2XT1A

Crystal structure of the hiv-1 capsid protein c-terminal domain (146- 231) in complex with a camelid vhh.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
86
structure length
86
Chain Sequence
SPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting HIV-1 Virion Formation with Nanobodies -Implications for the Design of Assembly Inhibitors
rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
molecule keywords GAG POLYPROTEIN
total genus 29
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2010-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2xt1A00
3VRLC 3MGEA 3P05A 3G28A 4U0CA 3DS4A 2L6EA 3H4EA 4COCA 3G1IA 3DS5A 3DTJA 4QNBA 5JPAA 2JO0A 3DPHA 4PH0A 1E6JP 3LRYA 4U0FA 1BAJA 1AUMA 4IPYA 3G29A 4U0AA 2XV6A 3G1GA 4PH1A 5I4TG 2BUOA 2EIAA 4XRQA 3DS1A 1EOQA 2XXMA 3NTEA 4U0BA 4XFYA 4U0EA 4WYMA 5HGLA 3G26A 3H47A 3DS2A 1QRJA 3DS3A 4XFXA 2M8NA 1A43A 5HGNA 1EIAA 1D1DA 2KODA 3DS0A 4XFZA 1A8OA 2LF4A 4U0DA 4XROA 2M8PA 4COPA 3G21A 2XT1A 3G0VA 2JYLA 5HGMA 5DCKA 2JYGA 4M0IA 5HGOA 2M8LA 2ONTA
chains in the Genus database with same CATH superfamily
4U0CA 3DS4A 5JPAA 5HV8A 3Q20A 4U0AA 1AF8A 3CCEP 3GKLC 2EG5A 4H2XC 4F37A 2LOLA 5EJDA 3RG6C 1S72P 1KLPA 3CC7P 1YI2P 1M1KQ 2PEJA 2FVAA 2GYKA 1JJ2O 1EOQA 2XZ0D 1VQ9P 5F2OA 5KP7B 1RO2A 1YIJP 1YHQP 2DGYA 2BHVA 3CC2P 1DV5A 2MVUA 1VQ5P 1OR5A 1VQLP 1NQ4A 3DTJA 1RO0A 3GZLA 2Z46A 2ROQA 1IMPA 1VQ4P 4DG9A 3EJEA 2LIUA 1KQSO 2X2BA 2N98A 2KG6A 1A8OA 2LF4A 2PY8A 2PENA 2Z45A 3B5IA 3CXCO 2KGDA 4PH1A 2CG5B 4XRQA 4XFYA 2K2QA 2FHSC 1M6EX 2KOPA 2QNWA 3H47A 2OARA 3B4QA 2GZFA 2KGCA 2KORA 2M8PA 3CE7A 2LPKA 2EHTA 3P05A 3CCVP 2AFDA 2XZ1C 5I4TG 2JB0A 3CCLP 1F80D 3M1MA 3CCMP 2K0XA 2XT1A 1W2BO 1GXGA 2KOSA 4GR2A 4BPFA 5BS1A 2XV6A 3G1GA 3CCUP 2L9FA 4NEOA 1VQ7P 3DS2A 2P9XA 1QVFO 2VLPA 2GZGA 3CD6P 2K93A 1K8AQ 2GDXA 3CMEP 3RG2A 2LL8A 3CCQP 4QNBA 2VSQA 5EW5E 1L0HA 1T8KA 2MF4A 3NTEA 2GDYA 2FADA 2K0DX 2MY5A 2GZIA 5F2KA 1ACPA 2GDWA 1D1DA 5HGNA 1FR2A 1EIAA 2KODA 2KWLA 3G4SP 3GJNA 3CCRP 2M5RA 1EMVA 2CQ8A 2CNRA 2FVFA 4IZ6A 2EIAA 5HVCA 2KW2A 2KGAA 2KG8A 2GZEA 