2XTYA

Structure of qnrb1 (r167e-trypsin treated), a plasmid-mediated fluoroquinolone resistance protein
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
216
structure length
208
Chain Sequence
GSHMALALVGEKIDRNRFTGEKIENSTFFNCDFSGADLSGTEFIGCQFYDRESQKGCNFSRAMLKDAIFKSCDLSMADFRNSSALGIEIRHCRAQGADFRGASFMFCSAYITNTNLSYANFSKVVLEKCELWENRWIGAQVLGATFSGSDLSGGEFSTFDWEAANFTHCDLTNSELGDLDIRGVDLQGVKLDNYQASLLMERLGIAVI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Qnrb1, a Plasmid-Mediated Fluoroquinolone Resistance Factor.
pubmed doi rcsb
source organism Klebsiella pneumoniae
molecule tags Cell cycle
molecule keywords QNRB1
total genus 87
structure length 208
sequence length 216
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13599 Pentapeptide_4 Pentapeptide repeats (9 copies)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.160.20.80 Mainly Beta 3 Solenoid Pectate Lyase C-like E3 ubiquitin-protein ligase SopA 2xtyA00
2XT2A 2O6WA 2XTXA 3PSZA 3NB2A 2J8KA 4YC5A 2XTWA 4YCQA 3DU1X 2QZAA 3SY2A 2XT4A 4YFOA 3SQVA 5DNSA 3PSSA 4YDTA 2QYUA 3NAWA 4YEIA 2XTYA
chains in the Genus database with same CATH superfamily
2XT2A 2O6WA 3ZSCA 1EZGA 1O8IA 4XLFA 1EE6A 3T9GA 5C1CA 1JRGA 3NB2A 1TYUA 2BX6A 4XKWA 4YC5A 2F3LA 1X0CA 2O04A 4XLHA 1CLWA 1O8JA 4XR6A 2O0WA 3DU1X 3RIQA 2VFOA 2ODLA 2EWEA 3TH0A 3JX8A 4Z03A 2XT4A 2NT9A 3LMWA 2NSPA 1O8LA 3GQ7A 1K4ZA 4PMHA 3SQVA 3PSSA 1OGOX 2NZMA 4YZQA 2VBMA 1QA3A 1OFLA 2QYUA 2NSTA 1RMGA 2VFNA 2O17A 1BHEA 3EQNA 3N6ZA 4OZZA 3SZEA 4YEIA 1KTWA 3FY3A 4JRAC 2PECA 1IB4A 3P4GA 1OOCA 3KRGA 4XL9A 4XLCA 1QQ1A 3GQ9A 2INVA 4YZ0A 4URRA 3JURA 1NHCA 2BSPA 1TSPA 2IQ7A 2B0RA 3B4NA 3VSTA 1GQ8A 2INUA 4XNFA 2NTQA 4YCQA 1QRCA 5JLVC 2QX3A 4XORA 2BM5A 3GRHA 1H80A 4OJLA 2PYGA 3BH7B 4W8RA 3SY2A 1XG2A 3B8YA 3GQ8A 3H09A 1QA1A 2QY1A 1IDKA 1BN8A 3LJYA 4V02C 4U49A 3N90A 3NAWA 4MXNA 1O8DA 1VBLA 1CZFA 3B90A 4XMYA 2Z8GA 1O8KA 1K8FA 4XLAA 4XONA 3WWGA 1QCXA 2X6YA 4KH3A 4C2LA 1KQ5A 1HF2A 1LLWA 1PXZA 2UVEA 1IA5A 2PYHA 2QXZA 4EW9A 2XTXA 1OGMX 1OFMA 4XLEA 2O0VA 1O8FA 1O88A 2VFQA 1DBGA 2XTWA 2IOUG 3BH6B 4OPWA 2X6WA 4OM9A 3SYJA 2UVFA 4XKVA 5AMVA 3AK5A 4MR0A 2YUHA 4YZXA 4YFOA 2X85A 4HWVA 4I84A 2BM6A 4XOPA 3VSVA 2X6XA 4W8TA 2VBKA 1O8HA 2NTPA 4NK6A 4OJPA 4YDTA 1HG8A 5DNSA 3SUCA 2VJJA 1LM1A 1TYXA 1K5CA 4Z05A 2BM7A 4XQFA 2G0YA 4NK8A 1TYVA 3VMWA 4W8QA 1PLUA 2XTYA 1WMRA 2J8IA 1O8GA 1OFEA 1LLZA 2O1DA 3LYCA 1O8MA 4YELA 5JMCB 1DABA 1JTAA 1KCDA 3PSZA 1O8EA 2J8KA 4YEJA 1IDJA 4OZYA 1KCCA 4XM3A 1QRBA 1RWRA 2V5IA 2NT6A 3EQOA 3ML3A 4W8SA 3UW0A 2BM4A 2QZAA 1AIRA 3PETA 1RU4A 1TYWA 1L1IA 4XOTA 2X3HA 2W7ZA 1QJVA 4YZAA 3VSUA 1DBOA 1PE9A 2NTBA 2VFPA 4XN0A 4Z06A 1EA0A 2VBEA 3VMVA 2VJIA 4XN3A 3ZPPA 1WXRA 4U4BA 4AVZA 5C1EA 4OJ6A 3GQAA 2VFMA 4OJ5A 4OJOA 1OFDA 2XC1A 1QA2A
chains in the Genus database with same CATH topology
