2XT4A

Structure of the pentapeptide repeat protein albg, a resistance factor for the topoisomerase poison albicidin.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
185
structure length
185
Chain Sequence
KDYCGESFVSEDRSGQSLESIRFEDCTFRQCNFTEAELNRCKFRECEFVDCNLSLISIPQTSFMEVRFVDCKMLGVNWTSAQAGALSFERCILNDSLFYGLYLAGVKMVECRIHDANFTEADCEDADFTQSDLKGSTFHNTKLTGASFIDAVNYHIDIFHNDIKRARFSLPEAASLLNSLDIELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MCBG-LIKE PROTEIN
publication title Pentapeptide-Repeat Proteins that Act as Topoisomerase Poison Resistance Factors Have a Common Dimer Interface.
pubmed doi rcsb
source organism Xanthomonas albilineans
molecule tags Cell cycle
total genus 76
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 2xt4A00
2XTXA 3DU1X 4YEIA 2XTWA 4YFOA 4YCQA 4YDTA 3NAWA 3PSSA 3SY2A 3NB2A 2XT2A 3PSZA 2QZAA 4YC5A 2XT4A 2J8KA 5DNSA 2QYUA 2XTYA 2O6WA 3SQVA
chains in the Genus database with same CATH superfamily
3BH6B 3DU1X 1TYUA 2NTPA 3PETA 2VBEA 2BM5A 4OZZA 2Z8GA 1O8LA 4XNFA 2X6XA 3N6ZA 4YCQA 4XLFA 2YUHA 3GQ8A 1OFEA 2VFMA 3NAWA 1JRGA 1LLZA 3SY2A 4EW9A 2PYGA 1O8GA 2UVEA 1OGOX 2VFNA 1O88A 1RU4A 3EQOA 1OFDA 1O8EA 1O8IA 4XOPA 4PMHA 3T9GA 1IA5A 3B90A 1PE9A 4OZYA 1CZFA 1QJVA 1LLWA 4OJLA 1JTAA 1EZGA 4U4BA 4YEJA 1WMRA 1LM1A 4OJPA 5AMVA 3RIQA 2XTXA 1QA1A 3EQNA 4OM9A 4OJ5A 4W8TA 1BHEA 3TH0A 1EA0A 3VMVA 2VFOA 3P4GA 4OPWA 2IOUG 4XM3A 1QRCA 1OFLA 4XMYA 5C1EA 2BX6A 2NT6A 3NB2A 4W8RA 2XT2A 1PXZA 3PSZA 2O0WA 1K5CA 1HF2A 1QA2A 1DBGA 1O8HA 2XT4A 3KRGA 1BN8A 4XLEA 3UW0A 1EE6A 4OJOA 4XONA 3GQ9A 4URRA 4YZ0A 1VBLA 2NT9A 2B0RA 2X6YA 2VFQA 5DNSA 1TYXA 1XG2A 2V5IA 4JRAC 2O04A 1X0CA 4OJ6A 1RWRA 2VBMA 2J8IA 2QXZA 3JX8A 2NTBA 3VSUA 1QRBA 2QYUA 2O6WA 2X6WA 3SYJA 1IDJA 3VMWA 4Z03A 3BH7B 3GRHA 4XKVA 4YEIA 4W8SA 5JLVC 2XC1A 2X3HA 5C1CA 4KH3A 1O8FA 2BSPA 3B4NA 3LYCA 1KCCA 3WWGA 1IB4A 1AIRA 2O1DA 4YDTA 4YZXA 3PSSA 4XLHA 1QCXA 1TYWA 1OGMX 1WXRA 4YC5A 4I84A 3LMWA 4XORA 1KQ5A 4NK8A 1O8DA 1OOCA 1KCDA 1DABA 3GQAA 2VBKA 4XQFA 4XKWA 1PLUA 3VSVA 1CLWA 3VSTA 2INUA 2XTYA 3SQVA 2PYHA 1QA3A 2QY1A 1HG8A 1TYVA 3LJYA 1QQ1A 4XLAA 2ODLA 2XTWA 4YZAA 2BM7A 5JMCB 4YELA 1IDKA 4YFOA 4Z06A 4U49A 3GQ7A 1L1IA 2G0YA 3JURA 3B8YA 3AK5A 1O8MA 2BM6A 2X85A 3H09A 2QZAA 3SUCA 1TSPA 2BM4A 1O8KA 4MR0A 4XL9A 4YZQA 1K4ZA 2J8KA 2UVFA 4C2LA 2QX3A 2O17A 2F3LA 1KTWA 2VJJA 3ML3A 4MXNA 3N90A 4AVZA 4XOTA 3ZSCA 2VJIA 2O0VA 1DBOA 4XN3A 3FY3A 2EWEA 2NTQA 4V02C 1O8JA 4NK6A 2NZMA 3ZPPA 1NHCA 4HWVA 4XN0A 2PECA 1OFMA 1RMGA 1K8FA 2IQ7A 2VFPA 2INVA 3SZEA 4Z05A 1GQ8A 2W7ZA 4XR6A 2NSPA 2NSTA 4W8QA 1H80A 4XLCA
chains in the Genus database with same CATH topology
2XTXA 3DU1X 4YEIA 2XTWA 4YFOA 4YCQA 4YDTA 3NAWA 3PSSA 3SY2A 3NB2A 2XT2A 3PSZA 2QZAA 4YC5A 2XT4A 2J8KA 5DNSA 2QYUA 2XTYA 2O6WA 3SQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XTX A;  3DU1 X;  4YEI A;  2XTW A;  4YFO A;  4YCQ A;  4YDT A;  3NAW A;  3PSS A;  3SY2 A;  3NB2 A;  2XT2 A;  3PSZ A;  2QZA A;  4YC5 A;  2XT4 A;  2J8K A;  5DNS A;  2QYU A;  2XTY A;  2O6W A;  3SQV A; 
