2XT4A

Structure of the pentapeptide repeat protein albg, a resistance factor for the topoisomerase poison albicidin.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
185
structure length
185
Chain Sequence
KDYCGESFVSEDRSGQSLESIRFEDCTFRQCNFTEAELNRCKFRECEFVDCNLSLISIPQTSFMEVRFVDCKMLGVNWTSAQAGALSFERCILNDSLFYGLYLAGVKMVECRIHDANFTEADCEDADFTQSDLKGSTFHNTKLTGASFIDAVNYHIDIFHNDIKRARFSLPEAASLLNSLDIELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pentapeptide-Repeat Proteins that Act as Topoisomerase Poison Resistance Factors Have a Common Dimer Interface.
pubmed doi rcsb
source organism Xanthomonas albilineans
molecule tags Cell cycle
molecule keywords MCBG-LIKE PROTEIN
total genus 76
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 2xt4A00
3SQVA 4YFOA 2XTYA 2XTWA 3PSZA 4YC5A 2O6WA 3PSSA 4YEIA 4YDTA 2J8KA 2XT2A 2XTXA 2QYUA 4YCQA 3NB2A 2XT4A 2QZAA 3NAWA 3SY2A 5DNSA 3DU1X
chains in the Genus database with same CATH superfamily
3LYCA 1CLWA 4XN0A 1O8LA 1LM1A 4XNFA 3N6ZA 1QRCA 4Z03A 1K5CA 4OZZA 4YZXA 1WXRA 3EQNA 2INUA 3PSZA 4I84A 2VBMA 2BM6A 4Z06A 2NTQA 4YEJA 1O8DA 4XN3A 1DBGA 4XLHA 3GRHA 4Z05A 4NK6A 2X6YA 1TYVA 4OZYA 3EQOA 4KH3A 3SUCA 1WMRA 1LLZA 1O8JA 2INVA 4YEIA 2ODLA 2BX6A 2X6WA 4EW9A 1OGOX 2QYUA 2NT9A 2XTXA 3GQAA 4YCQA 4V02C 3VSUA 3VSTA 4U49A 4XMYA 3B8YA 2NTPA 2PECA 1OGMX 1O8FA 4XLFA 3PETA 2XC1A 4YFOA 1GQ8A 4OJOA 2O0VA 3T9GA 1TYUA 4XQFA 1H80A 1DABA 4XOTA 2J8IA 3GQ7A 4XONA 2X85A 4XR6A 2XTWA 2VJIA 1K8FA 1O8KA 1VBLA 4XL9A 1NHCA 3P4GA 4OPWA 3ZSCA 1JRGA 1XG2A 4JRAC 2O0WA 4XLEA 1OFMA 4W8RA 2O6WA 5AMVA 3ZPPA 2X3HA 4YDTA 2J8KA 1DBOA 2PYHA 1O8MA 1HG8A 4OM9A 2PYGA 2F3LA 3SYJA 3N90A 1RMGA 1PE9A 1KCCA 2XT4A 1LLWA 2VFQA 4XKWA 1BHEA 2QZAA 4YZ0A 1HF2A 1QA3A 2UVEA 4XOPA 1OFLA 3VMVA 3BH7B 4U4BA 4URRA 2O17A 3RIQA 2QY1A 4XKVA 3SQVA 1K4ZA 1TYXA 2O1DA 1X0CA 2BM4A 1EE6A 2XTYA 2VBKA 2VFPA 2NZMA 1OFEA 2NTBA 1EZGA 2NT6A 1JTAA 2X6XA 2B0RA 2BM5A 2IQ7A 5C1EA 2W7ZA 3VSVA 4YC5A 1O8EA 4YELA 3B90A 3JURA 2UVFA 1IDKA 3PSSA 1RU4A 3B4NA 4NK8A 2V5IA 2VFNA 2IOUG 1PLUA 2BM7A 4MR0A 4XLCA 4YZAA 4AVZA 3SZEA 1IB4A 1TYWA 1QA1A 3NB2A 2YUHA 1PXZA 4OJ6A 1KQ5A 2NSTA 3H09A 3KRGA 3LMWA 3NAWA 2Z8GA 1O8GA 2VJJA 4MXNA 2VFMA 3GQ9A 3ML3A 4XLAA 3SY2A 3UW0A 1IA5A 1KCDA 1QJVA 4XM3A 1CZFA 3FY3A 1BN8A 1QRBA 1L1IA 2NSPA 5JMCB 1QCXA 2VBEA 1OOCA 3VMWA 1IDJA 1AIRA 2BSPA 4OJ5A 1O8HA 2EWEA 3JX8A 4OJLA 1O8IA 1QQ1A 1OFDA 2QXZA 4OJPA 4W8QA 1RWRA 1EA0A 4YZQA 5JLVC 2XT2A 2G0YA 4W8TA 3AK5A 3GQ8A 4W8SA 2VFOA 4C2LA 3BH6B 2QX3A 1O88A 1QA2A 4PMHA 3TH0A 4HWVA 5C1CA 1TSPA 3WWGA 3LJYA 4XORA 1KTWA 5DNSA 3DU1X 2O04A
chains in the Genus database with same CATH topology
3SQVA 4YFOA 2XTYA 2XTWA 3PSZA 4YC5A 2O6WA 3PSSA 4YEIA 4YDTA 2J8KA 2XT2A 2XTXA 2QYUA 4YCQA 3NB2A 2XT4A 2QZAA 3NAWA 3SY2A 5DNSA 3DU1X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SQV A;  4YFO A;  2XTY A;  2XTW A;  3PSZ A;  4YC5 A;  2O6W A;  3PSS A;  4YEI A;  4YDT A;  2J8K A;  2XT2 A;  2XTX A;  2QYU A;  4YCQ A;  3NB2 A;  2XT4 A;  2QZA A;  3NAW A;  3SY2 A;  5DNS A;  3DU1 X; 
