2XTYA

Structure of qnrb1 (r167e-trypsin treated), a plasmid-mediated fluoroquinolone resistance protein
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
216
structure length
208
Chain Sequence
GSHMALALVGEKIDRNRFTGEKIENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRAMLKDAIFKSCDLSMADFRNSSALGIEIRHCRAQGADFRGASFMFCSAYITNTNLSYANFSKVVLEKCELWENRWIGAQVLGATFSGSDLSGGEFSTFDWEAANFTHCDLTNSELGDLDIRGVDLQGVKLDNYQASLLMERLGIAVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords QNRB1
publication title Structure of Qnrb1, a Plasmid-Mediated Fluoroquinolone Resistance Factor.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Cell cycle
total genus 87
structure length 208
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 2xtyA00
4YC5A 2XTYA 3PSSA 2XT4A 4YDTA 3NAWA 4YEIA 2QZAA 2QYUA 4YFOA 3SY2A 2O6WA 3DU1X 2XTXA 3SQVA 3NB2A 2J8KA 3PSZA 2XTWA 5DNSA 4YCQA 2XT2A
chains in the Genus database with same CATH superfamily
1O8JA 2PECA 4XR6A 4YC5A 3T9GA 3P4GA 4XLEA 4YZQA 2VFNA 1OFEA 4XKWA 1WXRA 3SYJA 3EQOA 2QY1A 1OFLA 2QXZA 1EZGA 2YUHA 4EW9A 1TYXA 1PE9A 1OGMX 2VJIA 3LYCA 4XN3A 4Z03A 4YEIA 3LMWA 4XN0A 2QZAA 2IQ7A 1KQ5A 1QA3A 4W8QA 1EA0A 4YFOA 2NSPA 3TH0A 3DU1X 1BN8A 4MXNA 4W8TA 1DABA 2Z8GA 4URRA 2VBKA 3JURA 1BHEA 4XLFA 2PYGA 1O8EA 2X3HA 3N6ZA 2VFPA 2J8IA 4U4BA 1HF2A 1KTWA 1TYWA 1X0CA 4XOPA 3N90A 1DBGA 5JMCB 4NK8A 3H09A 4MR0A 1KCCA 2BM5A 1K4ZA 2G0YA 4OJ6A 1O8HA 3ZPPA 1O8GA 4YZXA 2INUA 3PETA 1RMGA 4C2LA 3ML3A 1O8MA 3AK5A 1HG8A 1QJVA 4YELA 3VSVA 4XLCA 4XNFA 2XT4A 3GQ7A 3GQAA 2NTQA 4XOTA 5C1CA 2X6XA 2X85A 3GQ8A 1LLWA 1LLZA 2ODLA 1JRGA 1QQ1A 2VFOA 4U49A 2BSPA 2X6WA 1K5CA 2NZMA 3SQVA 3WWGA 1TYVA 3SZEA 3EQNA 3GQ9A 3B4NA 1PLUA 1QRCA 4XLHA 4XMYA 1OGOX 4XL9A 4XKVA 2NTPA 1AIRA 1EE6A 2NTBA 4YCQA 3KRGA 5DNSA 3VSUA 4YEJA 4W8SA 1CLWA 1OOCA 4YZ0A 3BH6B 3SUCA 2BM4A 2UVEA 2VJJA 1O88A 1RU4A 2O1DA 5AMVA 4OJPA 1PXZA 3PSSA 2VBMA 4YDTA 1OFMA 2O17A 1OFDA 2NT9A 4OZYA 3SY2A 3JX8A 2EWEA 2O6WA 4OM9A 2O0WA 1CZFA 1IDKA 4XM3A 1O8DA 3LJYA 5JLVC 1RWRA 1KCDA 1NHCA 3B90A 3NB2A 2QX3A 1WMRA 1QA2A 4YZAA 2XC1A 1L1IA 4XORA 1IB4A 1VBLA 1TSPA 4Z06A 2V5IA 4AVZA 4XONA 2XTWA 3BH7B 1O8LA 2VBEA 4OJLA 3VMWA 2W7ZA 2VFMA 4OJ5A 2F3LA 1IA5A 4I84A 4W8RA 3FY3A 2X6YA 5C1EA 2XTYA 4PMHA 4V02C 1QA1A 2VFQA 1XG2A 2BM6A 3UW0A 2UVFA 4OJOA 2IOUG 3NAWA 2O0VA 2QYUA 2BM7A 4XLAA 4NK6A 1IDJA 2PYHA 1TYUA 2NSTA 1O8KA 4HWVA 3RIQA 1H80A 1DBOA 2XTXA 2BX6A 3VMVA 1JTAA 4JRAC 2B0RA 3GRHA 1QCXA 2O04A 2J8KA 3B8YA 4Z05A 2NT6A 4OZZA 2INVA 1GQ8A 3PSZA 1K8FA 4XQFA 3VSTA 1QRBA 1O8IA 4OPWA 3ZSCA 2XT2A 1O8FA 4KH3A 1LM1A
chains in the Genus database with same CATH topology
4YC5A 2XTYA 3PSSA 2XT4A 4YDTA 3NAWA 4YEIA 2QZAA 2QYUA 4YFOA 3SY2A 2O6WA 3DU1X 2XTXA 3SQVA 3NB2A 2J8KA 3PSZA 2XTWA 5DNSA 4YCQA 2XT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YC5 A;  2XTY A;  3PSS A;  2XT4 A;  4YDT A;  3NAW A;  4YEI A;  2QZA A;  2QYU A;  4YFO A;  3SY2 A;  2O6W A;  3DU1 X;  2XTX A;  3SQV A;  3NB2 A;  2J8K A;  3PSZ A;  2XTW A;  5DNS A;  4YCQ A;  2XT2 A; 
