3V42A 1LKXA 2Q2EB 1X4PA 2DT6A 2WBMA 2V1NA 3OOUA 4PFOA 4HSRA 1V5FA 1X4OA 4BQNA 2Z16A 1X1CA 2V6EA 4E7ZA 3MKWB 2L7KA 4II3A 1P9QC 2VJJA 3PNTA 2V7FA 2VLAA 2K9MA 2QKMB 4BE2A 2HVSA 2UWMA 2QKLB 2WAFA 3OMYA 2ZSIB 2UV1A 2A5WA 3OIPA 3SEZA 2RREA 3KX2A 2VXDA 4HRIA 2IGNA 3FKJA 4P1WA 2K9LA 2M7AA 2RNGA 3PNYA 3OYNA 2K3PA 1WJAA 4GRIA 2E5ZA 4XOTA 4ITVA 3M1CA 3H0DA 3H5AA 5CKTA 4BEHA 4F3QA 3PJRA 3CZ6A 4RLQA 3SDBA 2BVLA 2LBFA 3IAM2 2JSPA 3HOSA 2VKHA 2JUGA 4DGWB 1YX5A 2AQEA 2WAQA 3ZQQA 2DOAA 2LRDA 3SEQA 3ZCOA 2WADA 4B48A 3CJRB 3KYLA 2LC2A 3HKZA 3VSKA 2M4GA 2CV0A 2W1OA 2XF6A 4QPQA 1LFPA 2R7TA 4Y3OA 4ZYAA 3H5RA 3OYIA 2BW3A 3J7AY 4IKFA 3VYRB 4BGDA 2LOOA 1DP3A 2W00A 4HPQA 2KRCA 3TBIA 4JQFA 2WAEA 1HA8A 1OR7C 4IX7A 1R6RA 1WJBA 2I8DA 2X6YA 4KISA 1Z7LA 3FBNB 1DGRM 3F9KA 2F5VA 2IGMA 4XLHA 3RSNA 3OYBA 5KCMA 4IZZA 2L9SA 3DPTA 4XORA 5LD2C 5JHFA 5CPRB 3OYAA 1W36C 2JVHA 1WJFA 4DBRA 3H35A 3OR2C 2KZVA 2ZXIA 1PJRA 1QHGA 2E5NA 3K4KA 2VQHA 3LSGA 4C2UA 2Q1ZB 3W2VA 3RCOA 4F91B 1BR1A 4FASD 2CW8A 2VKDA 3PL8A 1S9HA 3ONQA 2WB1A 4PSWA 2CMPA 2CUJA 1MNEA 2XF5A 4F55A 2LYCA 4DJAA 2PMZA 1WFXA 2Y0SA 3K4NA 2IS2A 1N75A 4NQWB 3DTEA 5CQGA 3H9JA 3PNVA 4XLAA 4B43A 3LSIA 4C30A 4MLOA 4B47A 2X85A 2KDOA 3OYJA 3AL0B 3VYTB 3BG7A 2DJIA 4KT6A 2VJIA 3EUKL 3SZGA 4BDZA 4OAYA 3ZR8X 4PSXA 4D9JA 3LL7A 2FUG2 2GOMA 3I9V2 2OC6A 2ZXHA 2KRHA 3L2UA 2M4KA 3G2BA 4BE1A 1UAAA 4XLCA 4YEJA 4BJ6C 2NOJB 1QHHD 4RMNA 2L5QA 3SYTA 1T95A 2WY8Q 3NWSA 2VXZA 3HPGA 3A1YA 2VL8A 2JA2A 4BE0A 4CZCA 4E7KA 2MYSA 5HOOA 4X0GA 1PYVA 3OY9A 3L2WA 3TMOA 2WA0A 1NG7A 2GOXB 3E1SA 3K70D 2R4GA 3AKZA 4PJLA 2IS4A 3BCAA 3DKYA 2VJ4A 3E0JB 4BUPA 2PJRB 2W82A 1AA7A 3U21A 2CV2A 2CUZA 2KMUA 2KL4A 4CCLA 4J00A 5FRNA 2ZFUA 2HVQA 4KJZA 2R7XA 2KPMA 3H9GA 3OYHA 2CW7A 1ZELA 1X1AA 2E1MB 5FROA 3L2VA 3D5RC 1W36D 2L9NA 4XKWA 3UR3C 4U7BA 4B44A 4BU2A 4XONA 4XR6A 4BL0B 3OYLA 3CP2A 4RM2A 1SFKA 3CMMA 1MMDA 2R7QA 3DKXA 3AL0C 5HNFA 2Z1DA 4IQ4A 4BS9A 3PSFA 4XN0A 5TGTA 4P5OA 3K4MA 3W2WA 4J01A 2ZSHB 4CUGA 2ELJA 4CH7A 1D1BA 1MNDA 3L2RA 1FMVA 2KQRA 1TT0A 2Z2SB 4QPOA 4XMYA 3OWTA 2MFZA 1YX3A 2X6XA 3ZRGA 1ERDA 4HNUA 2VJ5A 3C2GA 4HG2A 1LDKB 1WJEA 3AFHA 4LITA 4XLFA 4XN3A 4F52A 4XKVA 4NUBA 2M3AA 1Z21A 4XL9A 1G8XA 2PJRA 5FRMA 1FMWA 1K6YA 4ZDPA 3L2QA 5CQEA 2HZDA 1MMAA 3D5LA 3QODA 2L2OA 1V5GA 4HEA2 3DQVC 4E7LA 4E7HA 3OL3A 2VPLA 3OYEA 2CV1A 3PUBA 4E6KG 1U0JA 1Z3XA 4PJJA 2LY2A 3A4CA 1KONA 3MKZA 3MD2A 5KHDA 2XF7A 4NC7A 4IQJA 2HNHA 1WJ5A 4BJTA 4E7IA 1N77A 5HNHA 1OLTA 3QYFA 4ZJZA 2AQFA 2F6CA 3K10A 4CCKA 3N05A 4CCNA 1D0XA 4N4OB 4PUSA 2XDVA 3QOEA 2XAUA 1D1CA 3IUOA 1UELB 3S93A 3DLAA 3VDXA 4HSTA 2K5CA 4CCOA 3LSMA 4XOPA 3LSKA 2LBFB 4Y4RA 2X51A 3HUGB 3QYEA 2V4JC 4BACA 2R7SA 2R7WA 4ZTFA 3I3LA 3KEYA 2HVRA 3A2KA 1D0YA 3CJQB 3IP4B 3HC7A 1MW7A 3W3CA 2RQQA 3QYBA 3K4BA 3S8PA 3OYKA 2KLOA 1WJCA 3LFUA 1DQUA 2IS6A 2BW3B 4AYBA 4HNTA 3BCBA 4C9YA 3S32A 3OS2A 1LVKA 3OYMA 3K4CA 4U87A 2X1EA 2IXSA 2HPMA 1D0ZA 3LSHA 2KP6A 3HL2A 3HPHA 2CFOA 4ZTJA 2OUMA 2X1CA 3DU6A 3BC8A 3DPLC 2M0MA 2IGOA 2W7NA 3OYDA 2X6WA 4XLEA 4LIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OR2 C;  1SAU A;  1JI8 A;  1YX3 A;  2A5W A;  3OR1 C;  2XSJ C;  2V4J C; 
#chains in the Genus database with same CATH topology
 2H8W A;  5H20 A;  3EUA A;  4AU7 A;  5FB2 A;  5KAF C;  5GAE J;  1YJN I;  2H09 A;  4KFC A;  1ZRD A;  4M3G A;  5ICC A;  2E2H J;  2XB0 X;  4LG3 A;  5K5O A;  2HYF A;  2IA2 A;  2TRT A;  2JVG A;  1WJD A;  4NHJ A;  3K4J A;  2VOO A;  1FEX A;  3BPX A;  1T08 B;  1JI8 A;  4EJT A;  4A0X A;  1AOY A;  4MO7 A;  1RC9 A;  4RGU A;  3F6V A;  1H88 C;  3UNG C;  3E6M A;  2O5R A;  5E3L A;  5EGO B;  3BR2 A;  1QU3 A;  3CLO A;  1NG6 A;  1TZL A;  3CMA I;  5DTD A;  5F1R A;  2F4I A;  3K70 C;  5FGM A;  1KU9 A;  2BXZ A;  2LTP A;  3LMM A;  2EIM H;  1VI0 A;  3CES A;  4XKB A;  3WG7 H;  4ABZ A;  4DBQ A;  3PFY A;  3CMY A;  4OAZ A;  4BAY A;  2VB6 A;  3LSJ A;  3AAF A;  4BHB A;  2K85 A;  3FHZ A;  1LFB A;  3S3O A;  4FET A;  4LMY A;  3CME I;  5ILS A;  5B3S H;  4OIO F;  1XC5 A;  1IRX A;  2HU9 A;  5JR3 A;  1S29 A;  3GFJ A;  1IUF A;  4UV8 A;  5JLW A;  2HTS A;  3V7R A;  3MKY B;  4HF2 A;  2XAH A;  1ENH A;  1TC3 C;  3OYF A;  3H0G J;  4AUX A;  2L7F P;  5DM7 F;  2MC4 A;  3F6O A;  4PCQ A;  1OYW A;  3RPU D;  3IL2 A;  4F92 B;  2RDP A;  2XC7 A;  2LSO A;  2Q8K A;  5JLX A;  1LB2 A;  1OPC A;  4N4N B;  2EFN A;  1FBS A;  4ZC3 A;  4I6Z A;  2PQ8 A;  6PAX A;  9ANT A;  4XID A;  5ILU A;  2X1D A;  2VQL A;  2CRG A;  2XAF A;  1VZ0 A;  3QPL A;  4W97 A;  2FF4 A;  3S1Q J;  2VE8 A;  1JKO C;  3PM1 A;  5IP7 J;  3JTG A;  1IRG A;  3TGN A;  3ZQG A;  2A3S A;  3E5U A;  1QA6 A;  5J47 A;  3RKW A;  2QA4 I;  2MAB A;  5D5W B;  2GLO A;  2P0W A;  3IHU A;  3K9T A;  4YFN F;  2ELH A;  4DOZ A;  2XVC A;  3IKV A;  3HG9 A;  5HLT A;  5K7H A;  3BG3 A;  