2XT1A

Crystal structure of the hiv-1 capsid protein c-terminal domain (146- 231) in complex with a camelid vhh.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
86
structure length
86
Chain Sequence
b'SPTSILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPGATLEEMMTACQGVGGPGHKARVL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GAG POLYPROTEIN
publication title Targeting HIV-1 Virion Formation with Nanobodies -Implications for the Design of Assembly Inhibitors
rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein/immune system
total genus 29
structure length 86
sequence length 86
ec nomenclature
pdb deposition date 2010-10-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1200.30 Mainly Alpha Orthogonal Bundle Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A Non-ribosomal Peptide Synthetase Peptidyl Carrier Protein; Chain A 2xt1A00
1A43A 4COCA 3DS1A 2EIAA 3H47A 3G26A 4U0FA 4IPYA 4U0CA 3G28A 2L6EA 3H4EA 2ONTA 1D1DA 4U0BA 3G1IA 2BUOA 4XFYA 1BAJA 4COPA 1EOQA 3G21A 3DS4A 4QNBA 2XV6A 1EIAA 4U0AA 3G0VA 5JPAA 3LRYA 4PH0A 3G29A 2M8LA 1QRJA 2KODA 3P05A 3G1GA 4XRQA 2M8NA 4XFZA 5HGOA 3DS3A 3DS0A 3DPHA 4WYMA 3DS2A 5HGMA 2JYLA 3VRLC 5DCKA 3NTEA 4M0IA 3MGEA 5I4TG 1AUMA 4XROA 4U0EA 4U0DA 5HGLA 1E6JP 2M8PA 5HGNA 2JYGA 4XFXA 2XXMA 1A8OA 4PH1A 2LF4A 2JO0A 3DTJA 3DS5A 2XT1A
chains in the Genus database with same CATH superfamily
2L22A 2EIAA 3CC2P 2GYKA 2MR7A 1ZMBA 2L6EA 2BUOA 2LIWA 2LL8A 1W2BO 2M5RA 1QRJA 2PEJA 1X3OA 3EJBA 2XZ1C 2FVFA 2Z44A 1Q82Q 2FQ1A 7CEIA 2K0XA 4UHPB 2N6ZA 2LOLA 1AF8A 2KGAA 1RO2A 5KP7B 3LRYA 2AF8A 2K92A 2X2BA 3DS3A 4WYMA 1Q86Q 3CCLP 2JBGA 2PEIA 3G6EP 2BHVA 2CG5B 2DGYA 3CD6P 3H4EA 1E0HA 4QNBA 2N6YA 5JPAA 3B4QA 2LTEA 2FQ2A 3NY7B 2GDYA 1VKUA 2KG8A 1L0IA 1A43A 1GXGA 4R0MA 2QNWA 1D1DA 4XFYA 1BAJA 2KOPA 1Q7YQ 1ACPA 3CMAP 1QVFO 3CCEP 2KODA 2MR8A 3P05A 1HY8A 4XFZA 2K94A 2N98A 4IZ6A 1VQKP 2KR5A 2XZ0D 3HYBA 1AUMA 2JU2A 5HGLA 1E6JP 1M74A 4HKGA 3I55P 2KGDA 4PH1A 2XT1A 1OR5A 3G4SP 3G1IA 5F2NA 1EOQA 1GPJA 1VQ4P 2N50A 2KOOA 3G1GA 3RG6C 5HGMA 2E1MA 3CXCO 2GZJA 2VLOA 1KLPA 2JYGA 1FR2A 1M1KQ 2FADA 1NJIQ 4H2WC 3CCVP 