2XT4A

Structure of the pentapeptide repeat protein albg, a resistance factor for the topoisomerase poison albicidin.
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
185
structure length
185
Chain Sequence
KDYCGESFVSEDRSGQSLESIRFEDCTFRQCNFTEAELNRCKFRECEFVDCNLSLISIPQTSFMEVRFVDCKMLGVNWTSAQAGALSFERCILNDSLFYGLYLAGVKMVECRIHDANFTEADCEDADFTQSDLKGSTFHNTKLTGASFIDAVNYHIDIFHNDIKRARFSLPEAASLLNSLDIELS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MCBG-LIKE PROTEIN
publication title Pentapeptide-Repeat Proteins that Act as Topoisomerase Poison Resistance Factors Have a Common Dimer Interface.
pubmed doi rcsb
source organism Xanthomonas albilineans
molecule tags Cell cycle
total genus 76
structure length 185
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 2xt4A00
3SY2A 2QZAA 2O6WA 2XT2A 4YFOA 3DU1X 4YEIA 3SQVA 3PSSA 3NAWA 4YC5A 4YCQA 3PSZA 2XTXA 2XTWA 2QYUA 2J8KA 2XTYA 4YDTA 5DNSA 2XT4A 3NB2A
chains in the Genus database with same CATH superfamily
3SY2A 1LLZA 1O8KA 1X0CA 3BH6B 2VFNA 4OJOA 3SZEA 3WWGA 3GRHA 1DBGA 1O8IA 1BN8A 2EWEA 4C2LA 1EA0A 1LLWA 2Z8GA 4YEJA 2O0VA 4YFOA 4XLCA 1O8GA 4U49A 2QX3A 3SUCA 4KH3A 4I84A 1L1IA 4Z06A 4XLFA 3VSUA 4OZZA 5C1CA 3JX8A 4XQFA 1QRBA 2O17A 2X6XA 4OPWA 4XORA 4AVZA 4W8TA 4OJ6A 4XLAA 1XG2A 2G0YA 3H09A 4U4BA 1RU4A 4XKVA 1EZGA 1QA2A 1TYWA 1OGOX 1KCDA 3T9GA 1WXRA 4XONA 4XLHA 4W8RA 3ZSCA 1O88A 1OGMX 2QXZA 4JRAC 2X3HA 3LYCA 2O1DA 1OFMA 1TYUA 2O0WA 2BM6A 1VBLA 1CLWA 1H80A 1RWRA 2X6WA 4PMHA 3N6ZA 1IDJA 2UVFA 2W7ZA 3GQ9A 4OM9A 4HWVA 4YEIA 2NTBA 2V5IA 4XNFA 1KQ5A 1TSPA 2XT4A 2NZMA 4OJLA 3EQOA 4V02C 4YELA 5C1EA 4EW9A 4MR0A 1BHEA 2NT9A 3EQNA 1OFDA 3GQ7A 4XL9A 3SYJA 3LJYA 2NSPA 1KTWA 1RMGA 4W8QA 1EE6A 4MXNA 2PECA 2IOUG 3RIQA 2INVA 3AK5A 4NK8A 3ML3A 4Z03A 2NTQA 1QA3A 1IA5A 4YZXA 1QQ1A 2UVEA 1IDKA 2VFMA 1K8FA 2QZAA 1PE9A 1OFLA 2BSPA 2O04A 2O6WA 3VSVA 1QJVA 3GQ8A 2INUA 3LMWA 3B4NA 2NTPA 4XOTA 1CZFA 5AMVA 1KCCA 1OOCA 2VFQA 2VJJA 3DU1X 3FY3A 3UW0A 2BX6A 4URRA 2F3LA 2ODLA 1O8EA 1O8HA 2X85A 1AIRA 3B90A 4XM3A 3PSSA 2IQ7A 4YZQA 1QA1A 3N90A 2BM4A 2VFPA 1PLUA 2XC1A 3TH0A 1IB4A 2XTXA 2PYHA 4XLEA 3ZPPA 2J8IA 1O8FA 1K5CA 1DABA 2J8KA 2XTYA 3P4GA 1TYXA 4YDTA 1O8LA 5DNSA 2VBMA 4NK6A 4W8SA 4XOPA 1TYVA 4XR6A 4YZAA 2XT2A 2QY1A 1O8JA 3KRGA 4OZYA 2VFOA 3PETA 2NSTA 4OJPA 3JURA 4XN0A 2PYGA 2VBKA 4Z05A 1JTAA 3B8YA 1HG8A 2YUHA 3SQVA 4XMYA 4YZ0A 1O8MA 3GQAA 3NAWA 1GQ8A 1K4ZA 1LM1A 1O8DA 2BM7A 1HF2A 2VBEA 4YC5A 3VMVA 3VMWA 4YCQA 3PSZA 3VSTA 2NT6A 1QCXA 3BH7B 4XKWA 5JLVC 2XTWA 1DBOA 5JMCB 2QYUA 4OJ5A 4XN3A 2VJIA 2B0RA 1PXZA 1QRCA 1OFEA 1JRGA 2BM5A 1NHCA 2X6YA 1WMRA 3NB2A
chains in the Genus database with same CATH topology
3SY2A 2QZAA 2O6WA 2XT2A 4YFOA 3DU1X 4YEIA 3SQVA 3PSSA 3NAWA 4YC5A 4YCQA 3PSZA 2XTXA 2XTWA 2QYUA 2J8KA 2XTYA 4YDTA 5DNSA 2XT4A 3NB2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SY2 A;  2QZA A;  2O6W A;  2XT2 A;  4YFO A;  3DU1 X;  4YEI A;  3SQV A;  3PSS A;  3NAW A;  4YC5 A;  4YCQ A;  3PSZ A;  2XTX A;  2XTW A;  2QYU A;  2J8K A;  2XTY A;  4YDT A;  5DNS A;  2XT4 A;  3NB2 A; 