3K6G A;  4B8X A;  4OU0 A;  3X2Q H;  3RKY A;  3CCL I;  1FZP B;  3ZMZ A;  2E1M C;  4WXC A;  1E2X A;  2UUZ A;  1BC8 C;  2D1V A;  2OCC H;  1XCB A;  2XSD C;  2DT7 B;  4DIQ A;  3HRT A;  4ON0 A;  3DWL E;  3OS0 A;  3BTC A;  4YEL A;  4R79 A;  1LDD A;  2BOL A;  4XKC A;  4XRF A;  2CG4 A;  3I59 B;  1LE8 B;  4LG0 A;  2K40 A;  1SMY F;  2PMH A;  1SMT A;  4PFO A;  2Z16 A;  3G73 A;  3K69 A;  1YW8 A;  5IYB J;  5DD4 A;  3PIP F;  1IRF A;  4C3J J;  3H1C A;  3WTY C;  1IXC A;  3CDH A;  2QUF A;  2Y9Y A;  2WV1 A;  2QKM B;  3CCQ I;  5LHG A;  3JCU C;  3RKQ A;  2HVS A;  2JA8 J;  2QKL B;  4RAZ A;  3OMY A;  1CF7 B;  4RB3 C;  3JRC A;  4F7Z A;  2OQG A;  3ASO H;  3D0S A;  3SEZ A;  1T33 A;  2R5Z A;  4EMS A;  1JKQ C;  4R8H A;  1ITY A;  1JKR C;  4HW0 A;  1Z77 A;  2HOE A;  3GLX A;  4P1W A;  2LMD A;  4R1H A;  2K3P A;  3TO9 A;  2OF7 A;  1WSU A;  2V9P A;  3CO6 C;  1R49 A;  2E5Z A;  1SVO A;  2HKO A;  2V6C A;  2XB5 A;  5B1A H;  1I1G A;  4OMY A;  2A5Y B;  4BQA A;  5J4Y A;  3SDB A;  2LBF A;  3HBL A;  4NDL A;  1IF1 A;  3IAM 2;  2JSP A;  2ESN A;  2KJB A;  4UUV A;  1QZZ A;  5C4J J;  1R58 A;  1IAW A;  3ZQQ A;  2DOA A;  2LRD A;  2Y0M A;  3WGI A;  5CVU A;  3ZCO A;  4B48 A;  1IDY A;  4I2O A;  5LHH A;  3JR9 A;  2LF8 A;  3E6B A;  2F48 A;  4HNV A;  1LFP A;  1QNT A;  2R7T A;  3JSP A;  2OTL I;  2OTJ I;  1IN7 A;  5EYR A;  1W5S A;  4CO8 A;  2Z9O A;  2VE9 A;  2KRC A;  2M1B A;  2B7E A;  1E3H A;  1HDP A;  3Q9S A;  2D45 A;  2X6Y A;  3ZQI A;  2DPD A;  3MEX A;  1MD0 A;  2LVS A;  2OD5 A;  4RAF A;  1RPW A;  1DGR M;  3F9K A;  2P5K A;  3CUQ B;  1ZQ3 P;  3DPT A;  3Q3S A;  3W6K B;  1T39 A;  5JHF A;  5CPR B;  2NNY A;  3OYA A;  1W36 C;  2JVH A;  3LQR A;  3LNQ A;  1IUY A;  4P96 A;  1FP1 D;  1WWX A;  2Y2Z A;  3I55 I;  2R5Y A;  4AIJ A;  3HOW J;  1G2H A;  2ZXI A;  1V54 H;  2E5N A;  3K4K A;  4AD9 A;  5GAG J;  2FSW A;  3ZQF A;  5M5X J;  3WTV C;  1IDZ A;  3RDI A;  1YQA A;  2ETH A;  2Q1Z B;  2A68 F;  2DA4 A;  1FNN A;  3I71 A;  2P5V A;  3W2V A;  1GXQ A;  3S2W A;  5E1X A;  1YRN B;  1BR1 A;  4EJW A;  1I5Z A;  5HLG A;  3CCJ I;  1BOA A;  4D5C A;  1G4D A;  2WB1 A;  1HQC A;  4BXU A;  4F55 A;  1JT0 A;  2CJJ A;  1OCO H;  4IL6 C;  5FD6 A;  3I0T A;  4BNC A;  3K4N A;  5FLV A;  1N75 A;  5CQG A;  4RGX A;  4B43 A;  4U88 A;  4WXH A;  2EPF A;  4IVN A;  2H6B A;  2VON A;  4K2E A;  3OYJ A;  2VJI A;  1LDJ A;  3U2R A;  5HDK A;  2BYV E;  2L01 A;  2FOK A;  1XGM A;  3LL7 A;  1BJZ A;  2MH2 A;  3BDD A;  2X48 A;  2YX7 A;  2DK5 A;  3C2B A;  4L9T A;  3FXQ A;  2EFP A;  3L2U A;  1UAA A;  4BE1 A;  1TNS A;  4LB5 A;  3ZOB A;  4YEJ A;  1O3T A;  3T8T A;  2AS5 F;  1QHH D;  1IRZ A;  3CDL A;  1TQP A;  4I0B A;  3CDI A;  2C6Y A;  1B59 A;  2OPT A;  4JX4 A;  3NWS A;  4EJO A;  2HQ5 A;  2VXZ A;  3GFI A;  3HPG A;  3A1Y A;  3JRD A;  3TO6 A;  2JA2 A;  4IHY A;  1ETQ A;  2DN0 A;  4BBS J;  2LKP A;  3N4M A;  3WU1 B;  2JA7 J;  2MW8 A;  4X0G A;  3I56 I;  4CXF A;  1PYV A;  1I3Q J;  2JSC A;  4HQM A;  3FMQ A;  1B72 A;  3AKZ A;  4OIQ F;  1QZE A;  2P81 A;  1ZG5 A;  4FE4 A;  2GWR A;  4XLN F;  2ZC2 A;  2DU9 A;  3J81 K;  1Y1W J;  1STZ A;  3MCZ A;  4OOI A;  2NVU B;  1ZK8 A;  3ZMS A;  2O7O A;  3M8E A;  2JWT A;  5L3B A;  1YFH A;  2W85 A;  2KMU A;  5E3O A;  1MMS A;  4BXX J;  2DMU A;  3L2C A;  3J80 Z;  4KJZ A;  3PO2 J;  2CWE A;  2OQR A;  2RAE A;  2QLZ A;  3ZMV A;  3F8N A;  5F04 A;  2KPM A;  3GLL A;  1PP7 U;  4CDG A;  2DFH A;  1VQ6 I;  5IT3 A;  1LE8 A;  2FML A;  1ZEL A;  3ZMT A;  5FLM J;  4MGR A;  2E1M B;  4KUM A;  4FX0 A;  3O6B B;  3ZN1 A;  4G7H F;  3L2V A;  2X4H A;  1WRJ A;  1QGP A;  3GWZ A;  1W36 D;  3UR3 C;  2GIZ A;  3GX4 X;  5HDG A;  2NVQ J;  4XON A;  2XAS A;  3CD6 I;  2D2W A;  1ZN2 A;  2XAJ A;  3D1N I;  4L5J A;  3BQY A;  3U9G A;  5IOZ A;  1MMD A;  1EH7 A;  4M6Y A;  1K78 B;  1JGG A;  1TL8 A;  3BP8 A;  4BS9 A;  2HQN A;  3OSF A;  2ECC A;  2QM3 A;  3AG3 H;  1SD4 A;  2M0C A;  2WB1 N;  5IPA A;  2D5V A;  3PFI A;  4YII A;  4CH7 A;  1RNL A;  5D4R A;  2DFI A;  4QPO A;  5IY5 H;  2MFZ A;  4WWC A;  2DA3 A;  3IC7 A;  4RAG A;  2XRN A;  4HNU A;  3M3Y J;  2VJ5 A;  3R61 A;  2EQR A;  3C2G A;  2D1H A;  1WJE A;  4KNY A;  1VQ9 I;  1LQ1 A;  5GTI C;  4HDU A;  5LRS A;  3DCF A;  4XKV A;  2L4A A;  2EBI A;  2DYS H;  2L7M P;  3Q0W A;  1Z21 A;  5KVR A;  2XPW A;  1G8X A;  4B4C A;  2PJR A;  2DW4 A;  5E20 A;  1RI7 A;  3L2Q A;  5CQE A;  1G3Y A;  2Z99 A;  4ZYD A;  1XPX A;  3JRE A;  5BOX A;  3FIW A;  2DFE A;  2OAZ A;  4BBR J;  2H94 A;  1FSE A;  4EQQ A;  3DEU A;  3OL3 A;  3B73 A;  2VPL A;  1WCM J;  3PUB A;  1U0J A;  1Z3X A;  1Y8R B;  3M1E A;  1KGS A;  2IVM A;  3LOC A;  3I53 A;  3A4C A;  2LD5 A;  3UKG A;  4A3I J;  3QP5 A;  5F27 A;  3G6E I;  4Y7N J;  1XB4 A;  4OIR F;  4NC7 A;  2QF7 A;  1YJ9 I;  3REO A;  4IQJ A;  4BJT A;  1K6O A;  2P7C B;  