2XTJA

The crystal structure of pcsk9 in complex with 1d05 fab
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
Knots found
sequence length
268
structure length
242
Chain Sequence
PWNSLVEVYLLDTSIQSDHREIEGRVMVTDFENVPEEDQASKCDSHGTHLAGVVSGRDAGVAKGASMRSLRVLNCQGKGTVSGTLIGLEFIRKSQLVQPVGPLVVLLPLAGGYSRVLNAACQRLARAGVVLVTAAGNFRDDACLYSPASAPEVITVGATNAQDQPVTLGTLGTNFGRCVDLFAPGEDIIGASSDCSTCFVSQSGTSQAAAHVAGIAAMMLSAEPELTLAELRQRLILFSAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Pcsk9-Binding Antibody that Structurally Mimics the Egf(A) Domain of Ldl-Receptor Reduces Ldl Cholesterol in Vivo.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/antibody
molecule keywords PROPROTEIN CONVERTASE SUBTILISIN/KEXIN TYPE 9
total genus 83
structure length 242
sequence length 268
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.4.21.-:
pdb deposition date 2010-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 2xtjA00
1YJCA 2W2OA 4GI3A 3VYVA 2PWAA 1YU6A 3EDYA 1GA6A 3DYBA 3VTAA 3LPDA 2P4EA 1IC6A 1Q5PA 2E1PA 2IY9A 2W2QA 3DE0X 3P5BA 1SUDA 5AQEA 3TI7A 2PRKA 3DE7X 1KE2A 3L1KA 1T1IA 1Y3FE 1Y4AE 1TK2A 3WHIA 1BFKA 1C3LA 1SCDA 1TM4E 1ZVJA 1SBIA 2Z58A 3LPCA 3I37X 3OSZA 1JEAA 3T41A 3SQOA 1AV7A 1S01A 2PKCA 1SUCA 2WV7A 3AJ9A 3LPAA 4MZDA 1HT3A 3HJRA 1AU9A 3DVQX 3EIFA 3LXUX 1SUBA 1TO2E 4AKSA 4C3VA 3ZXYA 1DUIA 5ARBA 1ST2A 3F7OA 2W2MA 1BJRE 3PTLA 5AMXA 3VHQA 4I0WB 2TECE 2ID8A 5FBZA 1PEKE 3AJ8A 1AF4A 3PRKE 3EE6A 1GNVA 1UBNA 2DP4E 1KDVA 5CW1A 2WWTA 1AQNA 1NDUA 5ARDA 3VSBA 1GNSA 2PWBA 5JXIA 1SUPA 4ZOQI 3DVSX 4FONA 3GCWA 2IXTA 1SBNE 1WVMA 5B1EA 5JXJA 2XTJA 5FAXA 3QTLA 1Y3CE 3GT4A 1R6VA 1TM1E 3DE4X 2ID4A 1Y1KE 1KDYA 5JXHA 2HD4A 3WQBA 1Y9ZA 5SICE 1C9NA 1C9MA 1SCAA 1GTG1 1THMA 3BGOS 1R0RE 1WMFA 1SN7A 3H42B 1SCJA 4JP8A 4DWWA 1DBIA 1Y3BE 2Z30A 2Z57A 4KG7A 5B1DA 5JMOA 1S02A 3DVRX 4KB5A 3D43A 3WIVA 2PQ2A 3I34X 3QMPA 1KE1A 1GA1A 2B6NA 1SIOA 4HVLA 2G4VA 1OT5A 1GCIA 3GT3A 4DJ5X 1EGQA 5JXGA 3A3NA 1VSBA 3F7MA 1TECE 1WMDA 2W2NA 1SBCA 1SUEA 2Z2YA 1R64A 2HPZA 3BPSA 3SICE 1Y34E 1Y33E 1SBTA 3DDZX 1PTKA 1PJ8A 1V5IA 5AVKA 4AKTA 1LW6E 4LVOA 3CNQS 1ST3A 4CFZA 3DE3X 1Y3DE 1T1EA 2V8BA 1P7WA 3I2YX 3DW3X 1PFGA 5ARCA 1MPTA 1SCBA 3A3PA 2SBTA 1YJBA 2Z2ZA 4NMXB 2GKOA 1GTL1 1V6CA 1T1GA 2Z2XA 3I30X 1AH2A 4ZARA 1ZVKA 2ZRQA 3Q5GA 1EA7A 3VV2A 4BWGA 3DE2X 1TO1E 2PYZA 4M1ZA 1YJAA 1BFUA 4C3UA 2SICE 1TM7E 3UNXA 1CSEE 4DZTA 3DW1X 1TM5E 2X8JB 4CFYA 3BX1A 1SVNA 3QFHA 2DQKA 1KDZA 2SECE 1GA4A 1P7VA 2WUVA 3CO0S 5I9SA 1MEEA 1P8JA 2W2PA 4OV6B 1SELA 1BE6A 1S2NA 1Y48E 2ZWOA 3AFGA 4LVNA 2ST1A 1GTJ1 3ZXXA 4RYDA 1SUAA 2XRMA 1SIUA 3D9QX 1OYVA 3WIUA 1TMGE 2PMWB 4NE9A 3DWEX 3VV3A 4WOCA 5K7SA 1OYOA 1AVTA 1AK9A 2Z56A 2ZWPA 4HX2A 1CNMA 1A2QA 3A3OA 4H6WA 4J94A 4NE7A 3GCXA 1BH6A 3DE1X 2WUWE 1SBHA 4K8RB 4OMCA 1C9JA 1SH7A 4OMDA 3TI9A 3F49S 1WSDA 5FFNA 4CG0A 3DE6X 3DE5X 1SPBS 4KPGA 4Z2AA 4WOBA 1NLUA 2X8JA 4YN3A 4H6VA 1TM3E 3Q40A 3TECE 1XF1A 1NDQA 4H6XA 1BE8A 2SNIE 5AVJA 1GT91 1Y4DE 1IAVA 1SCNE 2DUJA 2QTWB 4B5LA 1WMEA 1SIBE
chains in the Genus database with same CATH superfamily
1E9SA 4H18A 4QATA 4W7HA 3W9BA 1SG9A 1Y5NA 3TE7A 4BATA 3WAJA 5HZMA 1Y9AA 1C7FA 1SXJA 2WJVA 5C35A 1U9ZA 5HDBB 1L7VC 4JA0A 1LV8A 1PIWA 5F7JA 1YR8A 5CX1A 1QKJA 3C3CA 3R5KA 3F67A 4PN7A 4AP6A 3NG1A 2EKLA 4I1SA 2ZI3A 2C9YA 3P32A 3MUEA 4KX5A 4B6FA 2GZSA 4R9VA 1Y7PA 3ZHQA 2GBGA 1VJRA 1N1EA 4YMSA 3RS7A 1KWGA 1JVBA 5DGDA 3VYWA 1P1CA 1YIDA 2C77A 4ZMBA 5BXQC 5A0TA 4J9VA 1W85B 1Z0DA 2FWPA 1M0SA 3O03A 2QE7D 1BVUA 3GZ4A 1IXRC 2I29A 4OF4A 4G5GA 4LJAA 3UWKA 3WRVA 2JGIA 3RHZA 1JJAA 4EI9A 4EI2A 4CODB 4DKJA 3JVVA 1BDHA 2OL4A 2H52A 1EE9A 4L50A 2DCMA 4F56A 2X5KO 3A1VA 3OJXA 3ZE9A 5EZSA 4QBKA 1ZNWA 2R8OA 4C9BA 2AMLA 3S70A 1USVA 4CIYA 3NU1A 1QJCA 3QEKA 1Z82A 2R6DA 2F90A 4R84A 1NUUA 3SDBA 4UTVA 1NU6A 3A14A 3U4IA 1BOOA 1CQJA 1HRKA 2E6KA 1NE2A 3A31A 3HQ4O 1M7HA 2E89A 3KB2A 4LJLA 4LSGA 4Y9UA 3T7AA 3P9ZA 4ENVA 3P2OA 4JP8A 3B1JA 2Y99A 3D3NA 3HHEA 4G9BA 5GIOE 5IWAB 1XLTC 4QEKA 3VH1A 1QGDA 5IM4F 4KGVA 3LQ2A 3RIGA 3P9SA 5E9AA 3OG9A 4QXAA 1E3QA 4DGQA 6CHYA 5E38A 1JDZA 3GDGA 4ZTUB 4DNPA 4C20A 3F6CA 2CLMB 3FYUA 4L5JA 1WMDA 3RC3A 2JIRA 3FMGA 3L7OA 3T9DA 2RGCA 1KQOA 1T9GS 3V32A 3FE2A 4X97A 2Q1WA 3I4LA 1X80A 3CRRA 3L77A 3GJTA 3MWGA 2PYIA 3NHBA 4H9GA 2MHCA 2XSZA 5DYTA 1I10A 2C2OA 1OSNA 3OCXA 1FU7A 2IP1A 5AD1A 4MYDA 1HEUA 4BMXA 4DZTA 4R0MA 5CD1A 4KSBA 3H1EA 2TYSB 4KO1S 4LY6A 5LQAA 4V3BA 3O4GA 3S1LA 4URVR 2HBRA 3LAWA 4N5IX 2XRZA 1I7NA 2W6ZA 1MEEA 2W2PA 3QMVA 3Q6MA 4NU8X 4MMYB 1KPGA 5B7NA 1U1IA 3DT9A 2NPOA 4OKSA 3OOEA 4MDYA 2QIPA 4MCJA 4P4SA 4YJFA 5B12A 4R2MA 2FJPA 2P2DA 2GWRA 4MVJG 1GWNA 4P33A 4RORA 4Z7QB 3RVOA 2ZAOA 1W1WA 2WNHA 1JIUA 3M83A 3QUTA 2JRCA 4JNKA 1ODFA 1G1MA 1K4MA 3NO4A 3TLAA 2G5CA 2GD6A 1FTWA 4K9OA 4M7PA 3V4FA 3J81k 5E6RB 4W5HA 1UQTA 3P94A 3QUBA 4UJ3A 1IEXA 4CR8A 1W0JD 4ARVA 1B1CA 3KO8A 1IAVA 1ACMA 1F48A 1Z17A 3I61A 1E4OA 2HQSA 4HYTA 1OY1A 4GRAA 3UM9A 2IYOA 1DHTA 4M86A 2RK3A 2EG5A 1HETA 4B31A 4TGLA 2J6HA 1K0FA 2WTNA 3FPJA 3OBIA 4P80A 4UHEA 3CONA 421PA 4EPRA 4FBGA 2CB0A 2J3QA 5EXPA 1G2PA 1ZX1A 3UQZA 4I50F 1FDIA 2GBLC 