2AFEA 2OTJP 1K9MQ 2FAEA 2GZEA 3CC7P 4NEOA 1YHQP 2FVEA 2NO8A 1T8KA 5DCKA 2LIUA 2Z46A 3MGEA 4CA3A 1YJ9P 4U0EA 4U0DA 4BPGA 5HGNA 5KP6B 2QA4P 2KORA 1IMQA 2KOQA 3DS5A 2LMLA 4PWVB 1BXIA 3CCMP 3GJNA 4COPA 2JB0A 1AYIA 2K2QA 4GR2A 1M6NA 5F2KA 3GKLC 2N5IA 4MRTC 2CNRA 2GZFA 4XROA 5HV8A 1F80D 1VQOP 1VQ6P 1IUQA 1ZNVA 3G28A 3U43A 5KP8B 1YIJP 1N8RQ 1KC8Q 1VQ7P 3CCSP 4F37A 1RNIA 3CCJP 2LF4A 2FHSC 2K5XA 2PEKA 3WBHA 1Z6MA 2FVAA 2JGPA 2LKIA 1JJ2O 1M90Q 1M6EX 3G29A 2M8LA 2PEMA 4H2XC 5HGOA 1UNKA 3DS0A 3NTEA 2CQ8A 1K8AQ 2K93A 1MZ8A 3CCRP 2K0DX 1DNYA 2L9FA 1K30A 2KGEA 2PEQA 2VLPA 3M1MA 2KOSA 2KW2A 4U0FA 4IPYA 1K73Q 3Q20A 3EJDA 3DS4A 2XV6A 2KG6A 4GR6A 2L4BA 1S72P 3DPHA 2ERHA 3EJEA 5I4TG 1RO0A 5F2OA 2QEXP 2MD9A 3H47A 2VLQA 3CC4P 2PENA 2MVVA 2ONTA 4U0AA 4BPHA 3G71P 2EFJA 1CEIA 1VHNA 3CMEP 1HQBA 5EJDA 1YITP 2OARA 2OTLP 1GXHA 2XXMA 1KD1Q 2GZIA 2L0QA 3CE7A 5CZDB 1VQMP 1Q81Q 4U0BA 2VLNA 3GZLA 3G0VA 4XRQA 2CGQA 2AFDA 3VRLC 2MF4A 4DG9A 5BS2A 2P9XA 1VQNP 2GZGA 2MVUA 1KQSO 4H2YC 2VSQA 1YJNP 5BS1A 2JQ4A 3I56P 3G21A 2EG5A 1EMVA 1QVGO 3RG2A 2AVAA 3DS2A 2CWOA 2K0YA 4M0IA 2FACA 2KWLA 3H0DA 2Z45A 2N5HA 4XFXA 2PY8A 2JO0A 2LPKA 4COCA 3DS1A 4QKOA 4U0CA 1YJWP 1EIAA 2ROQA 5EW5E 2JYLA 1L0HA 3E2DA 2KGCA 3CCQP 2MY5A 1IMPA 5HVCA 3B5IA 3G26A 1NQ4A 1VQ9P 1VQ5P 3OW2O 3GZMA 2KG9A 3CPWO 1YI2P 2JU1A 2EHTA 3LMOA 2GDWA 1VQ8P 1UJZA 3HZQA 2EHSA 2FQ0A 2GDXA 2DNWA 2PNGA 4PH0A 3CCUP 1VQPP 4PXHB 2JAZA 2M8NA 1DV5A 4BPFA 2PEOA 2M8PA 1A8OA 3DTJA 2WPTA 1VQLP
chains in the Genus database with same CATH topology
2EIAA 2PEKA 3CC2P 3WBHA 1KQSO 1ZMBA 2L6EA 3G4SP 1YJNP 1JJ2O 5BS1A 3G1IA 2BUOA 1M6EX 5F2NA 1M90Q 1EOQA 3G21A 3I56P 2EG5A 1W2BO 3G29A 2M8LA 1QVGO 1VQ4P 1QRJA 2PEJA 2PEMA 3G1GA 5HGOA 3RG6C 3DS0A 5HGMA 3DS2A 2CWOA 3NTEA 2E1MA 4M0IA 3CXCO 3H0DA 1K8AQ 2Z45A 2JYGA 2Z44A 4XFXA 1Q82Q 2PY8A 1M1KQ 3CCRP 2JO0A 1NJIQ 1K30A 2PEQA 4COCA 3DS1A 3M1MA 3CCVP 4U0FA 4IPYA 4U0CA 1K73Q 3Q20A 2OTJP 1K9MQ 1RO2A 1YJWP 3DS4A 2XV6A 1EIAA 3LRYA 4GR6A 3CC7P 1YHQP 1S72P 3DS3A 3DPHA 4WYMA 1Q86Q 2JYLA 3CCLP 5DCKA 2Z46A 2PEIA 3E2DA 3MGEA 3G6EP 5I4TG 1YJ9P 1RO0A 4U0EA 4U0DA 5F2OA 5HGNA 3CCQP 2QEXP 2QA4P 2BHVA 3B5IA 