1N77 A;  3QYF A;  2AQF A;  3K10 A;  2UXX A;  3BR6 A;  4CCN A;  1JGS A;  1S3J A;  4GYI A;  4PUS A;  4BYY A;  4NB5 A;  1D1C A;  4NC6 A;  2XKP A;  3S93 A;  2EFO A;  5L3E A;  2QBY A;  3LSM A;  4XOP A;  1BW5 A;  4YIF A;  4AC0 A;  1D8K A;  4A0Y A;  2YSR A;  3B02 A;  1ON1 A;  1XSV A;  2K9S A;  5F0F A;  3I3L A;  2VUM J;  4X6A J;  3S2H J;  2PMU A;  3IH4 A;  4M71 A;  3SZT A;  2HFH A;  2HWV A;  3S8P A;  3QPT A;  2KLO A;  1WJC A;  2VI6 A;  5J8F A;  2XRO A;  1ETV A;  1SFU A;  2EB7 A;  4HNT A;  1Z7U A;  4M74 A;  1LVK A;  1ETO A;  1FWZ A;  2BXY A;  2X1E A;  3KFW X;  3GFM A;  2MH9 A;  3DP7 A;  3CC4 I;  2IA0 A;  1REP C;  1QRY A;  2W57 A;  3ZQ7 A;  1JTY A;  3I58 A;  3FKI J;  3JRB A;  4LIU A;  3IWF A;  4CCM A;  3F8C A;  3J7Y J;  3MZH A;  3S2D J;  1ZG3 A;  1MJA A;  4PFP A;  3LWF A;  3NRV A;  3DPU A;  5H6Q A;  3S15 J;  3E6D A;  4ZDL A;  3H36 A;  4CSW A;  4KIT B;  3V8L A;  2ZBK A;  1EV7 A;  2R0Q C;  2VQG A;  3HRU A;  1TLH B;  4PJ0 C;  5EZG A;  4Y52 J;  1UHS A;  2CQQ A;  3MMY B;  4LLG F;  4Y13 A;  1GUU A;  4ZDO A;  3B6A A;  2QQA A;  4LIV A;  1I1S A;  4I01 A;  4DZP A;  2JA6 J;  5BNG A;  2O8K A;  2P4W A;  1MSE C;  4N9H A;  4EM1 A;  2P8T A;  2R92 J;  2LRE A;  4BXF A;  1UST A;  3Q0V A;  3ECO A;  3FF5 A;  4LD5 A;  2XSJ C;  1MBK A;  1H0M A;  1R4N B;  1BA5 A;  1Z67 A;  3OS1 A;  4E7S A;  3CJT B;  4DZJ A;  1AWC A;  1SD7 A;  2ZFW A;  2QSH X;  2LNB A;  3FIS A;  3CP8 A;  3VSL A;  3FDY A;  3OYC A;  2TCT A;  4B3X A;  5JHU A;  2RNJ A;  1MMG A;  3WHB A;  4NNJ A;  2ZO4 A;  2R7O A;  1MBJ A;  2DOD A;  2E71 A;  4A3J J;  1X3W B;  3QQA A;  3ABL H;  1VQM I;  2P5L C;  4G6T B;  1G59 A;  3DEE A;  3BLY A;  4BH9 A;  2IPQ X;  4Z6Y A;  3WTT C;  2HQA A;  4PGH A;  1ZG1 A;  4BDY A;  1POG A;  5GTH C;  1H89 C;  2EZH A;  3KZZ A;  1WQ2 A;  3T8R A;  1XDU A;  4JOM A;  4UUS B;  2X9D A;  3FBI B;  4AVZ A;  1MMN A;  2R5Z B;  4KMF A;  3BZK A;  1IN8 A;  2LK2 A;  3H5N A;  4HF0 A;  2CSO A;  2GXB A;  3JW4 A;  2LY9 A;  2LY1 A;  1UJ8 A;  4RAY A;  5M5Y J;  2CUF A;  3OV8 A;  1RIO H;  4XQF A;  1HDD C;  4C2T A;  5DUK A;  4I7H A;  3TED A;  2CH0 A;  4GFB A;  4V19 K;  3HXL A;  3HOY J;  2V26 A;  3EPZ A;  4Y33 A;  4ZYG A;  2DAO A;  1HW1 A;  2IAI A;  2OV7 A;  1JHF A;  5LFA A;  4ANJ A;  2DCE A;  3DU5 A;  1YS6 A;  1BR4 A;  1ZGJ A;  1SVL A;  2F4M B;  1HOM A;  2QWW A;  1J75 A;  3D5S C;  5J6X A;  3PSI A;  2PJP A;  4WX9 A;  5JVG F;  4HLY A;  1LEA A;  3S14 J;  4BY7 J;  2G0E A;  4HLX A;  1YTY A;  2PFB A;  4OWR B;  5BQT A;  3M07 A;  1EH8 A;  1LVA A;  4PK4 A;  4DW6 A;  2BZT A;  2Q2E B;  2DT6 A;  5KK1 A;  2QZ8 A;  3FXK A;  4HSR A;  4A12 A;  1V5F A;  4QIW N;  2DMN A;  1K61 A;  4E7Z A;  2KIS A;  2L7K A;  3MKW B;  2ZJQ F;  2YPR A;  1WGX A;  2NRA C;  4II3 A;  3ZPL A;  2VJJ A;  3KP3 A;  2V7F A;  2K9M A;  1FX7 A;  3FXO A;  3I4N J;  2UWM A;  4CYD A;  1VQP I;  5D8K B;  2ZSI B;  2A5W A;  3ZN0 A;  3OIP A;  1GXP A;  2RRE A;  4MFD A;  4G6Q A;  3IKT A;  3KX2 A;  2OZU A;  2ID6 A;  2L9R A;  1ETK A;  2RNG A;  3PNY A;  5HLI A;  3OYN A;  2CQX A;  2VBY A;  5CJ9 A;  1WJA A;  1YI2 I;  1KQ0 A;  4GRI A;  2R5Y B;  1PUE E;  4RS8 A;  4HA8 A;  1YHQ I;  3FXR A;  3M1C A;  3L7W A;  3BWG A;  1CGP A;  3H5A A;  3CCE I;  4RA2 A;  1RKW A;  4BEH A;  1JUM A;  5FFX A;  3I64 A;  4RB1 A;  2Z3Y A;  3F22 A;  4MEX F;  1FT9 A;  3BR0 A;  3CZ6 A;  4YFK F;  3A02 A;  4IO9 F;  3ROU A;  1V4R A;  3HOS A;  2VKH A;  2JUG A;  1RR8 C;  4DGW B;  1VQL I;  5LEK A;  2XGE A;  1YX5 A;  1W4M A;  4MNU A;  4WF2 A;  3SEQ A;  3OIO A;  3G71 I;  2WAD A;  2G7U A;  1YIJ I;  2CV0 A;  2E7W A;  2XF6 A;  2XRL A;  3GTL J;  3O3K A;  5CYV A;  1ZYR F;  2OZ6 A;  1R00 A;  2EA4 A;  2G7H A;  5JI6 A;  3FWE A;  3H5R A;  3OYI A;  3J7A Y;  3FZV A;  1F5T A;  2RQP A;  2YR2 A;  1D8J A;  2WAE A;  1OR7 C;  1R6R A;  2BEO A;  2I8D A;  4EVI A;  4ZYE A;  2EZI A;  1U9N A;  1CQT A;  1P4X A;  1QO0 D;  3W6J B;  1FJL A;  1J59 A;  3I5U A;  2XIG A;  3L9F A;  3FBN B;  4IHS A;  2F5V A;  2IGM A;  4D0P A;  5TIS C;  5K5R A;  3OYB A;  2R7Z J;  4XOR A;  1PP8 F;  1UCR A;  4L5I A;  1PDN C;  4UB8 C;  4O6J A;  2ACJ A;  4HX7 A;  3KET A;  3H35 A;  2M5W A;  3BG5 A;  2LKX A;  1TQM A;  3NQO A;  5L3G A;  2DPU A;  2VQH A;  3LSG A;  2V1U A;  4F91 B;  1Z6R A;  1GT0 C;  2VBX A;  1B8I B;  2DDB A;  2NS7 A;  3SJM A;  1YOV B;  2DMP A;  1KQ9 A;  1KA8 A;  2JT1 A;  4PSW A;  1B72 B;  1O3R A;  4A3D J;  1WH5 A;  1GDT A;  2BY3 A;  3KLN A;  2PMZ A;  3P9C A;  2IS2 A;  3GTJ J;  1F1Z A;  4FT8 A;  4B09 A;  4C30 A;  5GAD J;  2PLY A;  2X85 A;  3C3W A;  2ZJR F;  4G7O F;  3CO7 C;  1FBQ A;  3NAU A;  3AL0 B;  1YG2 A;  2EA2 A;  2DMT A;  3K2Z A;  4I98 B;  3VYT B;  2YU9 J;  3W6V A;  4KT5 C;  5J1U A;  4L0Z B;  3E5Q A;  1FOW A;  3AG2 H;  4CHU A;  1SAN A;  1Q1H A;  3C7J A;  5FD5 A;  5EEH A;  2GOM A;  