2XT2A 2O6WA 2XTXA 3PSZA 3NB2A 2J8KA 4YC5A 2XTWA 4YCQA 3DU1X 2QZAA 3SY2A 2XT4A 4YFOA 3SQVA 5DNSA 3PSSA 4YDTA 2QYUA 3NAWA 4YEIA 2XTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XT2 A;  2O6W A;  2XTX A;  3PSZ A;  3NB2 A;  2J8K A;  4YC5 A;  2XTW A;  4YCQ A;  3DU1 X;  2QZA A;  3SY2 A;  2XT4 A;  4YFO A;  3SQV A;  5DNS A;  3PSS A;  4YDT A;  2QYU A;  3NAW A;  4YEI A;  2XTY A; 
#chains in the Genus database with same CATH topology
 2XT2 A;  2O6W A;  3ZSC A;  1EZG A;  1O8I A;  4XLF A;  1EE6 A;  3T9G A;  5C1C A;  1JRG A;  3NB2 A;  1TYU A;  2BX6 A;  4XKW A;  4YC5 A;  2F3L A;  1X0C A;  2O04 A;  4XLH A;  1CLW A;  1O8J A;  4XR6 A;  2O0W A;  3DU1 X;  3RIQ A;  2VFO A;  2ODL A;  2EWE A;  3TH0 A;  3JX8 A;  4Z03 A;  2XT4 A;  2NT9 A;  3LMW A;  2NSP A;  1O8L A;  3GQ7 A;  1K4Z A;  4PMH A;  3SQV A;  3PSS A;  1OGO X;  2NZM A;  4YZQ A;  2VBM A;  1QA3 A;  1OFL A;  2QYU A;  2NST A;  1RMG A;  2VFN A;  2O17 A;  1BHE A;  3EQN A;  3N6Z A;  4OZZ A;  3SZE A;  4YEI A;  1KTW A;  3FY3 A;  4JRA C;  2PEC A;  1IB4 A;  3P4G A;  1OOC A;  3KRG A;  4XL9 A;  4XLC A;  1QQ1 A;  3GQ9 A;  2INV A;  4YZ0 A;  4URR A;  3JUR A;  1NHC A;  2BSP A;  1TSP A;  2IQ7 A;  2B0R A;  3B4N A;  3VST A;  1GQ8 A;  2INU A;  4XNF A;  2NTQ A;  4YCQ A;  1QRC A;  5JLV C;  2QX3 A;  4XOR A;  2BM5 A;  3GRH A;  1H80 A;  4OJL A;  2PYG A;  3BH7 B;  4W8R A;  3SY2 A;  1XG2 A;  3B8Y A;  3GQ8 A;  3H09 A;  1QA1 A;  2QY1 A;  1IDK A;  1BN8 A;  3LJY A;  4V02 C;  4U49 A;  3N90 A;  3NAW A;  4MXN A;  1O8D A;  1VBL A;  1CZF A;  3B90 A;  4XMY A;  2Z8G A;  1O8K A;  1K8F A;  4XLA A;  4XON A;  3WWG A;  1QCX A;  2X6Y A;  4KH3 A;  4C2L A;  1KQ5 A;  1HF2 A;  1LLW A;  1PXZ A;  2UVE A;  1IA5 A;  2PYH A;  2QXZ A;  4EW9 A;  2XTX A;  1OGM X;  1OFM A;  4XLE A;  2O0V A;  1O8F A;  1O88 A;  2VFQ A;  1DBG A;  2XTW A;  2IOU G;  3BH6 B;  4OPW A;  2X6W A;  4OM9 A;  3SYJ A;  2UVF A;  4XKV A;  5AMV A;  3AK5 A;  4MR0 A;  2YUH A;  4YZX A;  4YFO A;  2X85 A;  4HWV A;  4I84 A;  2BM6 A;  4XOP A;  3VSV A;  2X6X A;  4W8T A;  2VBK A;  1O8H A;  2NTP A;  4NK6 A;  4OJP A;  4YDT A;  1HG8 A;  5DNS A;  3SUC A;  2VJJ A;  1LM1 A;  1TYX A;  1K5C A;  4Z05 A;  2BM7 A;  4XQF A;  2G0Y A;  4NK8 A;  1TYV A;  3VMW A;  4W8Q A;  1PLU A;  2XTY A;  1WMR A;  2J8I A;  1O8G A;  1OFE A;  1LLZ A;  2O1D A;  3LYC A;  1O8M A;  4YEL A;  5JMC B;  1DAB A;  1JTA A;  1KCD A;  3PSZ A;  1O8E A;  2J8K A;  4YEJ A;  1IDJ A;  4OZY A;  1KCC A;  4XM3 A;  1QRB A;  1RWR A;  2V5I A;  2NT6 A;  3EQO A;  3ML3 A;  4W8S A;  3UW0 A;  2BM4 A;  2QZA A;  1AIR A;  3PET A;  1RU4 A;  1TYW A;  1L1I A;  4XOT A;  2X3H A;  2W7Z A;  1QJV A;  4YZA A;  3VSU A;  1DBO A;  1PE9 A;  2NTB A;  2VFP A;  4XN0 A;  4Z06 A;  1EA0 A;  2VBE A;  3VMV A;  2VJI A;  4XN3 A;  3ZPP A;  1WXR A;  4U4B A;  4AVZ A;  5C1E A;  4OJ6 A;  3GQA A;  2VFM A;  4OJ5 A;  4OJO A;  1OFD A;  2XC1 A;  1QA2 A; 
#chains in the Genus database with same CATH homology
 2XT2 A;  2O6W A;  2XTX A;  3PSZ A;  3NB2 A;  2J8K A;  4YC5 A;  2XTW A;  4YCQ A;  3DU1 X;  2QZA A;  3SY2 A;  2XT4 A;  4YFO A;  3SQV A;  5DNS A;  3PSS A;  4YDT A;  2QYU A;  3NAW A;  4YEI A;  2XTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...