3T5BA 2CLEB 5DBIA 3BMOB 4IHAA 4HQNA 2IW1A 1MIOB 1Y1TA 4HBZA 3GRZA 5JEEA 3D7LA 4CRWB 4AKGA 3VO9A 3BMQA 3IAS1 1EUCA 3IQDB 2BFAA 2PBZA 3F74A 3VI3B 4N3AA 1FQWA 1ID8A 2M9MA 2FFHA 4KRYA 3WDLA 4QECA 4PZPA 4GQIA 4ZKDA 1NY6A 3GBSA 1A9RA 4I5DA 2YY6A 5A1JA 1JZTA 1FMTA 2KPOA 3ROZA 4KXLA 4QQ8A 3GUVA 4ICIA 1L8XA 1KVQA 1WCIA 2BVNA 1YVDA 2OWDA 2HSJA 4H6PA 4IOJA 1XA0A 2WF5A 3EQ7A 1VL8A 3O8RA 4UE6A 3MAGA 3VDXA 3IDFA 4TV9A 3BMCB 4P22A 1JE0A 4CDNA 5JR3A 1JHUA 3ZNQA 3QKIA 2J3LA 4K9MA 3H9CA 5AKJA 2DUMA 1DFGA 1T2CA 2YRFA 3WK8A 5JNTA 3E82A 4UQPA 1RKQA 1U9CA 3KB8A 4O4JF 3GEPA 5KNBH 3QBJA 2X5OA 3LUHA 3GRKA 1XMOB 1W9HA 5FOVA 1L4FA 5BWOA 1DKUA 2A78A 5B6PA 4M2LA 2QG9A 1PSZA 3O2NA 1TA0A 2YHIA 4U7GA 2PIDA 1RPAA 3IVRA 3GFPA 1X7DA 4XZ3A 2E4AA 3AR2A 3WYGA 3BYZA 3B51X 1V41E 4DR6B 4IZ6A 4B76A 3VR5A 3B89A 1W0KD 1KH1A 6ABPA 3UGJA 3K09C 1CUAA 4EVQA 3Q4GA 4A5SA 5H70A 1U11A 4IDCA 2ORYA 4L4UA 2J5QA 1I7DA 3BRWD 1NSFA 2WU3A 4ZYXA 4LWOA 2GR9A 3I3SR 3I9NA 4IF6A 4MJ7A 4WKCA 2CDRA 4CEJB 5EKSA 1Y80A 1SAYA 1AKMA 4TWZA 3HDTA 4U8GA 4AZSA 1Y48E 5JYCA 1ECJA 1FNNA 5JWHA 5FOXA 2WE7A 4G8JA 2R8BA 3DC7A 3W5UA 3ZHVA 1KA9H 1PFYA 4XVQA 3WC4A 1IBRA 1GNPA 3K7EA 4NYIR 5TF4A 2CL7X 4UATA 3CE6A 3QVJA 4IWXA 4XQ0A 3UMSA 4RABA 4L76A 1PW7A 1QGUA 4UBKA 3WWOA 4D6YA 4FHDA 2P90A 3TQIA 1E7RA 2ZBDA 4OMUA 5BOSA 1O08A 4D26A 4HZUA 4ZAXA 3GN2A 1XTVA 5CAEB 4RZSA 3A9WA 4B3CA 1CD5A 5EINA 2C2MA 4JI6B 5ERGB 4TS9A 3FHCB 1LVGA 4HPXB 1SD2A 3TGWA 1OLSA 1S7CA 2E82A 2VDVE 1XMVA 3E3AA 4OBWA 3N3BC 3QH4A 2HLNA 1QHNA 4POAA 4YEDA 5J4VA 1EB8A 2NZVG 2P3OA 4U02A 1DX4A 1YB5A 2VAWA 3G3EA 1GRRA 2ZI9A 2Q9UA 1RLOA 2AKYA 2C2GA 1UM9A 1YOVA 2XCUA 2GVDC 3HGMA 3NIWA 5KDOA 1W0JA 1ONBA 3WWPA 1B00A 3M6WA 1WHTB 1NUSA 4Q4HB 4IXDA 1MX3A 3RRFA 4MB0A 1LKZA 5KTKA 1LJ8A 3LPLA 1TK2A 4MLDA 1G8YA 4MJLA 3P71T 3OCVA 5K8UA 3AIKA 1X0XA 1C8KA 1L4YA 4E21A 1CQZA 2I99A 1ISSA 3IOBA 4CUZA 2ORWA 4M8LA 4NSNA 3TAUA 5I7EA 4AKSA 1T1JA 1AXRA 1V37A 3BCHA 1PJAA 3ZVLA 1A96A 2FPLA 5KYWA 1OBOA 1UJMA 2IVFA 1M0WA 1SXJC 4OM7A 4WZBE 1QQBA 1TC2A 4KN5A 2XUZA 3VSEA 4TTRA 2G9NA 1IWBB 1Y4UA 1UBLS 3KWLA 4ZDIA 4MR7B 1YONA 3PNLA 4A91A 1W0KA 5JS8A 3SZMA 3Q0IA 2WUDA 4CM8B 2IOYA 2HCFA 3QF4A 4X60A 3WZLA 4EKGA 5JXHA 3PEUA 4HNGA 2XWBF 3VU9B 5DXAA 2CYBA 3KKOA 2A4KA 3H2BA 1X7YB 5LKRA 4W1PA 2GCOB 4KDEA 1V5EA 5LBIA 1LSUA 2YBEA 3ZX5A 5C46F 2X41A 1KZGB 3RRYA 4US1R 5H9WA 2GA9A 4Q9KA 4GM0A 3NBZC 4Y6SA 5A2GA 4DJ5X 2NNWB 2P9JA 2P4QA 3E84A 3AI7A 3MBIA 2GLXA 1H22A 3H18A 3IAAA 3NRBA 4JX9A 4LMPA 4KAJA 4WK0B 4E09A 2H5IA 2OZVA 5SZIA 2G7ZA 1FBTA 1ZUIA 1B7GO 1HDEA 2MWMA 3PGA1 3PXAA 5AM5A 3TLZA 3TUIC 4BNWA 3CNQS 5IZ4A 2ZUFA 5SY4A 5G40A 1SHTX 1RZ3A 5K20A 2CVPA 5ARCA 1FVOA 3M8KA 5H1YA 4PNPA 2ZUVA 1JLSA 4IIEA 3DOOA 1CYEA 1T36B 1R0LA 1WL8A 1Z0JA 4HLNA 5E7IA 2PX6A 5KVCA 2YVLA 4KVZA 2BEJA 3IV9A 1EZ1A 5T3UA 1NUAA 2I2BA 4PBRA 1BH2A 2VT6A 1K8QA 2Q3CA 3I9FA 3WLJA 5DNUA 1EFPA 6REQB 5K6AC 3MS7A 2I22A 2ZP1A 2X4LA 3E6AA 2ST1A 1O3YA 5J63A 1AV6A 1E2JA 2O05A 5FUVA 4MV4A 3GLQA 3ORQA 5DNCA 1CZOA 4FFDA 2FOLA 4ZA2A 2I65A 3FAZA 4JZYA 3VUFA 2QMUA 2WFAA 1P0FA 5SZJA 1ML3A 3RTCA 3SLGA 1PUIA 3R3JA 4JBLA 5IK2D 5IS2A 3C6MA 2QGNA 3NTLA 2VPZA 3CTMA 2AX3A 4O02B 3BB3A 1K5PA 3E9YA 3CN9A 1GGJA 2IGTA 2IDMA 4FJ1A 1ZQ9A 3WOHA 1GTRA 4WINA 3VKFA 1L2TA 4RHUA 3DHVA 3Q40A 1GSIA 3WMEA 1WDWB 2ENUA 1JTEA 4XI9A 2LD4A 3EDQA 4M1QA 5IHXA 3ICEA 3KM0A 1BVYF 1V7PC 3B1ZA 3PUVA 4C06A 4DR4B 5E2IA 4V3CA 1P19A 2D1RA 4FFNA 4ASUD 1QP4A 2PX4A 3ZHTA 1K8RA 3H83A 2R1TB 2D4AA 3KKMA 3WLKX 4JT2A 3U4MA 2NX2A 4Z4CA 4ADSG 2H85A 3ND6A 4Q1AA 4WN9A 5B6JA 3PQ8A 2AI2A 4YDSA 3V1UA 1CUFA 3NWJA 4Y2TA 2O3SA 1QQ6A 1QWSA 4FR0A 4RM3A 4B6RA 1GUBA 2W6IA 3V4SA 1M8KA 3B7PA 4F9GA 1PZGA 3DVQX 4K1XA 2CJWB 3WHKA 3ICCA 4X00A 4O8CA 2QN9A 2PX8A 3K0EA 4Y1EA 1R4MB 4MPJA 3ZWOA 1E2GA 3RVKA 5ICGA 2XMZA 3WP0A 1RJ9A 4XSHA 2XEDA 4PSAA 5LU8A 1PL7A 2QSZA 5DK4A 1SUPA 2OO7A 3BDIA 3LQ4A 4JJKA 4Q4LA 3U3KA 5AK3A 2V65A 3SF8A 4A8PA 2C7QA 1MVNA 2B83A 2DPMA 2X0KA 1EXMA 1LS6A 1Z25A 4A2CA 5L95A 4C87A 3GRFA 4YV0A 2HOQA 4CIBA 1F6BA 1Z6QA 5KAPA 3OJWA 4P5EA 3W05A 4DB2A 2BAGA 3D59A 1LD3A 1QBKC 1QV9A 1FS6A 1JHRA 3PG5A 3NCTA 2XGOA 4OH1A 4OHRA 5JSYA 2QX4A 4D79A 1H4TA 1NW7A 4UEJA 1LNZA 2D13A 2FG7C 4L27A 4LYHA 2YN0A 4RS4A 3FVVA 5K51A 3VR2D 5KQLA 4FT4A 1MMFB 3FNIA 2EATA 2AN5A 5DP2A 3GGPA 4MRVA 1SOUA 4PG4A 3DPUA 4IIJF 3EMDA 1VL2A 2AG0A 2GEUA 2Q3HA 1TZMA 3BRQA 1IJBA 1OX4B 2R68A 4BAUA 4CQMD 1XQ9A 1JHPA 1K06A 3HKCA 4RZQA 3S8MA 1YGPA 5SYNA 3SC3A 3TR0A 5GJBA 4PLHA 4AL4A 4N6OA 4ZYWA 4YASA 1USIA 2FZCA 5HWSA 1EAMA 1HNWB 5BVHB 3ORSA 3M6AA 4OXYA 1RQNA 4WDRA 4DDHA 4UM9B 4YYZA 5G4KB 4CN8A 1X7WA 3VZDA 1ILEA 1V6CA 1VYVA 4V0SA 4R81A 4JUCA 1VFPA 2JLWA 4K3UA 4N0QA 4KH1A 3BFKA 4IIFA 1Z4JA 1AUQA 4UAUA 3OJOA 4IWNA 1JV2B 1KIAA 2LTAA 3A70A 5K7SA 1R9NA 4OUDA 1EGHA 3ZLTA 4BIMA 2QAGC 5K0BA 3E9ZA 3SX2A 4FDAA 4G1MB 2QE7A 3ANSA 1EHIA 1J9EA 3AERB 2XAAA 4IO0A 3NS7A 5EZQA 3IMGA 4JLAA 3VR6A 4H0FA 3THOA 4FHZA 4P31A 4QICA 1DAHA 1C8BA 1MFPA 3F6YA 1OYOA 3ND9A 2XA2A 3MOIA 1V1MB 3TJRA 3FD8A 2Z56A 3MCUA 5KVQA 4DLNA 5EJMA 1N8NA 5AVRA 3A26A 4D44A 2X3FA 1X1QA 4M7RA 5ELXA 1RYZA 3GJXC 1ORVA 1U6IA 4M1YA 3ST7A 4CR7A 