2L22A 1GXHA 2JQ4A 5F2NA 3NY7B 1VQKP 3G1IA 4CA3A 5KP8B 2CWOA 3WBHA 2EFJA 2WPTA 3EJDA 2BUOA 2ERHA 4PWVB 1VQ6P 1HQBA 2MR8A 1KD1Q 1VQ8P 1A43A 2EHSA 1DNYA 2N50A 1YJWP 2VLQA 3CC4P 1VQOP 2K92A 2LMLA 1UJZA 1YITP 1Q7YQ 3G28A 1VHNA 3CMAP 4PXHB 2LKIA 2GZJA 2JGPA 3DPHA 4U0FA 2PEKA 2MD9A 2FAEA 1ZNVA 1M74A 2N5HA 4HKGA 2OTLP 2K0YA 1M90Q 1YJNP 2M8LA 2JAZA 1E6JP 1BAJA 4IPYA 2LIWA 4WYMA 1IMQA 4H2YC 2PEOA 2N5IA 1BXIA 3LMOA 2PEIA 4XFZA 4XROA 3G21A 4MRTC 2JYGA 4M0IA 4R0MA 3DS0A 3VRLC 3MGEA 2L6EA 3H4EA 3DS5A 1CEIA 3G29A 2KOOA 1Q82Q 3G6EP 2PNGA 4XFXA 2JU1A 1MZ8A 4BPHA 2L0QA 4COPA 3GZMA 2KG9A 2VLNA 5HGOA 4QKOA 4GR6A 4COCA 3CCJP 1Q86Q 2MR7A 2Z44A 1K73Q 2CGQA 2JO0A 1AUMA 1N8RQ 1M6NA 2PEMA 2DNWA 7CEIA 3I55P 1GPJA 2K94A 3DS3A 2K5XA 2NO8A 3U43A 2AFEA 2AF8A 2KR5A 4U0DA 2VLOA 3G0VA 2N6YA 5KP6B 2FQ0A 2FQ1A 3CCSP 2PEQA 4PH0A 2FVEA 3G71P 1RNIA 2KGEA 3DS1A 3HZQA 4H2WC 5HGLA 1L0IA 2MVVA 1QRJA 1YJ9P 3I56P 3CPWO 5HGMA 2N6ZA 2ONTA 2FQ2A 3EJBA 2AVAA 1VKUA 1VQNP 1ZMBA 2E1MA 1IUQA 2FACA 1Z6MA 1KC8Q 3OW2O 2JU2A 2QEXP 1QVGO 2L4BA 2LTEA 1K30A 5DCKA 4U0BA 3HYBA 4BPGA 1AYIA 2KOQA 2QA4P 1E0HA 3LRYA 4UHPB 5BS2A 1NJIQ 2OTJP 2XXMA 4U0EA 1VQMP 3G26A 1VQPP 1Q81Q 3H0DA 1K9MQ 1HY8A 2M8NA 1UNKA 5CZDB 1X3OA 2JYLA 3E2DA 2JBGA
chains in the Genus database with same CATH topology
3P05A 3CCVP 4GR6A 5F2NA 4U0CA 3DS4A 4COCA 3CCJP 1VQKP 1Q86Q 3G1IA 2Z44A 5JPAA 2CWOA 2JO0A 3WBHA 2EFJA 3Q20A 1K73Q 1AUMA 5I4TG 4U0AA 1N8RQ 2BUOA 3CCLP 1M6NA 2PEMA 3CCEP 2EG5A 3M1MA 3I55P 1VQ6P 3CCMP 3DS3A 1KD1Q 1VQ8P 1A43A 3RG6C 1YJWP 4U0DA 1S72P 3CC4P 2XT1A 3G0VA 1VQOP 1W2BO 3CC7P 1YI2P 1YITP 1Q7YQ 3G28A 4GR2A 1M1KQ 5BS1A 3CMAP 2PEJA 3CCSP 2PEQA 3DPHA 4PH0A 4U0FA 2PEKA 1JJ2O 3G71P 2XV6A 3G1GA 1RNIA 3CCUP 3DS1A 1EOQA 3HZQA 1VQ7P 5HGLA 1VQ9P 3DS2A 5F2OA 1M74A 2P9XA 1QRJA 1QVFO 1YJ9P 1RO2A 1YIJP 2OTLP 1YHQP 3CD6P 3I56P 1K8AQ 2DGYA 1M90Q 3CPWO 2BHVA 1YJNP 5HGMA 3CC2P 2M8LA 2ONTA 1VQ5P 3CMEP 1VQLP 3CCQP 3DTJA 4QNBA 1VQNP 1E6JP 1RO0A 2Z46A 1BAJA 4IPYA 1ZMBA 3NTEA 1VQ4P 2E1MA 1IUQA 4WYMA 1KQSO 5F2KA 1KC8Q 3OW2O 2PEOA 5HGNA 1D1DA 1EIAA 2QEXP 1QVGO 2KODA 