2XTYA

Structure of qnrb1 (r167e-trypsin treated), a plasmid-mediated fluoroquinolone resistance protein
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
216
structure length
208
Chain Sequence
GSHMALALVGEKIDRNRFTGEKIENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRAMLKDAIFKSCDLSMADFRNSSALGIEIRHCRAQGADFRGASFMFCSAYITNTNLSYANFSKVVLEKCELWENRWIGAQVLGATFSGSDLSGGEFSTFDWEAANFTHCDLTNSELGDLDIRGVDLQGVKLDNYQASLLMERLGIAVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Qnrb1, a Plasmid-Mediated Fluoroquinolone Resistance Factor.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Cell cycle
molecule keywords QNRB1
total genus 87
structure length 208
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 2xtyA00
4YCQA 2XTXA 3NB2A 4YC5A 2XTYA 3SY2A 2O6WA 3DU1X 3NAWA 3SQVA 2J8KA 4YDTA 4YEIA 2XT4A 2QZAA 4YFOA 2XTWA 5DNSA 3PSSA 2QYUA 3PSZA 2XT2A
chains in the Genus database with same CATH superfamily
1BN8A 1RWRA 2BM7A 4U49A 2IOUG 4OM9A 2BX6A 2X85A 4XLFA 2O0WA 2INUA 2IQ7A 4URRA 4XLCA 1WMRA 4YEJA 1L1IA 4W8QA 3ZPPA 1OFMA 3N6ZA 3SY2A 2YUHA 1KCDA 2X3HA 1GQ8A 1TYUA 2NTPA 3ZSCA 1IDJA 1XG2A 2G0YA 1K4ZA 3JX8A 3T9GA 4I84A 1O8LA 4OJPA 2QY1A 1TYXA 2QX3A 1CZFA 1O8HA 4NK6A 1PXZA 2NSPA 4YDTA 5AMVA 1O8KA 1TYVA 3UW0A 2XT4A 1QA1A 4OJ6A 1QQ1A 2UVFA 2V5IA 4EW9A 1KCCA 3EQNA 2F3LA 2XC1A 3RIQA 1IA5A 4XLHA 1LM1A 3PSSA 1QA3A 2X6WA 3DU1X 1TSPA 1HF2A 1KTWA 2O04A 3JURA 4XM3A 1NHCA 3GQ9A 3KRGA 4Z05A 1QJVA 4YZXA 3P4GA 4JRAC 4YC5A 3VSUA 3B4NA 2NTQA 2X6XA 4YELA 4HWVA 1DBOA 3FY3A 3ML3A 2O6WA 2QXZA 3VMWA 2VFMA 4XN3A 3H09A 2J8IA 4XN0A 4XONA 5JLVC 3NAWA 1QA2A 1QCXA 3PETA 2PECA 4XLEA 2VFOA 3VSVA 3B90A 4W8TA 3GQ8A 1KQ5A 2VFQA 2QZAA 4YFOA 4PMHA 1O8DA 1LLZA 1RU4A 1OOCA 3GQ7A 1OGMX 1OFLA 1TYWA 5DNSA 1WXRA 3SYJA 1O8IA 1RMGA 1AIRA 4XOTA 2XTXA 1O8GA 4XMYA 4OPWA 2VBKA 3LMWA 3SUCA 1VBLA 1PE9A 4XKWA 1CLWA 2VJJA 4XKVA 1OFEA 2Z8GA 4XOPA 2NTBA 3SZEA 3WWGA 2NT6A 4W8SA 4Z03A 2BM6A 3LYCA 1H80A 4Z06A 3BH7B 1K5CA 2B0RA 4KH3A 3GRHA 3SQVA 2O0VA 1OGOX 2J8KA 2EWEA 2NT9A 1BHEA 1JTAA 4YEIA 3N90A 1PLUA 2NSTA 2O1DA 4OZYA 1O88A 5JMCB 4OJLA 1DBGA 4YZQA 4XL9A 2BSPA 2VFPA 1QRCA 3VSTA 4XLAA 4AVZA 2VBEA 2NZMA 4XORA 1HG8A 1LLWA 2O17A 2XTWA 3LJYA 4XNFA 4YCQA 3TH0A 4OZZA 1IB4A 1O8JA 1K8FA 3BH6B 5C1CA 4YZAA 4V02C 3NB2A 3PSZA 2XTYA 2VJIA 4MXNA 2UVEA 1QRBA 2BM5A 1O8FA 1OFDA 2ODLA 4NK8A 1EZGA 2PYGA 4OJ5A 4W8RA 1O8MA 4XR6A 2PYHA 3EQOA 2W7ZA 4OJOA 5C1EA 4YZ0A 2INVA 2VFNA 1X0CA 3VMVA 4MR0A 4XQFA 4C2LA 2VBMA 1IDKA 4U4BA 1O8EA 1DABA 1JRGA 2X6YA 3AK5A 1EA0A 3B8YA 2BM4A 2QYUA 1EE6A 3GQAA 2XT2A
chains in the Genus database with same CATH topology
4YCQA 2XTXA 3NB2A 4YC5A 2XTYA 3SY2A 2O6WA 3DU1X 3NAWA 3SQVA 2J8KA 4YDTA 4YEIA 2XT4A 2QZAA 4YFOA 2XTWA 5DNSA 3PSSA 2QYUA 3PSZA 2XT2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YCQ A;  2XTX A;  3NB2 A;  4YC5 A;  2XTY A;  3SY2 A;  2O6W A;  3DU1 X;  3NAW A;  3SQV A;  2J8K A;  4YDT A;  4YEI A;  2XT4 A;  2QZA A;  4YFO A;  2XTW A;  5DNS A;  3PSS A;  2QYU A;  3PSZ A;  2XT2 A; 