5FJJA 3PEWA 5DB4A 4C6HA 1L5GB 4L5AA 1JBQA 1E5TA 2BBOA 1NRJB 2GZ2A 1EFDN 1TM3E 2QRPA 3DMPA 3I32A 4HJXA 3T1NA 3QEBZ 4CIWA 1P44A 1WO8A 1SK9A 2QRNA 2BF4A 3G1TA 3I1IA 2ZBQA 1DWQA 1GZDA 4CMIA 5LQNA 4WFIA 4DQLA 1J1IA 4MVJI 4YUXA 4B3JA 2B0CA 5EVJA 4W1RA 1E0JA 3EGDB 4JR2A 1Q7CA 3GFTA 4M1WA 4QTTB 3UHFA 3WISA 4WQMA 5TS2A 1MOPA 2C99A 2RBKA 4JL6A 3H2GA 1I2ZA 1V9LA 1FNDA 1XTJA 2WTMA 5FV7A 4KHZA 1THTA 4P0QB 2HH9A 2DKNA 3OEHA 3GPBA 3SEQA 4PQEA 1H3FA 1SVLA 3O3NB 1Y6JA 3GPCA 5BV1A 1BNCA 2D3TA 5HFAA 3FNRA 5TJHA 3TQRA 4FYPA 4MUJA 4PRKA 3B52X 2YL2A 3DOJA 5TE9A 4B0OA 4UCFA 4FOSA 2XBUA 4IVQA 4OQDA 1YNSA 2Y8EA 5BSEA 4L3OA 1QP7A 4URZR 1RS0A 5J2TA 4EB6A 2OQVA 4CMHA 2NO5A 5IAJA 1AUXA 1L4LA 1CRWG 2BGRA 3A6EA 3BWBA 3HY3A 2LPMA 5A5DA 3FF4A 2H18A 3FNFA 2BLLA 1JLMA 1TMKA 2HRZA 5F9FA 2VDPB 3F9IA 5F4BA 3LX5A 4EWLA 2VP3A 4RLFA 4XRGA 1ONPA 4QRIA 3ZQ6A 2G88A 4JFRA 3LQ1A 2BUAA 1NN0A 2PUWA 4IHQA 4J03A 4TYWA 5IANA 1K9VF 3PDIA 4HX9A 4F93B 4IOKA 3MGBA 1CB0A 2NZ8A 4XYMA 5LXTA 1DINA 1EDEA 4F6RB 2OFXA 2GTIA 1MB2A 5CP8A 4BMCA 1DBIA 3GNLA 5EJAA 3RRJA 3BKWA 2G8LA 2WG1A 4BFWA 4GQAA 3DVRX 3FKJA 4Q1VA 1IZ7A 4RK0A 1GDTA 2PQ2A 5EUBA 4F5YA 1TCUA 1RRKA 4AMVA 3IKJA 1WB5A 4JUDX 3D5EA 1U9YA 1H6DA 2W2LD 1VIVA 2HDHA 1HDCA 3QA3E 3TRHA 3SDZA 3PDJA 3O1HB 1V4BA 3T1QA 1UH5A 3KZKA 1YMQA 3B8EA 3STWA 1PS9A 1U8YA 4L75A 3FX2A 4LJ6A 1J1UA 3R1IA 3LSYA 4DKXA 1S4MA 4JJAA 1OWMA 4RX1A 1ZOLA 1GL3A 1QHXA 5J43A 1NW3A 1T5HX 4JOQA 4TV8F 4BB0A 1HL3A 3OQOA 1KRHA 4F8EA 1G5HA 2E85A 4F5ZA 2FWNA 3NHAA 4X7BA 2J0VA 2X4GA 3HCCA 1XZMA 3FCYA 4QAQA 5E6UB 1XCBA 4OCZA 4ZT3A 1KDZA 3UA3A 3TBKA 1R5OA 2CXPA 1EQUA 1NTOA 1PTJC 1MQAA 2WAXA 3KPVA 3P9XA 4ZTBA 4UM8B 3WVNA 1ZAYA 1T5TA 5IW8A 1RXUA 2J3EA 3ECAA 1AKYA 2N3ZA 1V1RB 1NRIA 1WCYA 5CM2Z 1UJNA 2WUEA 3RSSA 3SN6A 4ZOLB 1UK7A 1M34B 3GYGA 5EHGA 3FYTA 3GUYA 4TSFA 3HA5A 3L0YA 3I09A 2D7CA 1N9GA 5FPYA 5AKGA 2ZRPA 1NNSA 1UAYA 3QELB 5CB4F 5LYYA 4Y6QA 3MQ2A 3OWHA 4E5YA 2AH5A 2JAPA 1JSXA 5TS3A 3IE0A 2FN8A 5JISA 5LA6F 1EWKA 3BIOA 1O57A 3IDZA 4IOLA 1Z5UA 4J16C 1C8LA 4KR9A 4H4CA 2P41A 1ZN2A 2E4WA 3FF1A 1THZA 1DAIA 2YXPX 2ZBUA 1Z3IX 3ZGYA 3UOWA 2JFUA 4XJTA 2R8EA 4PYOA 1ZRSA 4UBLA 3UGKA 1H85A 3WB9A 2SCUB 2PLRA 1J21A 3TOXA 1UDCA 2V7WA 3GEIA 3RT7A 4AUKA 5BQXA 1WBBA 3ZU6A 3A9SA 1E4EA 4DLUA 1FRQA 3ECCA 3OE4A 3P19A 4N7MA 4G6ZA 3SD7A 4FNAA 3FUVA 2PUBA 4KRXA 2BEVA 5IULC 4RF4A 1WCXA 2QAGA 3C41J 4QELA 4WXPA 4B71A 4I08A 4K46A 3RUAA 1IN4A 2JJ2A 1P9NA 5TQ0B 5HS4A 5G1NA 1XALA 2YX1A 1X74A 2Y1GA 3BG5A 2J0SA 2CYAA 4D81A 3HO8A 2QT1A 5AKIA 3RJTA 3SQDA 1HO3A 3JQ7B 1CP2A 1KAMA 3VR6D 2PVCA 1I0LA 1E2DA 1T36A 2PWBA 1KDOA 3A05A 1V5WA 4QJIA 1HFKA 1M34E 3D64A 1S8OA 3RD5A 2WIFA 1FRZA 3TKLA 3FPGA 5E1OA 1FYXA 2IV7A 5M04A 1EG7A 1VLHA 3OE7A 4C14A 3EF0A 1ZJZA 4NOMA 5U1PA 3QUAA 4F46A 3VMFA 2CN1A 1P8AA 2I4MA 4PTYA 1Z2OX 2V9PA 1VLQA 2IBTA 3HLTA 1Y0BA 2HA7A 1BCSB 3GAMA 1XXLA 4UNRA 4N7RA 5H4GA 2AG5A 1F38A 4HB0A 4OQEA 4OHPA 1H66A 1D4FA 4RAQA 3B7WA 4B6JA 1EP9A 2VEOA 1TU3A 4UCWA 2DBVO 1TUGA 2FUG1 1YFJA 1XVUA 3COYA 3VYTB 2DQ4A 3OD5A 4EKNB 1OH5A 1BS9A 3JQGB 4O2AA 4RF3A 3G0CA 5LB2A 1P5RA 1ISRA 3AUYA 1GP2A 2ZIUB 3LYHA 3FDXA 1RKUA 3E23A 4Y2UA 1XN4A 1OX5A 3UENA 1ZLYA 1S8FA 4GVLA 4IVRA 4LYDA 5A5FA 4K6MA 5JJCA 3BMXA 5ALPA 3NX4A 2GPWA 3LYUA 4OXQA 5BSGA 1XZ8A 1N2ZA 1SBYA 1UPXA 3G2PA 4G37A 1CERA 2V7QA 4ALJA 3S29A 3EBLA 3JZIA 4MKFA 2I78A 2LCQA 1L4KA 1I3OA 1NJFA 2PKYX 3CLUD 4WA7A 4KDRA 1JKIA 4U1RA 2O6HA 4RFSA 1A95A 1JH8A 2HEIA 1RKVA 2R6HA 2XE4A 3MWKA 3OQ6A 2WM2A 4IJQA 4PX5A 1HZJA 5AHXA 1E9RA 5EWJA 3HO1A 3WMRA 2E4UA 4G1FA 4AWXA 3H7AA 1EVJA 2JI7A 3NM4A 5LU9A 1RMQA 1YRYE 4NV3A 4CKYA 5A4DA 2INGX 5CFRA 4JDPA 2OK7A 2XRMA 1OYVA 3N0RA 2FPGB 4UVGA 3KJNA 2P6MA 1ISFA 1U8UA 2DHCA 1EXNA 3M6IA 3ESZA 1TIBA 1TT7A 2UUOA 2ZJAA 1GQRA 1A2QA 1TKCA 2I0FA 2VUHB 3F8TA 3HCNA 4Q4HA 3LOPA 4L3WA 1CRPA 2O2DA 5JANA 2O8CB 3E7WA 1P6XA 3E03A 1SCQA 4AFNA 5JV5A 4HAUA 2R5FA 2C7GA 1VXOA 4HFJA 2AXQA 3SM9A 1KYXA 4A5OA 2HMVA 1FP7A 3NDJA 2F3RA 1KJIA 2WBLC 4ZQBA 2EBHX 3EFEA 5CCBA 5C1DA 1B74A 1JNXX 1E4YA 2JJ8A 2NZUG 2RONA 1I4EB 3AQ4A 1NX6A 3H1TA 5I8ZA 3ZWMA 2K7ZA 4GPBA 4ZJZA 5CIYA 1GPKA 2BGJA 3AM3A 3R7NA 1GGKA 3INRA 3L7BA 4C0BA 5TGTA 3LW7A 2WQZA 3DMGA 3M5CA 2QVYX 4B80A 1GFSA 3AFHA 3OX1A 1QLHA 3M0EA 4IHJB 3D0RA 5I3CA 1HSZA 1NJ5A 4LRSB 4MHOA 1SC9A 2B98A 4K9LA 4WPGA 3EY4A 4C7KA 1E2EA 2ZYVX 2FJ0A 2FY8A 4OXIA 4FJ0A 3NQ41 4ARSA 4X54A 2PLFA 1CEQA 1JHZA 1M0TA 3WYBA 1J56A 1U0EA 1GDDA 1U9JA 4NAUA 2GYUA 2HCJB 2JNWA 3A4VA 5GGXA 4CKBB 1CIJA 521PA 5EHXA 1E1QD 4CHTA 1RVV1 2ZRDA 4ZVRA 4EY6A 1XP5A 4Y6LA 3LFUA 2I9PA 3PEFA 3T35A 1UPUA 2Y76A 4X63A 3EC2A 1G9XA 1HKUA 4R4JA 5DLDA 3AFOA 1B0AA 3E7DA 4DA7A 4JP3A 2R48A 4DZZA 1V6AA 1IOZA 4UHKA 5IT5A 3UWSA 5LYJF 3FTDA 4I5GA 4I4TA 3P52A 2QE6A 4BDSA 4PS1A 4JYAB 1J4AA 4R6XA 2TMDA 1VBKA 3EEBA 3P0EA 4F8YA 4F4IA 1NF8A 2D5CA 5AI4A 1G2IA 1DKLA 3DQPA 2PQMA 2WK1A 4XQ9A 2QOEA 1OCEA 3JR7A 1I9CA 1T15A 7MDHA 3OZCA 1ULUA 1YZHA 3ENKA 4MGKR 5TIIA 4YMGA 5JU6A 4URXR 1II9A 2Q2QA 2IHVA 4I1VA 1H2WA 5FR1A 4BECA 1SOWA 1N8KA 4QDXA 4PYKA 5CB0A 3AKZA 1VM6A 3N59A 3VSCA 1N77A 3BE5A 2JLZA 1OXVA 4RJTA 2Y05A 3Q2OA 1XLVA 3IMEA 1EP2B 4LVOA 