2PEIA 1A8OA 2LF4A 1K30A 4XFZA 4XROA 3G4SP 3G21A 2PY8A 2PENA 5DCKA 2JYGA 4M0IA 2Z45A 3CCRP 3DS0A 4U0BA 3VRLC 3MGEA 3HYBA 2L6EA 3H4EA 3B5IA 3DS5A 3CXCO 2QA4P 3LRYA 3G29A 4PH1A 2EIAA 5BS2A 4XRQA 1NJIQ 2OTJP 2XXMA 4XFYA 1Q82Q 3G6EP 4U0EA 1VQMP 3G26A 1VQPP 1M6EX 3H47A 1Q81Q 3H0DA 4XFXA 2OARA 2M8NA 1K9MQ 4COPA 2M8PA 2JYLA 5HGOA 3E2DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VRL C;  3MGE A;  3P05 A;  3G28 A;  4U0C A;  3DS4 A;  2L6E A;  3H4E A;  4COC A;  3G1I A;  3DS5 A;  3DTJ A;  4QNB A;  5JPA A;  2JO0 A;  3DPH A;  4PH0 A;  1E6J P;  3LRY A;  4U0F A;  1BAJ A;  1AUM A;  4IPY A;  3G29 A;  4U0A A;  2XV6 A;  3G1G A;  4PH1 A;  5I4T G;  2BUO A;  2EIA A;  4XRQ A;  3DS1 A;  1EOQ A;  2XXM A;  3NTE A;  4U0B A;  4XFY A;  4U0E A;  4WYM A;  5HGL A;  3G26 A;  3H47 A;  3DS2 A;  1QRJ A;  3DS3 A;  4XFX A;  2M8N A;  1A43 A;  5HGN A;  1EIA A;  1D1D A;  2KOD A;  3DS0 A;  4XFZ A;  1A8O A;  2LF4 A;  4U0D A;  4XRO A;  2M8P A;  4COP A;  3G21 A;  2XT1 A;  3G0V A;  2JYL A;  5HGM A;  5DCK A;  2JYG A;  4M0I A;  5HGO A;  2M8L A;  2ONT A; 
#chains in the Genus database with same CATH topology
 4U0C A;  3DS4 A;  5JPA A;  5HV8 A;  3Q20 A;  4U0A A;  1AF8 A;  3CCE P;  3GKL C;  2EG5 A;  4H2X C;  4F37 A;  2LOL A;  5EJD A;  3RG6 C;  1S72 P;  1KLP A;  3CC7 P;  1YI2 P;  1M1K Q;  2PEJ A;  2FVA A;  2GYK A;  1JJ2 O;  1EOQ A;  2XZ0 D;  1VQ9 P;  5F2O A;  5KP7 B;  1RO2 A;  1YIJ P;  1YHQ P;  2DGY A;  2BHV A;  3CC2 P;  1DV5 A;  2MVU A;  1VQ5 P;  1OR5 A;  1VQL P;  1NQ4 A;  3DTJ A;  1RO0 A;  3GZL A;  2Z46 A;  2ROQ A;  1IMP A;  1VQ4 P;  4DG9 A;  3EJE A;  2LIU A;  1KQS O;  2X2B A;  2N98 A;  2KG6 A;  1A8O A;  2LF4 A;  2PY8 A;  2PEN A;  2Z45 A;  3B5I A;  3CXC O;  2KGD A;  4PH1 A;  2CG5 B;  4XRQ A;  4XFY A;  2K2Q A;  2FHS C;  1M6E X;  2KOP A;  2QNW A;  3H47 A;  2OAR A;  3B4Q A;  2GZF A;  2KGC A;  2KOR A;  2M8P A;  3CE7 A;  2LPK A;  2EHT A;  3P05 A;  3CCV P;  2AFD A;  2XZ1 C;  5I4T G;  2JB0 A;  3CCL P;  1F80 D;  3M1M A;  3CCM P;  2K0X A;  2XT1 A;  1W2B O;  1GXG A;  2KOS A;  4GR2 A;  4BPF A;  5BS1 A;  2XV6 A;  3G1G A;  