#chains in the Genus database with same CATH topology
 3LYC A;  1CLW A;  4XN0 A;  1O8L A;  1LM1 A;  4XNF A;  3N6Z A;  1QRC A;  4Z03 A;  1K5C A;  4OZZ A;  4YZX A;  1WXR A;  3EQN A;  2INU A;  3PSZ A;  4I84 A;  2VBM A;  2BM6 A;  4Z06 A;  2NTQ A;  4YEJ A;  1O8D A;  4XN3 A;  1DBG A;  4XLH A;  3GRH A;  4Z05 A;  4NK6 A;  2X6Y A;  1TYV A;  4OZY A;  3EQO A;  4KH3 A;  3SUC A;  1WMR A;  1LLZ A;  1O8J A;  2INV A;  4YEI A;  2ODL A;  2BX6 A;  2X6W A;  4EW9 A;  1OGO X;  2QYU A;  2NT9 A;  2XTX A;  3GQA A;  4YCQ A;  4V02 C;  3VSU A;  3VST A;  4U49 A;  4XMY A;  3B8Y A;  2NTP A;  2PEC A;  1OGM X;  1O8F A;  4XLF A;  3PET A;  2XC1 A;  4YFO A;  1GQ8 A;  4OJO A;  2O0V A;  3T9G A;  1TYU A;  4XQF A;  1H80 A;  1DAB A;  4XOT A;  2J8I A;  3GQ7 A;  4XON A;  2X85 A;  4XR6 A;  2XTW A;  2VJI A;  1K8F A;  1O8K A;  1VBL A;  4XL9 A;  1NHC A;  3P4G A;  4OPW A;  3ZSC A;  1JRG A;  1XG2 A;  4JRA C;  2O0W A;  4XLE A;  1OFM A;  4W8R A;  2O6W A;  5AMV A;  3ZPP A;  2X3H A;  4YDT A;  2J8K A;  1DBO A;  2PYH A;  1O8M A;  1HG8 A;  4OM9 A;  2PYG A;  2F3L A;  3SYJ A;  3N90 A;  1RMG A;  1PE9 A;  1KCC A;  2XT4 A;  1LLW A;  2VFQ A;  4XKW A;  1BHE A;  2QZA A;  4YZ0 A;  1HF2 A;  1QA3 A;  2UVE A;  4XOP A;  1OFL A;  3VMV A;  3BH7 B;  4U4B A;  4URR A;  2O17 A;  3RIQ A;  2QY1 A;  4XKV A;  3SQV A;  1K4Z A;  1TYX A;  2O1D A;  1X0C A;  2BM4 A;  1EE6 A;  2XTY A;  2VBK A;  2VFP A;  2NZM A;  1OFE A;  2NTB A;  1EZG A;  2NT6 A;  1JTA A;  2X6X A;  2B0R A;  2BM5 A;  2IQ7 A;  5C1E A;  2W7Z A;  3VSV A;  4YC5 A;  1O8E A;  4YEL A;  3B90 A;  3JUR A;  2UVF A;  1IDK A;  3PSS A;  1RU4 A;  3B4N A;  4NK8 A;  2V5I A;  2VFN A;  2IOU G;  1PLU A;  2BM7 A;  4MR0 A;  4XLC A;  4YZA A;  4AVZ A;  3SZE A;  1IB4 A;  1TYW A;  1QA1 A;  3NB2 A;  2YUH A;  1PXZ A;  4OJ6 A;  1KQ5 A;  2NST A;  3H09 A;  3KRG A;  3LMW A;  3NAW A;  2Z8G A;  1O8G A;  2VJJ A;  4MXN A;  2VFM A;  3GQ9 A;  3ML3 A;  4XLA A;  3SY2 A;  3UW0 A;  1IA5 A;  1KCD A;  1QJV A;  4XM3 A;  1CZF A;  3FY3 A;  1BN8 A;  1QRB A;  1L1I A;  2NSP A;  5JMC B;  1QCX A;  2VBE A;  1OOC A;  3VMW A;  1IDJ A;  1AIR A;  2BSP A;  4OJ5 A;  1O8H A;  2EWE A;  3JX8 A;  4OJL A;  1O8I A;  1QQ1 A;  1OFD A;  2QXZ A;  4OJP A;  4W8Q A;  1RWR A;  1EA0 A;  4YZQ A;  5JLV C;  2XT2 A;  2G0Y A;  4W8T A;  3AK5 A;  3GQ8 A;  4W8S A;  2VFO A;  4C2L A;  3BH6 B;  2QX3 A;  1O88 A;  1QA2 A;  4PMH A;  3TH0 A;  4HWV A;  5C1C A;  1TSP A;  3WWG A;  3LJY A;  4XOR A;  1KTW A;  5DNS A;  3DU1 X;  2O04 A; 
#chains in the Genus database with same CATH homology
 3SQV A;  4YFO A;  2XTY A;  2XTW A;  3PSZ A;  4YC5 A;  2O6W A;  3PSS A;  4YEI A;  4YDT A;  2J8K A;  2XT2 A;  2XTX A;  2QYU A;  4YCQ A;  3NB2 A;  2XT4 A;  2QZA A;  3NAW A;  3SY2 A;  5DNS A;  3DU1 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...