2XT0A

Dehalogenase dppa from plesiocystis pacifica sir-i
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
297
structure length
297
Chain Sequence
MEFVRTPDDRFADLPDFPYAPHYLEGLPGFEGLRMHYVDEGPRDAEHTFLCLHGEPSWSFLYRKMLPVFTAAGGRVVAPDLFGFGRSDKPTDDAVYTFGFHRRSLLAFLDALQLERVTLVCQDWGGILGLTLPVDRPQLVDRLIVMNTALAVGLSPGKGFESWRDFVANSPDLDVGKLMQRAIPGITDAEVAAYDAPFPGPEFKAGVRRFPAIVPITPDMEGAEIGRQAMSFWSTQWSGPTFMAVGAQDPVLGPEVMGMLRQAIRGCPEPMIVEAGGHFVQEHGEPIARAALAAFGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cloning, Functional Expression, Biochemical Characterization, and Structural Analysis of a Haloalkane Dehalogenase from Plesiocystis Pacifica Sir-1.
pubmed doi rcsb
source organism Plesiocystis pacifica
molecule tags Hydrolase
molecule keywords HALOALKANE DEHALOGENASE
total genus 94
structure length 297
sequence length 297
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2010-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2xt0A00
4JUIA 5EI5A 3I2IA 1E5TA 3GBSA 1HQDA 4MWTA 1QFMA 3WJ2A 4WCVA 6YASA 2Z5GA 4YASA 4JNCA 1F6WA 2ZSHA 4G4JA 4PQEA 1JT2A 4Y2PA 2WSLA 4DTCA 2GBCA 4OYYA 4Y2QA 5CT5A 2DSNA 4QA9A 1O6GA 2ES4A 2Y6VA 4I19A 3VJKA 4K5QA 2G4LA 4Q34A 1QTIA 2RONA 3WWCA 4TVKA 5AICA 5AJHA 4UFOA 4ARAA 5KWIA 1CUEA 1AQLA 2HA6A 2BJHA 2CKMA 1FJ2A 1VZ3A 3DQZA 5HQ3B 2OGTA 5LZ4A 4HXGA 2Y1KA 3ILSA 1R1DA 1XZGA 1UK9A 3H0CA 4AN1A 2HFJA 3WZMA 3FAKA 4UBIA 3QM1A 1BU8A 5CT4A 1QIDA 2JGEA 3L1JA 1W6RA 3M3DA 5AKXA 1UOPA 5FRDA 4A16A 2Z3ZA 2O7VA 3FLEA 4LYDA 2RGUA 5LP1A 3FVTA 2CEKA 1P0MA 2OGZA 1BN7A 1XROA 2GZSA 1QIHA 1C7JA 1ZD2P 2E3JA 3N2ZB 4X94A 5ALKA 3KOOA 1ZI8A 1GQSA 3D2CA 2FJPA 1MX1A 5C8VA 3PF8A 2PU7A 4BP9A 3YASA 1E8MA 4KACA 3TJMA 3G9XA 1XQVA 1XZJA 1HPLA 3DEAA 5K3CA 4BB0A 1G4HA 3IDAA 5ALJA 1KU6A 5DNWA 1AMNA 4B9AA 1F8UA 5K3FB 5JD6A 4BYMA 4X91A 2DR0A 3PFBA 3AFIA 4QLOA 3WK8A 1E89A 3RM3A 3V1LA 2QMQA 4OUKX 2GBIA 3AIMA 3W05A 1HDEA 4EB0A 1XKLA 3IB3A 1VA5A 2CUTA 2C4HA 4LHEA 2HA0A 1PV1A 1UKAA 1CQWA 2VJDA 4FWBA 1L7QA 3QH4A 3BE8A 1TAHA 5ALLA 1YS2X 5T4EA 1JU3A 4MQMA 5HK8A 4HS9A 1ETHA 5CH8A 1QO9A 3C5WP 5A6VA 4XWGA 5J3JA 3SWWA 1UOOA 3H2JA 1CUCA 4UHCA 5ALIA 4BE9A 3O4GA 1YS1X 3O9VA 5A7FA 5LIPA 2D0DA 4EZIA 4ETWA 3C6YA 4CIBA 3T4UA 4FHZA 4UHDA 2YYSA 5AK3A 1ZICA 2WIFA 1LPSA 3JWEA 2XB6A 4DNPA 1PFQA 2DQYA 5AM5A 4KRXA 1U8EA 2XMSA 1EK2A 4L0CA 5AM1A 4DGQA 4PNZA 1X2EA 3I2FA 4X6XA 2WFMA 3O0DA 3NOXA 1YAJA 3WKDA 1GPLA 1LGYA 1K5PA 4BCDA 4UBOA 1WHSA 1ZD4A 2Y2VA 1AURA 3D2BA 3IUNA 4EBBA 5HK9A 4AMZA 4IHAA 5CH5A 4U2GA 4B9EA 4BVJA 4TPKA 2ZYHA 5HF5A 1IUNA 4INZA 2Z8ZA 3GUUA 4WFJA 5AM2A 4X6YA 1TIBA 4G5XA 3PF9A 2XUDA 3DLTA 3ZLUA 1VA4A 3D2AA 3LS2A 4X71A 1XQYA 5IVKA 4HXEB 4K6GA 3VVLA 3AINA 3CCCA 3W06A 3OURA 3C5VA 3MUNA 2PBLA 4Y2UA 4H0CA 5AKKA 5K3BA 4BC1A 5ISMA 2W22A 4Y2SA 3WIBA 3W04A 5SYNA 2WIKA 3FSGA 4E11A 4FNMA 5IH7A 3WLAA 2JGLA 5JATA 2HRRA 2VAXA 1ORVA 4C6HA 4FMPA 5FV4A 4LKOA 2XMZA 4FBLA 4C87A 5FXMA 2ZYRA 4L72A 3QVMA 2Y2UA 4GEGA 2QZPA 1CUWA 2JGKA 3DJYA 4GWLA 5E4JA 4C88A 4HZGA 5JADA 3ANTA 4MWSA 1DTEA 1GPNA 1XKTA 5FOQA 1DX4A 5D7BA 1BCRA 4W1QA 2XLCA 3R3XA 1UOQA 3MGAA 4J0HA 4ZI5A 4Q1VA 1CIJA 1XZLA 1YCDA 2GYVA 3PDCA 2D5LA 4H7EA 1ZIXA 2LIPA 1E8NA 2WG0A 5DJ5A 4P08A 5CXUA 2WIJA 4H7FA 3A70A 1J07A 1CV2A 1DT5A 1TKRA 4FLEA 5CBKA 4X00A 4X85A 5E4YA 1QIEA 1XZMA 3H2GA 4AN0A 3V48A 3UMJA 4C4YA 1BS9A 1R88A 1IUPA 1CFJA 2OCLA 1ZGBA 3PFCA 4G4IA 2WHPB 3ZWQA 5AM3A 2X8BA 4KEAA 1K63A 3ZI7A 1LPBB 2JGJA 4F60A 3Q8WA 2ZJ6A 3FYUA 3I6ZA 2OAGA 3LCRA 2HA3A 2O7RA 1CUVA 1BRTA 2XQGA 2YH2A 1GPKA 3R3WA 4H77A 4OYLA 3OTQA 1X2BA 2IIVA 4EHBA 3KWFA 1MO2A 2Q0XA 2H7CA 2VTVA 1LBTA 1A8UA 1ACJA 3P2MA 3RK4A 2QR5A 3H1BA 3Q0TA 3WYDA 5AH0A 2PPLA 3ED1A 2XQIA 3B12A 1SCQA 3F67A 4QDXA 2DHEA 4J0CA 1EX9A 4KJXA 4ZREA 2FX5A 2XUFA 1XRRA 5ALMA 1DQZA 1H22A 3IVMA 2WFLA 3EF3A 4Y2XA 1CLEA 1XRMA 4OSEA 3SK0A 3H2KA 1XRNA 4B0OA 3WL5A 4N8DA 1N1MA 2C0PA 3G9TA 1JJBA 5AKGA 1R9NA 1E8DA 1QE3A 3U0VA 3X3HA 4B81A 1BEZA 1OCEA 2OCGA 1TQHA 2QS9A 1ZOIA 4DM7A 3WKBA 1W76A 3E1GA 3K9BA 4RE6A 5CT8A 5E2IA 2AJDA 5ALSA 1CUHA 3FLBA 3BDIA 1ORWA 1Y7HA 4BZWA 4JYMA 2DHDA 5HCUA 1FSSA 1LPAB 4FFVA 1XZCA 1RWQA 4FKBA 2IX9A 1MAHA 5JAHA 5DNUA 3RLIA 4BATA 4DNQA 1Q0RA 2PSDA 2YXPX 4IO0A 4AQDA 1GT6A 4CCYA 5DLPA 5C8XA 3IUQA 1A88A 3DL7A 2WJ6A 4LIPD 2GBGA 3HLKA 3EQ9A 4KAFA 3R3UA 4U2EA 1EXWA 4X3CA 3QMVA 4BCCA 3G7NA 4MXDA 2WUDA 2BCEA 2DCMA 4B0PA 1W75A 3ESDA 5FLKA 3CCBA 1BCSA 2GYUA 2XMQA 3WK4A 1EK1A 2C5GA 5KWJA 3STTA 2RAUA 2JEZA 3HYSA 3BDVA 3KSRA 5AKYA 4UPDA 1EB8A 3DYVA 4B6GA 4BAGA 4LXGA 1MTZA 1DWPA 5IKXA 3R3YA 4C4XA 3ZV7A 3VDXA 5ALWA 3AZQA 1C4XA 1LPNA 4V2IA 5IVIA 4K6HA 2RIPA 3WK9A 4GXNA 1AC5A 2JF0A 3PI6A 3I2HA 1CPYA 2UZ0A 1QO7A 2VATA 3JW8A 1HBJA 2OQVA 5AIBA 3PUHA 1JU4A 3R41A 3SX4A 2WG1A 4QE3A 4QNNA 1WHTA 4MQLA 2O2HA 2XE4A 4KE8A 3UUFA 5JAPA 2CBGA 1ZJ4A 2WUGA 4G4GA 1CUBA 2VJAA 2PM8A 5FKJA 4A23A 2R11A 4CIAA 2O2IA 1HKHA 1MN6A 1CUZA 2BGRA 4Y2VA 1Q83A 4BBZA 4Q3OA 4O08A 1IMJA 4FDMA 4U2DA 2G5PA 3DOHA 4JYPA 5I7UA 3QMMA 3D0KA 4N8SA 4CG1A 3DOIA 1XRLA 1YR2A 3G0GA 5LKAA 1UFOA 1XFDA 4NMWA 3I2JA 4EY4A 5ALHA 2JIDA 3NGMA 2ORYA 3PUIA 1L7RA 4WFIA 5A71A 3ICWA 1VJ5A 5ALNA 2QVBA 