2XT4A

Structure of the pentapeptide repeat protein albg, a resistance factor for the topoisomerase poison albicidin.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
185
structure length
185
Chain Sequence
KDYCGESFVSEDRSGQSLESIRFEDCTFRQCNFTEAELNRCKFRECEFVDCNLSLISIPQTSFMEVRFVDCKMLGVNWTSAQAGALSFERCILNDSLFYGLYLAGVKMVECRIHDANFTEADCEDADFTQSDLKGSTFHNTKLTGASFIDAVNYHIDIFHNDIKRARFSLPEAASLLNSLDIELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pentapeptide-Repeat Proteins that Act as Topoisomerase Poison Resistance Factors Have a Common Dimer Interface.
pubmed doi rcsb
molecule keywords MCBG-LIKE PROTEIN
molecule tags Cell cycle
source organism Xanthomonas albilineans
total genus 76
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 2xt4A00
4YCQA 3SY2A 5DNSA 2J8KA 3SQVA 4YEIA 4YDTA 2XTXA 2XTYA 3PSZA 2XT2A 2QYUA 2O6WA 2QZAA 2XT4A 2XTWA 3DU1X 3NAWA 4YFOA 3NB2A 3PSSA 4YC5A
chains in the Genus database with same CATH superfamily
4XLCA 2NTPA 4W8RA 2J8IA 5C1EA 1HF2A 2O0WA 5DNSA 4JRAC 4XKVA 2J8KA 3SQVA 2QXZA 1RWRA 4YDTA 1QA2A 4XLEA 3B90A 2VBMA 3B4NA 4XL9A 3VMVA 4C2LA 1O8KA 4XM3A 4OJPA 2BM6A 4XLFA 2X3HA 2XT2A 2X85A 3EQOA 3LYCA 1AIRA 5JMCB 4OJLA 1OOCA 4I84A 1HG8A 4YELA 3VSTA 2PYGA 4YZQA 2XT4A 1QCXA 2VBEA 2VFPA 4NK8A 2NTBA 1O8IA 2PECA 2VFNA 1KTWA 3SYJA 5C1CA 2W7ZA 1O88A 1TYVA 4MXNA 4HWVA 3SY2A 4Z06A 1K4ZA 2VJIA 2VJJA 3T9GA 3SZEA 2BM7A 4AVZA 3ZSCA 4YZXA 1O8HA 3LMWA 3PETA 4OZZA 1DBOA 1QJVA 2NSTA 3VSVA 5JLVC 2YUHA 3PSZA 1JRGA 2BM5A 1O8JA 1O8LA 2PYHA 4XKWA 4OJ5A 1JTAA 3GQAA 3TH0A 2INUA 2O1DA 1O8FA 3BH6B 1TYUA 2INVA 1L1IA 4XNFA 2O6WA 4Z05A 3VMWA 1TYXA 3KRGA 3SUCA 1O8MA 1IDJA 2O17A 4Z03A 2VFMA 3NB2A 1O8EA 1PE9A 2VBKA 4KH3A 4OPWA 4U49A 1VBLA 3EQNA 1IA5A 1WMRA 1H80A 1O8DA 4OZYA 4OJOA 4XORA 4W8TA 2NZMA 3H09A 2IOUG 4EW9A 1CLWA 1OGMX 1KCCA 1TYWA 1WXRA 4NK6A 1EZGA 4OM9A 1XG2A 2VFQA 3BH7B 2G0YA 3P4GA 3GQ7A 3ML3A 4XMYA 1KCDA 1OFDA 2NT6A 3GQ8A 2QYUA 4XN0A 1GQ8A 2VFOA 3AK5A 1QA1A 1OGOX 3FY3A 2EWEA 4W8QA 1PLUA 4XQFA 1K5CA 1QRBA 2F3LA 2ODLA 3B8YA 3N6ZA 4YEJA 1K8FA 2QZAA 2XTWA 2BM4A 4XONA 1IB4A 4URRA 1LM1A 2NSPA 3GRHA 3N90A 4U4BA 2NT9A 4PMHA 4W8SA 1CZFA 4XOTA 3ZPPA 3WWGA 4XLAA 4YCQA 1BN8A 2NTQA 1QQ1A 1NHCA 1LLZA 2O04A 2BSPA 1DBGA 2QX3A 4XLHA 4YEIA 1TSPA 4MR0A 1KQ5A 5AMVA 2XC1A 1OFEA 2X6WA 2X6XA 1X0CA 2XTXA 2Z8GA 1OFLA 2XTYA 1EE6A 2X6YA 1PXZA 1IDKA 4V02C 2UVFA 4XN3A 1BHEA 1EA0A 1RMGA 2UVEA 4XOPA 2BX6A 1QRCA 4YZ0A 4OJ6A 3GQ9A 4XR6A 2QY1A 3VSUA 3JX8A 1O8GA 3DU1X 3NAWA 2O0VA 4YFOA 3RIQA 2IQ7A 1OFMA 4YZAA 3UW0A 3PSSA 1LLWA 4YC5A 1DABA 1QA3A 1RU4A 2V5IA 2B0RA 3JURA 3LJYA
chains in the Genus database with same CATH topology
4YCQA 3SY2A 5DNSA 2J8KA 3SQVA 4YEIA 4YDTA 2XTXA 2XTYA 3PSZA 2XT2A 2QYUA 2O6WA 2QZAA 2XT4A 2XTWA 3DU1X 3NAWA 4YFOA 3NB2A 3PSSA 4YC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YCQ A;  3SY2 A;  5DNS A;  2J8K A;  3SQV A;  4YEI A;  4YDT A;  2XTX A;  2XTY A;  3PSZ A;  2XT2 A;  2QYU A;  2O6W A;  2QZA A;  2XT4 A;  2XTW A;  3DU1 X;  3NAW A;  4YFO A;  3NB2 A;  3PSS A;  4YC5 A; 
#chains in the Genus database with same CATH topology
 4XLC A;  2NTP A;  4W8R A;  2J8I A;  5C1E A;  1HF2 A;  2O0W A;  5DNS A;  4JRA C;  4XKV A;  2J8K A;  3SQV A;  2QXZ A;  1RWR A;  4YDT A;  1QA2 A;  4XLE A;  3B90 A;  2VBM A;  3B4N A;  4XL9 A;  3VMV A;  4C2L A;  1O8K A;  4XM3 A;  4OJP A;  2BM6 A;  4XLF A;  2X3H A;  2XT2 A;  2X85 A;  3EQO A;  3LYC A;  1AIR A;  5JMC B;  4OJL A;  1OOC A;  4I84 A;  1HG8 A;  4YEL A;  3VST A;  2PYG A;  4YZQ A;  2XT4 A;  1QCX A;  2VBE A;  2VFP A;  4NK8 A;  2NTB A;  1O8I A;  2PEC A;  2VFN A;  1KTW A;  3SYJ A;  5C1C A;  2W7Z A;  1O88 A;  1TYV A;  4MXN A;  4HWV A;  3SY2 A;  4Z06 A;  1K4Z A;  2VJI A;  2VJJ A;  3T9G A;  3SZE A;  2BM7 A;  4AVZ A;  3ZSC A;  4YZX A;  1O8H A;  3LMW A;  3PET A;  4OZZ A;  1DBO A;  1QJV A;  2NST A;  3VSV A;  5JLV C;  2YUH A;  3PSZ A;  1JRG A;  2BM5 A;  1O8J A;  1O8L A;  2PYH A;  4XKW A;  4OJ5 A;  1JTA A;  3GQA A;  3TH0 A;  2INU A;  2O1D A;  1O8F A;  3BH6 B;  1TYU A;  2INV A;  1L1I A;  4XNF A;  2O6W A;  4Z05 A;  3VMW A;  1TYX A;  3KRG A;  3SUC A;  1O8M A;  1IDJ A;  2O17 A;  4Z03 A;  2VFM A;  3NB2 A;  1O8E A;  1PE9 A;  2VBK A;  4KH3 A;  4OPW A;  4U49 A;  1VBL A;  3EQN A;  1IA5 A;  1WMR A;  1H80 A;  1O8D A;  4OZY A;  4OJO A;  4XOR A;  4W8T A;  2NZM A;  3H09 A;  2IOU G;  4EW9 A;  1CLW A;  1OGM X;  1KCC A;  1TYW A;  1WXR A;  4NK6 A;  1EZG A;  4OM9 A;  1XG2 A;  2VFQ A;  3BH7 B;  2G0Y A;  3P4G A;  3GQ7 A;  3ML3 A;  4XMY A;  1KCD A;  1OFD A;  2NT6 A;  3GQ8 A;  2QYU A;  4XN0 A;  1GQ8 A;  2VFO A;  3AK5 A;  1QA1 A;  1OGO X;  3FY3 A;  2EWE A;  4W8Q A;  1PLU A;  4XQF A;  1K5C A;  1QRB A;  2F3L A;  2ODL A;  3B8Y A;  3N6Z A;  4YEJ A;  1K8F A;  2QZA A;  2XTW A;  2BM4 A;  4XON A;  1IB4 A;  4URR A;  1LM1 A;  2NSP A;  3GRH A;  3N90 A;  4U4B A;  2NT9 A;  4PMH A;  4W8S A;  1CZF A;  4XOT A;  3ZPP A;  3WWG A;  4XLA A;  4YCQ A;  1BN8 A;  2NTQ A;  1QQ1 A;  1NHC A;  1LLZ A;  2O04 A;  2BSP A;  1DBG A;  2QX3 A;  4XLH A;  4YEI A;  1TSP A;  4MR0 A;  1KQ5 A;  5AMV A;  2XC1 A;  1OFE A;  2X6W A;  2X6X A;  1X0C A;  2XTX A;  2Z8G A;  1OFL A;  2XTY A;  1EE6 A;  2X6Y A;  1PXZ A;  1IDK A;  4V02 C;  2UVF A;  4XN3 A;  1BHE A;  1EA0 A;  1RMG A;  2UVE A;  4XOP A;  2BX6 A;  1QRC A;  4YZ0 A;  4OJ6 A;  3GQ9 A;  4XR6 A;  2QY1 A;  3VSU A;  3JX8 A;  1O8G A;  3DU1 X;  3NAW A;  2O0V A;  4YFO A;  3RIQ A;  2IQ7 A;  1OFM A;  4YZA A;  3UW0 A;  3PSS A;  1LLW A;  4YC5 A;  1DAB A;  1QA3 A;  1RU4 A;  2V5I A;  2B0R A;  3JUR A;  3LJY A; 
#chains in the Genus database with same CATH homology
 4YCQ A;  3SY2 A;  5DNS A;  2J8K A;  3SQV A;  4YEI A;  4YDT A;  2XTX A;  2XTY A;  3PSZ A;  2XT2 A;  2QYU A;  2O6W A;  2QZA A;  2XT4 A;  2XTW A;  3DU1 X;  3NAW A;  4YFO A;  3NB2 A;  3PSS A;  4YC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...