2CO5 A;  3M7G A;  2OC6 A;  3I54 A;  4LFU A;  3KEO A;  4ESF A;  2W48 A;  4BJ6 C;  4Q4Z F;  2NOJ B;  5ILV A;  2MC3 A;  4O5V A;  3MZY A;  5K7F A;  3ERM A;  3HGY A;  4KMU X;  4UUS A;  5LEJ A;  1R7J A;  1T56 A;  5IYD J;  2ZME A;  4A6D A;  5ED4 A;  3R6S A;  4D7N A;  3H3V K;  4BE0 A;  4CZC A;  4OMZ A;  2KIU A;  1T6S A;  5D6F A;  1HSJ A;  3HSR A;  2I5U A;  4E7K A;  2K7L A;  1AKH A;  5HOO A;  5FKN A;  2JTV A;  1A6I A;  2X0L A;  3ZQH A;  3OSG A;  2WA0 A;  3E1S A;  3K70 D;  2E35 A;  1D5V A;  2NAZ A;  4Q48 A;  1OIS A;  2FU4 A;  4S05 A;  3LAJ A;  1ETW A;  1C0W A;  1IV8 A;  3P9K A;  4CYC B;  2PJR B;  3WHC A;  1L0O C;  3CJN A;  2IJL A;  1TW2 A;  3CC2 I;  5EF6 A;  2DA6 A;  2HDC A;  2CUZ A;  2HTJ A;  2XGC A;  4RDU A;  1ZR4 A;  2O8X A;  2HS5 A;  1S7A A;  1JT6 A;  1MBF A;  3S16 J;  3BZC A;  4A3L J;  2DOF A;  2EIL H;  1YW7 A;  2Q2E A;  3O8G A;  1XTA A;  3S1M J;  4LGW A;  1VQK I;  1FIP A;  3DFG A;  5J40 A;  2LR8 A;  5FRO A;  3D5R C;  1O3Q A;  2L9N A;  2ZB9 A;  4ZYH A;  1A6Q A;  4KA4 A;  4CZZ A;  2AO9 A;  3IH2 A;  4YFX F;  3HOU J;  1SFK A;  1LEB A;  1GHC A;  1SAX A;  2QBY B;  2B63 J;  2EIJ H;  4GCV A;  5HNF A;  3TP3 A;  3WTX C;  1OMI A;  3E7L A;  4C3I J;  2NS0 A;  4XN0 A;  1UG2 A;  3K4M A;  5F08 A;  3CCV I;  3W2W A;  1H9T A;  2ZSH B;  5FFZ A;  4CUG A;  1D1B A;  3CCR I;  2PMZ N;  5J8C A;  2RN7 A;  2XUB A;  3OWT A;  4XMY A;  4D7M A;  2BY1 A;  1P2F A;  1P7J A;  5CLS A;  1R5H A;  1FC3 A;  2FA5 A;  4LIT A;  2Y30 A;  4XN3 A;  1FBU A;  2E7X A;  1UHM A;  3RYR A;  5CVV A;  2V1D A;  4U0W A;  4XL9 A;  1WZ2 A;  4ASN A;  5FRM A;  1FMW A;  3KE2 A;  2EFW A;  4AIK A;  5IYC J;  4WXD A;  4HDV A;  1VF9 A;  2L2O A;  4HEA 2;  5IT9 K;  4E7L A;  4IOA F;  4UV9 A;  5E79 C;  4E6K G;  1TWC J;  3GCM A;  1KQ8 A;  2FRH A;  3P7N A;  4PJJ A;  2LY2 A;  3V8J A;  1TTY A;  3IWZ A;  1XGS A;  5IP9 J;  1P92 A;  4HV5 A;  3WTW C;  1FLI A;  1BIB A;  2FMY A;  5EJC A;  2EH3 A;  2HNH A;  4E7I A;  1RR7 A;  3KYC B;  1OLT A;  3VPR A;  4ZJZ A;  4I0A A;  3BPV A;  4DYR A;  3C18 A;  1D0X A;  4N4O B;  3QOE A;  2VPR A;  2EZL A;  4P9F A;  3IUO A;  3BTJ A;  2GM4 A;  4HST A;  4CCO A;  1R1T A;  1E3P A;  1IC8 A;  1P4W A;  3TKY A;  1I27 A;  3MWM A;  2NVT J;  1H8A C;  2GA1 A;  3HIF A;  4Y4R A;  2V4J C;  2R7W A;  1HBX G;  2J5O A;  4A3M J;  3QRF F;  1D0Y A;  1FY7 A;  3HC7 A;  1FIA A;  1A31 A;  3QYB A;  3QAH A;  2JPB A;  4RGS A;  3BJA A;  1MZB A;  1ZTR A;  3ISP A;  3QP6 A;  2H6C A;  2YUS A;  1VQ4 I;  2BW3 B;  4AYB A;  2HYG D;  2ESH A;  3PUF A;  3S32 A;  4BKX A;  4XK4 A;  2A61 A;  4U87 A;  2CW0 F;  2CQK A;  2IXS A;  4M3B A;  1B8I A;  5FKL A;  2KZG A;  4QWQ A;  4A3G J;  2KP6 A;  5GPA A;  1DU0 A;  2Y31 A;  2OUM A;  4A5M A;  4FTH A;  3SXY A;  2F2E A;  2K27 A;  3KP4 A;  3TQN A;  5HS8 A;  3OYD A;  4ZZD A;  2ZME C;  3HOV J;  4IHX A;  5KNL A;  2V9K A;  1F43 A;  3U1D A;  3GF2 A;  3EUH C;  2BE5 F;  1EA3 A;  1Y1V J;  1HC8 A;  1P4A A;  3QU6 A;  1GLN A;  3K1N A;  2XKO A;  3TOB A;  1Y56 A;  2V79 A;  3KP6 A;  4RM3 A;  4A5N A;  4DYC A;  3BJ6 A;  2IW5 A;  3QWL A;  1W5T A;  3I4M J;  1XN7 A;  2W84 A;  1LUJ B;  2WY7 Q;  1T98 A;  4AIH A;  5J1R A;  4U7D A;  1Z6T A;  2A69 F;  4II2 A;  3DKW A;  3CCY A;  2IGK A;  2MD0 A;  4DNC A;  3RTR A;  3FM3 A;  5D4S A;  4M3D A;  1XX5 A;  1Z1D A;  2VN2 A;  4J19 A;  1SAU A;  3J81 Z;  5HVQ C;  3A03 A;  2N8G A;  4H4K C;  3WTS C;  2E2J J;  5DCF A;  4CIC A;  4QLC U;  3ZQL A;  4JX5 A;  4BQQ A;  2BGC A;  1BI3 A;  4IJA A;  2CUE A;  3NAR A;  1O3S A;  1K7A A;  5F0C A;  3OYG A;  5GAH J;  4EAT A;  2HPI A;  1BL0 A;  3EYY A;  1N78 A;  1MH3 A;  4UB6 C;  1J09 A;  2M7B A;  4A93 J;  4UXN A;  2R7V A;  4XNF A;  4H0E A;  2QQB A;  2PI0 A;  3C2H A;  2RKH A;  3PQK A;  2VBZ A;  2W4S A;  4CYC A;  4M3F A;  2HOT A;  2L0K A;  3KYD B;  1Y6I A;  2DA2 A;  3TL4 X;  3FHN A;  3LA2 A;  4IRI A;  2OJE D;  3S1R J;  3RQ4 A;  1T0F C;  1U8R A;  1TP4 A;  2DO7 A;  1W7P A;  1FOX A;  4M6X A;  2VIX A;  3DTK A;  4M9X A;  2L02 A;  4D1Q A;  2JRM A;  2R7R A;  5D5U B;  2AHQ A;  1ZR2 A;  4LB6 B;  1G3T A;  1Z3Y A;  2IS1 A;  3FK7 A;  3CF2 A;  1X19 A;  1I3A A;  2KIF A;  1BC7 C;  1UG0 A;  4L5E A;  3OIQ A;  1LPQ A;  4IHV A;  3K4L A;  1U3E M;  4UNO A;  4AYB N;  1JUP A;  2OA4 A;  1YIT I;  3HOZ J;  5GPC A;  4XSX F;  3L1P A;  4OIN F;  5BPD A;  2JN6 A;  4BEH B;  5BPI A;  3JTH A;  2LG4 A;  5ICE A;  2EV6 A;  1R1V A;  2XPV A;  1BW6 A;  4ENM A;  3MZ8 A;  4KYW A;  2VQC A;  4KIB A;  3HOT A;  3IAS 2;  1LNW A;  3V7S A;  4RGR A;  4EM0 B;  1WKM A;  5M5W J;  4KIF A;  4PJN A;  2GAU A;  1KYW A;  1V55 H;  2A6T A;  2EV0 A;  2GQQ A;  3VYU B;  4XLP F;  4NC8 A;  2COM A;  1IN6 A;  1YE9 A;  2KIQ A;  3V42 A;  2JZY A;  2R7F A;  1X4P A;  2WBM A;  2KKO A;  1ZGA A;  3OOU A;  5AON A;  4BQN A;  3WE2 A;  2O61 A;  4IPA A;  