1QIJA 1JMYA 3FCYA 3I2GA 5EHQA 5I8PA 1QTRA 4D9JA 3C70A 1JJFA 4MJ3A 1QJ4A 4Y9SA 3WWOA 3ESBA 4LYEA 3H1AA 5LZ2A 4WDRA 4ZV9A 2XUAA 3QYJA 3H17A 2HADA 4W1RA 1ZJ5A 3C87A 4QDOA 2J3QA 1B6GA 5ESRA 3HI4A 4I4CA 4UHEA 2HL6A 1HL7A 4KR0A 3QPCA 3KDAA 2IITA 1C7IA 1DQYA 2HA5A 2V98A 4FFWA 4OCZA 1FFCA 3DNMA 3WMRA 1WB5A 3WA7A 3IA2A 3MVEA 1N5RA 1MX9A 4MEAA 3AUKA 4EA6A 5ALEA 1EA5A 3WWEA 2XUGA 4BRZA 2AJ8A 5CURA 4KRYA 4CG2A 5C7YA 2PX6A 4ZV7A 5DTJA 3FYUB 3TEJA 3BIXA 4OPMA 2QM0A 4WY5A 1ZIYA 4AZ3A 3D3NA 4H18A 3R0VA 1ZGCA 1BN6A 4TGLA 1A7UA 2HA4A 2XUOA 2YASA 2WUFA 5CW2A 1YASA 2WIGA 1UKCA 2DQZA 3G02A 4G8CA 2BUCA 4WJLA 2JBWA 4OU4A 5AK5A 4QEKA 4M0FA 4XVCA 5DYTA 4IH4A 3BF8A 5HKAA 5ALVA 4GI1A 2ROQA 4J0GA 4UFPA 3B5EA 1AKNA 4B82A 3HJUA 5A2GA 1GKLA 2WFLB 1H2ZA 1WPXA 2EDAA 4FOLA 1XLUA 1W4LA 1HLGA 3UUEA 4B84A 5EIEA 5ALGA 4DYHA 1H2XA 5BV7A 3FBWA 1N5MA 1OILA 3C6BA 4WY8A 3FCXA 4UHHA 3STYA 3WKAA 3KD2A 2VAVA 2HDWA 3S8YA 4X97A 1M33A 1LBSA 4ZWNA 3DS8A 4BZZA 3WIOA 1QIMA 2V96A 4NS4A 3ESAA 5HKBA 2VSQA 3LIIA 3AIKA 5D3ZA 4M0EA 1TCCA 5FDFA 3FYTA 4NVRA 1XZDA 2OLEA 4BCBA 2WJ3A 4H35A 1A8SA 1CEXA 2QUBA 4X95A 2VA9A 5JYCA 5AK6A 1VKHA 2XI4A 3HC7A 3K2IA 4UHBA 5EGNA 4K2AA 1ACLA 5AI8A 3QPAA 3WJ1A 2HA2A 5AI9A 3O9MA 4BE4A 4YK7A 1JI3A 2H1IA 2B61A 4L9AA 4W9RA 3VJMA 2B20A 3ZLVA 4PSCA 4DSAA 2G63A 3T52A 2H9YA 4BP8A 3F97A 4KAJA 4KYVA 1QFSA 2RHTA 4S0XA 4A5SA 3MUOA 1XZEA 4W1SA 1G5FA 4RPCA 5AI0A 2BFNA 4UBMA 1CUIA 1XZIA 1QLWA 5FUMA 3LP5A 4DMFA 1EDBA 4RGYA 2ZSIA 2XUIA 3F9CA 3DD5A 2ECFA 1ODTC 1VLQA 5AP9A 2VF2A 4J7AA 4QZVA 3GZJA 2I3ZA 5ALUA 1LPMA 1F0PA 1UK7A 2HM7A 2HA7A 4X93A 1YA8A 4ZRDA 4OD0A 2BUAA 1VE7A 2XQKA 3EQ8A 3E3AA 3WL8A 2HU8A 2XQFA 3A2MA 1K4YA 1UK6A 1RP1A 4GDMA 3FOBA 2PSJA 1LZKA 3G8YA 4HXFB 1E66A 1MJ5A 3B3QA 1D07A 4K6KA 3M83A 2XUKA 1DU4A 1SCIA 5AKIA 4QDTA 1JKMA 3IULA 3WKCA 2AXEA 1XLVA 4E15A 3G0IA 3AIOA 3L1IA 4P9NA 1EVQA 4J0IA 5JZSA 2GBFA 5K3EA 1CUSA 4KE9A 1CUAA 1FFAA 5CRIA 4IH1A 1JFRA 3C8HA 5DTIA 4FLMA 2WKWA 1B41A 3DKKA 2PSFA 1CVLA 3FSGD 3G9UA 3H19A 4UHFA 3C6ZA 4N8EA 1XLWA 3W2TA 5LKRA 2QUAA 5AKZA 1LLFA 5JALA 5AIAA 2WLSA 4G9EA 5ALOA 1SC9A 3D5EA 3FYUC 3WL6A 2C7BA 2WUEA 1T4MA 5IVDA 2Y6UA 3STXA 2PL5A 4UBNA 4AO6A 3EBLA 5EHNA 2WHQA 2H7XA 2HU5A 2H7YA 4J0KA 2Z8XA 5CTAA 5JAUA 2OQIA 4GW3A 1T2NA 4XJVA 4HRYA 1UZAA 1R50A 2V9ZA 4FNGA 3WK7A 1LZLA 3WWDA 3LIPA 1GGVA 5LLSA 5ALXA 2PVSA 1XQXA 2AJLI 4IQ4A 3H2HA 4B7ZA 3R3VA 5BWCA 3C43A 3D7RA 1QIGA 3C45A 3IIIA 1J1IA 3C6XA 1K8QA 3OG9A 2ACEA 3JYHA 4HRXA 2AJCA 2XUQA 1TCAA 4Q82A 3IUMA 2FUKA 2X76A 1MPXA 3CN7A 4ZGBA 3WL7A 3STVA 1GQRA 2R8BA 3HZOA 5T4FA 3F8SA 4BDSA 4LXHA 3CN9A 5DNVA 4YX9A 2QJWA 4E46A 5K3FA 2WHPA 4BTLA 1KU0A 1Y37A 1CRLA 4ITVA 3GA7A 4PW0A 4EY6A 5ALQA 1QOZA 4QLAA 3OM8A 1IVYA 5FPPA 3WI7A 3WK5A 5DWDA 1USWA 5AI5A 5FPQA 1FFEA 5K3AA 2PSHA 3O95A 4PF1A 1UT6A 5AOCA 7YASA 1EHYA 1TK3A 4UFNA 3WA6A 1XQWA 1J2EA 4H7KA 3GFFA 4FBMA 4CFSA 4L3WA 4Y2JA 4AXBA 2GZRA 1R9MA 2QJRA 4G1FA 1XZFA 1CUXA 1VXOA 3LLCA 5HFAA 4Y7DA 5LZ7A 2DFPA 2PKYX 3IURA 5AM0A 4BDTA 2C5FA 5CT9A 5AOAA 5AKLA 1KEZA 3A2LA 1QGED 2XMCA 3W9BA 2QRUA 5EIHA 3STWA 5CH3A 5KBYA 1ZI6A 4BVLA 5K3DA 1P0QA 1QZ3A 2OPHA 4PO3X 1H2YA 1XZHA 5AK4A 4LXIA 4MYDA 5JIBA 3FNBA 4HVTA 1RYYA 4BRSA 4CI9A 3R3ZA 2RHWA 3F98A 3WWPA 3VXKA 3AZOA 2PUHA 1G42A 2CJPA 5HFNA 4BC0A 1CUJA 1R3DA 2CMFA 5CXXA 4BVKA 4DNOA 1BE0A 1N8SA 4RE5A 5LZ9A 1IZ7A 5I9IA 1O6FA 3BL8A 1VZ2A 2J3DA 2QXTA 3D4LA 3W9UA 3IBTA 1UXOA 2WIDA 3WZLA 2OG1A 1XZBA 1U4NA 5SYMA 3I1YA 4F5ZA 5ALRA 4KAAA 4CCYB 2QTBA 5LZ5A 2BGNA 5C8ZA 3H18A 3ZPXA 2XUJA 1K6EA 5JAOA 1MT3A 3VISA 3A2NA 1X70A 3HACA 4Q3LA 4C01A 1EI9A 3HRHA 1GZ7A 1WM1A 2WG2A 1JMKC 3G0BA 4B80A 1WPRA 5AO9A 1AUOA 4EUSA 3O4HA 2V97A 3BJRA 3DYIA 1H23A 5AI6A 1ODSA 5C81A 3V9AA 5IVHA 1Q84A 3KWJA 1H2WA 3ANSA 3QZUA 4AB1A 4H7IA 1CR6A 4OU5A 1NU8A 3CXUA 1FFDA 1AZWA 2ACKA 4DMKA 4JEIA 3H04A 3I2KA 1SFRA 1YB6A 5A7HA 1F0NA 4HAIA 2VT6A 3RKSA 1A8QA 2WTNA 3STUA 2XMRA 2XT0A 2K2QB 4QWWA 2DHCA 3V1MA 1DWOA 3O4IA 2WILA 2I03A 3VVMA 3N0TA 1WCYA 4X92A 1XRPA 4AX4A 4EY7A 1BEEA 1EDDA 2WFZA 5F4ZA 3IUJA 4DMHA 4H7DA 3FVRA 2B4KA 1L7AA 3FLAA 5AKEA 3WQHA 4J0JA 1CUUA 2XUPA 1LPPA 4XX1A 4I3FA 4ROTA 4Y2TA 4PSUA 1EVEA 2XMBA 1QIFA 2RI6A 5ALDA 4WDQA 4G8DA 3R40A 4GLBA 3AJAA 3DCNA 3OOSA 2OXEA 2P8SA 5ALYA 2VT7A 3G0DA 2XLBA 4X90A 3OC0A 3ICVA 5HF6A 5KREA 5T4BA 2XQJA 5E4TA 4UUQA 4KE7A 2BUBA 1LNSA 2JGIA 2OGSA 1UKBA 1U2EA 2XMDA 1QIIA 2J4FA 3NWOA 1CUFA 4EY8A 4YPVA 3M81A 4OB8A 4FTWA 3F96A 1MNAA 3A6ZA 4GBGA 4MEBA 2XMGA 3K6KA 4XIIA 3WK6A 4AMYA 5H3HA 2XUHA 4OB7A 5CT6A 3GROA 4F21A 3TGLA 4PSDA 2QKYA 5HQ3A 2X5XA 2G5TA 4DNFA 1SCKA 2EDCA 4C4ZA 1DWQA 4AO8A 5AHXA 2I78A 3V1KA 4BAUA 2VJBA 4DSZA 1YAHA 4P93A 3VJLA 3DKRA 3QPDA 3ESCA 1GKKA 3E4DA 1CUGA 3HXKA 1S8OA 3QMWA 5JD4A 4BAZA 4DMCA 1P0PA 3G0CA 3HSSA 3E0XA 1ZI9A 4J03A 4AO7A 2WJ4A 4IH9A 2QOEA 2W6CX 5ALPA 1EH5A 1TRHA 3HEAA 4M0MA 1MX5A 2J4CA 2C0QA 1CUYA 2VJCA 3I1IA 3O4JA 1DT3A 1UWCA 1CQZA 5ALTA 3TRDA 3VKFA 2C58A 3I6YA 2ZJ7A 1J06A 1EINA 3WYNA 1DX6A 4NZZA 3PICA 4GECA 3RARA 2GYWA 1VOTA 4UBLA 3I28A 2WTMA 4N5HX 2QXUA 1NU6A 3KXPA 4C89A 3BWXA 1IUOA 5T4HA 1W1IA 5BWBA 1LPOA 2JGFA 1VE6A 2ONCA 5BOVA 4B85A 2WHRA 2OCIA 