3L0OA 2R1TA 3WSWA 3K0FA 2R4QA 4IXNA 3G2MA 1OC4A 3KAKA 2RH5A 3BEDA 2IDJA 2WJAA 2XH8A 4MI1A 3UXMA 2PYDA 3KXKA 4JLPA 1ZL2A 3QM1A 4LVUA 5G2OA 4FR5A 4G2TA 5IUKC 4Z5XA 4YPOA 3N0VA 4YDHB 1YGYA 3DW1X 2NU9B 1RRPA 4JI0B 1YZGA 1P9LA 3GFQA 4I4NA 4YH1A 4ECAA 3L0ZA 2GSWA 4G5QA 4QU9A 4ZOEA 3WGJA 2Q4DA 4QM6A 3BD6A 3H2IA 3ZE8A 2E9SA 2NMVA 1SELA 5A04A 5T4FA 2FN7A 4J0QA 1WETA 4OHUA 1UKVY 4MWDA 3VOTA 3AHJA 1I4LD 2UZ1A 5EMKA 4GSKA 4MUNA 4BPBA 4JODA 1AIPA 2ZR9A 4TZTA 4G5RA 4Y2JA 2YOFA 3T52A 3W0LB 2Q6OA 1X7XA 4FZ3A 1XE3A 1CJTC 2GBCA 4MR8B 1X2BA 3ZE7A 2NZJA 4B7UA 3W3AD 1XMJA 4OHOA 1NQOA 4EB0A 1IM8A 4YT4A 1ORIA 4G0VA 3KSRA 2OUKA 3LW8A 3D6UA 1ZMBA 1W0CA 3KCNA 3LY7A 4G1BA 4MVJP 1Y3AA 3NEJA 4E31A 1QQ7A 2I1WA 2AQIA 3BM5A 2Z2KA 3JSAA 1Z3CA 2VH1A 3BRCA 2CLCX 4L07A 3SBXA 5CT8A 1UMDB 3W8FA 3K96A 2H9YA 3WNQA 1EVLA 1L5ZA 4BNDB 2NV6A 2OOSA 4FZRA 3NVAA 4LY9A 5LCXA 5HR5A 2JGAA 3EC7A 3FPKA 1RM4A 2DT8A 3RFFA 3RSOA 4D80A 4DSAA 4DRXA 3ZVMA 3U4DA 2C5EA 4UNNA 4IXTA 3ABSB 4KX3A 1H1TA 1E66A 2E1PA 4B8YA 1MBZA 5KPDA 3LRTA 5H16A 1JILA 1V8ZA 1VMAA 2EERA 1E4EB 2DLCX 2OHXA 2X7XA 4B3TB 1ZQ1A 1KI6B 2CV2A 3QE2A 4JQOA 1T9AA 2UXBB 3UCXA 4Y18A 5I4KA 3FOZA 1G42A 1IPFA 1NMEA 3K72B 3OIVA 1N6LA 4YJKA 3OTQA 4UVIA 5DM2A 3T9AA 3F5MA 5ADWA 3JALB 3UA4A 4HNQA 2NO9A 4W6ZA 2HLHA 3M6UA 4MW4A 1ZGZA 4BHTA 1XXHA 1GNVA 2EKQA 1X7GA 1YZYA 1W36C 5IXSA 1SEVA 1X1BA 4U9UA 4WVLA 2V03A 1KGSA 3R24A 4Y30A 5ENDA 4ISCA 1RMYA 1P1BA 4TMFA 4D9CA 2O2JA 2R00A 2IHYA 3AI1A 1SC3A 1T3SA 3AF3A 4RD2A 3VGPA 1YNOA 4QE3A 2F8SA 1XRSB 4XEUA 1OBHA 3F97A 1J8QA 3HYRA 4PGHA 2HPAA 1Y1QA 4Y8VA 1ZKDA 4TPKA 4U7TB 3UCFA 2N42A 2ZJ0A 3FTPA 5L3SB 3NW9A 3GB9A 2Q3EA 3BZBA 1UP4A 1I30A 4PG5A 3JQ9A 1KIMA 1W5AA 4GX0A 4X6XA 4DDKA 1K8XB 1FNCA 2OMEA 3THYA 1HLDA 1XVLA 2WJGA 3N2GB 5LUBA 1T0IA 2OXEA 4B4OA 4F9FA 1YVPA 3CUUA 3SICE 1R64A 4GBGA 2HMYB 1SVKA 3AF2A 3QI7A 5AW0A 4ZEMA 3GJRA 1F8YA 2VK8A 5E6RA 4PM4A 3SG0A 3V4ZA 2JIPA 1BGVA 3P9NA 5JCPA 5KSOA 4M1TA 1CQJB 3RJ9A 1RYMA 2V8BA 4R0VA 4C0XA 5AM2A 2VDWA 1IZZA 4B6PA 1JEEA 3SOZA 1N6OA 3QV1A 4D45A 4W9MC 5F1OA 4EJFA 2UYCA 3G9QA 2FE1A 2P6OA 3HHPA 4N0EA 3R8CA 2ZDQA 5EPEA 3NBFA 1UFKA 2GBLA 5G0TA 1Q16A 5ICFA 3FTQA 2X22A 4EG0A 1UUFA 2H1WA 3FGOA 5J4KA 7REQA 3EFBA 1BFDA 5LZ7A 2FDCA 13PKA 4RTSA 2FFBA 3GA7A 3EZ9A 3U3XA 4WJLA 2ZT6A 3B5EA 5ADVA 1Z63A 5FTNA 1F60A 1OTHA 3DL2A 1YS2X 4X95A 5A3VA 3DFFA 2V98A 3E81A 4LPKA 4MVXA 4BC0A 2DRIA 4BO1A 4EFMA 2PSFA 3LT5A 3Q7EA 4WLVA 1DCFA 1T26A 3OLXA 5CT9A 1XQWA 2HAEA 4OMCA 2RHHA 3MUNA 4RIIA 5E3HA 2P9QA 5M29A 3CLRC 3FCOA 1GZ7A 3ILSA 4OAPA 4YO7A 5KNLA 2BMDA 3UTDA 4DCCA 2QAJA 3QSYA 5AOBA 1RYDA 2FFRA 1IE3A 1YFLA 3A8TA 3FLEA 3V6MA 1QLJA 2ACEA 1M72A 5ADUS 1PE0A 1OLUA 1N7HA 2Q5HA 1IN5A 2HJ9A 4RTQA 3SSAA 1W47A 3KSUA 3W4IA 3ZY2A 1OILA 3K9QO 2ZVQX 3PJDA 5TXGA 4FU0A 3TTSA 3HFRA 3VTAA 3W6NA 4ALKA 3R6TA 3I2FA 1IHDA 1DADA 3EXEB 1E2KA 5BNIA 2PNFA 1DO2A 1R0SA 4JBGA 1Z13A 2COKA 4YCJA 5ALEA 2HRCA 2QV0A 2V7EA 4PSKA 4BEJA 2AF4C 1MEJA 1VHDA 3RVSA 1C3LA 1NQVA 2EG9A 2Q2OA 4QO7A 5JZSA 3IUQA 2CE7A 4X92A 3ND5A 5HIMA 2C83A 4D3XA 4ER3A 2QRKA 3NRJA 4ZYYA 4KTVE 4OHVA 4UHBA 4YRPA 4A8TA 4F9EA 4PZ0A 2NSHA 5K8VA 3JARB 4V0NA 3RVRA 4TLEA 1Q0LA 3MTQA 3W3ZB 3DM5A 3BFVA 1QE3A 1SXPA 1TKAA 3VGJA 3H9QA 1YCHA 3GCWA 3JD2A 2DWPA 3O7WA 5DLYA 5ECWA 2IXAA 2BFCA 4JJ6A 1ACLA 5E4FA 1KJ9A 1QX3A 3HG7A 1KO8A 3FNHA 2VH2A 3OJCA 5DRYA 2ACVA 3G6KA 1Z5NA 4Q82A 4QQKA 4X1YB 3VH3A 4ND8B 2GM5A 4ENSA 2X42A 2R25B 3CJQA 1FW6A 1T5BA 1KORA 2O3QA 1U2DA 1Y3BE 5A0FA 2P0YA 4YJ3B 4RVDA 1Q22A 4XPIB 2V3WA 5FOSA 1Q17A 1SQFA 3DDOA 4QLOA 1XGKA 2BGUA 1NP6A 5C8YA 3L4KA 1RE1A 3RODA 3W06A 1U0FA 6Q21A 2WC1A 4KO8A 1J09A 5AP9A 1C9KA 5BYJA 1TK3A 3NJ4A 1JQKA 3DB2A 2B99A 1DCMA 5G41A 4C6TB 4GXRA 3TW0A 3OBBA 3BL6A 1XRNA 5MDHA 1VB3A 3WNBA 3OTOB 3IUJA 3LYLA 3RAPR 3FSGD 1IBCA 1A1VA 3G7NA 4G97A 1WVIA 3D7SA 1QHGA 1YIAA 1QQ5A 2VF2A 3GVIA 3TSOA 6ADHA 1B8OA 1H23A 1X94A 4BWYA 3K9HA 4DR5B 2YWGA 3K9NA 4QBIA 4I1OA 5E0KB 3JTEA 3K5WA 4JBXA 4F85A 1UEIA 1SZPA 5HKOA 3JAWA 1FYFA 5DNDA 1W75A 1X13A 4CW7A 3E9CA 3RPEA 1FMJA 1M74A 1SUAA 1H42A 1UCFA 2FPUA 2TS1A 3OF2A 3T6KA 3WDMA 3TR6A 1O0SA 3KHSA 3P9IA 1WDKA 2JFYA 1XRQA 1LZLA 2BFPA 4MI3A 2QLTA 4BZQA 1BKYA 3CBQA 1J2UA 1DE0A 5CJJA 4YFVA 2CXHA 1ZNZA 1ZUHA 3WYDA 4F21A 1PJLA 1RADA 1G8MA 4BNIA 3CH4B 3WO0A 1Z6TA 2O0KA 2MMCA 5DHAA 5F77A 3A1TA 3S4YA 3UAGA 2VKQA 3FPEA 2OD2A 5TEWA 4D43A 3LQKA 4H6XA 2D00A 3FCSB 2FR8A 3HS3A 1PN3A 4B5LA 4BBJA 2IYFA 2XBMA 1DNPA 4GICA 3IUNA 2JLRA 4DLZA 3VYVA 3JQGA 2BMEA 2VYNA 3VZRA 3FLMA 1LEHA 3OZ7A 4P4TA 4AROA 5KSZA 3BK1A 3P5BA 2PGLA 3QMWA 3QITA 1WU8A 4ZVSA 2RC5A 3VO2A 1N3LA 2Z3WA 2Y3IA 3OC6A 1X8XA 4QSMA 5DWVA 5AXCA 2IBSA 1TM4E 1JG1A 2H0QA 4JVLA 1BKDR 1LW7A 3GCDA 3CUYA 1SXQA 2RE8A 1NC1A 3E7FA 5BVGA 2AC4A 2WIBA 3K0FB 1P60A 4AU1A 1PJQA 4QGGA 2FA9A 4JN6B 2QVBA 2OV3A 1OVGA 3IKMB 1JQBA 4UREA 2VJDA 3E4DA 3PFBA 3S5UA 5J9FA 3TX6A 4RIEA 2EZ4A 3H5LA 4Z1MA 2CNBA 4EF5A 1H2EA 1YMUA 1UXGA 2XMQA 1TMYA 1OTYA 2FZ4A 4UC0A 3H0EA 4Y0VA 1RWOA 3U4HA 1WY7A 3GT4A 3C16C 4M0CA 5FA5A 2ID4A 1DIRA 1Q1QA 3EN0A 4JUBA 1ZD1A 3DBRA 3U7GA 1O8CA 1O4WA 2EBFX 2CF6A 4Q3CA 4I8DA 3PXDA 1GPYA 4MV5A 1W30A 5CDTA 