3DS5A 2DGYA 3H47A 3G26A 1VQ9P 3CC4P 3CD6P 2PENA 1VQ5P 3OW2O 3H4EA 2ONTA 3CCMP 4COPA 4QNBA 3CPWO 1YI2P 4U0AA 5JPAA 3G71P 2EFJA 4GR2A 1M6NA 5F2KA 1VQ8P 3CMEP 1YITP 2OTLP 2OARA 4XROA 3HZQA 2XXMA 1KD1Q 1VQOP 1VQ6P 1A43A 1IUQA 1VQMP 3G28A 1D1DA 1Q81Q 4U0BA 4XFYA 1BAJA 3G0VA 4PH0A 1Q7YQ 3CMAP 3CCUP 1VQPP 1QVFO 1YIJP 3CCEP 2KODA 3P05A 1N8RQ 4XRQA 2M8NA 4XFZA 1KC8Q 1VQ7P 3VRLC 3CCSP 1VQKP 3HYBA 1AUMA 2PEOA 5BS2A 1RNIA 5HGLA 1E6JP 1M74A 2M8PA 2P9XA 3I55P 1VQNP 1A8OA 4PH1A 3CCJP 2LF4A 3DTJA 2XT1A 1VQLP
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A43 A;  4COC A;  3DS1 A;  2EIA A;  3H47 A;  3G26 A;  4U0F A;  4IPY A;  4U0C A;  3G28 A;  2L6E A;  3H4E A;  2ONT A;  1D1D A;  4U0B A;  3G1I A;  2BUO A;  4XFY A;  1BAJ A;  4COP A;  1EOQ A;  3G21 A;  3DS4 A;  4QNB A;  2XV6 A;  1EIA A;  4U0A A;  3G0V A;  5JPA A;  3LRY A;  4PH0 A;  3G29 A;  2M8L A;  1QRJ A;  2KOD A;  3P05 A;  3G1G A;  4XRQ A;  2M8N A;  4XFZ A;  5HGO A;  3DS3 A;  3DS0 A;  3DPH A;  4WYM A;  3DS2 A;  5HGM A;  2JYL A;  3VRL C;  5DCK A;  3NTE A;  4M0I A;  3MGE A;  5I4T G;  1AUM A;  4XRO A;  4U0E A;  4U0D A;  5HGL A;  1E6J P;  2M8P A;  5HGN A;  2JYG A;  4XFX A;  2XXM A;  1A8O A;  4PH1 A;  2LF4 A;  2JO0 A;  3DTJ A;  3DS5 A;  2XT1 A; 
#chains in the Genus database with same CATH topology
 2L22 A;  2EIA A;  3CC2 P;  2GYK A;  2MR7 A;  1ZMB A;  2L6E A;  2BUO A;  2LIW A;  2LL8 A;  1W2B O;  2M5R A;  1QRJ A;  2PEJ A;  1X3O A;  3EJB A;  2XZ1 C;  2FVF A;  2Z44 A;  1Q82 Q;  2FQ1 A;  7CEI A;  2K0X A;  4UHP B;  2N6Z A;  2LOL A;  1AF8 A;  2KGA A;  1RO2 A;  5KP7 B;  3LRY A;  2AF8 A;  2K92 A;  2X2B A;  3DS3 A;  4WYM A;  1Q86 Q;  3CCL P;  2JBG A;  2PEI A;  3G6E P;  2BHV A;  2CG5 B;  2DGY A;  3CD6 P;  3H4E A;  1E0H A;  4QNB A;  2N6Y A;  5JPA A;  3B4Q A;  2LTE A;  2FQ2 A;  3NY7 B;  2GDY A;  1VKU A;  2KG8 A;  1L0I A;  1A43 A;  1GXG A;  4R0M A;  2QNW A;  1D1D A;  4XFY A;  1BAJ A;  2KOP A;  1Q7Y Q;  1ACP A;  3CMA P;  1QVF O;  3CCE P;  2KOD A;  2MR8 A;  3P05 A;  1HY8 A;  4XFZ A;  2K94 A;  2N98 A;  4IZ6 A;  1VQK P;  2KR5 A;  2XZ0 D;  3HYB A;  1AUM A;  2JU2 A;  5HGL A;  1E6J P;  1M74 A;  4HKG A;  