2I3DA 4DLNA 1BROA 4WFKA 5JD5A 5A62A 1E3QA 3QITA 4U2CA 3G9ZA 5D6OA 2QT9A 3I6MA 4Q3KA 4EY5A 1YSCA 3QBJA 4GHWA 1ODCA 4ZXFA 4X7BA 3DL4A 4J3JA 5LZ8A 4QDUA 2ZVDA 4BTVA 3FWHA 1UK8A 2HFKA 3BXPA 1ISPA 1CUDA 1FFBA 1NX9A 2HRQA 4CCWA 5DYYA 5EHXA 3BJMA 3BIWA 2B9VA 4J0DA 1I6WA 1XRQA 5HF9A 4RNCA 1IZ8A 4ARBA 2VQ6A 4PV7A 4UBKA 4QWMA 1SOMA 4P92A 5HF8A 5AOBA 4E14A 1JJIA 4Y2RA 5AKHA 4HTAA 1WOMA 1Y7IA 4U2FA 5A7GA 1G66A 4QDZA 5EHZA 1GXSA 5AKJA 2EEPA 2HIHA 2PUJA 2WU3A 1QIKA 3V1NA 5EFZA 4Q05A 1U65A 1AX9A 5HZGA 5JARA 1YB7A 3H2IA 2OCKA 3GELA 1VXRA 5ALZA 2PU5A 1AGYA 3HABA 2VEOA 4G9GA 2BAGA 3AILA 5CMLA 3M82A 2HU7A 5JASA 4KE6A 3DDUA 5D3KA 3PE6A 1THGA 2OAEA 4CG3A 5K5EA 5EIAA 1MNQA 1YA4A 5AI4A 2NW6A 1WB6A 2CB9A 2CZQA 4DIUA 2JGMA 2PSEA 3S2ZA 2BKLA 4MYSA 4N5IX 4FLFA 1THTA 2HHAA 5AM4A 3SC2A 3L1HA 5FP0A 3U1TA 4Z49A 4G8BA 2ZJFA 2JEYA 5JZ9A 4X6UA 1EDEA 3NUZA 1QONA 1MAAA 3EIOA 3AZPA 5YASA 3C8DA 3OPMA 1MU0A 2WQZA 1EB9A 4W63A 4B83A 1OXMA 1DINA 4H7JA 2Z3WA 2WU4A 3ZLTA 2ZYSA 4H7HA 1ZD3A 2XDWA 1Q0ZA 2WM2A 4JH0A 1XZKA 2AJBA 1W52X 4U2BA 5JANA 5LYYA 1XZAA 5DYWA 2ZYIA 4AZ0A 1P0IA 4F0JA 5JZBA 5ALFA 2O2GA 1PJAA 1TCBA 1WB4A 3WKEA 3EQ7A 4OB6A 1Z68A 3BF7A 1ZD5A 3D59A 4UBJA 2FJ0A 4Y2YA 4W1PA 1R4ZA
chains in the Genus database with same CATH superfamily
1UQTA 4PQYA 1PK8A 2D2FA 2V55B 1YJCA 3LRPA 1J5EB 4LDZA 3CA8A 1X6VA 2VVTA 4CR6A 2O0HA 3M6AA 4WCVA 2RDMA 4JELA 5DISB 3EMBA 3DO8A 1YQEA 2GB4A 2Z5GA 4YASA 5T57A 1RI4A 4JNCA 3ZNPA 1VCOA 3BGVA 4NDNE 5E6RB 2BHTA 3IJPA 4MYUA 2ZSHA 2GR9A 2XUZA 4LJ7A 4PAWA 1JHZA 1GPUA 4UXHA 2B69A 1V8DA 1QH1A 2IPMA 2DG2A 1YOBA 5A0VA 3U0BA 4KXQA 1M2VA 3G88A 3O21A 1Q5PA 1O94D 3JQPA 1XLTA 4JD5A 4KIWA 3OPYB 4DWJA 3QKWA 4R9VA 4N9QA 3SYTA 5BUSA 3PDIB 3T7TA 3OKAA 3H5OA 4UQOA 1EE9A 4OQPA 1O6GA 4K5QA 2C8VA 2FZLA 4Q34A 3SKXA 1QTIA 3PJRA 2O4UX 3B36A 1USIA 2AC2A 3F1LA 4AKTA 3E2PA 2C2KA 3ONEA 5KWIA 3MCUA 1ENZA 3OU6A 3R0XA 4GNKA 3MJHA 1I5OA 4BNHA 1ICEA 4N39A 1GQYA 2BCGY 2RHJA 4TV9B 2F62A 3QU5A 4KO3S 4ESOA 3GLFB 4PVDA 7ABPA 3M1AA 3DQZA 5DM4A 5HQ3B 2YJ3A 3NP7A 3ZX4A 3E23A 2NADA 3B1FA 2X3FA 1Q77A 1Z47A 3DWGA 5F1KA 3ILSA 3DQPA 1FP1D 4J0FA 4S1VA 1VMAA 1XZGA 4DR7B 1O9BA 2DFNA 2FSPA 4QAJA 4WV3A 2ERYA 1XCBA 3H0CA 1QANA 1QS0B 3CJQA 2AI1A 4AN1A 5BW4A 3A1WA 4IRMA 3UMVA 2P30A 3HFJA 1PJ2A 4W9MC 2IF0A 2OZKA 5EE0A 4RA9A 4PNEA 1QPBA 1BU8A 4NL4H 4UTZA 1IY0A 1I5EA 1JP7A 2D1SA 4PYNA 1LF5A 1SBCA 2B8NA 2L18A 4OHBA 5CT4A 5ER6A 3ZGYA 1UOPA 5FRDA 3KHSA 3PP8A 5K01A 2FUEA 1J20A 1T1RA 4UZFA 3E9RA 2XZOA 2Z3ZA 3VAAA 1GCUA 1H1TA 1TQ6A 1T6NA 5LIRA 3R7SA 3BCUA 1BN7A 4LKRA 3R8CA 3WTCA 3K0FA 3NORA 1Z56C 3QWIA 2C4TA 3PNBA 4KPUB 1YVEI 2A5YB 2HCJB 2HMWA 2XWBF 1XXHB 1Y3IA 4FT2A 1TEVA 4JIGA 4B3TB 1H0KA 1AUPA 4GQAA 2DGDA 1LDNA 2ZWIA 3QIAA 3C8ZA 2C94A 3H6HA 2HRDA 3OZFA 4K8OA 2LD4A 3OTHA 5FBWB 4Q00A 5K0EA 5E7IA 5FNZA 3MIZA 2C9OA 2YYZA 3GK3A 2B9EA 2J3KA 3L02A 1U8CB 2W8BA 2XJ9A 3YASA 2QLFA 4QSHA 3D31A 1B6RA 3EF1A 4EA7A 1XCOA 4FZ3A 1RCFA 1P3Y1 3CW2A 4RTNA 2H1OA 5BSWA 4F9GA 3U3OA 1FQWA 3S8EA 2H1HA 1K27A 2HAEA 3RVMA 1P1RA 4ND5A 4E7OA 1GR0A 3CVYA 4Z4IA 1ISJA 3E8XA 3K0AA 5BYJA 2XDQA 1G8JA 4BB0A 1FYVA 4ABYA 3UJPA 4HNQA 2Z4SA 4F71A 5ALJA 2H4YA 3KJXA 4KKVA 2Y71A 1OAKA 1XYGA 3DDSA 3NHYA 1GG5A 1KU6A 1N3YA 2HMSA 3NBXX 5HG0A 5CDFA 1MQAA 3ZVRA 1E2NA 1UJNA 3DHWC 5DNWA 4B9AA 2IPXA 1TECE 1MO3A 4TT3A 3FW1A 4EOGA 5DMHA 2DR0A 3I4CA 4O59O 3VX4A 2PNFA 3BWVA 1E89A 4UHBA 3WK8A 3V1LA 4RM3A 5BVHA 5J4LA 4O2BF 2QMQA 4RBNA 4U0JA 3RIMA 1GPH1 2X3YA 2FSUA 3EOZA 2XBMA 2NUPA 5LA6A 4KFSA 4QTXA 4AF8A 4EB0A 1H9CA 1QZZA 4E70A 3HKEA 1JL3A 4JL8A 1H8HA 1VA5A 1XDZA 2EYUA 2JJ2A 4ZIRA 2RGRA 2HA0A 1M1UA 2NXEA 1PV1A 4LGCA 1RWWA 3AR2A 4QJ3A 1G19A 3KHUA 4P4GA 1PDVA 4NYMQ 2CZGA 5KNLA 1Y5NA 2VJDA 1PD1A 1FP2A 3NZEA 4ZVKA 4ZCPA 1RQXA 2R1VB 5LP6F 1RWNA 3QH4A 1EFVB 3BE8A 1R0LA 4N3AA 4AWXA 4HLUA 1M2GA 5E3IA 4PC2A 3GA5A 2JGDA 5ALLA 5A9TA 3ZHUA 1K8ZB 4YRLA 3R44A 3Q10A 3EQ6A 4ZQFA 2R8PA 3JQBC 4F86A 1QU2A 1G5TA 1X7XB 1XJCA 4NFSA 2F1JA 2JAXA 3CRQA 3E22B 3T3PB 2JHCA 4F5EA 2C0CA 4JI5B 3A0UA 1SCDA 3WB2A 1OIWA 2HHLA 4PQGA 4ZT3A 4ZYZA 1QH8B 4C04A 1BKSB 1UXGA 4NK4A 4OP3A 4XOUA 2COEA 5E2AA 3T35A 5KI6A 1L3CA 1U7TA 2DWQA 2QQGA 3IUYA 3OEHA 4PNPA 4LJRA 5DT9A 1HMPA 3H2JA 4W7IA 1CUCA 3P9QA 1D5WA 3SS8A 5FLXA 3ZBTA 4AY5A 1MV8A 4ZEWA 5A7FA 2E4XA 1J9GA 4L75A 4EZIA 4XSHA 3C6YA 3BEDA 4CIBA 4FHZA 1H4VB 2C9MA 3ADOA 4MRPA 4W8HA 2QYOA 2DKFA 2PWAA 2QRZA 3TLXA 3LBYA 3E05A 1DBVO 1U0FA 1U2TA 1LPSA 1OFVA 1QPZA 3OA2A 4CIXA 1D9XA 2XB6A 1WX1A 4CMHA 3CVWA 2Q6TA 2AUMA 1YIOA 1EBUA 4BNTA 1XU4A 1C1HA 5KNDD 4HNGA 1WDTA 1Z5PA 1TVKA 1RJEA 2WZQA 4I1UA 2D0OB 3PEVA 1NRXA 2VNKA 3DMFA 4DSOA 2XMSA 3H3XA 1EK2A 4B48A 2XDAA 3Q1LA 4HADA 1D04A 1U80A 5EXDA 2IH2A 4IQ0A 5JNVA 3I2FA 2OV2A 1I4DD 2RC6A 2OXFA 3L8YA 1NBME 3ZEIA 3U1VA 2NNLD 5AJVB 4YAKA 5ES4B 3LWBA 4URZR 5EJ9A 4OA8A 3NOXA 5JH7A 3WKDA 1TEXA 2P2YA 5GIOE 5K0SA 1DRUA 1LGYA 1F2TB 1K5PA 1VGVA 3O84A 4A0HA 2GMWA 4FGSA 3BDAA 3BXHA 3VR6H 1QHYA 1NF8A 2H2AA 3TSZA 3ORFA 4RHUA 1F48A 2GFQA 1PQPA 2GDJA 4JJAA 2OBBA 3I3SR 3ADCA 1D2AA 1JSXA 3UXMA 3OESA 4MZXA 5LLTA 2EFHB 3ORQA 2O2EA 4ESEA 2FMUA 3Q3GE 1T36A 1TA0A 2Q1WA 3SDZA 3WO0A 2JIQA 