2XTYA

Structure of qnrb1 (r167e-trypsin treated), a plasmid-mediated fluoroquinolone resistance protein
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
216
structure length
208
Chain Sequence
GSHMALALVGEKIDRNRFTGEKIENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRAMLKDAIFKSCDLSMADFRNSSALGIEIRHCRAQGADFRGASFMFCSAYITNTNLSYANFSKVVLEKCELWENRWIGAQVLGATFSGSDLSGGEFSTFDWEAANFTHCDLTNSELGDLDIRGVDLQGVKLDNYQASLLMERLGIAVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Qnrb1, a Plasmid-Mediated Fluoroquinolone Resistance Factor.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Cell cycle
molecule keywords QNRB1
total genus 87
structure length 208
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 2xtyA00
2XTWA 4YDTA 2XTYA 3DU1X 3SQVA 4YFOA 4YEIA 2O6WA 2XT4A 2XT2A 4YCQA 3SY2A 2QZAA 4YC5A 3PSSA 3NB2A 5DNSA 3NAWA 2XTXA 3PSZA 2J8KA 2QYUA
chains in the Genus database with same CATH superfamily
1IDJA 2XTWA 1K4ZA 1X0CA 2VJIA 4PMHA 4YDTA 1O8GA 2BM7A 3SQVA 2BM4A 3LJYA 4YEIA 1KTWA 4XLHA 3ML3A 2Z8GA 3VSTA 4XKWA 1QA1A 2XT2A 1BHEA 2IQ7A 3B8YA 2X6YA 5JLVC 4JRAC 4OJOA 1IA5A 3B90A 4OJPA 4C2LA 1QA3A 3KRGA 4XLAA 4I84A 2VFPA 3JX8A 3GQ7A 3PSSA 2VFOA 3P4GA 2VFNA 3N90A 1H80A 1TYVA 1RWRA 2QY1A 4XLCA 2NSPA 4MXNA 4W8RA 1L1IA 5DNSA 1JTAA 1LM1A 4XR6A 1GQ8A 1O8JA 3B4NA 2XTXA 3GRHA 2W7ZA 4XKVA 4YEJA 4Z06A 2PYGA 3PSZA 3SUCA 4XN3A 2QZAA 4Z05A 1O8DA 1JRGA 3T9GA 3BH6B 2XTYA 4XLFA 4XONA 4HWVA 3H09A 1IB4A 2QX3A 1K8FA 1K5CA 3ZSCA 1O8KA 4MR0A 1TSPA 4OPWA 2NT6A 2XT4A 2VBKA 1OFEA 1IDKA 1OFMA 3SY2A 4U49A 1XG2A 1OFDA 4XL9A 4AVZA 2INVA 3UW0A 1RMGA 1KQ5A 5C1CA 4YELA 5C1EA 2EWEA 4V02C 2VFMA 1HF2A 2PECA 2VJJA 1QRCA 4XN0A 2XC1A 4KH3A 2BX6A 3GQAA 4W8QA 2J8IA 3TH0A 3BH7B 1TYUA 3FY3A 1PLUA 1WMRA 4U4BA 4W8TA 1CZFA 4NK8A 2VBMA 3EQNA 4OM9A 3DU1X 2F3LA 1PXZA 3LMWA 1O8EA 1OGMX 2O1DA 3WWGA 1RU4A 2INUA 2NTBA 4OZZA 2B0RA 3RIQA 3GQ8A 4XM3A 2BM6A 1O8MA 4YCQA 4XNFA 1WXRA 3JURA 2V5IA 1QCXA 1QA2A 3LYCA 2UVFA 1O8IA 1AIRA 2UVEA 4YC5A 4Z03A 1PE9A 3SZEA 3VMVA 1EZGA 1LLZA 3NB2A 1QRBA 1NHCA 2VBEA 2NT9A 2X6WA 4OJ5A 2G0YA 3PETA 1DABA 3NAWA 4W8SA 2IOUG 2QXZA 4YZAA 2QYUA 1EA0A 1OFLA 3SYJA 1VBLA 2NTPA 4OJ6A 2O17A 4URRA 4XOTA 3ZPPA 2NTQA 4YFOA 1KCDA 2X85A 3AK5A 1QQ1A 1BN8A 2O6WA 3VMWA 2NZMA 1CLWA 1O88A 2X6XA 2YUHA 1O8FA 2BM5A 4YZQA 1OGOX 5JMCB 2O0WA 1TYXA 1EE6A 2BSPA 2ODLA 1DBOA 2VFQA 1DBGA 2O0VA 3N6ZA 1O8LA 4OZYA 4XMYA 3GQ9A 1TYWA 5AMVA 1HG8A 4YZ0A 4NK6A 2X3HA 2O04A 4XLEA 2NSTA 4EW9A 4OJLA 4YZXA 4XQFA 1LLWA 1QJVA 3EQOA 1O8HA 3VSVA 4XOPA 4XORA 2J8KA 2PYHA 1OOCA 3VSUA 1KCCA
chains in the Genus database with same CATH topology
2XTWA 4YDTA 2XTYA 3DU1X 3SQVA 4YFOA 4YEIA 2O6WA 2XT4A 2XT2A 4YCQA 3SY2A 2QZAA 4YC5A 3PSSA 3NB2A 5DNSA 3NAWA 2XTXA 3PSZA 2J8KA 2QYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XTW A;  4YDT A;  2XTY A;  3DU1 X;  3SQV A;  4YFO A;  4YEI A;  2O6W A;  2XT4 A;  2XT2 A;  4YCQ A;  3SY2 A;  2QZA A;  4YC5 A;  3PSS A;  3NB2 A;  5DNS A;  3NAW A;  2XTX A;  3PSZ A;  2J8K A;  2QYU A; 
