2XTCA

Structure of the tbl1 tetramerisation domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
74
structure length
74
Chain Sequence
SITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPAALISILQKGLQYVEAEISINEDGTVFDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Assembly of the Smrt/Ncor Core Transcriptional Repression Machinery.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords F-BOX-LIKE/WD REPEAT-CONTAINING PROTEIN TBL1X
total genus 22
structure length 74
sequence length 74
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08513 LisH LisH
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.960.30 Mainly Alpha Up-down Bundle Mitochondrial Import Receptor Subunit Tom20; Chain A Mitochondrial Import Receptor Subunit Tom20; Chain A 2xtcA00
2XTCA 2XTEA 2XTDA 1UUJA
chains in the Genus database with same CATH superfamily
3CDWA 2IM2A 4Y2CA 4R0EA 4NLTA 3OL6A 4WFZA 3OLBA 2WK4A 4QPXA 2F8EX 4WYLA 3KNAA 1RA7A 4NLYA 1SH2A 2IM3A 4Y34A 2IJFA 2ILZA 2IM0A 4NRTA 3BSOA 4IQXA 3AX2A 1RA6A 2UUWA 4K4TA 4NLQA 1RAJA 4X2BA 4NLWA 2E9ZA 4K4WA 4ZP7A 5JXSA 4K4ZA 2B43A 5F8JA 2XTCA 4NLUA 4K4XA 3UR0A 1SH0A 1XR6A 3H5XA 3KOAA 1TQLA 4Y2AA 3UPFA 5F8IA 3N6NA 2XTEA 1OM2A 1U09A 4NLVA 3N6LA 3OL7A 3SFGA 4WFYA 5F8LA 5F8NA 4ZPAA 2E9TA 3AX5A 2IM1A 1KHVA 3AWRA 4Y3CA 4WZMA 3KMSA 3QIDA 3N6MA 4WFXA 4ZP9A 4WYWA 4O4RA 2V1TA 4LQ9A 4NLRA 2E9RX 3NKYA 3CDUA 3BSNA 4WZQA 5F8GA 2ILYA 2XZ2A 3NMAA 1RDRA 3KMQA 2UUTA 4K4VA 3KLVA 4NZ0A 2EC0A 1XR7A 2CKWA 4NLXA 4ZP6A 3SFUA 4ZPBA 4NRUA 1XR5A 4K4UA 4NLOA 3OLAA 4ZPCA 3H5YA 2D68A 1WNEA 4K50A 4K4YA 1TP7A 4NYZA 3OL9A 1KHWA 3AX3A 2D7SA 4IKAA 3NAHA 4ZPDA 1UUJA 5F8MA 3NAIA 2XTDA 4K4SA 3NL0A 3DDKA 4NLSA 4NLPA 3UQSA 5F8HA 1SH3A 3OL8A 2V1SA 4LQ3A 4ZP8A
chains in the Genus database with same CATH topology
3CDWA 2IM2A 4Y2CA 4R0EA 4NLTA 3OL6A 4WFZA 3OLBA 2WK4A 4QPXA 2F8EX 4WYLA 3KNAA 1RA7A 4NLYA 1SH2A 2IM3A 4Y34A 2IJFA 2ILZA 2IM0A 4NRTA 3BSOA 4IQXA 1RA6A 2UUWA 4K4TA 4NLQA 1RAJA 4X2BA 4NLWA 2E9ZA 4K4WA 4ZP7A 5JXSA 4K4ZA 2B43A 5F8JA 2XTCA 4NLUA 4K4XA 3UR0A 1SH0A 1XR6A 3H5XA 3KOAA 1TQLA 4Y2AA 3UPFA 5F8IA 3N6NA 2XTEA 1U09A 4NLVA 3N6LA 3OL7A 3SFGA 4WFYA 5F8LA 5F8NA 4ZPAA 2E9TA 2IM1A 1KHVA 4Y3CA 4WZMA 3KMSA 3QIDA 3N6MA 4WFXA 4ZP9A 4WYWA 4O4RA 4LQ9A 4NLRA 2E9RX 3NKYA 3CDUA 3BSNA 4WZQA 5F8GA 2ILYA 2XZ2A 3NMAA 1RDRA 3KMQA 2UUTA 4K4VA 3KLVA 4NZ0A 2EC0A 1XR7A 2CKWA 4NLXA 4ZP6A 3SFUA 4ZPBA 4NRUA 1XR5A 4K4UA 4NLOA 3OLAA 4ZPCA 3H5YA 2D68A 1WNEA 4K50A 4K4YA 1TP7A 4NYZA 3OL9A 1KHWA 2D7SA 4IKAA 3NAHA 4ZPDA 1UUJA 5F8MA 3NAIA 2XTDA 4K4SA 3NL0A 3DDKA 4NLSA 4NLPA 3UQSA 5F8HA 1SH3A 3OL8A 4LQ3A 4ZP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XTC A;  2XTE A;  2XTD A;  1UUJ A; 