3H65A 3LC2O 4PZEA 4MRMA 1LDGA 1NQXA 3KRTA 4PCAA 1UKZA 3CRMA 5CH5A 1U2QA 3L0YA 4MB2A 1RAEA 2PA3A 4BVJA 2ZUDA 3EZFA 1YE8A 2ZYAA 1NAHA 4RH1A 5HF5A 2OT3B 4GLOA 3LQ1A 4YAEA 5EPEA 4BWYA 3CC8A 3HKCA 4INZA 3GUUA 2FW8A 4OGGA 4K6FA 4G2NA 4WFJA 3TKAA 3RROA 3ZH9B 3IL2A 2A84A 3B5JA 4LVCA 4P35A 4HUTA 1PG0A 4L74A 3LSTA 3WDMA 2B35A 1IVNA 3TB6A 4F56A 2C61A 3DLTA 2E2WA 3KQMA 2AOTA 2P35A 3THWA 4ZCLA 3WAKA 4QU8A 3HBNA 1PKEA 3ZCQA 2P6PA 3E18A 4EAQA 1VA4A 3D2AA 1KI2A 3K1AB 4FI3C 4ROSA 4X71A 4ETIA 1S8NA 5A4JA 3JYPA 3EAGA 2OMKA 3T5GA 4K6GA 4EDFA 5K6AA 3PD0A 3QPBA 3VVLA 1L7DA 3AINA 3BIOA 1I4WA 2JI8A 3AB8A 3C5VA 4JJKA 2JD1A 2O06A 3LHSA 2PMWB 2PV7A 1NVGA 3O3NB 3RRJA 5K3BA 3SM9A 4QUHA 3JYQA 1WOYA 3LUDA 3PGKA 4Y2SA 3NP9A 2OC4A 2OBYA 3U7EB 1RWPA 1U9ZA 2YWFA 4NEHB 4RF4A 1L8AA 1EFTA 3ZU5A 1G64A 1GUDA 4LJ4A 3MEQA 2PX2A 2VDWA 2W2VA 5JBQA 2Q3CA 1FVFA 1MIOB 1QORA 3CF4G 1PLLA 4R41A 4EFKA 4G37A 4GYYA 3ZHOA 2HIMA 3QVOA 3WGOA 2AB0A 1XDDA 4QQKA 5DLYA 1NXSA 4Q4CA 2JGLA 4V0NA 2Q3DA 4P4SB 3H16A 5JATA 1OFUX 3MRXA 2CFSA 3E82A 1IBMB 2AKAB 5DIFA 1IJEA 1GTMA 2ZRGA 2O8FB 3AR4A 4OO3A 5IJWA 4D02A 1E1YA 3AV3A 4R1QA 1II0A 1ORVA 5FV4A 4ASUA 3IUBA 1J22A 2XMZA 5I4CA 3JTMA 3NASA 5I5GA 4ZZ0A 1ZR2A 4MMZB 1NAIA 1SZPA 5ERXA 3FPSA 2PR7A 4EP1A 3LPLA 1FYWA 4YUXA 4E6PA 3FCEA 1NUUA 3JSXA 2UVQA 2CNLA 2VHZA 5HRUA 4KPYA 1TFUA 4XVQA 3I5YA 2OGWA 4F3YA 1F2UA 3AHJA 4FS8A 4ZYUA 4Z8YA 3T1TA 3T1VA 4REQA 1D4FA 3OJFA 5IU6A 3PUXA 3HP4A 4JP1A 1QV7A 1CYDA 4ZALA 5TPZD 4PWYA 3VKVA 2GHTA 4M8NE 5IAKA 1FF9A 3CVOA 3ST7A 3K7EA 3QKUA 5IAOA 1IEVA 3U5TA 2AG5A 1KKUA 1Q1NA 1QO0D 1M6VA 4WKCA 3A1EA 5B3KA 4RXTA 1DTEA 4WY2A 1GPNA 5EP4A 1V39A 5C2JB 2ECPA 5KVSA 1FMFA 1ONPA 2R8EA 2UDPA 3QYPA 3NHLA 4ZAGA 3EPLA 1GQOA 2VPZA 6PFKA 1U3CA 2JIOA 2I8CA 1D8TA 2VDUE 4MWBA 1Y7PA 1R0ZA 4AJJA 3UJ9A 2F3SA 5CX1B 1YQXA 2RHCA 2CF6A 3LP8A 1QBGA 3UOAB 4YV0A 1DX4A 1PU2A 1RZ3A 3E4CA 3EAFA 3SVZA 1K2VN 2DTDA 2VNJA 3PNMA 3N9IA 1G1AA 3MGAA 1B16A 5IDYA 3L9WA 4WMLA 2OV1A 4Q1VA 4B79A 1XZLA 2DT8A 2O6LA 2ZITA 2JFFA 4DA7A 4RA6A 3NVAA 5GZ1A 1NVDA 2FP4B 3PDCA 3M4JA 2W98A 3M1YA 4UTVA 5FD8A 2X2OA 1XTJA 1DE0A 1PD0A 2WYVA 4TKMA 3F4LA 2IX3A 1MG5A 2R6CA 2VKTA 4PZDA 2IV2X 2QLTA 1E8NA 2X42A 4KTTE 4W6QA 4YCMA 3N2KA 4N12A 4PM4A 1E7QA 4FHEA 4BJHB 2UZ1A 4XD7D 2I66A 3ZNOA 2J3HA 3AL3A 3JQ8B 3WGTA 4H7FA 1M2KA 3LE8A 3NHZA 1ZCJA 4L28A 4GOOD 3WDLA 1BAPA 2AMYA 1MB9A 3F9RA 3I53A 2JJYA 4M7RA 1SQ5A 1Z38A 4BX0A 4MHOA 2VYFA 5E6RA 1VI6A 3GI1A 3GRUA 5IJ0A 5L4SA 2FUNB 4YP9A 2LUOA 3C3KA 2UAGA 1FPMA 2ZT5A 1ISIA 1RBYA 3TQIA 1ZDMA 1C0IA 1TIKA 2W58A 5E4YA 4BHTA 4RHXA 2C7RA 1IJFA 4HV4A 4CM5A 3HUFA 3M5DA 4NR0A 2YX1A 2ZTUA 4UM7A 3V48A 5BY2A 1O4WA 3H1FA 4C4YA 4BFSA 1CS4C 4QGHA 3UBTA 4E5MA 4HB2A 2OCLA 5IUNC 4GE3A 4Q3AA 1APBA 5AM3A 2OQ2A 5GVRA 3NU1A 5IC5A 3UYLA 4EELA 1REQB 4JI0B 5KYVA 3PQ2A 1WW3A 5DI3B 4EGAA 1YCFA 1OH7A 1WKBA 1IM8A 2J9GA 1KOLA 3IT0A 4R6XA 1U2SA 4US2R 4QTTB 4ZTZB 2NSDA 1KVQA 4WZBA 4FJ1A 3GFGA 2IH4A 4D8TA 4G4SO 3WY9A 5BN4A 1P44A 4JENA 2C5AA 1WDMA 5L7TA 1N6LA 3UC9A 2JLYA 1Q1BA 3IP1A 3BYZA 3VR3D 4YUAA 3W5VA 1K88A 2WJYA 2BI8A 1CUVA 1BRTA 2D13A 1NXVA 3F2IA 1YRQA 1LA2A 1GPKA 1T0JB 3VZPA 1OPXA 1QS0A 1RM0A 3Q7TA 1OB5A 1ATIA 2L69A 1SUDA 3OTQA 1X2BA 5BMOA 1QKJA 3MGBA 4RA9B 2H2WA 3KWFA 1EP2B 2V1UA 5EKTA 2JAUA 5J2TF 1B0PA 4FOTA 2DECA 2C3MA 4KXWA 5HRAA 1AH2A 4KO4S 1NV9A 4LSMA 2VF5X 4KPFC 3TNLA 4ZT6A 4I81A 3TVYA 3EIXA 3GCDA 2YICA 2P67A 2FN9A 2Q6OA 3KOZA 4LX0A 2XGGA 3B6ZA 3PRYA 1X8KA 4GOND 1NNEA 1N7HA 3IXMA 3X2EA 3RK4A 3DOFA 1PFUA 4GP9A 3NAZA 4MVJM 1SUPA 1G98A 4GYJA 4DF3A 1GUAA 3WYDA 5IKPA 1B8PA 2Q50A 1Y8ZA 2DFKB 1GAWA 1V3UA 9ABPA 3GO4A 1ZUD1 3LL7A 1RPTA 2P9CA 3Q7SA 4NY1A 4G5GA 1EX6A 4YMGA 4ZVSA 3RJ9A 2VR1A 3D4BA 4JLWA 3RKUA 2PYDA 3A06A 2RHOA 2O3UA 3B20A 3OCWA 3QLEA 3FHOA 1X94A 5CEFA 2QTZA 2AA3A 5MFPA 5ALMA 4Y2XA 1QX3A 1MDBA 1QR2A 1QR6A 4FYMA 1CLEA 1SBIA 4YQZA 4OSEA 4A36A 3SK0A 1XRNA 3RG2A 1FRFS 5C1IA 3WL5A 1HH4A 1N1MA 2ZWMA 1XYYA 3G9TA 3NATA 1HLPA 2FHPA 1R9NA 1E8DA 3AW8A 1QGUA 1QE3A 3UJHA 2FPGA 3JRWA 4HNRA 1WW2A 4RIHA 4NCBA 3TLEA 3FGPA 1MRSA 4DDVA 5CHYA 1K0FA 1N6OA 1ECPA 1NZJA 3DWEX 4CMEC 4F2PA 2H2DA 4Q0MA 3C3CA 4GKBA 1WDKA 5KYXA 4NMLA 1Z5NA 5L95A 2V6GA 1NWHA 1MZVA 2EXXA 3LYAA 4U9IS 1OCEA 3X3HA 4B81A 4PYJA 4DS3A 2VCYA 1BYIA 4E2WA 2YC2C 5K2OA 2QS9A 1ZOIA 1HSOA 2H51A 2R25B 3SHFA 2QZ4A 4BFVA 4TTQA 4DM7A 3A1NA 2NTEA 4HD8A 2VFAA 4PEVA 5ENVA 4LX8A 5LA6B 5TXGA 5IS2A 1JHAA 1B1CA 1L4KA 1XXLA 2WMOB 2INGX 1PZFA 3K9BA 3LCMA 5CT8A 5E2IA 3VOSA 4M1YA 2D7CA 3NAGA 4ZIRB 1ZC4A 4P2GA 1JDTA 2Z2IA 5IJZA 4PGFA 5KPDA 1B23P 2PKQP 1M2NA 2OCPA 4BRWA 5KO2A 1U8TA 1KC3A 4GNRA 2VIIA 1FQOA 5CTJA 4LE2A 4US0R 4ARVA 4O4LA 3VTAA 2IS1A 1OY1A 3CLVA 3ZK8A 4I6JA 1GUYA 1RRGA 1KYIA 4GGOA 4BOYA 3QU7A 4WLEA 4XEHA 5KQLA 5EEHA 4Z0NA 3FMVA 2PUTA 1XEWY 4TWZA 2IX9A 2GEBA 1MAHA 5JSUA 1ZVMA 2R6FA 2E7ZA 3ENWA 3L6BA 4UMVA 4RK1A 4NE9A 5FA8A 3PFKA 3V00A 4DLXA 3FN4A 4A9AA 4EG3A 2XCUA 4ZYXA 1RSZA 1FNBA 3QYFA 4M99A 2BHNA 2PSDA 3O75A 4BATA 2QNIA 4W5WA 3G2HA 3PXBA 3EIFA 4R01A 3KE9A 2WFAA 3VC2A 4D9HA 3FE2A 4E22A 1XJQA 4CM6A 2UU9B 3ZDQA 1RC8A 4TMXA 3SR4A 3BH7A 3A14A 2VPWA 1DV1A 4M9ZA 2Z56A 4UUPA 3WG9A 1GN9A 