1X1C A;  3J7A O;  1ZAO A;  1L3L A;  3RQI A;  1R5G A;  4UVA A;  4FCY A;  3PNT A;  2OBP A;  2V9V A;  3G4S I;  2ICW G;  4XRS A;  4EJV A;  2WAF A;  1Z91 A;  1R36 A;  2UV1 A;  4EGY A;  1NHA A;  3GUD A;  3KIO A;  1K4S A;  2M87 A;  2JA5 J;  5ICG A;  1EH6 A;  2VT3 A;  3GTM J;  3G1O A;  2VXD A;  3NEU A;  3R4K A;  3BQZ A;  4HRI A;  3FKJ A;  2K9L A;  2M7A A;  2NS8 A;  3GTQ J;  1LFU P;  1YYV A;  3RJP A;  2E2I J;  3BRO A;  5CVR A;  4UY8 I;  3LQQ A;  4XOT A;  1HLV A;  1TWA J;  3B6C A;  3H0D A;  1BBY A;  5J4V A;  5FKM A;  1DUX C;  2IRF G;  5CKT A;  4F3Q A;  4HV6 A;  5FKK A;  4V2F A;  2DYR H;  2BVL A;  2YX4 A;  1J2X A;  3ELK A;  5E17 F;  1OR7 A;  1PUF A;  1B4A A;  2AQE A;  3HTS B;  5FJ8 J;  2LC2 A;  1UZC A;  3VSK A;  4G9Y A;  2LDU A;  2W1O A;  2V1X A;  4QPQ A;  1R9T J;  1SFO J;  1D5Y A;  1IZ1 A;  1R4M B;  2J5P A;  4ZYA A;  2BW3 A;  4FQG A;  3CF5 F;  5DDG A;  4IKF A;  3VYR B;  3V4G A;  2Q0O A;  1EJ9 A;  2LOO A;  4LJZ F;  4N0B A;  4HPQ A;  1FTZ A;  1I50 J;  4IX7 A;  3DBR B;  3ECH A;  3K1M A;  2EJR A;  1RZ4 A;  1X3Z B;  1UHW A;  4P9U A;  3ERE D;  1F4K A;  1DDN A;  1Z7L A;  2JQ7 A;  1U6G A;  1ZLJ A;  1LJ9 A;  4XRS G;  3JRG A;  2K3F A;  3RSN A;  3A0H C;  3EQL F;  3F8F A;  1XD7 A;  4JYK A;  3KZY A;  1TW3 A;  3WOD F;  1TWF J;  2IP2 A;  1X2M A;  2EK5 A;  1YIO A;  3GO5 A;  4KN7 X;  5BS6 A;  4DBR A;  3DLL F;  1X2N A;  3AG1 H;  1S7E A;  1XSD A;  4G12 A;  2PG4 A;  2XPU A;  3OR2 C;  2KZV A;  2ZME B;  1MIJ A;  1PJR A;  1SFX A;  2DOE A;  1QHG A;  1SD6 A;  2Y75 A;  4XBF A;  3V7C A;  3GZN B;  2BBY A;  1JJ8 C;  1Z9C A;  3QOP A;  5DS9 A;  4C2U A;  1AKH B;  3E5X A;  3RCO A;  1TQI A;  1AHD P;  3G1L A;  2E1C A;  3A0B C;  2CW8 A;  2VKD A;  4FAS D;  1BN5 A;  5H6R A;  3J7Z I;  3ONQ A;  4GXO A;  1T2K A;  5C44 J;  2G9W A;  3GYH X;  2LYC A;  4DJA A;  1IN5 A;  2A07 F;  2Y0S A;  1SC7 A;  1IXR C;  4C3H J;  2L7Z A;  1IW7 F;  3HZJ A;  4XLA A;  1NK2 P;  1ZRF A;  2FD5 A;  3IH3 A;  3Q9V A;  1WI3 A;  3F8B A;  5KAI C;  2MBF A;  1FYK A;  3VOD A;  3BG7 A;  4KT6 A;  5HLH A;  3F8M A;  1GV5 A;  3EUK L;  1O7L A;  1QBJ A;  3SZG A;  1Y8Q B;  1XG1 A;  2QEN A;  3WGH A;  3ZR8 X;  4D9J A;  3O2P E;  2FEZ A;  5L3D A;  2FUG 2;  2TDX A;  4BY1 J;  2BHZ A;  3HOX J;  3WGG A;  4IOC F;  3G2B A;  1HF0 A;  3EET A;  1S5L C;  4G8X A;  3E97 A;  1UFM A;  1HKS A;  2FXA A;  2P6T A;  1EF4 A;  1BI1 A;  1WVR A;  2KFD A;  1WH7 A;  1ETY A;  1OJL A;  4I09 A;  2O9L A;  1OKR A;  2F5F A;  5HS7 A;  3SYT A;  1T95 A;  1RKT A;  3DBH B;  4ESB A;  1J7K A;  1D3Y A;  1Z05 A;  4IXA A;  2DMQ A;  1QQI A;  2VL8 A;  3K0L A;  1R23 A;  1TBX A;  2HOA A;  2M8E A;  2ZNY A;  4I02 A;  1E3O C;  1MKM A;  1MBH A;  3CUQ C;  1MGT A;  2ME6 A;  3DF8 A;  2UZK A;  1IGN A;  2JUC A;  4GYG A;  3ULQ B;  3HDD A;  3ESW B;  2NVX J;  1U5T C;  4FX4 A;  4PZJ A;  3TMO A;  1NG7 A;  2DLL A;  2GOX B;  2JRT A;  4KDP A;  1G6N A;  2DA1 A;  2R4G A;  3HSE A;  4PJL A;  3O8H A;  3E0J B;  1NH3 A;  4EV0 A;  4NQW A;  1YW9 A;  2R7D A;  2W82 A;  5D5X B;  2H8R A;  1N25 A;  3U21 A;  3WU2 C;  1FOY A;  2KL4 A;  3MVP A;  5FRN A;  5DCM B;  1VND A;  2HVQ A;  4M73 A;  4YIR X;  3ZP5 A;  4KN4 X;  1QPM A;  1XS9 A;  2R7X A;  1XGN A;  2ELK A;  1X58 A;  3OYH A;  2CW7 A;  2HEO A;  1Y0U A;  3SFZ A;  3C1D A;  2DTZ A;  2MLG A;  1X1A A;  2DQL A;  3CCM I;  3SDG A;  2VT2 A;  4XKW A;  4U7B A;  4B44 A;  4BU2 A;  5HOD A;  4XR6 A;  5K1Y A;  4BL0 B;  1YLF A;  2ME0 A;  3CP2 A;  3GFL A;  2B0L A;  4RM2 A;  4M9S A;  2R7Q A;  3FXL A;  1NTC A;  4GO1 A;  5M3F J;  2Z1D A;  1BJA A;  2HI3 A;  3QPS A;  5E3N A;  1WPK A;  2PBI A;  3PSF A;  4A3E J;  2VOP A;  2EZK A;  2Y69 H;  5TGT A;  4CGZ A;  1T38 A;  1B9M A;  4S0H B;  5H2F C;  1MDM B;  4KIC A;  1XCV A;  4J01 A;  3KPH A;  3QU3 A;  4A69 C;  1BIA A;  1MND A;  1DPU A;  1U78 A;  1R1U A;  2MA3 A;  3HM5 A;  2Y0S N;  4OIP F;  2Z2S B;  2STT A;  1W7P D;  3T1B A;  4WCG A;  1OCP A;  1YX3 A;  2HGC A;  4X1E A;  3F72 A;  4UVC A;  4ENK A;  2EWN A;  3QPH A;  3F21 A;  3AFH A;  3WE3 A;  4XLF A;  1ZKG A;  5IP6 A;  3FXU A;  3H92 A;  1I6H J;  2FX0 A;  4NUB A;  1BI2 A;  5B66 C;  2NYX A;  2M3A A;  3R0A A;  2ADU A;  4NBQ A;  3GTG J;  4A6E A;  2KDZ A;  2HDD A;  5TRD A;  2O6G E;  3A01 A;  1K6Y A;  4QTR A;  2M45 A;  2B9S A;  2HZD A;  1W5C C;  3QOD A;  2KJC A;  3PQJ A;  3P5J A;  4E7H A;  1FYM A;  3HSF A;  4E70 A;  2CV1 A;  3TOA A;  1I6X A;  2LF7 A;  5DM6 F;  1G3W A;  1GVD A;  4EEF G;  5EEA A;  3HTU A;  3BZ6 A;  1KON A;  3CLQ A;  3SHF A;  3MKZ A;  3TP0 A;  1HST A;  1TWG J;  5KHD A;  2Y9Z A;  2XF7 A;  5EZH A;  1WJ5 A;  2ZJ2 A;  1FSH A;  2HKX A;  3L09 A;  2F6C A;  5E1W A;  2BY0 A;  4A0Z A;  1NK3 P;  1KU2 A;  2AXL A;  3SQN A;  4ENJ A;  3HYI A;  3IV5 A;  2DFF A;  3DLA A;  4MTD A;  2EFQ A;  2K5C A;  4EGZ A;  1KU7 A;  3LSK A;  5EDN