#chains in the Genus database with same CATH topology
 1O8J A;  2PEC A;  4XR6 A;  4YC5 A;  3T9G A;  3P4G A;  4XLE A;  4YZQ A;  2VFN A;  1OFE A;  4XKW A;  1WXR A;  3SYJ A;  3EQO A;  2QY1 A;  1OFL A;  2QXZ A;  1EZG A;  2YUH A;  4EW9 A;  1TYX A;  1PE9 A;  1OGM X;  2VJI A;  3LYC A;  4XN3 A;  4Z03 A;  4YEI A;  3LMW A;  4XN0 A;  2QZA A;  2IQ7 A;  1KQ5 A;  1QA3 A;  4W8Q A;  1EA0 A;  4YFO A;  2NSP A;  3TH0 A;  3DU1 X;  1BN8 A;  4MXN A;  4W8T A;  1DAB A;  2Z8G A;  4URR A;  2VBK A;  3JUR A;  1BHE A;  4XLF A;  2PYG A;  1O8E A;  2X3H A;  3N6Z A;  2VFP A;  2J8I A;  4U4B A;  1HF2 A;  1KTW A;  1TYW A;  1X0C A;  4XOP A;  3N90 A;  1DBG A;  5JMC B;  4NK8 A;  3H09 A;  4MR0 A;  1KCC A;  2BM5 A;  1K4Z A;  2G0Y A;  4OJ6 A;  1O8H A;  3ZPP A;  1O8G A;  4YZX A;  2INU A;  3PET A;  1RMG A;  4C2L A;  3ML3 A;  1O8M A;  3AK5 A;  1HG8 A;  1QJV A;  4YEL A;  3VSV A;  4XLC A;  4XNF A;  2XT4 A;  3GQ7 A;  3GQA A;  2NTQ A;  4XOT A;  5C1C A;  2X6X A;  2X85 A;  3GQ8 A;  1LLW A;  1LLZ A;  2ODL A;  1JRG A;  1QQ1 A;  2VFO A;  4U49 A;  2BSP A;  2X6W A;  1K5C A;  2NZM A;  3SQV A;  3WWG A;  1TYV A;  3SZE A;  3EQN A;  3GQ9 A;  3B4N A;  1PLU A;  1QRC A;  4XLH A;  4XMY A;  1OGO X;  4XL9 A;  4XKV A;  2NTP A;  1AIR A;  1EE6 A;  2NTB A;  4YCQ A;  3KRG A;  5DNS A;  3VSU A;  4YEJ A;  4W8S A;  1CLW A;  1OOC A;  4YZ0 A;  3BH6 B;  3SUC A;  2BM4 A;  2UVE A;  2VJJ A;  1O88 A;  1RU4 A;  2O1D A;  5AMV A;  4OJP A;  1PXZ A;  3PSS A;  2VBM A;  4YDT A;  1OFM A;  2O17 A;  1OFD A;  2NT9 A;  4OZY A;  3SY2 A;  3JX8 A;  2EWE A;  2O6W A;  4OM9 A;  2O0W A;  1CZF A;  1IDK A;  4XM3 A;  1O8D A;  3LJY A;  5JLV C;  1RWR A;  1KCD A;  1NHC A;  3B90 A;  3NB2 A;  2QX3 A;  1WMR A;  1QA2 A;  4YZA A;  2XC1 A;  1L1I A;  4XOR A;  1IB4 A;  1VBL A;  1TSP A;  4Z06 A;  2V5I A;  4AVZ A;  4XON A;  2XTW A;  3BH7 B;  1O8L A;  2VBE A;  4OJL A;  3VMW A;  2W7Z A;  2VFM A;  4OJ5 A;  2F3L A;  1IA5 A;  4I84 A;  4W8R A;  3FY3 A;  2X6Y A;  5C1E A;  2XTY A;  4PMH A;  4V02 C;  1QA1 A;  2VFQ A;  1XG2 A;  2BM6 A;  3UW0 A;  2UVF A;  4OJO A;  2IOU G;  3NAW A;  2O0V A;  2QYU A;  2BM7 A;  4XLA A;  4NK6 A;  1IDJ A;  2PYH A;  1TYU A;  2NST A;  1O8K A;  4HWV A;  3RIQ A;  1H80 A;  1DBO A;  2XTX A;  2BX6 A;  3VMV A;  1JTA A;  4JRA C;  2B0R A;  3GRH A;  1QCX A;  2O04 A;  2J8K A;  3B8Y A;  4Z05 A;  2NT6 A;  4OZZ A;  2INV A;  1GQ8 A;  3PSZ A;  1K8F A;  4XQF A;  3VST A;  1QRB A;  1O8I A;  4OPW A;  3ZSC A;  2XT2 A;  1O8F A;  4KH3 A;  1LM1 A; 
#chains in the Genus database with same CATH homology
 4YC5 A;  2XTY A;  3PSS A;  2XT4 A;  4YDT A;  3NAW A;  4YEI A;  2QZA A;  2QYU A;  4YFO A;  3SY2 A;  2O6W A;  3DU1 X;  2XTX A;  3SQV A;  3NB2 A;  2J8K A;  3PSZ A;  2XTW A;  5DNS A;  4YCQ A;  2XT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...