5L7WA 4LIPD 4MUBA 3DQQA 1TM4E 4XA8A 2P78A 2AF4C 4IRUB 4JJ7A 2PUDA 3EQ9A 1C0LA 1Z29A 2P91A 4CODB 5BVGA 2C8LA 5KSOA 1EXWA 4FBGA 3DFFA 4JLDA 4NBSA 3W5DA 1UZLA 4Y67A 1CYEA 1X1EA 2ZRNA 1DAGA 1FDRA 1PUJA 3HCBA 3PPYA 4PPNA 4UKDA 2UUPA 4ZU1X 2O1EA 3UMGA 2Y3IA 3NBUA 3SEAA 4QTUB 4J1QA 2RBEA 4BNUA 1K7FB 3FDJA 3G7NA 3ZWKA 4MXDA 2PDAA 2WUDA 4ENWA 1Y6ZA 3V6LA 5DGIA 1Z5ZA 2FFQA 2IBSA 4ZDJA 1PQWA 1FNDA 4B0PA 2Y1OA 2GHIA 4X3OA 4D3DA 3GNTA 1OXKB 3K15A 4HEHA 1NP7A 3ESDA 2JGNA 1I36A 2DM6A 1V6AA 3CIOA 1BVYF 2I7DA 3X1ZA 4YLYA 1FLNA 1N3LA 2GYUA 3P0FA 1JFFB 1OXSC 4YMWA 3VPBA 1N8TA 1EK1A 3AQIA 1CZRA 3GVPA 4KO1S 1J2TA 1GSHA 5B7QA 4EL0A 5J2UA 3C6QA 3CH7A 3B1KA 4X66B 4IW3B 5KWJA 1IBRA 1Z0SA 2RAUA 4MI3A 5BORA 4LF9B 2EBWA 2YVLA 3D8SA 4Q7KA 2HF9A 3BDVA 3I05A 3HXPA 1RJGA 2MOKA 1HFEL 1NG1A 4JL6A 3TRKA 3WAGA 1PG2A 1YKSA 1I7SB 5B4VA 1ZCFA 2YY5A 5IUKC 1P73A 1XO1A 2A0XA 2HRBA 2MYUA 4CLOA 4PE5B 1WMEA 3U81A 4PXSA 1M74A 2YXBA 3SX0A 3V8PA 1YUMA 1ES9A 4BAGA 2FR8A 1SXJE 5M7EA 4IUDS 3FNEA 5K0JA 1IPFA 2FFHA 2G0NA 1MTZA 1DWPA 3FCSB 4H2DA 3D3WB 1KYWA 4NX2A 2O0MA 3S2SA 5DGDA 4R40A 1JR3A 4QOEA 3ZDRA 5EAIA 4B33A 1KDYA 1AXGA 3ZDZB 3R0QA 1XAIA 5IKXA 3N2ZB 5JEEA 1O94A 4MWZA 3Q7RA 1KI1A 2VYVD 4O4IF 2D1FA 3KYCB 1JXAA 1FW6A 1CEEA 1KO5A 1TDJA 2GZMA 3UB2A 1C4XA 3KIPA 5JPIA 2AOTB 4V2IA 2CXUA 2VRCD 3PHHA 4FT4A 2M6KA 2C4WA 2POQX 3VR0A 4O5OA 1DBRA 3WK9A 5B3JC 4PG6A 2EARA 1J0CA 1N2GA 1YULA 4IOJA 2JCYA 1JB9A 4Z7QB 1FZQA 1YQ9A 1FRZA 3EXEB 2FCAA 3FB1A 3MPUA 3TM5A 2UZ0A 4HZUA 3ZDEA 1SCBA 1HDZA 3N2GB 4WACA 4KDCA 1P3JA 3OQOA 2HQRA 1UM9B 1US8A 3MFQA 1L5OA 4E1BA 2PSSA 3FNIA 4TRRA 4P81A 4ZVUA 4CMIA 1VIYA 1W96A 2QR3A 3PUHA 3ZJYA 3SQLA 1BS1A 3P9YA 5GZ6A 3MBIA 1QOPB 1HT3A 2AK2A 3SQNA 1RW4A 5JXHA 5DF1A 5HXAA 1Y1LA 1FP7A 1GL6A 2DLNA 4C5BA 2O2HA 2Q28A 1OHHD 3IT2A 2TECE 4HX9A 3TZEA 3SQMA 3DZBA 1AU9A 4TQUS 2GXQA 4XUEA 4YRJA 3MGCA 1CUBA 4E5DA 2VRNA 1UWLA 5F9HA 4C2AA 3P32A 2LCIA 3RUEA 3O8RA 2R11A 4UMDA 2W4MA 2AMJA 3F46A 4JLNA 4ND2A 1S4QA 2B8JA 1E2DA 3CR7A 2QTCA 3GLUA 3L1KA 1SC6A 3H8SA 5BSEA 5JPDA 3G82C 3IIJA 1P2UA 1YR7A 4RQAA 1TZCA 1J8YF 4NCJA 1P2BA 1U3TA 2QQ5A 4P36A 3O74A 5HJEA 5KS2A 2Y1LA 2IZZA 4OHOA 4LGYA 2NU8B 1NJSA 2VUUA 3TI7A 2FLVA 4Q3OA 3U2QA 1E2PA 4JJ6A 1IMJA 1RCUA 3BXZA 3JD0A 2HWKA 5AW2A 4U2DA 2G5PA 1S3IA 3W6UA 4D0GA 1EFHA 2PZLA 1K5HA 3TOCA 3MWEB 3LW7A 4URYR 3QNMA 1C9EA 1UEXC 1H8EA 4LJ8A 1U2PA 1FNNA 2Q07A 3GRZA 3HCPA 1YS7A 4YMSA 2OAP1 5FHRA 4QOGA 3L2OB 5LKAA 4WESA 1AXRA 4B3SB 1LDBA 1V9CA 4WE3A 1TUIA 1MVNA 2WAMA 4NMWA 4M6WB 1S0UA 3CEAA 3FSRA 3UKOA 1GRCA 3NGMA 2ORYA 1UOEA 3P71T 1OBOA 1VSBA 2F1HA 2VQEB 2XECA 5EJGA 3LI2A 4LJYA 3VSEA 2AH5A 4B4VA 3ZLJA 2E1PA 2QVBA 1PV4A 3PB3A 4D26A 1JMYA 2XB9A 2XEDA 2BTQB 1KR5A 2RGXA 3V8EA 4HJRA 3ENKA 3I2GA 2G9QA 3C8MA 4RIIA 3ZCXA 2ZG6A 3G2QA 4YAJA 3TQOA 3AY3A 1M6WA 3TNJA 4AJHA 2DRIA 1QTRA 1Z63A 2IDMA 2GBLC 5H8WA 3I04M 4KQJA 3BUSA 5DHQA 3PX7A 4Y9SA 3WAJA 3MOSA 1NVBA 1P2VA 2O48X 3PNPA 3EODA 4OYHA 4WDRA 1WCWA 4XH9B 2BKAA 2UZ1B 2VL7A 4R3UC 1E3EA 1EJBA 1FLVA 3DFIA 4NV3A 4CHGA 2D7DA 2I6UA 5BQOA 1W35A 2O23A 1FTGA 4QRIA 2C3UA 1XEXA 1RWBA 4TLMB 1UBNA 5JJ5A 4K3UA 5CP8A 5K8UA 1U0BB 3AWIA 2FWMX 1UBOS 3EMDA 1X9HA 3FDIA 3KVRA 4GQIA 2JI7A 1X13A 4FHFA 3IVRA 5CM9C 2NUTA 1HL7A 4KR0A 3OTWA 1ZNXA 1NWCA 3DMGA 3QPCA 5KC8A 2QA5A 1N92A 2BEKA 3HEBA 3FPHA 3GNSA 3WGLA 1EVZA 3DZJA 1XRJA 2HA5A 1TEZA 2W37A 2XA2A 4MINA 2EBUA 1ZXXA 4OCZA 3IHWA 4XIFA 3WMRA 1WB5A 5B7NA 2M6LA 1GGJA 2VJLA 2Q4BA 5ER9A 2OYRA 5KNDA 2UVPB 2VDVE 4AG6A 2YVUA 2XV1A 1YK1A 3K0BA 4I36A 4J49A 4TYMA 3AU9A 1G7CA 4MITA 5ALEA 1LI7A 2WM9B 4D9FA 3MAJA 4C7OA 3BG5A 1VPLA 1PR1A 3QVGB 3ZWOA 2QP4A 1EVKA 4R2XA 5FBVB 2XCRB 1CY0A 3LBFA 3NHPA 3OFJA 3A05A 4RKWA 5T41A 2NTNA 1J0EA 3MS2A 4BX3A 3KQUA 5JWRA 4BJ3A 1QF7A 2ZLBA 2BDEA 2I55A 2Y76A 3U6BA 4LCEA 5BN4B 3PX3A 2QXYA 1LTQA 2GVDC 3GJQA 4NOLA 3Q40A 2OM6A 5GPBA 2Z08A 2IYUA 4ZQGA 1P39A 3BICA 4WY5A 1DO0A 2Q1SA 1L5QA 2FFJA 3ZOZA 1TUEA 3W4JA 1G6HA 4AZ3A 1NXOA 2B6NA 4C7JA 1E9SA 4HEQA 2G71A 3UCXA 2NO0A 1NPDA 1Y5RA 1QHXA 2CNNA 3WRYC 4QPPA 1BN6A 3VTZA 1JDPA 1QGZA 2D0PB 4WUVA 1HA3A 4TS1A 2VTBA 4WERA 3O92A 4F8YA 2PTHA 5C8DA 2NVWA 4DCSA 2WA2A 2YASA 3RWBA 2RHHA 1PL8A 1I33A 1U2GA 3HB5X 3RWOA 1PGNA 4C2BA 1QU3A 2WMYA 4C0QC 1CCWA 3OX4A 3HBLA 3WFIA 1T3HA 5CW2A 2YJNA 4UEOA 1ACMA 1U5BA 2P5UA 1HDYA 2ONZA 2PX5A 2WIGA 1JQ5A 2D00A 3EWSA 3OM0A 2BL4A 3JQAB 3VYRB 4PRKA 3CLHA 2MR6A 3KM0A 4TWBA 1N1DA 4OJQA 1E2QA 3V55A 3TLZA 1QGDA 4N54A 8ADHA 1Z22A 2PZKA 3G02A 2XXJA 3ENVA 4G8CA 3ZY2A 4CMJA 3FUVA 1ZK0A 4JJZA 4A15A 2JBWA 3I9MA 4ZHQA 4P98A 1UPCA 5AK5A 4BNXA 2E89A 3ZJUA 4TZ6A 4DG8A 3BA6A 3GFSA 4DSUA 3MNFA 4IH4A 4MAAA 3WRXC 5ALVA 8AT1A 5C0OE 4UFPA 1P29A 2CFOA 5JSYA 1YR3A 1H8ED 2C1XA 2PUVA 1SUEA 1UDWA 1K7YA 3KCNA 4HH4A 4OP1A 4TMKA 4DLAA 1DMSA 2H4FA 1V5FA 2YNMA 4OHRA 1GKLA 3W78A 1BDJA 1Q95A 1SZDA 1ZK1A 1HTBA 1ONOA 3WBFA 3W7VA 1SU4A 2CT8A 1IATA 4FFBA 1P75A 3KFXA 1ZGJA 3FI9A 1GP2A 2BI7A 1MABA 2H5LA 4FOLA 1PGQA 1RBMA 3RPEA 1OVMA 3BULA 3PUZA 4YP1A 3VX3A 5MDHA 1HLGA 4OF4A 2DJ5A 1H5NA 5BSFA 3UUEA 4R1TA 4IFBA 4KVAA 2IYAA 2QD5A 2X14A 2R84A 1GZUA 5ALGA 2LXNA 1NN5A 2IIQA 2D1YA 4ENTA 4TQ9A 5ERGB 