#chains in the Genus database with same CATH topology
 3SY2 A;  1LLZ A;  1O8K A;  1X0C A;  3BH6 B;  2VFN A;  4OJO A;  3SZE A;  3WWG A;  3GRH A;  1DBG A;  1O8I A;  1BN8 A;  2EWE A;  4C2L A;  1EA0 A;  1LLW A;  2Z8G A;  4YEJ A;  2O0V A;  4YFO A;  4XLC A;  1O8G A;  4U49 A;  2QX3 A;  3SUC A;  4KH3 A;  4I84 A;  1L1I A;  4Z06 A;  4XLF A;  3VSU A;  4OZZ A;  5C1C A;  3JX8 A;  4XQF A;  1QRB A;  2O17 A;  2X6X A;  4OPW A;  4XOR A;  4AVZ A;  4W8T A;  4OJ6 A;  4XLA A;  1XG2 A;  2G0Y A;  3H09 A;  4U4B A;  1RU4 A;  4XKV A;  1EZG A;  1QA2 A;  1TYW A;  1OGO X;  1KCD A;  3T9G A;  1WXR A;  4XON A;  4XLH A;  4W8R A;  3ZSC A;  1O88 A;  1OGM X;  2QXZ A;  4JRA C;  2X3H A;  3LYC A;  2O1D A;  1OFM A;  1TYU A;  2O0W A;  2BM6 A;  1VBL A;  1CLW A;  1H80 A;  1RWR A;  2X6W A;  4PMH A;  3N6Z A;  1IDJ A;  2UVF A;  2W7Z A;  3GQ9 A;  4OM9 A;  4HWV A;  4YEI A;  2NTB A;  2V5I A;  4XNF A;  1KQ5 A;  1TSP A;  2XT4 A;  2NZM A;  4OJL A;  3EQO A;  4V02 C;  4YEL A;  5C1E A;  4EW9 A;  4MR0 A;  1BHE A;  2NT9 A;  3EQN A;  1OFD A;  3GQ7 A;  4XL9 A;  3SYJ A;  3LJY A;  2NSP A;  1KTW A;  1RMG A;  4W8Q A;  1EE6 A;  4MXN A;  2PEC A;  2IOU G;  3RIQ A;  2INV A;  3AK5 A;  4NK8 A;  3ML3 A;  4Z03 A;  2NTQ A;  1QA3 A;  1IA5 A;  4YZX A;  1QQ1 A;  2UVE A;  1IDK A;  2VFM A;  1K8F A;  2QZA A;  1PE9 A;  1OFL A;  2BSP A;  2O04 A;  2O6W A;  3VSV A;  1QJV A;  3GQ8 A;  2INU A;  3LMW A;  3B4N A;  2NTP A;  4XOT A;  1CZF A;  5AMV A;  1KCC A;  1OOC A;  2VFQ A;  2VJJ A;  3DU1 X;  3FY3 A;  3UW0 A;  2BX6 A;  4URR A;  2F3L A;  2ODL A;  1O8E A;  1O8H A;  2X85 A;  1AIR A;  3B90 A;  4XM3 A;  3PSS A;  2IQ7 A;  4YZQ A;  1QA1 A;  3N90 A;  2BM4 A;  2VFP A;  1PLU A;  2XC1 A;  3TH0 A;  1IB4 A;  2XTX A;  2PYH A;  4XLE A;  3ZPP A;  2J8I A;  1O8F A;  1K5C A;  1DAB A;  2J8K A;  2XTY A;  3P4G A;  1TYX A;  4YDT A;  1O8L A;  5DNS A;  2VBM A;  4NK6 A;  4W8S A;  4XOP A;  1TYV A;  4XR6 A;  4YZA A;  2XT2 A;  2QY1 A;  1O8J A;  3KRG A;  4OZY A;  2VFO A;  3PET A;  2NST A;  4OJP A;  3JUR A;  4XN0 A;  2PYG A;  2VBK A;  4Z05 A;  1JTA A;  3B8Y A;  1HG8 A;  2YUH A;  3SQV A;  4XMY A;  4YZ0 A;  1O8M A;  3GQA A;  3NAW A;  1GQ8 A;  1K4Z A;  1LM1 A;  1O8D A;  2BM7 A;  1HF2 A;  2VBE A;  4YC5 A;  3VMV A;  3VMW A;  4YCQ A;  3PSZ A;  3VST A;  2NT6 A;  1QCX A;  3BH7 B;  4XKW A;  5JLV C;  2XTW A;  1DBO A;  5JMC B;  2QYU A;  4OJ5 A;  4XN3 A;  2VJI A;  2B0R A;  1PXZ A;  1QRC A;  1OFE A;  1JRG A;  2BM5 A;  1NHC A;  2X6Y A;  1WMR A;  3NB2 A; 
#chains in the Genus database with same CATH homology
 3SY2 A;  2QZA A;  2O6W A;  2XT2 A;  4YFO A;  3DU1 X;  4YEI A;  3SQV A;  3PSS A;  3NAW A;  4YC5 A;  4YCQ A;  3PSZ A;  2XTX A;  2XTW A;  2QYU A;  2J8K A;  2XTY A;  4YDT A;  5DNS A;  2XT4 A;  3NB2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...