3CCU P;  2L9F A;  4NEO A;  1VQ7 P;  3DS2 A;  2P9X A;  1QVF O;  2VLP A;  2GZG A;  3CD6 P;  2K93 A;  1K8A Q;  2GDX A;  3CME P;  3RG2 A;  2LL8 A;  3CCQ P;  4QNB A;  2VSQ A;  5EW5 E;  1L0H A;  1T8K A;  2MF4 A;  3NTE A;  2GDY A;  2FAD A;  2K0D X;  2MY5 A;  2GZI A;  5F2K A;  1ACP A;  2GDW A;  1D1D A;  5HGN A;  1FR2 A;  1EIA A;  2KOD A;  2KWL A;  3G4S P;  3GJN A;  3CCR P;  2M5R A;  1EMV A;  2CQ8 A;  2CNR A;  2FVF A;  4IZ6 A;  2EIA A;  5HVC A;  2KW2 A;  2KGA A;  2KG8 A;  2GZE A;  2L22 A;  1GXH A;  2JQ4 A;  5F2N A;  3NY7 B;  1VQK P;  3G1I A;  4CA3 A;  5KP8 B;  2CWO A;  3WBH A;  2EFJ A;  2WPT A;  3EJD A;  2BUO A;  2ERH A;  4PWV B;  1VQ6 P;  1HQB A;  2MR8 A;  1KD1 Q;  1VQ8 P;  1A43 A;  2EHS A;  1DNY A;  2N50 A;  1YJW P;  2VLQ A;  3CC4 P;  1VQO P;  2K92 A;  2LML A;  1UJZ A;  1YIT P;  1Q7Y Q;  3G28 A;  1VHN A;  3CMA P;  4PXH B;  2LKI A;  2GZJ A;  2JGP A;  3DPH A;  4U0F A;  2PEK A;  2MD9 A;  2FAE A;  1ZNV A;  1M74 A;  2N5H A;  4HKG A;  2OTL P;  2K0Y A;  1M90 Q;  1YJN P;  2M8L A;  2JAZ A;  1E6J P;  1BAJ A;  4IPY A;  2LIW A;  4WYM A;  1IMQ A;  4H2Y C;  2PEO A;  2N5I A;  1BXI A;  3LMO A;  2PEI A;  4XFZ A;  4XRO A;  3G21 A;  4MRT C;  2JYG A;  4M0I A;  4R0M A;  3DS0 A;  3VRL C;  3MGE A;  2L6E A;  3H4E A;  3DS5 A;  1CEI A;  3G29 A;  2KOO A;  1Q82 Q;  3G6E P;  2PNG A;  4XFX A;  2JU1 A;  1MZ8 A;  4BPH A;  2L0Q A;  4COP A;  3GZM A;  2KG9 A;  2VLN A;  5HGO A;  4QKO A;  4GR6 A;  4COC A;  3CCJ P;  1Q86 Q;  2MR7 A;  2Z44 A;  1K73 Q;  2CGQ A;  2JO0 A;  1AUM A;  1N8R Q;  1M6N A;  2PEM A;  2DNW A;  7CEI A;  3I55 P;  1GPJ A;  2K94 A;  3DS3 A;  2K5X A;  2NO8 A;  3U43 A;  2AFE A;  2AF8 A;  2KR5 A;  4U0D A;  2VLO A;  3G0V A;  2N6Y A;  5KP6 B;  2FQ0 A;  2FQ1 A;  3CCS P;  2PEQ A;  4PH0 A;  2FVE A;  3G71 P;  1RNI A;  2KGE A;  3DS1 A;  3HZQ A;  4H2W C;  5HGL A;  1L0I A;  2MVV A;  1QRJ A;  1YJ9 P;  3I56 P;  3CPW O;  5HGM A;  2N6Z A;  2ONT A;  2FQ2 A;  3EJB A;  2AVA A;  1VKU A;  1VQN P;  1ZMB A;  2E1M A;  1IUQ A;  2FAC A;  1Z6M A;  1KC8 Q;  3OW2 O;  2JU2 A;  2QEX P;  1QVG O;  2L4B A;  2LTE A;  1K30 A;  5DCK A;  4U0B A;  3HYB A;  4BPG A;  1AYI A;  2KOQ A;  2QA4 P;  1E0H A;  3LRY A;  4UHP B;  5BS2 A;  1NJI Q;  2OTJ P;  2XXM A;  4U0E A;  1VQM P;  3G26 A;  1VQP P;  1Q81 Q;  3H0D A;  1K9M Q;  1HY8 A;  2M8N A;  1UNK A;  5CZD B;  1X3O A;  2JYL A;  3E2D A;  2JBG A; 