3BEOA 1SIUA 5TPWA 5DBGA 5BR4A 1A8IA 1ZKDA 3FBWA 1LLQA 4LTMA 3USZA 2RARA 4E5VA 3IMKA 5C8YB 3L6DA 3STYA 2C1EA 4GXQA 1L2TA 3NV7A 1XF1A 2WT8A 5KTNA 3IAS6 1BEUB 5B3LA 2ZROA 2M98A 3OCUA 3D5TA 2O07A 4XCQA 3ABOB 3U80A 2NO1A 1DS6A 3GRYA 4MV7A 1ILWA 4ARCA 2I3GA 1N1EA 5BT8A 1U02A 1E1DA 3BMNA 3EGCA 3PLRA 4L4XA 2L0XA 2HC9A 1A77A 1MMFB 4M0EA 4N5LA 2OK7A 4EHKA 3Q0EA 5IMSA 3ZIDA 3RVPA 5B6IA 1XZDA 1H65A 2ZJ3A 2WJ3A 2EF0A 4YAOA 2EX0A 3KLOA 3Q85A 3PHIA 1ZY2A 1CEXA 1P1IA 2QUBA 4HGRA 4CKWB 4RABA 2FDXA 3DE4X 5JYCA 2HBQA 3KR2A 1EKXA 2P4HX 1R0YA 3UAYA 2J6HA 2REQB 2ID9A 5G0TA 1HDXA 2EHDA 2XZLA 3JAMA 1PNTA 5EGNA 1M9NA 4K2AA 4Y98A 4BY9E 2GF0A 3DHEA 4I8IA 1RTTA 3NHAA 3OIVA 3ZEAA 3ZWXA 2PGIA 2VDLB 3L4BA 3WJ1A 5HEKA 4B3DA 2R79A 5JAQA 3CFYA 4BE4A 4KUEA 3O2QB 1JEJA 3L9XA 3GLIE 3V2GA 3JXEA 3EUFA 3TJZA 3LA8A 2ECKA 4OEHA 1K9VF 1ABFA 1GZ6A 1Z4PX 2RC5A 2KWIA 4IEFB 3WZ2A 3TOZA 5DM60 4HTFB 4IDAA 3ZLVA 4PSCA 1NVTA 5KYUA 1KYZA 2IOQA 2GD0A 2PT9A 1DEXA 2ZEJA 3MJEA 1DXOA 3PQ3A 1VJCA 4G0ZA 4IFIA 1ZONA 1UBTS 1UQUA 4QREA 2H9YA 1Z0FA 4RK6A 1U94A 1XPRA 1BC5A 4I8DA 4NNOA 5EJ7A 2YWHA 3F4BA 1SG9A 4ZAVA 4OMDA 5MN6A 2A5DA 2Z3VA 3BIJA 2VWGA 2XVYA 2ZBQA 4S0XA 1ZH6A 5TY0A 5B6JA 3MGKA 3NYIA 2AHOA 3BMQB 1XZEA 2GCOA 2HPHA 3CF0A 3ON5A 4W1SA 1V1JA 1LK5A 4RPCA 4AD8A 2XA9A 5FEMA 1CK4A 1FFSA 3ZHRA 4JVOA 1GQQA 2VH1A 2BFNA 2MWMA 3WGVA 1SQFA 3PU6A 1TEHA 2ZCUA 3A26A 3F74A 2ICAA 3B7WA 3CV3A 4HI0E 2L2QA 4I1IA 4K6MA 1B76A 4G0WA 2ODWA 4YHBA 5FUMA 1JLHA 3HNOA 5DSZA 1EDBA 1QZXA 2NX2A 2X7XA 3CZPA 4R68A 4F6CA 2M6SA 3AF5A 3WXBA 1OTYA 1I32A 3EDOA 4HUJA 4JP8A 3PZRA 1KH3A 1F1BA 5DXAA 2Z6VA 4O2AF 4E3WA 1XTUA 3VTKA 2OO3A 4HR7A 4G1BA 2WWIA 3BFVA 4YCLA 1V8BA 1PW5A 2C9CA 4MP8A 4TLBA 3DD5A 2C7QA 4BV2A 4F4UA 1KWGA 2B2XA 2G6TA 1R0RE 3LBHA 5J40A 4F04A 2VF2A 2B6HA 1JECA 1LD3A 1TA9A 4NESA 3PHGA 2FRDC 3DAYA 4BKQA 1YC2A 4FMCB 1LPMA 3VGPA 1GA4A 1IZZA 1JXQA 2GK7A 4BO0A 4M1MA 2ETVA 4DDTA 2CUZA 4IG9A 3BL6A 3OZXA 1R18A 4JZYA 4QXRA 3ETNA 4WEQA 5K6TA 4J7UA 4N48A 3VZSA 4L78A 2V7XA 3W4IA 1YA8A 4ZI7F 4UU1A 3EH2A 1G18A 3RREA 1GR1A 1OE0A 2BUAA 2FQQA 4I9NA 4AYTA 2WHXA 2QGNA 2AXNA 2II6A 3FI0A 4IVNA 4O4JB 1RQ2A 2M6RA 1F6BA 3E3AA 1WQ1R 4UTNA 4LRYA 3TZCA 5JSZB 2IIPA 1Z6YA 1JJ7A 4HMPA 2X58A 1EJ0A 2W2KB 4DV4B 3OBBA 2XQFA 2VK1A 4UAGA 5FPHA 3ENZA 3P0RA 4I4IA 3OOHA 1EXVA 3GZNA 1UK6A 3TRFA 1GSOA 4L6AA 4HQRA 4R16A 4CQMB 4BUJA 3FOBA 2JRCA 4HXFB 4PS0A 1N2CE 4R5HA 2PXXA 3HH8A 3NH6A 5EUCA 2CXOA 5KHLB 3E35A 4IEIA 3B3QA 2F2TA 2YV5A 1D07A 2CLCX 3QPUA 3EXG2 5TPZA 1X87A 1EZ1A 1DU4A 1NDQA 2OAQ1 2NM0A 4GVXA 3WGYA 4I5DA 2ZRLA 4ZK6A 4INJA 1PNVA 1JKMA 3QUQA 1IM2A 1XX6A 2X8WA 1J42A 4NHOA 3AF4A 3BVPA 4QYMA 1Z4OA 3AVUA 5E7MA 3WKCA 2AXEA 1XLVA 2QMUA 4ON9A 2YQ5A 4YRCA 4ARUA 4MJLA 3G0IA 5L3VA 2XTAA 3CPHA 4CKEB 4P9NA 4EVSA 1Z8DA 5IXYA 1KQ3A 1N2HA 3DTTA 2CYAA 5JNWA 3T3GA 4MQEB 3IIKA 4V0KA 2DAPA 1B2LA 5KQSA 3ZH2A 1Z07A 4JLVA 1UBMS 2P2DA 2X0JA 4MJXA 1OAAA 1JQJC 1W4AA 2JK0A 3VYTB 3ZHZA 5K0CA 1IHOA 4Q1BA 4BMXA 4P4TA 2P9HA 3JYOA 4TXMA 3HUEA 2HZ7A 1RMTA 3C8HA 3JQ7B 1E1NA 5DTIA 2Q6IA 5I9SA 4PANA 3NTLA 5EQFA 3GDGA 4WNYA 2WKWA 3LQFA 3JY6A 3KCQA 5EIOA 3R7BA 2I4OA 5HWSA 5FBLB 2PSFA 1RT9A 1HZZA 1SHLA 1ZW1A 3G9UA 4DCTA 3A3NA 2B3DA 1DKMA 3C6ZA 4RZUA 3PTLA 4ZI3A 7REQA 2ZIFA 5IG2A 4XYBA 4Q1FA 1BH2A 5D85A 3OPYA 3DM5A 4LRWA 3DAHA 4GVLA 3LUPA 2ZU6A 3PDIA 5FOTA 3TM4A 2QENA 5LKRA 3Q8KA 2AV6A 1TJ5A 1U0RA 1GA1A 3OZVA 3U1BA 4I55B 4CF5A 2BTQA 2XSZA 2GM4A 1Y0BA 1DAMA 2OFFA 2WLSA 2W48A 4AX8A 3UXEA 2YUTA 4MV0A 5ALOA 1Y81A 4ABTA 4KOAA 3NBYC 3COZA 3D5EA 3E48A 4CF3A 1C30B 2QX6A 4HO1X 2Z2ZA 4OFWA 4OGWA 1SKMA 3PDWA 3R3SA 4TV9A 1I1QB 2WUEA 4K6OA 3WBKA 4WZAA 3RYCA 1SXJC 4DQVA 5IVDA 5GM1A 4C4PA 2Y6UA 1T9GR 1YBMA 2FX2A 3NWBA 1PJ4A 2H2FA 4FMDF 3LM8A 3EVAA 4XLLA 3BHMA 2AYYA 1TTQB 4AO6A 5DSXA 1TVEA 1UF9A 2FOIA 2H1SA 3WRVA 4Z51A 3SYNA 1RJFA 1YO6A 1AV7A 3SICE 4EY3A 4J0KA 2H7XA 2HU5A 3CLTC 3OAAD 1SKBA 3ESXA 2Z8XA 3PV0A 4I0WB 2VJOA 2R1TA 3CSUA 4FHGA 3I42A 4YJDA 1V3QE 5CTAA 5AVOA 3SZLA 3VNBA 1ZGZA 4ER6A 3GYGA 4GW3A 1A7JA 2V45A 2GPTA 5HS6A 3OWXA 4P33A 2XOKA 1CNFA 4O8ZA 2QF7A 2RH4A 4DUGD 3IE0A 4X45A 1R50A 3KC2A 1FVHA 3TB4A 1IQUA 1W47A 2RH8A 3HVKA 1WXXA 3QKSB 4DYDA 4LWQA 1NQWA 3TF5A 3P27A 2VYQA 4OBEA 5IZCC 3HP7A 2Q3JA 3L5KA 2PVSA 2C2HA 3LUHA 1Y42X 3MJFA 4OGKA 3QVGA 1XE3A 4B8ZA 1OD6A 1VDMA 3HCCA 5J59A 4DJ5X 1YV9A 1QVZA 3AJ9A 5H7XA 3T12A 1CS0A 1XQXA 1N6RA 3SIRA 4HSGA 3H2HA 3VR2A 5HDQA 5IM4F 1EUQA 3RTDA 1Q19A 1S02A 1E94E 2HK7A 2QPAA 1IHXA 2G06A 3NFRA 1GCOA 3MTEA 4FGZA 1GUZA 4JYCA 1ELOA 1TMYA 4N76A 2GESA 5FA5A 4OKNA 1LJ8A 1MA3A 4EO7A 4MPDA 2RE8A 4FYWA 5BQXA 5G0WA 3JYHA 4FYIA 4B3RB 3W3AD 2F4NA 2AJCA 4JXXA 2E9SA 2XUQA 2PGLA 1I0ZA 4OMUA 4B3MB 2X76A 1FFHA 5FOSA 3LHIA 4FZ5A 1IY1A 1NG9A 3O7MA 4RENA 3LY7A 2CLSA 2HCRA 3IP3A 5JFOA 2X9NA 4KSYA 4RULA 1MO5A 1A72A 1AG9A 1IXZA 4RANA 1UP6A 5TRTA 5J4KA 1BMFA 2OV4A 4ME6A 4D0NA 1HRDA 3LRXA 4K26A 3PUJA 4KK4A 2OO5A 3LWZA 2VYNA 1U5BB 3NAQA 2BGKA 4DJJA 4HYEA 4GPAA 2HLDD 4M0LA 4ZZ2A 2FUG1 2AOUB 2IXTA 5DNVA 1SCNE 1SELA 1OI4A 1U5AA 2QJWA 2WHPA 2EX1A 2X7HA 1Q3HA 2Q9CA 3MYYA 4KIJA 3RSOA 3W8NA 1QRSA 1DXHA 1E0KA 3RANA 1JJAA 3V4PB 3VBEA 4ZHQB 1T8PA 