#chains in the Genus database with same CATH topology
 3BH6 B;  3DU1 X;  1TYU A;  2NTP A;  3PET A;  2VBE A;  2BM5 A;  4OZZ A;  2Z8G A;  1O8L A;  4XNF A;  2X6X A;  3N6Z A;  4YCQ A;  4XLF A;  2YUH A;  3GQ8 A;  1OFE A;  2VFM A;  3NAW A;  1JRG A;  1LLZ A;  3SY2 A;  4EW9 A;  2PYG A;  1O8G A;  2UVE A;  1OGO X;  2VFN A;  1O88 A;  1RU4 A;  3EQO A;  1OFD A;  1O8E A;  1O8I A;  4XOP A;  4PMH A;  3T9G A;  1IA5 A;  3B90 A;  1PE9 A;  4OZY A;  1CZF A;  1QJV A;  1LLW A;  4OJL A;  1JTA A;  1EZG A;  4U4B A;  4YEJ A;  1WMR A;  1LM1 A;  4OJP A;  5AMV A;  3RIQ A;  2XTX A;  1QA1 A;  3EQN A;  4OM9 A;  4OJ5 A;  4W8T A;  1BHE A;  3TH0 A;  1EA0 A;  3VMV A;  2VFO A;  3P4G A;  4OPW A;  2IOU G;  4XM3 A;  1QRC A;  1OFL A;  4XMY A;  5C1E A;  2BX6 A;  2NT6 A;  3NB2 A;  4W8R A;  2XT2 A;  1PXZ A;  3PSZ A;  2O0W A;  1K5C A;  1HF2 A;  1QA2 A;  1DBG A;  1O8H A;  2XT4 A;  3KRG A;  1BN8 A;  4XLE A;  3UW0 A;  1EE6 A;  4OJO A;  4XON A;  3GQ9 A;  4URR A;  4YZ0 A;  1VBL A;  2NT9 A;  2B0R A;  2X6Y A;  2VFQ A;  5DNS A;  1TYX A;  1XG2 A;  2V5I A;  4JRA C;  2O04 A;  1X0C A;  4OJ6 A;  1RWR A;  2VBM A;  2J8I A;  2QXZ A;  3JX8 A;  2NTB A;  3VSU A;  1QRB A;  2QYU A;  2O6W A;  2X6W A;  3SYJ A;  1IDJ A;  3VMW A;  4Z03 A;  3BH7 B;  3GRH A;  4XKV A;  4YEI A;  4W8S A;  5JLV C;  2XC1 A;  2X3H A;  5C1C A;  4KH3 A;  1O8F A;  2BSP A;  3B4N A;  3LYC A;  1KCC A;  3WWG A;  1IB4 A;  1AIR A;  2O1D A;  4YDT A;  4YZX A;  3PSS A;  4XLH A;  1QCX A;  1TYW A;  1OGM X;  1WXR A;  4YC5 A;  4I84 A;  3LMW A;  4XOR A;  1KQ5 A;  4NK8 A;  1O8D A;  1OOC A;  1KCD A;  1DAB A;  3GQA A;  2VBK A;  4XQF A;  4XKW A;  1PLU A;  3VSV A;  1CLW A;  3VST A;  2INU A;  2XTY A;  3SQV A;  2PYH A;  1QA3 A;  2QY1 A;  1HG8 A;  1TYV A;  3LJY A;  1QQ1 A;  4XLA A;  2ODL A;  2XTW A;  4YZA A;  2BM7 A;  5JMC B;  4YEL A;  1IDK A;  4YFO A;  4Z06 A;  4U49 A;  3GQ7 A;  1L1I A;  2G0Y A;  3JUR A;  3B8Y A;  3AK5 A;  1O8M A;  2BM6 A;  2X85 A;  3H09 A;  2QZA A;  3SUC A;  1TSP A;  2BM4 A;  1O8K A;  4MR0 A;  4XL9 A;  4YZQ A;  1K4Z A;  2J8K A;  2UVF A;  4C2L A;  2QX3 A;  2O17 A;  2F3L A;  1KTW A;  2VJJ A;  3ML3 A;  4MXN A;  3N90 A;  4AVZ A;  4XOT A;  3ZSC A;  2VJI A;  2O0V A;  1DBO A;  4XN3 A;  3FY3 A;  2EWE A;  2NTQ A;  4V02 C;  1O8J A;  4NK6 A;  2NZM A;  3ZPP A;  1NHC A;  4HWV A;  4XN0 A;  2PEC A;  1OFM A;  1RMG A;  1K8F A;  2IQ7 A;  2VFP A;  2INV A;  3SZE A;  4Z05 A;  1GQ8 A;  2W7Z A;  4XR6 A;  2NSP A;  2NST A;  4W8Q A;  1H80 A;  4XLC A; 
#chains in the Genus database with same CATH homology
 2XTX A;  3DU1 X;  4YEI A;  2XTW A;  4YFO A;  4YCQ A;  4YDT A;  3NAW A;  3PSS A;  3SY2 A;  3NB2 A;  2XT2 A;  3PSZ A;  2QZA A;  4YC5 A;  2XT4 A;  2J8K A;  5DNS A;  2QYU A;  2XTY A;  2O6W A;  3SQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...