A;  3WG9 A;  1SFE A;  2DTR A;  1VQO I;  4UHT A;  3H3U A;  1FTT A;  3JRA A;  4GDF A;  4BAC A;  4ZTF A;  2HVR A;  3KEY A;  4WK8 F;  4FE7 A;  3CJQ B;  4M9Z A;  3IP4 B;  5DD8 A;  3W3C A;  4M72 A;  1O7F A;  3ABU A;  5HS9 A;  2RQQ A;  3K4B A;  1U8B A;  3OYK A;  3FK6 A;  5AIQ A;  3BOQ A;  3LFU A;  1DQU A;  3RKX A;  4XIC A;  2IS6 A;  3BCB A;  4C9Y A;  4AVP A;  3EUH A;  2DK8 A;  2HPM A;  5K7Z A;  2L3D A;  3LSH A;  3BJO A;  3ML6 A;  3CCS I;  3HPH A;  4ZTJ A;  2FQ3 A;  3DU6 A;  3GZ5 A;  1X1P A;  2W25 A;  3MN2 A;  2IGO A;  2X6W A;  4XLE A;  2F5C A;  3LAP A;  1FP2 A;  1D1A A;  4HQE A;  3CTA A;  3HJE A;  3AG4 H;  5EG0 B;  1HXD A;  2LH9 A;  1W1W E;  4XM3 A;  1GV2 A;  1W7P B;  2VAS A;  2WWY A;  1X1D A;  1JHH A;  2XAQ A;  4E7J A;  4L18 B;  1FPQ A;  1VTN C;  3OR1 C;  1X1B A;  3LA3 A;  1K83 J;  2IBD A;  3GVA A;  4PDK A;  4TV7 A;  4L0Y B;  5ERI A;  5C3E J;  3VWB A;  3M8F A;  5LGT A;  3P9I A;  1PVE A;  3CUO A;  1IV6 A;  2E1N A;  3FXM A;  5D6E A;  1USS A;  1UB9 A;  2ZJP F;  3HUG A;  2E19 A;  1APL C;  1E17 A;  2WC2 A;  2DXI A;  2NOG A;  2R7U A;  4JX6 A;  4BQO A;  4F93 B;  1EKE A;  2ZXW H;  1YS7 A;  3GBG A;  2OCE A;  3DEW A;  1BOB A;  3KP2 A;  2MD5 A;  3BY6 A;  2A6E F;  3MKL A;  4MQV A;  4IRG A;  2M8G X;  5LGN A;  3M8J A;  1O57 A;  1T0F A;  1E0E A;  2H27 A;  2BV6 A;  2DA7 A;  3GME A;  2KHM A;  1ZHF A;  5F0H A;  3KZI C;  4S04 A;  2FNA A;  2E60 A;  2A05 A;  2PEX A;  1DP7 P;  4CA0 A;  3BTL A;  4YRV A;  2CS3 A;  5F64 A;  3JAM K;  3G3Z A;  4G94 A;  2GXG A;  3VYS B;  4LLN A;  4RLF A;  1BR2 A;  2PN6 A;  4LLL A;  1Q1V A;  3WU0 A;  3DTI A;  4A3B J;  3F0C A;  4A3F J;  2XV4 S;  3OL4 A;  4A3C J;  1OCT C;  4HF1 A;  2KIM A;  3I4P A;  5BMZ A;  3S1N J;  4HYE A;  1U5T B;  2RV8 A;  3S3N A;  5FLX K;  1K4T A;  5DCM A;  3HRM A;  5K5Q A;  4BHP A;  3BG9 A;  4L9J A;  1TWH J;  5DEQ A;  3ZGK A;  4C2M J;  4HBL A;  1RRJ A;  1MSF C;  2HQR A;  1G3S A;  2QVO A;  4M6V A;  1XDS A;  1IXS B;  2CQ7 A;  2DA5 A;  3VB2 A;  1ZGW A;  3ZXS A;  2LLK A;  2CFX A;  5E8G A;  2BVM A;  3ASN H;  3W2A A;  5A2Q K;  4O3M A;  1XGO A;  2CQN A;  4XSZ F;  2CGP A;  4N9I A;  1VQ8 I;  1M1E B;  3ZMD A;  2WV0 A;  5EGO A;  2F5E A;  2W24 A;  2XAG A;  2K9Q A;  3H9Q A;  3HRS A;  4BJ5 C;  4PJM A;  1DGW Y;  2HDW A;  2RC4 A;  2ZCW A;  4AWX B;  4CCJ A;  2LP0 A;  3JAM Z;  2QSG X;  1IG7 A;  1V5E A;  2DQR A;  1MDM A;  3GW2 A;  3DBL B;  2XGD A;  1B9N A;  1PUF B;  4JBA A;  3BG6 A;  3T5X A;  1OCZ H;  1ON2 A;  2MGQ A;  2HOS A;  5E18 F;  5FLX Z;  1B6A A;  5IT9 Z;  3Q0U A;  4G7Z F;  3RYP A;  3S3M A;  3NWT A;  4E4H A;  3FX3 A;  1LKX A;  3LFK A;  3N97 A;  3E3V A;  2V1N A;  1QPI A;  1VQ7 I;  1X4O A;  2ISY A;  2NVY J;  2V6E A;  2H1L A;  4L9V A;  3J80 K;  1P9Q C;  2LKS A;  3JSO A;  2VLA A;  4IHT A;  2GA2 A;  3K1P A;  4BE2 A;  2BY2 A;  5A2Q Z;  2GIV A;  2E36 A;  1A35 A;  5E8I A;  2NNN A;  2FBK A;  4FHT A;  4MFE A;  2IGN A;  3ABK H;  4B1R A;  1S7O A;  3GEZ A;  1P6R A;  2FBI A;  3HB9 A;  2DDA A;  4EJU A;  1HKT A;  1IO2 A;  1MNM C;  4I99 C;  4ITV A;  1X3U A;  2JPC A;  4LG0 B;  1B1B A;  4U0V A;  2YU3 A;  3PJR A;  4JK1 X;  4U0Y A;  2E1O A;  2K4B A;  4RLQ A;  3DXJ F;  5B1B H;  2RVC A;  1VFC A;  3RZO J;  2VKV A;  4JP0 A;  1YO5 C;  2Y48 A;  4HX8 A;  3S17 J;  3KEQ A;  1ETX A;  2WAQ A;  3VEP A;  3KYL A;  3CJR B;  1S8N A;  3CC7 I;  4LK0 F;  1R5I D;  3HKZ A;  2M4G A;  4IF4 A;  3TW6 A;  3RPQ A;  3R0J A;  5F1J A;  1A04 A;  1HW5 A;  3I59 A;  4DQ2 A;  5JFR A;  1QVT A;  4HOB A;  2X6O A;  1RUO A;  2FBH A;  3TO7 A;  4Y3O A;  1VQ5 I;  3SFI A;  4HX4 A;  4BGD A;  1DP3 A;  3HHH A;  2W00 A;  2CYY A;  3R60 A;  3TBI A;  1JTX A;  1HCR A;  4JQF A;  5J3L A;  1HA8 A;  1ZLK A;  1WJB A;  3HHG A;  2EV5 A;  4KIS A;  2IT0 A;  4KIG A;  1ONV A;  2GBY A;  1GVJ A;  4AID A;  2MG4 A;  4RB2 C;  1R71 A;  5D5V B;  2QQ9 A;  1CF7 A;  4XLH A;  5D8L B;  4IZZ A;  2FOW A;  5KCM A;  2L9S A;  2COB A;  2MSY A;  5LD2 C;  3BR1 A;  3LST A;  3LA7 A;  5EG0 A;  2R3S A;  1ULY A;  3VFZ A;  2O0Y A;  4FIS A;  2VOD A;  1S6L A;  1WJF A;  1KYZ A;  1SEU A;  1OQY A;  1JE8 A;  4HZF A;  3JRH A;  1R22 A;  4G6D A;  2YS9 A;  1OCC H;  3BT9 A;  4L9N A;  4Y15 A;  3JRF A;  1ACI A;  1ORK A;  5IOY A;  1MBE A;  3V8K A;  3PL8 A;  1S9H A;  3RPU A;  3RZD J;  4MHG A;  5C4X J;  2CMP A;  1AU7 A;  2CUJ A;  1MNE A;  2XF5 A;  4UVB A;  1W0U A;  5DYM A;  5B5E C;  3MFK A;  3M4O J;  2FE3 A;  1WFX A;  3U1K A;  2GXA A;  4BHC A;  4NQW B;  2VKE A;  3DTE A;  3EDP A;  3H9J A;  3PNV A;  5HDN A;  3ZQC A;  2ZKZ A;  2QGU A;  3LSI A;  4MLO A;  2OU2 A;  4B47 A;  4M3E A;  1TT5 B;  2KDO A;  2QQ8 A;  2EIK H;  1OYY A;  4AM3 A;  3FMS A;  2DJI A;  1RUN A;  4B3A A;  2H1K A;  4MEY F;  2STW A;  4ZH4 F;  4BDZ A;  4OAY A;  4DYQ A;  1W0T A;  4PSX A;  4PGG A;  2Z5U A;  4ETS A;  2ZXJ A;  4D5F A;  2HR3 A;  1MJ9 A;  2M30 A;  3CUQ A;  3I9V 2;  4W1U A;  3CQZ J;  2ZXH A;  3VOE A;  2KRH A;  1Y0N A;  5EEG A;  2M4K A;  4XLC A;  2K4J A;  2MLK A;  1U5T A;  1SVM A;  2O03 A;  4QSH A;  3MQ0 A;  4RMN A;  2L5Q A;  1IN4 A;  1TNT A;  2A6H F;  1O4X A;  4MIM A;  2WY8 Q;  3GTP J;  2WAQ N;  1WHU A;  3GXO A;  5M3M J;  3ABT A;  3H3Z A;  4RB0 A;  5JVT A;  2DI3 A;  1RET A;  3HKZ N;  4EM2 A;  1RES A;  1SD5 A;  2M9H A;  3KCC A;  2MYS A;  4LOC A;  1JKP C;  3L00 A;  4ESJ A;  5FO5 A;  3K2A A;  1OYI A;  5E3M A;  1YRN A;  3Q5F A;  2JMW A;  3KP5 A;  2IEK A;  3OY9 A;  3L2W A;  5CVI A;  3K7A J;  3WTZ A;  3RI4 A;  2I10 A;  2IS4 A;  2GZW A;  5AIP A;  2WTE A;  3BCA A;  3DKY A;  2VJ4 A;  4Y17 A;  4BUP A;  1MJB A;  2FNP A;  4V2G A;  2P7V B;  3A01 B;  1AA7 A;  3KLO A;  4LK1 F;  3F3X A;  3ZMU A;  2PX9 A;  3GTO J;  2CV2 A;  4P55 A;  4CCL A;  2HZT A;  4J00 A;  1WI9 A;  2ZFU A;  1A5J A;  1P7I A;  4XRM A;  2RGV A;  2DBB A;  3H9G A;  3EYI A;  4Z2Y A;  2KRF A;  4A2U A;  2NXN B;  2KT0 A;  2QSF X;  4HAM A;  3FMR A;  3KP7 A;  2K86 A;  1JUS A;  5LLQ A;  2L9V A;  1ZAR A;  3OYL A;  1F36 A;  1HW2 A;  1U9O A;  3CMM A;  3GTK J;  3DKX A;  3AL0 C;  1I39 A;  3TDZ C;  1S72 I;  1XMX A;  2IA1 A;  4IQ4 A;  4ENN A;  2HXI A;  2VC0 A;  5LBQ A;  1A36 A;  1ZRE A;  1MH4 A;  4P5O A;  5ICF A;  2L4M A;  4RBO A;  2ELJ A;  3L2R A;  1FMV A;  4UUT A;  2M34 A;  2KQR A;  1TT0 A;  3TW7 A;  2X6X A;  4I76 A;  3ZRG A;  1ERD A;  1FOK A;  1T8I A;  4HG2 A;  2LFB A;  1LDK B;  4IRH A;  3F23 A;  5DUI A;  1BM9 A;  4F52 A;  1H9G A;  4MTE A;  1K79 A;  2HYJ A;  1U2W A;  1QZY A;  5E1Z B;  2QEX I;  1BI0 A;  1ODD A;  2F4O B;  3MAJ A;  4ZDP A;  3WTU C;  1ZRC A;  3RIR A;  2VBW A;  3M9A A;  4A3K J;  1MMA A;  3D5L A;  3FM5 A;  1V5G A;  2DT5 A;  3DQV C;  3PIO F;  2UXN A;  3HEF A;  1Y39 A;  2FJ1 A;  1J0R A;  3OYE A;  1ZH5 A;  1KU3 A;  2ECB A;  1QVU A;  5CVJ A;  3G1M A;  3BR3 A;  2K9N A;  2ZNZ A;  3MD2 A;  3CCU I;  5LRR A;  1XSX A;  2ID3 A;  2QCO A;  5HNH A;  1YJW I;  1VQN I;  5FKO A;  4CCK A;  1OFC X;  3ABM H;  2CU7 A;  5L3F A;  5LGU A;  3N05 A;  2L54 A;  3COA C;  1KZH A;  1DU6 A;  2XDV A;  5DV5 A;  2XAU A;  3JRI A;  1OCR H;  1UEL B;  1HKQ A;  3BTI A;  4GGG A;  3VDX A;  1K78 A;  2JJ7 A;  2AXT C;  3E6C C;  3FXJ A;  1Z0X A;  1MBG A;  2LBF B;  2JK3 A;  2X51 A;  3HUG B;  1DPR A;  3QYE A;  2R7S A;  2P6S A;  3LSP A;  5TJJ A;  2R93 J;  3A2K A;  2M2E A;  3IRQ A;  2EIN H;  2ISZ A;  1MW7 A;  5LHI A;  3BR5 A;  2BHY A;  3IRR A;  2VC1 A;  1XMA A;  2QYO A;  1IJW C;  3DV8 A;  2HXO A;  4MQ9 F;  3GZ6 A;  3TDU C;  3T0Y A;  3OOP A;  1FYL A;  1J5Y A;  4Q47 A;  4IEJ A;  1J9I A;  2XGX A;  4IHW A;  4Q5S F;  3OS2 A;  3OYM A;  5F6F A;  5GP9 A;  3K4C A;  2FQ4 A;  5L3C A;  2O3F A;  2Z33 A;  1JXS A;  1V3F A;  2DJN A;  5J1Y A;  3PO3 J;  1D0Z A;  2E34 A;  3HL2 A;  2K02 A;  1F9N A;  2CFO A;  2F5D A;  1XMK A;  2X1C A;  3BC8 A;  3DPL C;  3HGG A;  2M0M A;  4ZZL A;  3LSR A;  1UMQ A;  2XHK A;  2W7N A;  4YG2 F;  1JJ6 C;  3SZP A; 
#chains in the Genus database with same CATH homology
 4CCM A;  1D1A A;  5KNL A;  2V9K A;  4PFP A;  3EUA A;  4AU7 A;  3DPU A;  2LH9 A;  3EUH C;  4ZDL A;  4XM3 A;  1EA3 A;  2VAS A;  4CSW A;  4KIT B;  1X1D A;  1GLN A;  1Y56 A;  4E7J A;  3OR1 C;  2VQG A;  1X1B A;  4RM3 A;  4LG3 A;  3MMY B;  3VWB A;  4ZDO A;  2JVG A;  1WJD A;  3K4J A;  2WY7 Q;  4LIV A;  4II2 A;  1JI8 A;  2LRE A;  4BXF A;  2DXI A;  2IGK A;  2R7U A;  2MD0 A;  4BQO A;  3UNG C;  4F93 B;  2O5R A;  1QU3 A;  3RTR A;  3GBG A;  1NG6 A;  1TZL A;  2XSJ C;  1BOB A;  2F4I A;  3K70 C;  1SAU A;  3OS1 A;  3LMM A;  4DBQ A;  3CES A;  4XKB A;  4E7S A;  3PFY A;  5HVQ C;  4OAZ A;  4H4K C;  2VB6 A;  3M8J A;  4BQQ A;  3CP8 A;  1E0E A;  3VSL A;  3FDY A;  3OYC A;  3S3O A;  4FET A;  4B3X A;  2KHM A;  1MMG A;  3OYG A;  4EAT A;  1IRX A;  2HPI A;  2E60 A;  4NNJ A;  2HU9 A;  1N78 A;  2R7V A;  1J09 A;  2M7B A;  2R7O A;  4CA0 A;  4YRV A;  2CS3 A;  4XNF A;  3VYS B;  1G59 A;  3C2H A;  1BR2 A;  3DEE A;  2W4S A;  4G6T B;  4RLF A;  3BLY A;  3MKY B;  3DTI A;  2HQA A;  1Y6I A;  4BDY A;  3OYF A;  3TL4 X;  3FHN A;  3OL4 A;  2MC4 A;  3RPU D;  3RQ4 A;  1T0F C;  4F92 B;  3S3N A;  2XC7 A;  4N4N B;  4JOM A;  2VIX A;  4ZC3 A;  3DTK A;  3FBI B;  4AVZ A;  4D1Q A;  1MMN A;  2X1D A;  2R7R A;  3ZGK A;  2VQL A;  1VZ0 A;  3H5N A;  1Z3Y A;  2LY1 A;  2IS1 A;  3CF2 A;  1X19 A;  3ZXS A;  1UG0 A;  3OIQ A;  4XQF A;  3K4L A;  4C2T A;  2BVM A;  3W2A A;  2CH0 A;  2MAB A;  2P0W A;  3HXL A;  2V26 A;  3EPZ A;  4Y33 A;  4DOZ A;  4BEH B;  3HG9 A;  5HLT A;  2LG4 A;  3H9Q A;  2OV7 A;  4BJ5 C;  3K6G A;  1DGW Y;  2HDW A;  4PJM A;  2VQC A;  4CCJ A;  5LFA A;  3HOT A;  4ANJ A;  3IAS 2;  1V5E A;  2DCE A;  3DU5 A;  1BR4 A;  2E1M C;  2UUZ A;  3D5S C;  2DT7 B;  4PJN