4Y8VA 1KARA 1XMJA 3WMFA 4M8IA 1CRLA 1BMFD 3BH6A 1H9AA 3HJRA 1FFXB 5EWJA 2O2DA 3OU2A 4PW0A 3LXMA 2IU6A 4EY6A 2VHWA 5E3JA 3TL2A 4GR4A 4AS1A 2FWPA 1DC7A 2HGSA 3OMWA 4GBED 5KCZA 3KPJA 1TTTA 3CVUA 2A1TR 2R3SA 2AYZA 4H3SA 2C20A 2ZR0A 1HT0A 1PT5A 1XEWX 5G3YA 3WNCA 2FMFA 2IW3A 1V4VA 3MT0A 2XVZA 4HZIA 4FWTA 121PA 4DR5B 2DKNA 3VPSA 1NZDA 2WHEA 1E63A 3VTFA 5EKSA 4Q93A 2ZDHA 3HL0A 4PF1A 3BK2A 3Q9SA 2CXHA 3ZIAD 3K2EA 2JGDB 2G9UA 2OC9A 3OZIA 4UFNA 4BASA 2P2GA 4D8YA 5L3QA 4JT4A 3U3JA 5C46F 4V38A 4ND4A 1LQUA 3FCAA 1OAOA 3JWJA 1SUFA 1KAHA 1X7XA 2P40A 3IX7A 3EVZA 2DHQA 4XQEA 1P5ZB 3PD1A 3PXCX 4BNNA 3CRW1 4H7KA 4PAOA 3S8MA 4AU1A 1UP7A 4IJUA 2OA0A 1KXZA 1DPFA 1G3MA 5EUMA 1HF3A 3RRFA 2UXDB 4FMDB 1XPUA 1J49A 2OENG 1T3TA 2W6OA 4G1FA 5J9FA 2IU0A 2XYRA 3R76A 4YRNA 5ELMA 2OESA 2IEYA 2VS1A 2BKUA 1X8XA 2XVAA 2Y67A 4L51A 5HFAA 3RBZA 4AIRA 3ZCSA 3VYVA 4C20A 3I0MA 4KQKA 4TMFA 4DV3B 1Z4IA 1ZH8A 4DLVA 4PR0A 1LJUA 1TUGA 1JIXA 2QHXA 4FDTA 4E5PA 3IR7A 5FBQB 2CHVA 2FV8A 2GI4A 2IYXA 4TXJA 1ENOA 3BMNB 2UYQA 721PA 1VL8A 3AUJB 1QC5A 4GD3Q 3TR6A 2A1IA 2J09A 2VP9A 4J3NA 3MLAA 4MQFB 2PH5A 3RS3A 5D7NA 2AN1A 2C5FA 5CT9A 1LQTA 5HMLA 3ZWDA 3R9KA 4IVPA 1KVRA 4ECAA 2EOAA 2QTFA 5H68A 5K0FA 1TXGA 1XDWA 2E18A 1H6DA 2AEMA 4P4NA 5CH3A 4BU0A 5HYVA 5I48A 3HR4A 2RGDA 3G6WA 3JQAD 4NIMA 5GWXA 4DWOA 1JHRA 2LCFA 4AMGA 2MSDB 1EHCA 2FE4A 1P77A 4XM2A 2GEFA 3TGWA 5FR1A 5AVSA 4DR6B 1SU7A 4FQ5A 3H6KA 2H8GA 3ONNA 4Y3UA 1DUIA 4F92B 1RZRA 4L7VA 2XF2A 5JIBA 1QYCA 2CE2X 4Q03A 2DUNA 1RU3A 2VP2A 1YHNA 4HVTA 2NUBA 3MT8A 3I37X 1E79A 4CI9A 4RPHA 4Z0PA 2FW1A 3R3ZA 2XRMA 3CE9A 2MSEB 1Q11A 1PP4A 1WD5A 2BBTA 2NSYA 4DJFC 2FW0A 1G42A 3AFNA 3KQVA 4NICA 1KEKA 4KR7A 4NQRA 1Z74A 4BKUA 2Y1DA 1SPXA 3IODA 1P8AA 3NBKA 1FJHA 2H92A 2P68A 2XWSA 2WAYA 3GJTA 3L8DA 5CXXA 5AJYA 1U28C 1XXHE 3FCUB 4GPIB 4DNOA 4EWLA 2R6ZA 1G21E 4GM1A 1PIWA 1N8SA 1MTOA 1NW9B 1OIVA 3VUFA 2O57A 2GN9A 3C6KA 3PHCA 3WYAA 4EPVA 5LZ9A 1XVLA 2P65A 4U7HA 1IBSA 5A5GA 3BL8A 1E9EA 3GIWA 4E21A 1T2CA 3TECE 1GPBA 1VLVA 2PZJA 4FE7A 2OXTA 2RG7A 1VG1A 2QXTA 2QRHA 2V7WA 4C4RA 4EGCB 4ZRMA 4RUKA 1WKCA 5HTKA 3KTDA 3V4OA 3TTTA 4C7XA 4FCWA 5DK6A 1QP0A 1PJ8A 6CHYA 4X8HA 5LMNB 4LYHA 4YRQA 4EJSB 5JS7A 2X19A 1SK9A 5JS6A 3L6CA 1RQRA 2OG1A 1XZBA 3GAFA 4F5ZA 5DBEX 2VDKB 1H9BA 3HMQA 4KAAA 1OU4A 2PYIA 3OTIA 1O87A 4JNKA 4PYIA 3ZW7A 2IH5A 1ZRNA 3SEZA 3TW6A 1ZR4A 3N58A 2WV9A 1T9DA 2BM0A 4O6VA 5EIBD 3IEMA 4UE6A 4FFMA 4WI1A 1YU6A 3GH3A 3R6TA 5E9QA 5EE1A 5KCMA 2CYBA 1MT3A 3F71A 3U3XA 5JAOA 1FYDA 3BE4A 1PJRA 4P83A 3U60B 2O8EA 1C5KA 1IG0A 2O2YA 3VC1A 1MIOA 1BDHA 4YMTA 2FVYA 3W1VA 5KQPA 4D7AA 2FGKA 1Z35A 1YZNA 3G0BA 3IC5A 1E9CA 1YR1A 4PBTA 1XJWA 4P4SA 1PBTA 4MB0A 1SCUB 4NULA 4JKOA 3CNLA 2RGCA 1A8PA 1MD9A 4QQRA 1NM5C 5GM2A 5A3JA 1UXJA 4EYQA 3U3MA 1GLVA 4H6XA 4MUYA 2V97A 3BJRA 1VSVA 2GN8A 2P2NA 5AI6A 3ISVA 4BNFA 3O2SB 4AICA 2ZBVA 4JB2A 2E0IA 1ODFA 4TYNA 1A0OA 2IPNA 3OLVA 4Q6BA 4C0KA 1MVOA 4EHIA 5TEWA 1J70A 2YW9A 1JSCA 2BC9A 3A4IA 3NANA 4V0OA 2BYTA 2AZDA 5CA1F 3D64A 2CHGA 4PIVA 4TL7A 2CFCA 1RLIA 3TD9A 3PWTA 1OX5A 4YS6A 2HV8A 5I9TA 4Z4FA 5B5SA 4P5DA 4X44A 1TD1A 3VR5D 3EY4A 3R75A 3HHEA 2D74A 4M9RA 3P9KA 4NBWA 4BLOA 1GU0A 5L45A 2Y27A 1M6VB 3H04A 4PG8A 1EAMA 1JLMA 1HE4A 2ISSD 3P20A 4MKIA 3MOGA 1SHKA 1QG6A 4M9UA 4QTYA 1Q0TA 3BH0A 4MUXA 4TTAA 3OIYA 1T13A 1ZJZA 5TE9A 1I7DA 3FPCA 4NYIR 5JCJA 1XHFA 3RKSA 5KTOA 1P18A 2WTNA 3STUA 1XK7A 1FMLA 1RHKA 1SVWA 2WB4A 3SC2B 3EXHB 3LZCA 5F1PA 4I1OA 1Q0HA 3KUUA 2MYTA 1DWOA 3OUZA 3S70A 3W5HA 2P75A 4DQLA 4KXUA 5KB3A 1WO8A 2P3SA 2DR3A 3U16A 1K3FA 2G36A 1A5TA 1EK5A 3KAQA 2I03A 4P5PA 2A3NA 3UJNA 2F8SA 3AVWA 4X92A 4NXMB 4D9GA 3EE6A 4BL5A 5CHEA 2IKSA 2ODNA 4UD6A 2VPXA 2YHIB 1NQOA 2EC5A 5K0ZA 5LU9A 1A8HA 4M8KA 3S40A 2QTRA 1E20A 3AR8A 4F4DA 1BEEA 4MKZA 1E4EA 4MQ4A 3NEJA 2WHYA 4QT0A 4UM9B 1JRLA 5EWMA 5F4ZA 3DE3X 4DMHA 1XAJA 5CYGA 3I83A 5DM70 3RS9A 1T0BA 3VDNB 2JZNA 5BRAA 1BGVA 1QMPA 3C14C 5JI3E 4CETA 1G8YA 4EKDA 4TYQA 4MS3B 3ZY3A 4GFDA 4O8CA 2NYRA 3FLAA 4TKZA 821PA 3GRKA 3M2PA 3N1UA 4KC0A 4RD0A 4F5WA 1BA2A 1UCFA 3RI3A 3HADA 1O6CA 1LVHA 1TE2A 1QHSA 3BJZA 4J0JA 4TTSA 5DGCA 3WFJA 3AL0C 4DBLC 1LPPA 1K4MA 1Z2CA 2OCAA 4I3FA 4QBKA 4ROTA 4F2DA 4GI5A 3RSGA 5JMWA 2O1SA 4N6OA 5DN6D 4PSUA 3EGIA 1AMUA 1S3SA 3Q3EA 1MA0A 7REQB 2AFIB 2P6NA 4L5BA 3BTVA 2RI6A 5CA0F 3B85A 3OOJA 1RABA 4DV6B 5C9ZA 3MRVA 4TLEA 2PD4A 2YFQA 1XTZA 4M1WA 4MR9A 2PL1A 2X4GA 3WL4A 3S1SA 8GPBA 3QE9Y 4G8DA 4KR9A 4IZHA 3SR3A 4DG9A 1JAHA 5BMVB 1T29A 3IHLA 3Q7IA 5DWQA 1A4IA 2HIAA 3AJAA 4BBJA 1CG6A 5DI3A 4MKXA 2R2AA 1G21A 3PG5A 1IZ0A 2OXEA 3GGDA 3AETB 5M2QA 1BIFA 2FDCA 2VT7A 4X0EA 2EGHA 2WF6A 1QYXA 2YWRA 4CLRB 2XLBA 4WZAB 4EEKA 4WZBB 2FG5A 2X9QA 3OOYA 4UEWA 3VH3A 3F6BX 1R8JA 2VCHA 4P5EA 1JR3D 4KE7A 3CNEA 3OFKA 1VPWA 2I4TA 4XSVA 4AYWA 2ZI6A 5CIYA 3UA4A 1TAQA 4FOSA 1UKBA 4NZMA 3NMUF 1X42A 4IS3A 3Q8MA 3UNXA 2OEPA 1P7CA 3LG2A 3D4OA 1VBFA 5AK0A 2ZRCA 3KVYA 1E3SA 1RZVA 3I01M 4XLTA 3C16C 4OI4A 3UFBA 3IP7A 3KD3A 4DLWA 3NWOA 5LNK1 4DCUA 4CDNA 1KDTA 5C1PA 3SNHA 1KZ6A 5LQUA 4EY8A 2COUA 1TYAE 3V4ZA 4EUNA 3NDBB 3O5AA 2BCJQ 2O9JA 5I45A 3HG7A 1YWGO 2F7SA 4MZDA 2ZRMA 4FTWA 3PQCA 3WYFA 