2XTYA

Structure of qnrb1 (r167e-trypsin treated), a plasmid-mediated fluoroquinolone resistance protein
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
216
structure length
208
Chain Sequence
b'GSHMALALVGEKIDRNRFTGEKIENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRAMLKDAIFKSCDLSMADFRNSSALGIEIRHCRAQGADFRGASFMFCSAYITNTNLSYANFSKVVLEKCELWENRWIGAQVLGATFSGSDLSGGEFSTFDWEAANFTHCDLTNSELGDLDIRGVDLQGVKLDNYQASLLMERLGIAVI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords QNRB1
publication title Structure of Qnrb1, a Plasmid-Mediated Fluoroquinolone Resistance Factor.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Cell cycle
total genus 87
structure length 208
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 2xtyA00
4YDTA 2O6WA 2QYUA 3SQVA 4YEIA 2XTWA 2XT2A 2XTYA 3SY2A 2J8KA 3NAWA 3NB2A 3PSSA 2XTXA 3DU1X 2QZAA 2XT4A 5DNSA 3PSZA 4YC5A 4YFOA 4YCQA
chains in the Genus database with same CATH superfamily
3H09A 3ZPPA 1BN8A 4XKVA 1WXRA 3B8YA 1OFLA 1O8MA 3VMVA 1PLUA 4YEIA 2NSTA 2XT2A 4YZQA 1CZFA 3RIQA 2UVFA 2J8KA 2XC1A 3LYCA 4NK8A 2NTPA 1O8FA 4U4BA 4XLAA 1KCDA 1JRGA 1LM1A 3NAWA 3NB2A 4W8RA 1OGMX 4KH3A 2F3LA 1QCXA 2XTXA 4OM9A 3DU1X 3SUCA 1TSPA 1K5CA 2EWEA 1IA5A 2BM7A 3SYJA 5DNSA 3JURA 3PSZA 4MXNA 1K4ZA 3KRGA 2NTBA 3ML3A 4XR6A 4YFOA 3BH6B 5AMVA 1L1IA 4XQFA 4W8TA 1QA3A 1OFDA 1IDKA 3VSUA 2J8IA 2BM4A 1TYXA 4OPWA 2QX3A 2O04A 4NK6A 3GQ7A 4OJ5A 3ZSCA 4XOPA 2NTQA 1H80A 4XLHA 4YDTA 2VFNA 2QYUA 2PECA 2X6XA 2PYHA 2O1DA 1RMGA 3EQNA 2XTWA 2XTYA 2QXZA 2VFMA 1DBGA 3N6ZA 4OJ6A 1TYWA 4URRA 4XONA 3B90A 4U49A 1OFEA 2V5IA 1XG2A 2X85A 5JMCB 1PE9A 1NHCA 1QA1A 4XOTA 2VJIA 1O8JA 2Z8GA 1QJVA 3B4NA 2QZAA 1HG8A 4OZYA 3GQ9A 1JTAA 1AIRA 4YC5A 4YZAA 2VBEA 2ODLA 3SZEA 1QA2A 4XLEA 1OOCA 2O0VA 2VFPA 1EA0A 1O88A 3GQAA 2VBMA 3LJYA 1CLWA 4AVZA 1KTWA 4HWVA 2B0RA 2W7ZA 3GQ8A 4C2LA 2YUHA 1WMRA 4XL9A 2PYGA 1O8KA 3BH7B 2BSPA 4YZ0A 2BX6A 4OZZA 1TYVA 3T9GA 2X6WA 1RWRA 1LLZA 2G0YA 1PXZA 3VSTA 1O8EA 2NT6A 4OJOA 4XN0A 3PSSA 2INUA 4XLCA 2VFQA 2VJJA 3N90A 2UVEA 1OFMA 4XMYA 1LLWA 1QRBA 3EQOA 4W8QA 1O8GA 4JRAC 1RU4A 2BM5A 4Z06A 1K8FA 4XNFA 4OJPA 5C1EA 4Z03A 4YCQA 4W8SA 1HF2A 1QRCA 3JX8A 4PMHA 3WWGA 1OGOX 3GRHA 3PETA 2O6WA 4XM3A 3SQVA 4YELA 4YEJA 1O8DA 3AK5A 4Z05A 4XORA 1KQ5A 1O8HA 1VBLA 4XN3A 2QY1A 3VSVA 3SY2A 1IB4A 1QQ1A 3LMWA 4OJLA 1DBOA 4V02C 3TH0A 2VBKA 1IDJA 2O0WA 2X6YA 4XKWA 4EW9A 5C1CA 4YZXA 5JLVC 2NZMA 2VFOA 2IQ7A 1X0CA 2NT9A 2NSPA 2O17A 2X3HA 4MR0A 1DABA 1TYUA 1GQ8A 2INVA 1BHEA 2XT4A 3VMWA 1O8LA 4I84A 4XLFA 1EE6A 1O8IA 1EZGA 3FY3A 1KCCA 2BM6A 3UW0A 3P4GA 2IOUG
chains in the Genus database with same CATH topology
4YDTA 2O6WA 2QYUA 3SQVA 4YEIA 2XTWA 2XT2A 2XTYA 3SY2A 2J8KA 3NAWA 3NB2A 3PSSA 2XTXA 3DU1X 2QZAA 2XT4A 5DNSA 3PSZA 4YC5A 4YFOA 4YCQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YDT A;  2O6W A;  2QYU A;  3SQV A;  4YEI A;  2XTW A;  2XT2 A;  2XTY A;  3SY2 A;  2J8K A;  3NAW A;  3NB2 A;  3PSS A;  2XTX A;  3DU1 X;  2QZA A;  2XT4 A;  5DNS A;  3PSZ A;  4YC5 A;  4YFO A;  4YCQ A; 