#chains in the Genus database with same CATH topology
 1IDJ A;  2XTW A;  1K4Z A;  1X0C A;  2VJI A;  4PMH A;  4YDT A;  1O8G A;  2BM7 A;  3SQV A;  2BM4 A;  3LJY A;  4YEI A;  1KTW A;  4XLH A;  3ML3 A;  2Z8G A;  3VST A;  4XKW A;  1QA1 A;  2XT2 A;  1BHE A;  2IQ7 A;  3B8Y A;  2X6Y A;  5JLV C;  4JRA C;  4OJO A;  1IA5 A;  3B90 A;  4OJP A;  4C2L A;  1QA3 A;  3KRG A;  4XLA A;  4I84 A;  2VFP A;  3JX8 A;  3GQ7 A;  3PSS A;  2VFO A;  3P4G A;  2VFN A;  3N90 A;  1H80 A;  1TYV A;  1RWR A;  2QY1 A;  4XLC A;  2NSP A;  4MXN A;  4W8R A;  1L1I A;  5DNS A;  1JTA A;  1LM1 A;  4XR6 A;  1GQ8 A;  1O8J A;  3B4N A;  2XTX A;  3GRH A;  2W7Z A;  4XKV A;  4YEJ A;  4Z06 A;  2PYG A;  3PSZ A;  3SUC A;  4XN3 A;  2QZA A;  4Z05 A;  1O8D A;  1JRG A;  3T9G A;  3BH6 B;  2XTY A;  4XLF A;  4XON A;  4HWV A;  3H09 A;  1IB4 A;  2QX3 A;  1K8F A;  1K5C A;  3ZSC A;  1O8K A;  4MR0 A;  1TSP A;  4OPW A;  2NT6 A;  2XT4 A;  2VBK A;  1OFE A;  1IDK A;  1OFM A;  3SY2 A;  4U49 A;  1XG2 A;  1OFD A;  4XL9 A;  4AVZ A;  2INV A;  3UW0 A;  1RMG A;  1KQ5 A;  5C1C A;  4YEL A;  5C1E A;  2EWE A;  4V02 C;  2VFM A;  1HF2 A;  2PEC A;  2VJJ A;  1QRC A;  4XN0 A;  2XC1 A;  4KH3 A;  2BX6 A;  3GQA A;  4W8Q A;  2J8I A;  3TH0 A;  3BH7 B;  1TYU A;  3FY3 A;  1PLU A;  1WMR A;  4U4B A;  4W8T A;  1CZF A;  4NK8 A;  2VBM A;  3EQN A;  4OM9 A;  3DU1 X;  2F3L A;  1PXZ A;  3LMW A;  1O8E A;  1OGM X;  2O1D A;  3WWG A;  1RU4 A;  2INU A;  2NTB A;  4OZZ A;  2B0R A;  3RIQ A;  3GQ8 A;  4XM3 A;  2BM6 A;  1O8M A;  4YCQ A;  4XNF A;  1WXR A;  3JUR A;  2V5I A;  1QCX A;  1QA2 A;  3LYC A;  2UVF A;  1O8I A;  1AIR A;  2UVE A;  4YC5 A;  4Z03 A;  1PE9 A;  3SZE A;  3VMV A;  1EZG A;  1LLZ A;  3NB2 A;  1QRB A;  1NHC A;  2VBE A;  2NT9 A;  2X6W A;  4OJ5 A;  2G0Y A;  3PET A;  1DAB A;  3NAW A;  4W8S A;  2IOU G;  2QXZ A;  4YZA A;  2QYU A;  1EA0 A;  1OFL A;  3SYJ A;  1VBL A;  2NTP A;  4OJ6 A;  2O17 A;  4URR A;  4XOT A;  3ZPP A;  2NTQ A;  4YFO A;  1KCD A;  2X85 A;  3AK5 A;  1QQ1 A;  1BN8 A;  2O6W A;  3VMW A;  2NZM A;  1CLW A;  1O88 A;  2X6X A;  2YUH A;  1O8F A;  2BM5 A;  4YZQ A;  1OGO X;  5JMC B;  2O0W A;  1TYX A;  1EE6 A;  2BSP A;  2ODL A;  1DBO A;  2VFQ A;  1DBG A;  2O0V A;  3N6Z A;  1O8L A;  4OZY A;  4XMY A;  3GQ9 A;  1TYW A;  5AMV A;  1HG8 A;  4YZ0 A;  4NK6 A;  2X3H A;  2O04 A;  4XLE A;  2NST A;  4EW9 A;  4OJL A;  4YZX A;  4XQF A;  1LLW A;  1QJV A;  3EQO A;  1O8H A;  3VSV A;  4XOP A;  4XOR A;  2J8K A;  2PYH A;  1OOC A;  3VSU A;  1KCC A; 
#chains in the Genus database with same CATH homology
 2XTW A;  4YDT A;  2XTY A;  3DU1 X;  3SQV A;  4YFO A;  4YEI A;  2O6W A;  2XT4 A;  2XT2 A;  4YCQ A;  3SY2 A;  2QZA A;  4YC5 A;  3PSS A;  3NB2 A;  5DNS A;  3NAW A;  2XTX A;  3PSZ A;  2J8K A;  2QYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...