3LTNC 3ENQA 1GZDA 2YY6A 4GS5A 4GBGA 4NG4A 5EKDA 3P9SA 2FEXA 1IB6A 4WEOA 4P31A 1KHTA 3BRWD 1W4CA 2XMGA 1VJDA 2C2OA 2QTNA 2BMDA 4JUAA 1CS0B 5BMVF 1E5DA 5DNYB 1KA9H 3DE2X 5H3HA 3QMPA 4Y9TA 2E1RA 2XUHA 3LQKA 2HNKA 3M9LA 1IK4A 3JZMA 3NFYA 1Z17A 4HJXA 3VPAA 3PXXA 1RM3A 5BN3B 4M2LA 5LM3A 3ILVA 4TQGA 1QFJA 1UC9A 3AC0A 5F2EA 3NTOA 1C8BA 5DW3A 3N2EA 3PX2A 3TOSA 2QAGB 4JYZA 3IP8A 2HRCA 4FGJA 5DNAA 3WVNA 1DWQA 3OZTA 4AJ9A 1WTAA 5AXBA 3MTBA 3H9QA 3ZWAA 3FZGA 3LFHA 3I8OA 2VJBA 3ECSA 1IXSB 3FPFA 4N6GA 3UMMA 3TBKA 5JNUA 4LC0A 4IZIA 4R5MA 4BEBA 3WQQA 5BSUA 4M9XA 3R6WA 5I8ZA 5U1PA 2GDZA 1W6UA 3EY9A 5LXTB 2PS3A 1J9ZA 2Q3LA 1Z2NX 3K5PA 3AF1A 1E6KA 1I24A 4KZKA 3U44A 3Q3JB 2JZCA 1WRBA 3CUWA 3G49A 1JTFA 5JD4A 4BAZA 3J80A 1S8AA 1R5BA 2WVHA 2YFYA 5C18A 3HSSA 3E0XA 3RVBA 1DFGA 3CUKA 5DNDA 4GBJA 1OT3A 3FGNA 2OB1A 4PHFA 4IH9A 1G41A 2I5PO 1X1SA 2W6CX 4LJLA 1U98A 2C8KA 3WJ7A 4RMHA 4BBAA 4X65B 3LUBA 1WNTA 5A02A 3N0RA 4PSKA 4OX9Y 3B60A 2B30A 3D3EA 3HU3A 4OK5A 1H05A 3WHPA 3SC4A 2RIRA 4KPGA 3EA5A 1U0OC 4GPD1 3N75A 1NVMB 1P74A 2JASA 4RYDA 4EYSA 1WJGA 1OLXA 1DT3A 1JDVA 1F1JA 2DE0X 1CQZA 2BISA 2Q2OA 4AJIA 3KR9A 5IABA 3OETA 3EF0A 3I6YA 5HBGA 1MJGM 1KHHA 2UYGA 1K6MA 2QUJA 4TL9A 1P4AA 4R2IA 4D9EA 2ZUFA 4YI3A 1M34B 4O4LB 2IGBA 1QQ6A 1EZ4A 1S2DA 4J43A 2PUEA 2J3JA 4JLOA 1VYHA 4F9FA 1QP7A 1C1DA 4JDPA 4BYGA 4HWSA 4LBVA 2H6EA 1NNSA 3H42B 4K9OA 3WLNA 3M4ZA 4B7AA 1UFVA 3QE3A 2WPDA 1K3TA 3IQXA 4HUQB 2O0JA 4J1SA 4RZHA 3F9IA 4XASA 1G2IA 1P2TA 2ZJOA 2D2EA 4PZUA 1FOEB 4N5HX 1TVCA 4I7EA 3AOEC 3TAUA 4UOEA 4ZKDA 3AM5A 3CG0A 2G1JA 2QXUA 3NM4A 3PFIA 1HKUA 1NU6A 3T8YA 4F5YA 4OLAA 4ZYVA 4CKCB 3EBPA 2YV4A 3GUVA 4EMSA 1C3OA 5T4HA 3D8TA 1CY2A 4PZZA 1RQGA 2QN8A 3T38A 4O4HF 2HR1A 3OFVA 4M9QA 3KXLA 3UWSA 3I30X 2YIVX 3O8QA 4BJ6A 3O8CA 5E0OA 1YNOA 1H4SA 4YC7A 3LLMA 3KQLA 1VG8A 1V0JA 2ZSUA 2ONCA 3BB4A 4UUMA 5JNLA 1Q12A 2H4WA 4MVXA 3R5KA 1WZIA 3B3GA 3R4CA 1U0TA 2LRHA 4L9RA 1BVHA 3MGGA 4F1WA 1BROA 2BH2A 3NBZC 2BELA 1D8AA 1ZM7A 3LNCA 4LHXA 3ZU3A 2OVFA 4EPXA 1E3QA 3QITA 1TPZA 2HSDA 1FPQA 4FWIB 4UM9D 4WLOA 5DEOA 2QI9F 1R8QA 2IZ1A 1TMOA 1IWBB 4JR1A 1XNQB 1T3LA 3ZVLA 1CEQA 1CZHA 1XVAA 2Q5OA 3H1EA 4U8HA 4R3WA 1SBTA 3VI4B 3IHKA 3QOWA 4I3GA 3AERB 3DF9A 1ODCA 3E9NA 2GASA 4ZXFA 1BJTA 1C3JA 4G5QA 1X14A 2GAFA 4J76A 3F47A 5J2UB 3TVDA 4E4YA 3M5PA 4TL8A 2AZMA 5IT5A 1C3EA 3DE6X 3ORYA 3TMKA 1RXIA 4FX2A 1VCNA 1CUDA 3B1VA 3TNDA 3EEFA 3ROFA 5HJ5A 3OEED 1H94A 1Z37A 1ZNWA 4EF5A 1XMIA 4MRSA 2H9IA 1NVWQ 4WNCA 3TMAA 4EW3A 1ZZGA 2OLJA 4E5YA 3E27A 2APJA 5GY7A 5KSWB 4HN2A 3RC1A 4B8YA 2Y0BA 3B2EA 4IHJA 4FM9A 2FUG6 4L3OA 4J0DA 1I6WA 3QJGA 3TDNA 3T1HB 3BTUA 1JF8A 2AL7A 4WCFB 3HYRA 1H6AA 2B94A 5HF9A 1CY4A 1WUJS 3UV3A 4ARBA 2AG6A 1GVNB 1T9GS 2PBFA 1TKCA 4QJBA 4C14A 4NQZA 1WUYA 4Y7CA 5AXAA 4QWMA 5CIQA 1S7CA 2Q6LA 3LF1A 1L4EA 4QFMA 3M5CA 3BE6A 1QNFA 3TYXA 1JDNA 4EZBA 5FV7A 1V6CA 3JQEA 3KYCA 3PXGA 1YZKA 3QWFA 3E53A 2IYSA 2WUWE 5J1SB 4DAEA 1N2JA 1KMIY 1OTHA 4BP3A 1SUBA 3L8GA 4E14A 1NLYA 2XIQA 2ECQA 4G1UC 4R54A 4EJSA 3PR3A 3USES 2O4CA 2YZGA 4JBXA 5DTQA 3UV6A 3K35A 4TWRA 1Y7IA 2PX8A 3W9SA 3AEQA 4UW9A 5E6UB 4U2FA 2PFSA 2QW8A 4RX1A 1UAYA 4LS3A 3QOXA 4QDZA 5EHZA 1I1NA 5M3BA 3A1SA 3MTAA 2EEPA 1OBVA 2GUGA 2HIHA 2RMKA 3LYUA 1LK7A 4IAOA 1T8SA 4LC9A 1YI8A 1IZYA 1OH6A 3RSCA 1BDMA 1CHDA 1RQPA 4GWKA 4HFJA 4IDPA 1YBHA 3GRPA 1DC3A 1PSWA 4RL6A 3RVQA 2VDJA 2YXLA 1PZMA 3K1YA 1M5RA 3B6MA 4P82A 2JFNA 4DQUA 4Y9DA 2WJPA 3MD0A 2Q29A 3I9NA 5KX5B 1AVTA 1QV9A 3Q72A 1JH9A 3IBFA 3ICPA 3DGEC 1JHQA 1YB7A 3GUCA 1OGIA 1NE7A 3PPVA 3SZUA 2W93A 2VC2B 4LPSA 5JPCA 4CQLA 2ZPUA 2OCKA 2Z9DA 2BM9A 3K96A 4F4JA 5ALZA 2CFIA 2GTIA 3PGLA 4XD7A 1SNYA 5KPJA 4KQXA 3HYTA 3HABA 2OHHA 4JBWA 4K0KB 2BVNA 5JWOA 2BZ1A 4XAQA 2OP0A 5FUQA 1EFPB 5CMLA 4CM1A 2IEDA 2X3UA 3RRBA 1TO1E 2HU7A 2B98A 4NJMA 4EG7A 1W2WB 3O93A 4HNTA 5FULA 1W9HA 3PE6A 1P5JA 4YJHA 4RVHA 2NU8A 3V1YA 4EVRA 3Q8XB 2OAEA 3BJIC 4JV5B 4JLKA 3P9IA 1DO2A 3M8KA 5EIAA 4DT1B 1MNQA 3IV6A 1YA4A 2F6RA 3H4IA 1X7YB 1EE2A 4C4TA 1VLHA 4RHCA 2CB9A 4A5OA 1E6WA 3EBOA 3BGWA 4NS1A 1V7CA 2PSEA 4IWYA 3ZZMA 1OX6A 1XCMA 4YALA 5FT9A 5TJHA 4QL3A 2EWMA 5JWHA 1F4VA 1TU3A 3R7AA 1QLHA 4XB2A 4MYSA 4N5IX 4PSAA 1THTA 2HHAA 2VRBA 5AM4A 3EEIA 2P9FA 3SC2A 5H4GA 5FP0A 2PBZA 3U1TA 1X3LA 1FMJA 3A4LA 4G8BA 5DV9A 1O97D 3INRA 5JZ9A 1UBHS 4R4JA 1ULTA 3P9XA 4NPAA 3HM9A 1VRWA 3OEWA 4OLHA 3O38A 1DCMA 5AXCA 5CAEB 5ETJA 3AEYA 4RVOA 5KJ1A 4HNSA 1JQDA 2FMXA 2W7TA 1FFWA 3CTMA 3L93A 2ZU0C 2QLJA 2JCBA 3LGXA 1G63A 3NYWA 1DTSA 4HAVA 4B35A 3WYCA 1IN8A 5CFNA 2BGUA 4W63A 3QE2A 1I7LA 4P6VF 4XIYA 5JZOA 4MUFA 1DINA 2ZUEA 3NOOA 4MR8A 2FRVA 2FPLA 4D25A 2H0AA 4MS3A 4D74A 3C98A 5DB4A 5DWVA 3AUSA 3O9ZA 3BREA 4IRXA 3PC4A 4IOMA 1KL7A 3IKJA 4MMXB 2WP8J 2HWYA 1ZD3A 2H7VA 4KXNA 3GLGE 2WM2A 1SKYB 1UC4B 2NUTB 4II3A 4BU1A 3UF0A 4JI8B 3RODA 1XZKA 1MBZA 2BEWA 2G07A 1B00A 2CK3D 3ZY4A 3QTTA 4N7BA 3UAZA 4KNYA 1JYEA 2QE6A 7MDHA 4M89A 5LYYA 3HJHA 4OATA 4WXMA 4CUJA 2G17A 4L5JA 5TARA 3N8HA 1YONA 2CBXA 3U4IA 1GPJA 1J99A 1RC1A 2V6MA 1IHDA 4MR9B 4GEKA 2RKBA 1HZJA 3ETDA 5H5JA 1CSEE 4MO9A 4DRZA 5EXXA 1DBWA 4LYFA 5JZBA 2GSWA 2EZ8A 1X0VA 1WB4A 3LZ6A 3WKEA 2V3CC </