#chains in the Genus database with same CATH topology
 3H09 A;  3ZPP A;  1BN8 A;  4XKV A;  1WXR A;  3B8Y A;  1OFL A;  1O8M A;  3VMV A;  1PLU A;  4YEI A;  2NST A;  2XT2 A;  4YZQ A;  1CZF A;  3RIQ A;  2UVF A;  2J8K A;  2XC1 A;  3LYC A;  4NK8 A;  2NTP A;  1O8F A;  4U4B A;  4XLA A;  1KCD A;  1JRG A;  1LM1 A;  3NAW A;  3NB2 A;  4W8R A;  1OGM X;  4KH3 A;  2F3L A;  1QCX A;  2XTX A;  4OM9 A;  3DU1 X;  3SUC A;  1TSP A;  1K5C A;  2EWE A;  1IA5 A;  2BM7 A;  3SYJ A;  5DNS A;  3JUR A;  3PSZ A;  4MXN A;  1K4Z A;  3KRG A;  2NTB A;  3ML3 A;  4XR6 A;  4YFO A;  3BH6 B;  5AMV A;  1L1I A;  4XQF A;  4W8T A;  1QA3 A;  1OFD A;  1IDK A;  3VSU A;  2J8I A;  2BM4 A;  1TYX A;  4OPW A;  2QX3 A;  2O04 A;  4NK6 A;  3GQ7 A;  4OJ5 A;  3ZSC A;  4XOP A;  2NTQ A;  1H80 A;  4XLH A;  4YDT A;  2VFN A;  2QYU A;  2PEC A;  2X6X A;  2PYH A;  2O1D A;  1RMG A;  3EQN A;  2XTW A;  2XTY A;  2QXZ A;  2VFM A;  1DBG A;  3N6Z A;  4OJ6 A;  1TYW A;  4URR A;  4XON A;  3B90 A;  4U49 A;  1OFE A;  2V5I A;  1XG2 A;  2X85 A;  5JMC B;  1PE9 A;  1NHC A;  1QA1 A;  4XOT A;  2VJI A;  1O8J A;  2Z8G A;  1QJV A;  3B4N A;  2QZA A;  1HG8 A;  4OZY A;  3GQ9 A;  1JTA A;  1AIR A;  4YC5 A;  4YZA A;  2VBE A;  2ODL A;  3SZE A;  1QA2 A;  4XLE A;  1OOC A;  2O0V A;  2VFP A;  1EA0 A;  1O88 A;  3GQA A;  2VBM A;  3LJY A;  1CLW A;  4AVZ A;  1KTW A;  4HWV A;  2B0R A;  2W7Z A;  3GQ8 A;  4C2L A;  2YUH A;  1WMR A;  4XL9 A;  2PYG A;  1O8K A;  3BH7 B;  2BSP A;  4YZ0 A;  2BX6 A;  4OZZ A;  1TYV A;  3T9G A;  2X6W A;  1RWR A;  1LLZ A;  2G0Y A;  1PXZ A;  3VST A;  1O8E A;  2NT6 A;  4OJO A;  4XN0 A;  3PSS A;  2INU A;  4XLC A;  2VFQ A;  2VJJ A;  3N90 A;  2UVE A;  1OFM A;  4XMY A;  1LLW A;  1QRB A;  3EQO A;  4W8Q A;  1O8G A;  4JRA C;  1RU4 A;  2BM5 A;  4Z06 A;  1K8F A;  4XNF A;  4OJP A;  5C1E A;  4Z03 A;  4YCQ A;  4W8S A;  1HF2 A;  1QRC A;  3JX8 A;  4PMH A;  3WWG A;  1OGO X;  3GRH A;  3PET A;  2O6W A;  4XM3 A;  3SQV A;  4YEL A;  4YEJ A;  1O8D A;  3AK5 A;  4Z05 A;  4XOR A;  1KQ5 A;  1O8H A;  1VBL A;  4XN3 A;  2QY1 A;  3VSV A;  3SY2 A;  1IB4 A;  1QQ1 A;  3LMW A;  4OJL A;  1DBO A;  4V02 C;  3TH0 A;  2VBK A;  1IDJ A;  2O0W A;  2X6Y A;  4XKW A;  4EW9 A;  5C1C A;  4YZX A;  5JLV C;  2NZM A;  2VFO A;  2IQ7 A;  1X0C A;  2NT9 A;  2NSP A;  2O17 A;  2X3H A;  4MR0 A;  1DAB A;  1TYU A;  1GQ8 A;  2INV A;  1BHE A;  2XT4 A;  3VMW A;  1O8L A;  4I84 A;  4XLF A;  1EE6 A;  1O8I A;  1EZG A;  3FY3 A;  1KCC A;  2BM6 A;  3UW0 A;  3P4G A;  2IOU G; 
#chains in the Genus database with same CATH homology
 4YDT A;  2O6W A;  2QYU A;  3SQV A;  4YEI A;  2XTW A;  2XT2 A;  2XTY A;  3SY2 A;  2J8K A;  3NAW A;  3NB2 A;  3PSS A;  2XTX A;  3DU1 X;  2QZA A;  2XT4 A;  5DNS A;  3PSZ A;  4YC5 A;  4YFO A;  4YCQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...