1I5RA 2XNKA 3M81A 1NQTA 1FDOA 3QPBA 5LQUA 3SZLA 1HE2A 1WULS 1S9DA 4AECA 4AN4A 1ZONA 1J49A 2EV9A 4S24A 4PR0A 4EY5A 1CUJA 1BDIA 1NIPA 1KC3A 1O9HA 2XRFA 1T24A 1KP3A 2DE0X 3RYTC 3ASVA 3EPLA 1NX9A 3I12A 3ROMA 1QB8A 1SHLA 3UWMA 1M5TA 1UPCA 2EW2A 4GNKA 3DQQA 5A5GA 3GT7A 2GBPA 2DFDA 1U7TA 3AWDA 3R7FA 4LKOA 4CM8A 5AVTA 1N6NA 2PPVA 3THSA 3VU9A 3ZHCA 1NR7A 1FFXB 2Z2XA 4FDMA 3LKBA 3B6JA 3LXXA 1LDMA 5MN4A 4W5RA 3THRA 1T6ZA 3HR4A 1SM4A 1UAGA 3GJ7A 3ROKA 1YCFA 4DIFA 4W5WA 1S3FA 4YRSA 2BPOA 1EJ2A 3AKYA 1JKJB 2FPPB 3K2EA 3LVRE 2G76A 4I4CA 4N54A 4PZZA 5EG5A 3RR2A 2NN3C 3GLHE 1ECCA 3ONVA 2R6FA 2QYTA 4UNIA 4YRAA 3NOVA 5K09A 4BV2A 3LGSA 3GOHA 4PBTA 4DA0A 3AUAA 3HV0A 5AKEA 4YUYA 3HP4A 4IUDS 4E15A 3S2GA 1EB9A 2FNAA 3LM8A 2WU4A 3TFQA 4Q0MA 1F1BA 4E2XA 3L0BA 1KEEB 5HIAA 3PEYA 5LC1A 2KX7A 3AJRA 2IXDA 3BWXA 1YU9A 3DLTA 3TLYA 4FDLA 3TQOA 4LDNA 3TZHA 3ZG6A 3SQWA 2GHRA 3QVSA 4R8LA 4WLOA 5T8KA 4HGNA 4TN1A 3WKDA 1ZNXA 4IYRA 4RKFA 2PL5A 1ES9A 3HRHA 3NBMA 1KMHA 5JXWA 1F1JA 1OWPA 1E1LA 1E7QA 5K8TA 3UPTA 1Z34A 5JD4A 2Y1LA 4KVFA 4U63A 3KPWA 5IVIA 2EC5A 2O23A 2VFAA 4ID3A 4LY3A 4P5PA 5L3RA 3ZBQA 2GK7A 2C4UA 5DPMA 3JQAD 4BNLA 4HZUB 4EGQA 5JPCA 2IHNA 4B3GA 5HCUA 1J2RA 1Z9BA 4LOIA 4O4LF 4YP5A 5JAOA 2H5LA 1ULBA 4IW3B 5DMXA 3O26A 3RU2A 1K2WA 4YHHB 4C05A 5IVKA 1D7OA 1RHJA 2CD7A 3BSFA 3CEPB 4OXNA 4Y2QA 4AM8A 2B1RA 3EVGA 4NPAA 4U3JB 1BXGB 3HLYA 2HUPA 4L4RA 3W2TA 4ZOBA 5B7PA 5LDDC 5HEKA 2WU8A 4MITA 1EVQA 3H2ZA 3UMGA 2XWPA 2QPOA 5LIPA 1BMFA 3DQZA 1CQPA 1WP9A 4OHXA 1ZBQA 3NOOA 3KPJA 1R8XA 2JGDA 1Z8HA 3D6JA 2QZ9A 3PIIA 4JB8A 4J9UE 1CT9A 2OHHA 1WMAA 3LH5A 4K03A 3SYTA 3UYLA 2GCEA 1M1YA 4YBZA 3QY0A 1JBEA 3A6FA 5ED4A 3KDAA 4N3BA 4G9EA 3NTVA 1OHHA 3LT2A 4QA9A 4A23A 1Q1AA 3GLHA 1TO6A 4ZHSA 2YV2A 1CVRA 3IX7A 3ZDYB 2OAGA 2BJWA 1B41A 1H2YA 1XJ5A 1U1GA 2HK8A 3EVAA 3FKSD 2VP6A 4LOLA 5K9ZA 3V80A 2C31A 1GTG1 1C1YA 3BXZA 1H2BA 2Y2UA 1CZKA 2FSPA 3LKZA 4L4SA 4DMGA 3FOFC 1KNXA 1AHNA 2XJ9A 4R83A 2RAPA 4UFOA 3WK5A 3EW9A 1AY0A 3AF6A 3DZFA 1BX1A 3LL4A 1VBMA 3QVGB 2C3PA 4YI5A 4JWTA 4XYBA 4ZT2A 4WESA 1XQ1A 3LRPA 2WB2A 2ZJOA 3QF4B 2M98A 3HKDB 3HO6A 3CZCA 3TTWA 2F17A 3H2YA 3EIUA 2VTKA 2AG6A 5FOWA 4URFA 3IOYA 4LHWA 1RM0A 4M4SA 4BB6A 3KDPA 3W4JA 4B85A 2JF0A 1QCDA 5IT4A 2J46A 1T25A 3K1YA 3T8YA 3FCEA 1NUQA 4OIMA 2K2WA 2QJFA 2LZ0A 1HPLA 1XQYA 2ECKA 3U40A 4ZJYA 3EJWA 5F51A 1KI6A 2OTCA 2FSHA 3BC1A 3PTZA 1ZI6A 1P81A 4KV9A 4RCYA 5BR7A 1IN1A 5SZHB 4KFSA 4EHJA 1ZR4A 2C2HA 4GF5A 5DI3A 3G1WA 2HWUA 3RGGA 2HTFA 1P0CA 1P2BA 4HWTA 1TYBE 3KOUA 4JJGA 1ZK1A 1N78A 1GL6A 2PXAA 1W87A 5BYKA 1UPFA 3U60B 5T3YA 1IUKA 2B92A 1YL5A 2QUZA 2IQ5A 1YDWA 3ID6C 4QOGA 1YR9A 1QTQA 2ZLBA 4MV8A 1EFAA 2I7DA 3OT4A 3WWDA 3DFIA 3ONDA 3CVJA 1VQ1A 4IGAA 3I0NA 2ECPA 3L6RA 2I80A 3T7DA 1SK8A 4PYIA 1U5AA 3VR3D 3P27A 2OORA 5LBUA 2ZJ3A 3UWOA 2PZMA 4D0GA 2FE4A 4R9UC 5B58C 5H80A 1WU7A 2C9MA 2L17A 2V7BA 3KJHA 4R3UC 3W8DA 2FFAA 1EX9A 1MXHA 1THGA 3GDHA 3WMWA 1NOJA 3UKDA 1D8TA 2PT7A 1S1MA 2M1ZA 2RHDA 3L06A 3CO5A 3PR2B 5IK2A 3D5TA 3ZGVA 4OQQA 4D9JA 5I8WA 2VCYA 2DTEA 3VJMA 3PLAE 3VC2A 3VPBA 1WB9A 3FDZA 4HVAA 4EJSB 1Y9JA 2GKGA 4LMAA 1HV8A 1L5MA 4NECA 1TZKA 3INGA 3O3OB 4RK6A 1GSAA 4BP3A 4EZBA 3VPFA 2XI4A 2UYHA 4OSPA 5T41A 4IX9A 1KI9A 4P3XA 2WHPA 3VHRA 1G7CA 1TVKA 2ZQYA 4IKOA 4AZ0A 4F3CA 1M6NA 3CCFA 1RBMA 4S1OA 3AF5A 2X8AA 3UK6A 1KK1A 5K3AA 3SCZA 1R5BA 3DM9B 4WUTA 3L7IA 4JT4A 4ZI3A 4YCAA 4ZD6A 5KQPA 1DLJA 3M5PA 1EUQA 5JVDB 4CEHA 1F8FA 1CUBA 4H7PA 3VNBA 1LBSA 4CLOB 2GOYA 1JTFA 2MSLA 5DF1A 3QXSA 4Q7QA 2GEFA 4UAVA 4PLZA 1AKQA 4XD7D 1XP8A 3IPXA 4PIVA 3VYRB 1EX1A 4MPDA 1C0PA 4WBXC 3OUTA 2D2FA 1MV5A 4JLBA 4XD2A 1U2GA 4H1HA 5KINB 1R0KA 2NUAA 2PRIA 2UUPA 5I51A 4MPTA 3W79A 4OQLA 2AUNA 2C7OA 3R5XA 4QWWA 4CETA 3EXG1 5K6RA 1RXSA 7GPBA 1PT9A 1PV4A 3CHYA 4XTCS 3KNZA 7REQB 4KWHA 5A3QA 1X7ZA 1TUEA 3WWCA 2UYQA 4YRZA 1GG5A 2ZULA 3H3JA 4JI2B 4NU6A 2YFHA 3DYVA 4D8VA 3SK0A 2FH5B 3D4PA 2NU7B 2XNDD 4W9NA 4FB5A 2JW5A 5EIWA 3UH0A 4W82A 1Z4LA 1ZD2P 1JEYB 1XCLA 5FI3A 1E7WA 3G2LA 4P08A 1QH8B 5FL3A 3DTTA 1DDOA 3Q3IA 3OQNA 4QXQA 2CFCA 3IT3A 2JVIA 5K03A 4RD1A 2Z09A 2ZUBA 1P4JA 2FSIA 2G9QA 3LCMA 3PR1A 1VRCA 2XF8A 5EQTA 3BX1A 4JR1A 4JROA 4F3NA 1BDMA 4ZVMA 3UUEA 3H05A 3DMYA 3VX4A 4LX0A 1GA4A 2HHCA 1HOTA 3EMBA 4YCNA 4E5SA 4NH4A 4L78A 4O3MA 4R2JA 5C37A 1DS6A 4WNAB 3WL8A 4DMRA 1GRQA 1P5JA 4P98A 4D41A 4UTZA 4QU8A 4Z86A 4ZYLA 3EA0A 5CA1A 1XTSA 1HMYA 1KJNA 3NT5A 2AJCA 5JZBA 3DOFA 3V48A 5TNXA 3IE2A 4D5GA 1NRXA 1UJCA 3EJ6A 1O77A 4GPEA 2EBUA 3HB0A 4LZWA 4OMDA 4A7PA 5LZ2A 5HCNA 4KPGA 5HK8A 4L9WA 1NVDA 3H5VA 3KOOA 3MPUA 3LVBA 2XMPA 2L18A 3B13B 2RHOA 2RB5A 4X1OA 2MR5A 3ZZUA 4WXMA 2EJWA 1W29A 3OEED 1X7WB 5FUMA 4JP2A 2QTNA 1OJ7A 4MKRA 5DX1A 3HV2A 4F5EA 1YJXA 2LIPA 2WVGA 5LQCA 1QIDA 1C9EA 4FSHA 3E1GA 3ETGA 4ILKA 5BPFA 1EPUA 1OZHA 3PCXA 3JYNA 3PFIA 4DAOA 3RJZA 4DMLA 2ONKA 1NHGA 1G18A 2PS1A 2HMWA 3IEPA 3PWSA 2CEKA 2H31A 4MYRA 2FMUA 1CJKC 3PP8A 4IIBA 4Q7EA 1QK3A 2FN3A 3Q7SA 4R8SA 2FMXA 1YD7A 1QTIA 1OIVA 3ROXA 1A8IA 5KX5F 4XPIA 1QGAA 4HGYA 3VR0A 1UDRA 1WSBA 5KYYA 2Q2WA 3A3KA 1GV1A 2I1VB 4MA5A 2BEKA 2GS9A 4UXHA 2PJRA 4FE4A 4CKWA 2XNDA 4UEOA 4WCFC 1W1UA 4PZUA 