#chains in the Genus database with same CATH topology
 3CDW A;  2IM2 A;  4Y2C A;  4R0E A;  4NLT A;  3OL6 A;  4WFZ A;  3OLB A;  2WK4 A;  4QPX A;  2F8E X;  4WYL A;  3KNA A;  1RA7 A;  4NLY A;  1SH2 A;  2IM3 A;  4Y34 A;  2IJF A;  2ILZ A;  2IM0 A;  4NRT A;  3BSO A;  4IQX A;  3AX2 A;  1RA6 A;  2UUW A;  4K4T A;  4NLQ A;  1RAJ A;  4X2B A;  4NLW A;  2E9Z A;  4K4W A;  4ZP7 A;  5JXS A;  4K4Z A;  2B43 A;  5F8J A;  2XTC A;  4NLU A;  4K4X A;  3UR0 A;  1SH0 A;  1XR6 A;  3H5X A;  3KOA A;  1TQL A;  4Y2A A;  3UPF A;  5F8I A;  3N6N A;  2XTE A;  1OM2 A;  1U09 A;  4NLV A;  3N6L A;  3OL7 A;  3SFG A;  4WFY A;  5F8L A;  5F8N A;  4ZPA A;  2E9T A;  3AX5 A;  2IM1 A;  1KHV A;  3AWR A;  4Y3C A;  4WZM A;  3KMS A;  3QID A;  3N6M A;  4WFX A;  4ZP9 A;  4WYW A;  4O4R A;  2V1T A;  4LQ9 A;  4NLR A;  2E9R X;  3NKY A;  3CDU A;  3BSN A;  4WZQ A;  5F8G A;  2ILY A;  2XZ2 A;  3NMA A;  1RDR A;  3KMQ A;  2UUT A;  4K4V A;  3KLV A;  4NZ0 A;  2EC0 A;  1XR7 A;  2CKW A;  4NLX A;  4ZP6 A;  3SFU A;  4ZPB A;  4NRU A;  1XR5 A;  4K4U A;  4NLO A;  3OLA A;  4ZPC A;  3H5Y A;  2D68 A;  1WNE A;  4K50 A;  4K4Y A;  1TP7 A;  4NYZ A;  3OL9 A;  1KHW A;  3AX3 A;  2D7S A;  4IKA A;  3NAH A;  4ZPD A;  1UUJ A;  5F8M A;  3NAI A;  2XTD A;  4K4S A;  3NL0 A;  3DDK A;  4NLS A;  4NLP A;  3UQS A;  5F8H A;  1SH3 A;  3OL8 A;  2V1S A;  4LQ3 A;  4ZP8 A; 
#chains in the Genus database with same CATH homology
 3CDW A;  2IM2 A;  4Y2C A;  4R0E A;  4NLT A;  3OL6 A;  4WFZ A;  3OLB A;  2WK4 A;  4QPX A;  2F8E X;  4WYL A;  3KNA A;  1RA7 A;  4NLY A;  1SH2 A;  2IM3 A;  4Y34 A;  2IJF A;  2ILZ A;  2IM0 A;  4NRT A;  3BSO A;  4IQX A;  1RA6 A;  2UUW A;  4K4T A;  4NLQ A;  1RAJ A;  4X2B A;  4NLW A;  2E9Z A;  4K4W A;  4ZP7 A;  5JXS A;  4K4Z A;  2B43 A;  5F8J A;  2XTC A;  4NLU A;  4K4X A;  3UR0 A;  1SH0 A;  1XR6 A;  3H5X A;  3KOA A;  1TQL A;  4Y2A A;  3UPF A;  5F8I A;  3N6N A;  2XTE A;  1U09 A;  4NLV A;  3N6L A;  3OL7 A;  3SFG A;  4WFY A;  5F8L A;  5F8N A;  4ZPA A;  2E9T A;  2IM1 A;  1KHV A;  4Y3C A;  4WZM A;  3KMS A;  3QID A;  3N6M A;  4WFX A;  4ZP9 A;  4WYW A;  4O4R A;  4LQ9 A;  4NLR A;  2E9R X;  3NKY A;  3CDU A;  3BSN A;  4WZQ A;  5F8G A;  2ILY A;  2XZ2 A;  3NMA A;  1RDR A;  3KMQ A;  2UUT A;  4K4V A;  3KLV A;  4NZ0 A;  2EC0 A;  1XR7 A;  2CKW A;  4NLX A;  4ZP6 A;  3SFU A;  4ZPB A;  4NRU A;  1XR5 A;  4K4U A;  4NLO A;  3OLA A;  4ZPC A;  3H5Y A;  2D68 A;  1WNE A;  4K50 A;  4K4Y A;  1TP7 A;  4NYZ A;  3OL9 A;  1KHW A;  2D7S A;  4IKA A;  3NAH A;  4ZPD A;  1UUJ A;  5F8M A;  3NAI A;  2XTD A;  4K4S A;  3NL0 A;  3DDK A;  4NLS A;  4NLP A;  3UQS A;  5F8H A;  1SH3 A;  3OL8 A;  4LQ3 A;  4ZP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...