A;  3PSI A;  3BG6 A;  4DIQ A;  3DWL E;  2A6T A;  3OS0 A;  3VYU B;  4YEL A;  4R79 A;  2BOL A;  4NC8 A;  4OWR B;  4XKC A;  3S3M A;  3NWT A;  1YE9 A;  4PK4 A;  4E4H A;  3V42 A;  1LKX A;  2Q2E B;  1X4P A;  2DT6 A;  2WBM A;  2V1N A;  3OOU A;  4PFO A;  4HSR A;  1V5F A;  1X4O A;  4BQN A;  2Z16 A;  1X1C A;  2V6E A;  4E7Z A;  3MKW B;  2L7K A;  4II3 A;  1P9Q C;  2VJJ A;  3PNT A;  2V7F A;  2VLA A;  2K9M A;  2QKM B;  4BE2 A;  2HVS A;  2UWM A;  2QKL B;  2WAF A;  3OMY A;  2ZSI B;  2UV1 A;  2A5W A;  3OIP A;  3SEZ A;  2RRE A;  3KX2 A;  2VXD A;  4HRI A;  2IGN A;  3FKJ A;  4P1W A;  2K9L A;  2M7A A;  2RNG A;  3PNY A;  3OYN A;  2K3P A;  1WJA A;  4GRI A;  2E5Z A;  4XOT A;  4ITV A;  3M1C A;  3H0D A;  3H5A A;  5CKT A;  4BEH A;  4F3Q A;  3PJR A;  3CZ6 A;  4RLQ A;  3SDB A;  2BVL A;  2LBF A;  3IAM 2;  2JSP A;  3HOS A;  2VKH A;  2JUG A;  4DGW B;  1YX5 A;  2AQE A;  2WAQ A;  3ZQQ A;  2DOA A;  2LRD A;  3SEQ A;  3ZCO A;  2WAD A;  4B48 A;  3CJR B;  3KYL A;  2LC2 A;  3HKZ A;  3VSK A;  2M4G A;  2CV0 A;  2W1O A;  2XF6 A;  4QPQ A;  1LFP A;  2R7T A;  4Y3O A;  4ZYA A;  3H5R A;  3OYI A;  2BW3 A;  3J7A Y;  4IKF A;  3VYR B;  4BGD A;  2LOO A;  1DP3 A;  2W00 A;  4HPQ A;  2KRC A;  3TBI A;  4JQF A;  2WAE A;  1HA8 A;  1OR7 C;  4IX7 A;  1R6R A;  1WJB A;  2I8D A;  2X6Y A;  4KIS A;  1Z7L A;  3FBN B;  1DGR M;  3F9K A;  2F5V A;  2IGM A;  4XLH A;  3RSN A;  3OYB A;  5KCM A;  4IZZ A;  2L9S A;  3DPT A;  4XOR A;  5LD2 C;  5JHF A;  5CPR B;  3OYA A;  1W36 C;  2JVH A;  1WJF A;  4DBR A;  3H35 A;  3OR2 C;  2KZV A;  2ZXI A;  1PJR A;  1QHG A;  2E5N A;  3K4K A;  2VQH A;  3LSG A;  4C2U A;  2Q1Z B;  3W2V A;  3RCO A;  4F91 B;  1BR1 A;  4FAS D;  2CW8 A;  2VKD A;  3PL8 A;  1S9H A;  3ONQ A;  2WB1 A;  4PSW A;  2CMP A;  2CUJ A;  1MNE A;  2XF5 A;  4F55 A;  2LYC A;  4DJA A;  2PMZ A;  1WFX A;  2Y0S A;  3K4N A;  2IS2 A;  1N75 A;  4NQW B;  3DTE A;  5CQG A;  3H9J A;  3PNV A;  4XLA A;  4B43 A;  3LSI A;  4C30 A;  4MLO A;  4B47 A;  2X85 A;  2KDO A;  3OYJ A;  3AL0 B;  3VYT B;  3BG7 A;  2DJI A;  4KT6 A;  2VJI A;  3EUK L;  3SZG A;  4BDZ A;  4OAY A;  3ZR8 X;  4PSX A;  4D9J A;  3LL7 A;  2FUG 2;  2GOM A;  3I9V 2;  2OC6 A;  2ZXH A;  2KRH A;  3L2U A;  2M4K A;  3G2B A;  4BE1 A;  1UAA A;  4XLC A;  4YEJ A;  4BJ6 C;  2NOJ B;  1QHH D;  4RMN A;  2L5Q A;  3SYT A;  1T95 A;  2WY8 Q;  3NWS A;  2VXZ A;  3HPG A;  3A1Y A;  2VL8 A;  2JA2 A;  4BE0 A;  4CZC A;  4E7K A;  2MYS A;  5HOO A;  4X0G A;  1PYV A;  3OY9 A;  3L2W A;  3TMO A;  2WA0 A;  1NG7 A;  2GOX B;  3E1S A;  3K70 D;  2R4G A;  3AKZ A;  4PJL A;  2IS4 A;  3BCA A;  3DKY A;  2VJ4 A;  3E0J B;  4BUP A;  2PJR B;  2W82 A;  1AA7 A;  3U21 A;  2CV2 A;  2CUZ A;  2KMU A;  2KL4 A;  4CCL A;  4J00 A;  5FRN A;  2ZFU A;  2HVQ A;  4KJZ A;  2R7X A;  2KPM A;  3H9G A;  3OYH A;  2CW7 A;  1ZEL A;  1X1A A;  2E1M B;  5FRO A;  3L2V A;  3D5R C;  1W36 D;  2L9N A;  4XKW A;  3UR3 C;  4U7B A;  4B44 A;  4BU2 A;  4XON A;  4XR6 A;  4BL0 B;  3OYL A;  3CP2 A;  4RM2 A;  1SFK A;  3CMM A;  1MMD A;  2R7Q A;  3DKX A;  3AL0 C;  5HNF A;  2Z1D A;  4IQ4 A;  4BS9 A;  3PSF A;  4XN0 A;  5TGT A;  4P5O A;  3K4M A;  3W2W A;  4J01 A;  2ZSH B;  4CUG A;  2ELJ A;  4CH7 A;  1D1B A;  1MND A;  3L2R A;  1FMV A;  2KQR A;  1TT0 A;  2Z2S B;  4QPO A;  4XMY A;  3OWT A;  2MFZ A;  1YX3 A;  2X6X A;  3ZRG A;  1ERD A;  4HNU A;  2VJ5 A;  3C2G A;  4HG2 A;  1LDK B;  1WJE A;  3AFH A;  4LIT A;  4XLF A;  4XN3 A;  4F52 A;  4XKV A;  4NUB A;  2M3A A;  1Z21 A;  4XL9 A;  1G8X A;  2PJR A;  5FRM A;  1FMW A;  1K6Y A;  4ZDP A;  3L2Q A;  5CQE A;  2HZD A;  1MMA A;  3D5L A;  3QOD A;  2L2O A;  1V5G A;  4HEA 2;  3DQV C;  4E7L A;  4E7H A;  3OL3 A;  2VPL A;  3OYE A;  2CV1 A;  3PUB A;  4E6K G;  1U0J A;  1Z3X A;  4PJJ A;  2LY2 A;  3A4C A;  1KON A;  3MKZ A;  3MD2 A;  5KHD A;  2XF7 A;  4NC7 A;  4IQJ A;  2HNH A;  1WJ5 A;  4BJT A;  4E7I A;  1N77 A;  5HNH A;  1OLT A;  3QYF A;  4ZJZ A;  2AQF A;  2F6C A;  3K10 A;  4CCK A;  3N05 A;  4CCN A;  1D0X A;  4N4O B;  4PUS A;  2XDV A;  3QOE A;  2XAU A;  1D1C A;  3IUO A;  1UEL B;  3S93 A;  3DLA A;  3VDX A;  4HST A;  2K5C A;  4CCO A;  3LSM A;  4XOP A;  3LSK A;  2LBF B;  4Y4R A;  2X51 A;  3HUG B;  3QYE A;  2V4J C;  4BAC A;  2R7S A;  2R7W A;  4ZTF A;  3I3L A;  3KEY A;  2HVR A;  3A2K A;  1D0Y A;  3CJQ B;  3IP4 B;  3HC7 A;  1MW7 A;  3W3C A;  2RQQ A;  3QYB A;  3K4B A;  3S8P A;  3OYK A;  2KLO A;  1WJC A;  3LFU A;  1DQU A;  2IS6 A;  2BW3 B;  4AYB A;  4HNT A;  3BCB A;  4C9Y A;  3S32 A;  3OS2 A;  1LVK A;  3OYM A;  3K4C A;  4U87 A;  2X1E A;  2IXS A;  2HPM A;  1D0Z A;  3LSH A;  2KP6 A;  3HL2 A;  3HPH A;  2CFO A;  4ZTJ A;  2OUM A;  2X1C A;  3DU6 A;  3BC8 A;  3DPL C;  2M0M A;  2IGO A;  2W7N A;  3OYD A;  2X6W A;  4XLE A;  4LIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...