3VR5D 4C4XA 1RWMA 1VIMA 4D0SA 2O8EA 1C1DA 1GQSA 4V02A 3UFBA 1C3EA 1DBWA 1U65A 2IHZA 4W1QA 4Y1RB 4UBMA 2HD4A 4GOXA 3E8SA 1A7AA 3ZI0A 2NQ8A 4H16A 4R54A 1FTSA 1V7ZA 3RS4A 3SNHA 2NYVA 5D3ZA 1H2FA 4FOOA 3PSHA 3D6AA 3LP5A 1Z0IA 5LKAA 4O0LA 5GAJA 2IYXA 4MGZR 4H35A 1C3VA 3KZ1E 4J2TA 4IS2A 2WPDD 1KVRA 5GV8A 2GXAA 1LB1B 1CUDA 1NJGA 1V11A 1AQLA 2CMFA 4XX0A 2HPZA 1K5DA 2HXYA 3KT3A 1COZA 4NZPA 4V0RA 3OEYA 3V7FA 4FEAA 3GO4A 4Q93A 1WKCA 3JQ8B 1V8OA 2FTKE 1U8AA 3VC3A 4TSRA 3CEMA 3W9UA 3ZQJA 4ZJUA 1CUEA 1LH0A 3QX7A 4WNAA 4HEQA 5K0TA 2FW0A 2IGBA 4C7MA 3V8BA 1JR3E 2JLAA 2GNPA 4FYWA 5IT9A 5A02A 3KQPA 4HB4A 1YJ5A 2CLKB 4RGYA 5EXTA 3TLBA 3U81A 2JIMA 4HR7A 1O1YA 4BGDA 2Q62A 1IL0A 4PO8A 3ZWQA 1W5SA 2ZJ4A 5AKZA 2WKWA 4GOJA 2Q6LA 2R60A 1LPMA 2AFHB 1IY1A 2WFMA 3B53X 1T8RA 5AW5A 3OPQA 4G4SP 3ZDFA 4GMDA 1O94A 3C3KA 1JEJA 1AHIA 1BMTA 4KN9S 4FFOA 1OC2A 2ZRFA 1YIOA 1IZ0A 4DUGD 2BWJA 3VVMA 4NMWA 4PZDA 4QUEA 4AY6A 2A2ZA 4WJZA 2BI7A 1LY1A 4QZVA 2QY6A 2ZIAA 1CY8A 3QZUA 3W9SA 2C9BA 1FTYA 1F7UA 2R11A 1X39A 3F4LA 4INJA 3EASA 4RH1A 2BE7A 1GTSA 4IF4A 4A0SA 4W7IA 4IBOA 4FINA 1P0MA 3D3KA 4CLRA 1R3DA 2IPMA 5JQWA 2G7MC 1A9YA 5KKCA 3FYHA 3RVQA 3BMOA 3O5AA 1T8YA 3CLTD 1DZIA 1U5CA 4JL5A 2Z04A 4RTNA 5AXAA 1IB6A 1D7AA 1HNNA 1LBTA 2B7CA 2EKDA 2PANA 3LLMA 3MAJA 4RF5A 2PV7A 1TEXA 2BM8A 2CXTA 3IUPA 4HHEA 2F7SA 4RV4A 3SC6A 4TXLA 3UJ7A 4Q4CA 3SEZA 4BO9A 3ONWA 3NXKA 1RHRA 1JB9A 3RRMA 1JL3A 1YVUA 1DQYA 2WYVA 4HNAA 3ZWAA 4K6GA 3QI2A 3MRSA 2IEDA 2YW2A 2GGSA 1T6NA 1QBGA 3A4IA 4D4KA 1XAIA 5KBYA 2E5LB 3ZY3A 1EFLA 3L07A 4AG6A 5LZ9A 3N3AC 4A8JA 4HVTA 3B82A 3JZAA 1MH9A 3PTLA 1XEWX 4HY3A 2B3TA 1GRVA 2AC2A 2QRUA 4FKBA 1P2FA 1RXIA 2A67A 1MG5A 4Z53A 2J9ZB 2VHXA 3SJZA 1KMNA 3GRUA 1R0ZA 4Y7CA 5IBQA 4IRXA 4CZ2A 4HN2A 1JHYA 3I9MA 2CVFA 5AHOA 2C5LA 1ZJ6A 3SF0A 1GEEA 2HC9A 4HH1A 4RTLA 1E2LA 2F9FA 2KJQA 1OB2A 1IBLB 2I8AA 4L22A 1KEKA 3FPHA 2WF8A 1SKBA 4IHJA 3PQ4A 5ILQA 1BHQ1 3PX2A 2H2WA 2OHOA 2VJAA 4P0PB 1A8SA 2GN8A 2JFGA 3QHPA 4PSDA 4NH0A 4MYCA 1CKEA 2JD2A 4WKOA 3WG9A 3TE6A 2E5FA 4BN0A 3JR3A 2A5GA 3CCBA 3U3RA 2GO7A 1EFCA 4QSHA 2ETXA 1ZS9A 1FP2A 1PSDA 4W9RA 2LVBA 1B73A 4NJEA 4QARA 5BNWA 4LXUA 5CNKA 5EJ5A 2MTBA 3SXUA 2VPTA 2WD7B 4WHMA 4X94A 1D1PA 2BYTA 4EHFA 1YZLA 4QT4A 4ZALA 5H8WA 1KZ1A 1I6LA 2XOXA 3LT1A 4FHGA 5C2JB 3U7IA 1UMCB 1M3SA 3EGXA 3UMVA 4QXRA 3ETNA 4CFZA 4Q3OA 3RNLA 1XTPA 1GU7A 2XQKA 5KTYA 1KDPA 4OHZA 2QKYA 4I14A 3IVGA 4MW2A 2ORED 4OXXA 2V0GA 4NXNB 3OCJA 5EWMA 2JGNA 5KZMB 8ADHA 1BXKA 1JT2A 1JHDA 1QHHA 4EBFA 8LDHA 5KPJA 1CFJA 1VL6A 4MS4A 4ECEA 5FF9A 2ZSEA 4GFDA 2X8JB 4Z3KA 3C5EA 1IHYA 2IIQA 3C85A 3DEHA 3QFHA 4KVGA 3SHWA 2GCIA 3UT6A 5KQSA 5ALNA 5C8XA 5I9SA 5K0SA 2WIJA 4D6PA 1GFIA 3UW3A 1U8XX 1SUSA 5F64A 2O54A 2B4RO 2AI3A 3EQ2A 4RGVA 4DL9A 3KEOA 3T0GA 1QGYA 5DIFA 1W2HA 1KMIY 3GPIA 2WYIA 4EO9A 4KQHA 3CINA 4CKZA 1Y1RA 4II2A 1IHPA 3FBTA 4MUXA 4OY3A 4NMHA 4RCVA 4OYHA 4JOCA 5BR8B 1PQYA 3O31A 3SS9X 1MVOA 1DXYA 4C0HA 2C92A 5IBCA 5L3QB 3KYIB 3OSUA 5L45A 4WFQA 1ZMTA 5FA8A 5FWYA 2XPCA 2A0XA 3V4OA 1XEFA 3EMVA 1WXFA 1OPXA 3HB4X 1R10A 1TL7C 3AU9A 3I9V1 3KT0A 3QU5A 4J43A 2Z8YM 4MQUA 4H6VA 4OGKA 1GLVA 3DV9A 4QYMA 2O2CA 2PSEA 3B5IA 3G2JA 2G07A 5JO0A 1BE8A 2IZOA 1DEHA 5DLEA 1GT91 3T3EA 2Y1XA 2FZGA 3E3LA 3O4JA 4XTRA 2AS0A 1AB5A 2D0PB 2ZRAA 3WL3A 1T1SA 3DHWC 3O8QB 2A0YA 4DREA 2I34A 2OO5A 2AMVA 1XZJA 3MG9A 5EL0A 1CY7A 1Z75A 3GIDA 3W7VA 2WWFA 1Q5PA 2H1SA 3DBLB 2X0FA 1NW9B 3F6RA 2DFPA 2HTEA 1F8UA 3KUUA 3AB7A 1WCIB 2H4JA 2M2IA 3L1KA 2C9OA 3I1JA 1RHQA 1K7CA 1X7ZB 2GBIA 3FDJA 4MV1A 3L8EA 5I01A 1E3MA 2G5PA 3FW1A 3AVYA 3L1HA 5FORA 3K2IA 4DLAA 2WV7A 4FX2A 4D2IA 1PTJA 2HRQA 2ZFUA 5B1IA 4IDQA 1WTAA 2QD3A 5IF3A 1YJ8A 2RHTA 1W4AA 2W2MA 3RRNA 4FDTA 5IH7A 1CY0A 3LPNA 3E2MA 3TM5A 1R9JA 2RH8A 3F6SA 1Q7EA 4RZUA 5CXSA 3W2HA 5BV7A 5L4LA 4H4DA 4PLWA 1U0TA 1OROA 4E30A 1D5WA 3IO5A 4WH0A 1NVFA 2VYFA 4NE2A 1P39A 4X93A 1DAKA 4I4IA 4Z6KA 1TZCA 1Z0AA 3CA8A 3V9AA 1YA8A 5K8LA 4YQFA 4LY0A 4R2IA 3K0AB 4F2WA 1Y7LA 3HEMA 3QKRA 3QLTA 1TE2A 2HU2A 5JJ5A 2GRAA 4MQLA 3MA0A 3HUFA 1U6JA 3EF3A 2WB4A 4GI1A 4CIAA 3NIBA 3RYCB 3JPWA 1ADCA 2VSQA 3RRZA 4GM4A 1XA4A 1BCRB 3QPUA 2PSJA 2QN8A 4YAJA 1PZMA 1U7PA 3BAFA 3MOSA 1DJOA 4C07A 1YAHA 3CX6A 5EN4A 5H02A 2JIQA 1ODLA 4OQZA 4MX8A 4Z8YA 4CDGA 4DCGA 5DT9A 2IDZA 1XPOA 2FXIA 5FBHA 4JU9A 4NY1A 4E5MA 4NFYA 2LUOA 3SR3A 1I1OA 3N76A 2CLIB 1M2GA 2GEDA 1TK9A 4BNHA 4BEVA 4KGXA 4L0MA 1HDIA 2VI5A 4J1TA 4DUZB 2ZEJA 5F5LA 1R2QA 2ZT7A 3EUEA 1B76A 4BMVA 4QLBA 2D2VA 1YACA 4L16A 2C3OA 1HQYE 5K3FB 1W2WB 2C4WA 3IR7A 1CNFA 2VF8A 2FKNA 2PEYA 3DDCA 4MYSA 5DX0A 1W4CA 4E6PA 4ZT6A 5A9SB 4WADA 3D2LA 4DR1B 4ZCQA 1PV2A 5JFOA 2ZG6A 3D1LA 4IUCS 4D9EA 4FM9A 1W25A 1SHZA 2VYQA 1M6VA 3PL1A 1OGJA 4OLAA 5DP1A 1VKJA 4D9IA 4I5IA 1W96A 3B6MA 3V5NA 4IH1A 1K63A 1KJJA 1UFVA 2CXXA 2CXNA 3C3PA 1EA5A 4Z7JA 3NUZA 2XWJI 4ZQCB 1N0VC 4B3IA 4ZEXA 3NFRA 4N3CA 5FV4A 1X92A 2VJMB 2DR2A 3REQB 4KQ1A 1FZQA 3Q0EA 4JYMA 4EZEA 3CRNA 1C50A 3F7TA 3N87A 4ZU3A 1NL3A 1ELOA 5JASA 3USZA 2ZJBA 4TTVA 3TCNA 4B32A 5HUJA 1NFQA 4O2BB 2VJOA 1NBME 3IIMA 1Z6XA 3D8BA 3G0IA 4B45A 4KNYA 1IQUA 4DJTA 1ZJJA 2QRHA 2DPLA 4L72A 5KSYA 1H4QA 1JHMA 