3I55 P;  2KGD A;  4PH1 A;  2XT1 A;  1OR5 A;  3G4S P;  3G1I A;  5F2N A;  1EOQ A;  1GPJ A;  1VQ4 P;  2N50 A;  2KOO A;  3G1G A;  3RG6 C;  5HGM A;  2E1M A;  3CXC O;  2GZJ A;  2VLO A;  1KLP A;  2JYG A;  1FR2 A;  1M1K Q;  2FAD A;  1NJI Q;  4H2W C;  3CCV P;  2AFE A;  2OTJ P;  1K9M Q;  2FAE A;  2GZE A;  3CC7 P;  4NEO A;  1YHQ P;  2FVE A;  2NO8 A;  1T8K A;  5DCK A;  2LIU A;  2Z46 A;  3MGE A;  4CA3 A;  1YJ9 P;  4U0E A;  4U0D A;  4BPG A;  5HGN A;  5KP6 B;  2QA4 P;  2KOR A;  1IMQ A;  2KOQ A;  3DS5 A;  2LML A;  4PWV B;  1BXI A;  3CCM P;  3GJN A;  4COP A;  2JB0 A;  1AYI A;  2K2Q A;  4GR2 A;  1M6N A;  5F2K A;  3GKL C;  2N5I A;  4MRT C;  2CNR A;  2GZF A;  4XRO A;  5HV8 A;  1F80 D;  1VQO P;  1VQ6 P;  1IUQ A;  1ZNV A;  3G28 A;  3U43 A;  5KP8 B;  1YIJ P;  1N8R Q;  1KC8 Q;  1VQ7 P;  3CCS P;  4F37 A;  1RNI A;  3CCJ P;  2LF4 A;  2FHS C;  2K5X A;  2PEK A;  3WBH A;  1Z6M A;  2FVA A;  2JGP A;  2LKI A;  1JJ2 O;  1M90 Q;  1M6E X;  3G29 A;  2M8L A;  2PEM A;  4H2X C;  5HGO A;  1UNK A;  3DS0 A;  3NTE A;  2CQ8 A;  1K8A Q;  2K93 A;  1MZ8 A;  3CCR P;  2K0D X;  1DNY A;  2L9F A;  1K30 A;  2KGE A;  2PEQ A;  2VLP A;  3M1M A;  2KOS A;  2KW2 A;  4U0F A;  4IPY A;  1K73 Q;  3Q20 A;  3EJD A;  3DS4 A;  2XV6 A;  2KG6 A;  4GR6 A;  2L4B A;  1S72 P;  3DPH A;  2ERH A;  3EJE A;  5I4T G;  1RO0 A;  5F2O A;  2QEX P;  2MD9 A;  3H47 A;  2VLQ A;  3CC4 P;  2PEN A;  2MVV A;  2ONT A;  4U0A A;  4BPH A;  3G71 P;  2EFJ A;  1CEI A;  1VHN A;  3CME P;  1HQB A;  5EJD A;  1YIT P;  2OAR A;  2OTL P;  1GXH A;  2XXM A;  1KD1 Q;  2GZI A;  2L0Q A;  3CE7 A;  5CZD B;  1VQM P;  1Q81 Q;  4U0B A;  2VLN A;  3GZL A;  3G0V A;  4XRQ A;  2CGQ A;  2AFD A;  3VRL C;  2MF4 A;  4DG9 A;  5BS2 A;  2P9X A;  1VQN P;  2GZG A;  2MVU A;  1KQS O;  4H2Y C;  2VSQ A;  1YJN P;  5BS1 A;  2JQ4 A;  3I56 P;  3G21 A;  2EG5 A;  1EMV A;  1QVG O;  3RG2 A;  2AVA A;  3DS2 A;  2CWO A;  2K0Y A;  4M0I A;  2FAC A;  2KWL A;  3H0D A;  2Z45 A;  2N5H A;  4XFX A;  2PY8 A;  2JO0 A;  2LPK A;  4COC A;  3DS1 A;  4QKO A;  4U0C A;  1YJW P;  1EIA A;  2ROQ A;  5EW5 E;  2JYL A;  1L0H A;  3E2D A;  2KGC A;  3CCQ P;  2MY5 A;  1IMP A;  5HVC A;  3B5I