#chains in the Genus database with same CATH topology
 1BN8 A;  1RWR A;  2BM7 A;  4U49 A;  2IOU G;  4OM9 A;  2BX6 A;  2X85 A;  4XLF A;  2O0W A;  2INU A;  2IQ7 A;  4URR A;  4XLC A;  1WMR A;  4YEJ A;  1L1I A;  4W8Q A;  3ZPP A;  1OFM A;  3N6Z A;  3SY2 A;  2YUH A;  1KCD A;  2X3H A;  1GQ8 A;  1TYU A;  2NTP A;  3ZSC A;  1IDJ A;  1XG2 A;  2G0Y A;  1K4Z A;  3JX8 A;  3T9G A;  4I84 A;  1O8L A;  4OJP A;  2QY1 A;  1TYX A;  2QX3 A;  1CZF A;  1O8H A;  4NK6 A;  1PXZ A;  2NSP A;  4YDT A;  5AMV A;  1O8K A;  1TYV A;  3UW0 A;  2XT4 A;  1QA1 A;  4OJ6 A;  1QQ1 A;  2UVF A;  2V5I A;  4EW9 A;  1KCC A;  3EQN A;  2F3L A;  2XC1 A;  3RIQ A;  1IA5 A;  4XLH A;  1LM1 A;  3PSS A;  1QA3 A;  2X6W A;  3DU1 X;  1TSP A;  1HF2 A;  1KTW A;  2O04 A;  3JUR A;  4XM3 A;  1NHC A;  3GQ9 A;  3KRG A;  4Z05 A;  1QJV A;  4YZX A;  3P4G A;  4JRA C;  4YC5 A;  3VSU A;  3B4N A;  2NTQ A;  2X6X A;  4YEL A;  4HWV A;  1DBO A;  3FY3 A;  3ML3 A;  2O6W A;  2QXZ A;  3VMW A;  2VFM A;  4XN3 A;  3H09 A;  2J8I A;  4XN0 A;  4XON A;  5JLV C;  3NAW A;  1QA2 A;  1QCX A;  3PET A;  2PEC A;  4XLE A;  2VFO A;  3VSV A;  3B90 A;  4W8T A;  3GQ8 A;  1KQ5 A;  2VFQ A;  2QZA A;  4YFO A;  4PMH A;  1O8D A;  1LLZ A;  1RU4 A;  1OOC A;  3GQ7 A;  1OGM X;  1OFL A;  1TYW A;  5DNS A;  1WXR A;  3SYJ A;  1O8I A;  1RMG A;  1AIR A;  4XOT A;  2XTX A;  1O8G A;  4XMY A;  4OPW A;  2VBK A;  3LMW A;  3SUC A;  1VBL A;  1PE9 A;  4XKW A;  1CLW A;  2VJJ A;  4XKV A;  1OFE A;  2Z8G A;  4XOP A;  2NTB A;  3SZE A;  3WWG A;  2NT6 A;  4W8S A;  4Z03 A;  2BM6 A;  3LYC A;  1H80 A;  4Z06 A;  3BH7 B;  1K5C A;  2B0R A;  4KH3 A;  3GRH A;  3SQV A;  2O0V A;  1OGO X;  2J8K A;  2EWE A;  2NT9 A;  1BHE A;  1JTA A;  4YEI A;  3N90 A;  1PLU A;  2NST A;  2O1D A;  4OZY A;  1O88 A;  5JMC B;  4OJL A;  1DBG A;  4YZQ A;  4XL9 A;  2BSP A;  2VFP A;  1QRC A;  3VST A;  4XLA A;  4AVZ A;  2VBE A;  2NZM A;  4XOR A;  1HG8 A;  1LLW A;  2O17 A;  2XTW A;  3LJY A;  4XNF A;  4YCQ A;  3TH0 A;  4OZZ A;  1IB4 A;  1O8J A;  1K8F A;  3BH6 B;  5C1C A;  4YZA A;  4V02 C;  3NB2 A;  3PSZ A;  2XTY A;  2VJI A;  4MXN A;  2UVE A;  1QRB A;  2BM5 A;  1O8F A;  1OFD A;  2ODL A;  4NK8 A;  1EZG A;  2PYG A;  4OJ5 A;  4W8R A;  1O8M A;  4XR6 A;  2PYH A;  3EQO A;  2W7Z A;  4OJO A;  5C1E A;  4YZ0 A;  2INV A;  2VFN A;  1X0C A;  3VMV A;  4MR0 A;  4XQF A;  4C2L A;  2VBM A;  1IDK A;  4U4B A;  1O8E A;  1DAB A;  1JRG A;  2X6Y A;  3AK5 A;  1EA0 A;  3B8Y A;  2BM4 A;  2QYU A;  1EE6 A;  3GQA A;  2XT2 A; 
#chains in the Genus database with same CATH homology
 4YCQ A;  2XTX A;  3NB2 A;  4YC5 A;  2XTY A;  3SY2 A;  2O6W A;  3DU1 X;  3NAW A;  3SQV A;  2J8K A;  4YDT A;  4YEI A;  2XT4 A;  2QZA A;  4YFO A;  2XTW A;  5DNS A;  3PSS A;  2QYU A;  3PSZ A;  2XT2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...