4IAOA 4R2LA 3ZTWA 2W6PA 2OV2A 3C6XA 1MGPA 3CEJA 3EVNA 3QNMA 3R75A 2ILTA 3QNWA 1YBAA 2D6FA 1VL1A 1ZYUA 3DR3A 4O4IB 4F1WA 5J58A 4RHEA 2ZI6A 4LJSA 3SQLA 1TNDA 3TBHA 5D7NA 2DFLA 3Q41A 4ZAYA 3WAGA 5HVNA 4GKKB 3PUYA 1U04A 3BKXA 3GJQA 2CNOA 2J0UB 1MG0A 1L5LA 2ODAA 2W0MA 3HCDA 3PC8A 4JKOA 4P36A 3O1LA 3C43A 2XHEA 4DYVA 4A16A 2XOEA 2UVPA 3U9TA 1LPOA 3C74A 1T4CA 2G4LA 2IYZA 5F2OA 3IDAA 3NAQA 1M66A 1CF9A 3CZQA 4N03A 4TROA 3R7WB 3VNQA 4B6SA 2X5JO 1GGMA 1KR5A 4A8JB 2Q8NA 3MWEA 1M54A 2J41A 2O0LA 2QZPA 4LV6A 5M3BA 2QTTA 2ABWA 2XCIA 3ND7A 5C1OA 4Q9JA 4EECA 4Z54A 5LDHA 3P2MA 2OENG 2FQ1A 3NYWA 3R0QA 4DS3A 4S05A 3PNYA 4EBBA 1HDYA 1WSWA 2QI9F 2UKDA 4ZOQI 5K8IA 2EU8A 1XI2A 1PR0A 3K6SB 2W00A 5K5EA 4EYSA 4RZ3A 2VRCD 5BMVB 3G5MA 4GS5A 3QTLA 4ER7A 3L8CA 2Q5QA 1NN3A 2MR6A 5KDLA 4EDFA 1I4TD 1TM1E 1XRPA 4NYMQ 2X9VA 3IL2A 3GGOA 2NVUB 2PSDA 3V3TA 2OESA 1Y9ZA 2YC4C 4R5MA 5AXBA 1XOIA 3SYKA 3PX3A 4E5KA 2JJ1D 4RHYA 1PV1A 1TJ3A 3DZJA 5IDXA 2OGZA 1U02A 4LHEA 4W7SA 1PBNA 4AMGA 1P4AA 1PLLA 2Q1UA 3MJRA 5ALHA 3ONNA 5CYGA 5JHGB 2PT6A 4M46A 4PN3A 4RZHA 3WGNA 1D5CA 4O2RA 4FHFA 4IR7A 5D85A 5A9SA 2B6NA 4S0XA 1HYHA 2QDXA 2Y66A 3RBVA 4DIKA 1ZDMA 1NKTA 3RU9A 2I6XA 3B1VA 4RA9B 4HRVA 2A7QA 3HNPA 2XLCA 2R86A 2EX4A 4FW8A 1WXGA 2BKXA 2W6QA 4A26A 4CCYB 5D6OA 5A2QA 4I19A 2R2AA 3LQQA 3OIGA 4ND8A 2IU3A 2W6MA 3MMPA 1U4OA 1XD2B 2XQJA 1XNHA 5B2ZA 1GV0A 621PA 2VJCA 3K6JA 1XXHB 4D0RA 3FUCA 4BE4A 4QDTA 2V1UA 2BGWA 2B4QA 2G71A 1ZITA 1BFUA 4QNMA 4YRLA 1AK1A 1CVLA 1V16A 2C8JA 3DF7A 1L5VA 3ILXA 2XDQA 2BKEA 4N47A 3SDSA 5C3UA 4MMZB 5IJZA 2A9OA 2GZRA 1KSJA 4LGCA 3ZV3A 1N33B 5IDYA 3N9IA 2WTAA 3WWZA 3HVHA 3FWNA 4ESEA 3KR0A 3HXQA 3VPSA 1AF7A 1RI2A 2Z9CA 1RIIA 2HK9A 1J0CA 3HA3A 1SPXA 4KQFA 2DPGA 2A1UB 1Q6YA 2R84A 2I3BA 2OCGA 3Q1KA 1ESNA 1HE8B 2H65A 2PZLA 4JB2A 4PFJA 1OWOA 2CMHA 2HA6A 4YUZA 4REOA 1C1DB 2RHCA 3DE1X 5HKBA 5I7HA 2WYOA 2PGDA 2VA9A 2W6JA 5JECA 2RGBA 2PUHA 2Y68A 1T9BA 1JX6A 1SZDA 2YNMA 3BD8A 3MW8A 3N0TA 3PHGA 4JC8A 4XW2A 5F5XA 1X3SA 2PCLA 1J25A 3UQYS 5TJ9A 4D8TA 1FQOA 4MAMA 5DBFA 4DA9A 4OM8A 1RXCA 3LCUA 3FVWA 5CCEA 1XZFA 4NFLA 2XT6A 1UXOA 4PNHA 5DO9A 3WLFA 5HF5A 3ZLBA 2GI4A 3ENZA 3RASA 1U0JA 3MYRA 4J1TC 3QY9A 4IIXA 1A5ZA 1KXJA 4WN3A 5EJ7A 1I0IA 1HQKA 1OHHD 3MS4A 4TRNA 5KOIA 4MAFA 1H5NA 4KXMA 4RQAA 3V8EA 3LUKA 5EESA 4DM7A 2XB9A 4BUJA 1DC8A 2ANBA 3RSQA 1N2SA 3S55A 3TI7A 5JTTA 1NG9A 1PLJA 2CB9A 1M75A 4OHBA 5EMNA 4G84A 2HPVA 2JAQA 4FNMA 1ZAKA 1IATA 3GR6A 1KZ7B 5FI5A 3IILA 4CHGA 3SI7A 2HJWA 3DFKA 4NU0A 2DHQA 4X64B 3I5YA 2K4MA 2G1PA 2BFNA 3GVPA 4YNBA 1YRLA 1UR5A 4GRIA 4Y2VA 3SIXA 2FN4A 1BD3A 4KXXA 1GUZA 4A6EA 3FOBA 1RD4A 2P78A 2YTZA 3C3DA 2Q6TA 2XUDA 3EXHB 4IHKA 5JAQA 3ZHBA 3Q98A 3HB5X 4IS3A 1H4SA 1MNAA 2IPOA 3B3GA 3G6WA 5CXQA 5CFNA 3W6OA 4BOYA 4YR9A 1UBUS 5BURA 4CQNA 2D1TA 3OEWA 4YRDA 4HH3C 1RRVA 1NN5A 1JA0A 2RB4A 1GEGA 3LHFA 3PXCX 3ANLA 4HJRA 1DKRA 4YWJA 1WZ2A 4EB3A 4KR2A 4BQNA 1N2EA 1C9NA 5CDGA 1MJNA 4NMMA 3E9QA 1J2TA 4FFMA 2QJOA 4OA5A 4HNSA 3OF3A 3ZIUA 3Q11A 4AYXA 3EXEA 3JVDA 4FYMA 2YFYA 4MQMA 3T5TA 3IQFA 3FZGA 1E6MA 3CEAA 4FOTA 3S1AB 5AI5A 5ERXA 3WKAA 5L3QA 3EYAA 4TQUS 3RB8A 1WEHA 1A77A 1YQDA 2Q46A 5KDDA 2HQRA 3GHHA 1RRCA 1ZOOA 3VNUA 4JLDA 5A3SA 4UNSA 1KMHB 3JW8A 4LRUA 3GEMA 3CF0A 3F8SA 4XIFA 3PDCA 3AVVA 4XWYA 2CHEA 2UVQA 4YHBA 1B0ZA 3RLIA 3TEJA 3ITEA 4HGQA 5FRDA 2BP7B 1PR2A 1FUYB 3AGPA 3TM4A 3D3EA 4AJ4A 4P83A 1GLGA 2C3MA 4C6RA 4LDRA 4U39A 1QOZA 3DPIA 2Y71A 3TEMA 3TOZA 3WE7A 4MK4A 2LDBA 1YR3A 3WGGA 1JJFA 2QYSA 3CURA 4EHHA 1S89A 1OVMA 2H1OA 2OCDA 5CU7A 1LX7A 4GOND 3VU3A 2J6CA 4RMGA 4UVEA 3R7LA 2B2CA 1Z6AA 2PMKA 1ZOPA 2I7VA 4FYVA 3V7UA 5CJPA 1OXTA 3CJRA 1E63A 4L0QA 3RK0A 4XQEA 4CKXA 2I7XA 3R3VA 1ECBA 2WEKA 3AUXA 2C82A 1SBHA 2I2CA 4K8RB 4AO8A 1FFDA 4FI3F 3M70A 4YRGA 1JWLA 3QE0A 5CTJA 3EA5A 3PXEA 2O7NA 4QO8A 4L1KA 2QTGA 1BEZA 1XPUA 4QFMA 4BDTA 3OQHA 2QUHA 1TYDE 3BTOA 3K6KA 2YV4A 1ND6A 4GP9A 2ZREA 3A6LA 2IHKA 1NMSA 4MA0A 4M1SA 5FWXB 2PS3A 4IQ8A 1KI2A 1LBIA 1QIHA 1CJSA 1REQB 1KO7A 1MIOA 1SCIA 2BDUA 2BEWB 2MOKA 2NO7A 3NBAA 3OPYI 2Q45A 1ZGCA 5EI5A 4D57A 1AOXA 4YMVA 3OJEA 3PC3A 1Y8RB 5C7OO 2YJ3A 4L7VA 5D51S 1ZESA 3SX4A 1SUDA 4GU5A 1A1SA 4UMEA 2H9AA 4REQA 1OH7A 3WGTA 1WXHA 4M21A 5E7JA 2EIHA 1MO6A 3D7RA 1KQ3A 1RQRA 1LVUA 3C5WP 2VC2B 1OI7A 1SBIA 1OXKB 3JZMA 3TNDA 2X14A 1AV7A 2OO3A 4FKZA 3BXXA 3PL5A 4CR6A 4GPD1 1LGYA 3GMSA 1WVGA 2CZQA 5FTJA 3VC1A 5JQGF 1E92A 2AXPA 3HEAA 2OFOA 4L5CA 4EAAA 5ULLA 1DCKA 4FFWA 1BAPA 2Q8PA 4DLKA 5BMOA 2TMYA 2M6SA 2PPLA 1HI9A 1U4SA 3EGCA 3L01A 1TW2A 4MKIA 4NNJA 5EHQA 1HUQA 4F1KA 3VJKA 1SBNE 2EJTA 3QP9A 1U2EA 4JR0A 4TM8A 2CCGA 5HILA 3RT1A 5B1EA 1RI4A 4FIZA 3BCSA 4KQ2A 3DE4X 4PEVA 5BVGB 5AESA 3Q6IA 4G85A 2QVXX 4IGFA 2VHZA 2F55A 3ULKA 4CEIA 1L8OA 5CK4A 2RJ3A 5BRAA 5AVYA 2QLBA 3CV3A 3MWLA 3CZRA 2ZYRA 5B7GA 4GKBA 3OCZA 2GT1A 4K0RA 3RQIA 3QE9Y 2AOTA 4KI7A 3FRJA 2Z57A 1QX4A 5BSTA 1Q7GA 1UT6A 3F71A 3I5AA 4J7AA 4RMJA 3T3OA 1F2VA 1AQIA 1NVUQ 1A76A 4XVUA 5E6UA 3TL6A 1VIAA 1BXZA 1VPLA 1QH9A 2D2XA 2GAAA 4XGKA 4INPA 2VHVA 2EDCA 3LBYA 1N5RA 1EGQA 2G72A 3A9VA 3LE8A 4PYQA 5YASA 4CTOA 1YTLA 2JG3A 2I2DA 4FYHA 1QRTA 5CEJA 3S1SA 1DQSA 1GYRA 