A;  3G26 A;  1NQ4 A;  1VQ9 P;  1VQ5 P;  3OW2 O;  3GZM A;  2KG9 A;  3CPW O;  1YI2 P;  2JU1 A;  2EHT A;  3LMO A;  2GDW A;  1VQ8 P;  1UJZ A;  3HZQ A;  2EHS A;  2FQ0 A;  2GDX A;  2DNW A;  2PNG A;  4PH0 A;  3CCU P;  1VQP P;  4PXH B;  2JAZ A;  2M8N A;  1DV5 A;  4BPF A;  2PEO A;  2M8P A;  1A8O A;  3DTJ A;  2WPT A;  1VQL P; 
#chains in the Genus database with same CATH homology
 2EIA A;  2PEK A;  3CC2 P;  3WBH A;  1KQS O;  1ZMB A;  2L6E A;  3G4S P;  1YJN P;  1JJ2 O;  5BS1 A;  3G1I A;  2BUO A;  1M6E X;  5F2N A;  1M90 Q;  1EOQ A;  3G21 A;  3I56 P;  2EG5 A;  1W2B O;  3G29 A;  2M8L A;  1QVG O;  1VQ4 P;  1QRJ A;  2PEJ A;  2PEM A;  3G1G A;  5HGO A;  3RG6 C;  3DS0 A;  5HGM A;  3DS2 A;  2CWO A;  3NTE A;  2E1M A;  4M0I A;  3CXC O;  3H0D A;  1K8A Q;  2Z45 A;  2JYG A;  2Z44 A;  4XFX A;  1Q82 Q;  2PY8 A;  1M1K Q;  3CCR P;  2JO0 A;  1NJI Q;  1K30 A;  2PEQ A;  4COC A;  3DS1 A;  3M1M A;  3CCV P;  4U0F A;  4IPY A;  4U0C A;  1K73 Q;  3Q20 A;  2OTJ P;  1K9M Q;  1RO2 A;  1YJW P;  3DS4 A;  2XV6 A;  1EIA A;  3LRY A;  4GR6 A;  3CC7 P;  1YHQ P;  1S72 P;  3DS3 A;  3DPH A;  4WYM A;  1Q86 Q;  2JYL A;  3CCL P;  5DCK A;  2Z46 A;  2PEI A;  3E2D A;  3MGE A;  3G6E P;  5I4T G;  1YJ9 P;  1RO0 A;  4U0E A;  4U0D A;  5F2O A;  5HGN A;  3CCQ P;  2QEX P;  2QA4 P;  2BHV A;  3B5I A;  3DS5 A;  2DGY A;  3H47 A;  3G26 A;  1VQ9 P;  3CC4 P;  3CD6 P;  2PEN A;  1VQ5 P;  3OW2 O;  3H4E A;  2ONT A;  3CCM P;  4COP A;  4QNB A;  3CPW O;  1YI2 P;  4U0A A;  5JPA A;  3G71 P;  2EFJ A;  4GR2 A;  1M6N A;  5F2K A;  1VQ8 P;  3CME P;  1YIT P;  2OTL P;  2OAR A;  4XRO A;  3HZQ A;  2XXM A;  1KD1 Q;  1VQO P;  1VQ6 P;  1A43 A;  1IUQ A;  1VQM P;  3G28 A;  1D1D A;  1Q81 Q;  4U0B A;  4XFY A;  1BAJ A;  3G0V A;  4PH0 A;  1Q7Y Q;  3CMA P;  3CCU P;  1VQP P;  1QVF O;  1YIJ P;  3CCE P;  2KOD A;  3P05 A;  1N8R Q;  4XRQ A;  2M8N A;  4XFZ A;  1KC8 Q;  1VQ7 P;  3VRL C;  3CCS P;  1VQK P;  3HYB A;  1AUM A;  2PEO A;  5BS2 A;  1RNI A;  5HGL A;  1E6J P;  1M74 A;  2M8P A;  2P9X A;  3I55 P;  1VQN P;  1A8O A;  4PH1 A;  3CCJ P;  2LF4 A;  3DTJ A;  2XT1 A;  1VQL P; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...