#chains in the Genus database with same CATH homology
 3P05 A;  3CCV P;  4GR6 A;  5F2N A;  4U0C A;  3DS4 A;  4COC A;  3CCJ P;  1VQK P;  1Q86 Q;  3G1I A;  2Z44 A;  5JPA A;  2CWO A;  2JO0 A;  3WBH A;  2EFJ A;  3Q20 A;  1K73 Q;  1AUM A;  5I4T G;  4U0A A;  1N8R Q;  2BUO A;  3CCL P;  1M6N A;  2PEM A;  3CCE P;  2EG5 A;  3M1M A;  3I55 P;  1VQ6 P;  3CCM P;  3DS3 A;  1KD1 Q;  1VQ8 P;  1A43 A;  3RG6 C;  1YJW P;  4U0D A;  1S72 P;  3CC4 P;  2XT1 A;  3G0V A;  1VQO P;  1W2B O;  3CC7 P;  1YI2 P;  1YIT P;  1Q7Y Q;  3G28 A;  4GR2 A;  1M1K Q;  5BS1 A;  3CMA P;  2PEJ A;  3CCS P;  2PEQ A;  3DPH A;  4PH0 A;  4U0F A;  2PEK A;  1JJ2 O;  3G71 P;  2XV6 A;  3G1G A;  1RNI A;  3CCU P;  3DS1 A;  1EOQ A;  3HZQ A;  1VQ7 P;  5HGL A;  1VQ9 P;  3DS2 A;  5F2O A;  1M74 A;  2P9X A;  1QRJ A;  1QVF O;  1YJ9 P;  1RO2 A;  1YIJ P;  2OTL P;  1YHQ P;  3CD6 P;  3I56 P;  1K8A Q;  2DGY A;  1M90 Q;  3CPW O;  2BHV A;  1YJN P;  5HGM A;  3CC2 P;  2M8L A;  2ONT A;  1VQ5 P;  3CME P;  1VQL P;  3CCQ P;  3DTJ A;  4QNB A;  1VQN P;  1E6J P;  1RO0 A;  2Z46 A;  1BAJ A;  4IPY A;  1ZMB A;  3NTE A;  1VQ4 P;  2E1M A;  1IUQ A;  4WYM A;  1KQS O;  5F2K A;  1KC8 Q;  3OW2 O;  2PEO A;  5HGN A;  1D1D A;  1EIA A;  2QEX P;  1QVG O;  2KOD A;  2PEI A;  1A8O A;  2LF4 A;  1K30 A;  4XFZ A;  4XRO A;  3G4S P;  3G21 A;  2PY8 A;  2PEN A;  5DCK A;  2JYG A;  4M0I A;  2Z45 A;  3CCR P;  3DS0 A;  4U0B A;  3VRL C;  3MGE A;  3HYB A;  2L6E A;  3H4E A;  3B5I A;  3DS5 A;  3CXC O;  2QA4 P;  3LRY A;  3G29 A;  4PH1 A;  2EIA A;  5BS2 A;  4XRQ A;  1NJI Q;  2OTJ P;  2XXM A;  4XFY A;  1Q82 Q;  3G6E P;  4U0E A;  1VQM P;  3G26 A;  1VQP P;  1M6E X;  3H47 A;  1Q81 Q;  3H0D A;  4XFX A;  2OAR A;  2M8N A;  1K9M Q;  4COP A;  2M8P A;  2JYL A;  5HGO A;  3E2D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...