3B20A 4YAIA 4YMTA 4LZJA 4AF6A 5FULA 4NC9A 2J30A 3DXYA 2D62A 4I4TB 4GZMA 1ZBDA 4RVNA 2MYPA 3HZHA 2FEWB 2YWFA 3DMTC 1SC4A 2V7GA 5F98A 3GCGA 4RIHA 1NY5A 5JUWA 3GJ6A 2Z1NA 5BN4A 3I28A 3FY4A 4E5PA 1WG8A 1BC5A 4QUKA 3PCTA 5KOHA 3WKCA 3V1YA 2AQ8A 2JH8A 4GZLA 2QTRA 1EBFA 2JL1A 3AK4A 1ZA1A 1YUBA 4CDMA 1L7QA 1OFHA 1K8YB 4IM7A 3VTKA 1CJUC 2Q5EA 3O8OA 4Y6PA 3EVDA 1K3TA 1P1RA 4JB3A 3D9QX 3SHQA 4BX8A 4X1IA 4UDXX 4RVSA 2BW0A 5GY7A 2HMUA 2GD0A 3FM9A 4AS2A 4EDHA 1T0JB 3I05A 5HF6A 5I7WA 4HXFB 3DB1A 3ET4A 4ZK2A 5CX1B 5IDWA 1L3IA 5JSZB 3L8ZA 1B6RA 1SQSA 4KDFA 3MGAA 1SVWA 4OGFA 1BWQA 1MX5A 2CHUA 3F49S 2IS2A 3ZKWB 2UXCB 1G21A 1KETA 1NSTA 4MQ5A 1HK7A 1UPAA 4U2DA 4G0OA 1DMSA 3WBJA 3L7JA 3ZY5A 3L05A 3NV7A 4HYYA 1EXDA 2FWJA 2D5AA 5HDQA 1CW2B 1XZPA 3GNTA 1JYFA 4J7XA 4NCNA 5JSKA 2CVHA 4RMNA 8ABPA 4CM7A 1I01A 3PFNA 4G07A 1PYDA 4MVJM 1UIRA 1X7HA 1FPMA 4P8RA 4LF9B 2Q49A 2QYOA 4JKIA 2C4TA 3SC4A 4BB5A 4LF4B 3EMKA 1OFGA 4F92B 3WSTA 4NBVA 4MP6A 1NM5A 1NQUA 1V43A 3JQPA 4KQKA 5ECYA 2I91A 3ASZA 1KE2A 3KLNA 4BNKA 2LCFA 3A32A 4ZT4A 3HL4A 5CVJA 4MHTA 1TF2A 1JH9A 4B74A 1F3LA 4U5QA 3RUEA 1RWBA 4LC0A 4WSOA 1T13A 4RLHA 5JEDA 1B8UA 3BQ9A 2A8YA 3SS8A 1Z4KA 1JHQA 2QPTA 5AMXA 3RU7A 1CUIA 3R77A 2G0NA 2XY4A 3K70D 2GWHA 1NDHA 1U1FA 2QN2A 1JKJA 2FPPA 4MS1B 5BN1A 1XK6A 1X7YA 3CLHA 4X6YA 1LCIA 3R3WA 3IBYA 4BRWA 2GCOA 2OBNA 2PCJA 3NAGA 1H69A 3E0XA 5AK5A 1E9VA 4ZCTA 4B6EA 5A9TA 4AX4A 3HADA 3N8HA 1RXYA 2FQWA 3UUFA 4BVKA 5EJFA 1YQXA 1G63A 3ZDEA 2EGGA 2Y2VA 2EFJA 1IG3A 4Q9NA 2FSUA 4GKJB 3WQSB 4G4IA 4WZAE 4G4SO 3MHPA 1T2DA 3E58A 4LN1A 1ATIA 4OJQA 1SN7A 1NBOA 2YWJA 2FR8C 3FBGA 3GUZA 4FMDF 4RXUA 1NBHA 3ZIDA 3EEOA 1EDZA 4PZ9A 2FMIA 3MLBA 3UF0A 3NYRA 1N2CE 2EWWA 2QPLA 2R97A 1QPGA 1AA9A 3A0UA 2P7HA 3I6QA 4BLVA 3C1UA 5BT9A 5K45A 4H77A 5KX5B 3SGLA 1OYYA 3VC7A 5JTUA 1DXQA 4W99A 3UMJA 1Y33E 2XF2A 2NU6A 1ARZA 1I7LA 1P5HA 1LTQA 2EWMA 4EITA 1HT2E 2ETVA 4D6XA 5GGYA 4X20B 3ER6A 1QVVA 1RPTA 5AKHA 1SR8A 2JIDA 1VIDA 3D2BA 4NNPA 3N2KA 4KBYA 4AY3A 4B34A 3IDQA 1NRWA 4COOA 1ENOA 4Z4EA 2XNJA 3K4PA 3BTSA 3JXEA 2HA2A 4N8DA 1RI3A 3MRXA 3PWTA 2OP1A 1WMBA 4JMLA 5C80A 1GPH1 4WKGA 4AQYB 1LI4A 2D59A 2H48A 4NJOA 3L3BA 3STVA 1GILA 5KTMA 3N2NA 1UOEA 1PG0A 2HR1A 4EJMA 2Q5JA 1M6HA 3TLXA 4BVBA 4C21A 2R87A 5AJWA 5B6IA 4MWBA 3H16A 3H8JA 1QM5A 4PHGA 3F6EX 1YBHA 4N12A 2C9DA 2RJNA 2RBEA 2WWWA 4AY5A 1EUDA 4D9BA 5IUNC 2FHPA 2XOKD 5BSRA 1RHKA 3JYOA 3HKDA 4HDNB 3NANA 1E3IA 4OJYA 3O4VA 4U2GA 3LKDA 1P7YA 4YN3A 4HDMB 1CUHA 2HT1A 3CY6A 2XKKA 2ZYHA 3AJAA 3H3XA 5LMNB 3H9UA 1E1RA 1KP2A 2FP4B 2PMCA 2WWGA 2ZT8A 3UBMA 3LQFA 2XX3A 3Q3JB 5CMLA 4F38A 4PLVA 2WHXA 1XK7A 4LHVA 4JCCA 3HM2A 6PFKA 5FEMA 1T2VA 4HWPA 2XGGA 3IAXA 1DJQA 4JIMA 4KUGA 1ODTC 3MELA 2P30A 2ZSIA 1JIIA 4EL0A 3R41A 3W8NA 2DBRA 2C8KA 1M1NA 1GKUB 3MJTA 4TVOA 1JAXA 4D74A 2AJLI 5JI2E 1NVMB 2V9CA 1Z88A 4XQGA 2UVDA 4CDRA 1M2KA 4L8FA 1PK8A 3HJRA 5B2EA 4AI6A 1XCMA 4KXFB 1VE9A 3FFXA 4G0XA 3QBTA 3TIXB 3VHQA 2DHRA 3PB3A 3V4PB 5LJIA 1U5BB 1XHLA 2RI6A 5FBZA 1QIMA 3OUUA 4CKBA 3NGMA 4LZLA 4Z3DA 1XMSA 4QJ3A 2YASA 3N07A 4BVLA 5TDHA 4WGGA 4YMHA 1YQ9A 1Z7GA 2CKMA 2G5TA 2ZJZA 2ZRCA 4LDPA 1R6BX 1FRVA 4ENQA 1JS1X 3ZD6A 4D99A 3NAMA 4YRKA 3HI6A 5DTQA 1BQ3A 1N2XA 1ZHHA 3DGFC 4XVHA 1E58A 1Z0UA 2O0JA 4JASB 1KMCA 4NL4H 1NYTA 3G17A 2P3QA 1U1EA 4RY0A 3UJAA 5C5EA 2YR0A 3AUUA 3M3HA 2CFRA 5LLSA 1WXIA 2J3MA 2NSJA 4ZU1X 5A4IS 3IT2A 3AL3A 1A9PA 1P29A 4MB2A 1JDNA 4CUJA 3BFPA 2XVMA 1K1EA 2C00A 4GL2A 2PUDA 1YMVA 2QRZA 5CURA 3RSHA 4LMRA 3AEUA 4EY8A 4XFJA 5AHRA 4BFXA 1N7GA 1ECPA 3ASUA 1ZINA 2DYKA 2RKOA 3LG2A 1OT5A 3FJYA 2MU1A 1W5BA 2QD5A 3V3KA 1JFSA 2WD9A 4LBVA 1I2MA 3BZUA 3ZBUA 2ZUEA 3PRHA 4HUQA 3ZK8A 1WZUA 1T9KA 4XYEA 2WWHA 5JMPA 4DJEC 1ZK3A 1TTPB 4EVRA 1ZNQO 3HP7A 4ZEVA 5IKEA 3BJMA 3MCWA 1Q0QA 3ZOZA 5IASA 2BKVA 1DJLA 1ZCJA 4RDXA 1GPMA 1KOJA 1G3QA 1HX7A 5M5BA 5KCZA 4Z9XA 3IC5A 2PGOA 1R0BA 2Y4NA 1BHO1 3HGQA 3HSYA 4PLPA 2W2KA 4MCHA 1DC7A 2GUGA 3UICA 4ITUA 3ANYB 1ECGA 2FWRA 3EPPA 3ETLA 3SAJA 1DG1G 2QNRA 1WNFA 4E70A 4YXFA 1V8DA 1XL1A 2A9FA 1G6Q1 3II6X 4OI4A 4C76A 1IOLA 4RL6A 4Y9RA 4V0ME 3MXTA 4AO7A 3DXZA 2C88A 1VDZA 1OOEA 1KL7A 3QFFA 5DM60 1UPTA 2D2IA 2FRDA 4RV5A 4BNVA 1ZK2A 1HM5A 2C1EA 2VNSA 1L5NA 4X65B 1I4DD 4BMZA 2FEKA 1FFCA 2HLDD 2L69A 3QPWA 4K9DA 1H0HA 2GDZA 1Z5VA 4KLRA 4QTZA 4I1UA 3EGDA 4RHXA 3SEFA 1QVWA 2C1XA 5THQA 3H13A 3STYA 1ZMOA 4H7FA 2EL9A 2J4CA 4FWBA 3IXMA 2W8BA 1XZHA 4C4OA 1P17A 1SUFA 4EPXA 3TNYA 5IABA 2VDKB 2ORVA 1WNTA 1KU0A 4FQ7A 4DA6A 4DMKA 4M37A 4F45A 1CS4C 5EIEA 3ZD8A 1A8UA 1AMUA 3EG9A 1QH8A 1U0GA 2Z1MA 3OLZA 4YRNA 3BHMA 2PBFA 1SVIA 4RC9A 5IPFA 5B30A 2FZEA 2IS4A 4M9ZA 4FX5A 3LHDA 4DC1A 5ALUA 1PJ4A 2F4NA 3UGQA 2IXEA 2WKRA 1YVEI 2PBRA 5TVKA 3URMA 4DLPA 4B3MB 3ENWA 4KXYA 4UEQA 4DEXA 1R0YA 3OWOA 3CEHA 3VBCA 3ZH9B 4DLRA 2YV3A 3H4VA 3RANA 1GPJA 4AYWA 4YAKA 4JBNA 3K4HA 4WMLA 1FNSA 1WW8A 3GLRA 3SJ7A 2UXDB 4ZRDA 5U9CA 4DSOA 2RDMA 2CBGA 3OOJA 2WVAA 4YGXB 1X1CA 2O06A 3A6KA 5G0UA 4QYSA 2P79A 2Y1WA 2B82A 1E4VA 3VSBA 4KO4S 2XZTA 4BEBA 3I0ZA 4FONA 2IUTA 2WZBA 1OU0A 5LLTA 1W88B 5AOVA 4PNZA 4W8HA 2QL7A 2ID7A 2MJLA 2XTJA 4XUEA 1EWYA 4ZPXA 1EHCA 4DUPA 4E4RA 1G8FA