2XTZA

Crystal structure of the g alpha protein atgpa1 from arabidopsis thaliana
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
349
structure length
341
Chain Sequence
MGSGIHIRKLLLLGAGESGKSTIFKQIKLLFQTGFDEGELKSYVPVIHANVYQTIKLLHDGTKEFAQNETDSAKYMLSSESIAIGEKLSEIGGRLDYPRLTKDIAEGIETLWKDPAIQETARGNELQVPDTKYLMENLKRLSDINYIPTKEDVLYARVRTTGVVEIQFSPVGEVYRLFDVGGQRNERRKWIHLFEGVTAVIFCAAISEYDQTLFEDEQKNRMMETKELFDWVLKQPCFEKTSFMLFLNKFDIFEKKVLDVPLNVCEWFRDYQPVSSGKQEIEHAYEFVKKKFEELYYQNTAPDRVDRVFKIYRTTALDQKLVKKTFKLVDETLRRRNLLEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of a Self-Activating G Protein Alpha Subunit Reveals its Distinct Mechanism of Signal Initiation
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords GUANINE NUCLEOTIDE-BINDING PROTEIN ALPHA-1 SUBUNIT
total genus 130
structure length 341
sequence length 349
chains with identical sequence B, C
ec nomenclature ec 3.6.5.1: Heterotrimeric G-protein GTPase.
pdb deposition date 2010-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 2xtzA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2xtzA01
5SZHB 1KHTA 2ZJ5A 2J3EA 5CDFE 2JLSA 2QENA 3BBPA 3Q85A 5CIQA 1G16A 1ZCAA 5JEEA 5JBQA 4HLDA 1HEIA 3U6BA 3E1SA 4DLXA 3AF3A 4D0LB 1BO6A 1A4RA 4DLVA 3SNHA 1C9KA 3CF2A 1IY0A 1S9HA 1LTQA 1HT2E 2QTFA 5CYPA 1T91A 3VTKA 5KDOA 4GBMA 2EU8A 2IYYA 5AUOB 2WIBA 4MUBA 1II9A 3K9NA 3ZIAD 4JLAA 1T5LA 2CCJA 4U5XA 1RJ9A 1W4AA 2GJSA 3MWLA 1QHIA 4RSGA 2GXSA 3TRFA 3C5CA 4ZI2A 1G20E 2EFGA 2H16A 2OFXA 3NBXX 2F3TA 2BBOA 5EP3A 2AKYA 2V7QD 4DVGA 3LX8A 3OIYA 1UEIA 2ZU6A 4DLSA 4ZKEA 3A1VA 3U3MA 4DZZA 4EFMA 4L15A 4CT5A 3QG5A 4LJ4A 3P4XA 3RRYA 3OEHA 1WP9A 4IJMA 4QM6A 5ELXA 3SYLA 2GK7A 2QG6A 2UZIR 3ADKA 3TVTA 2OUKA 1BYUA 2K5UA 4M9QA 2QNRA 1QHNA 2Z6VA 4UNPA 3RS4A 3CR7A 2X19A 4HB4A 2FEMA 2D4HA 1ZIPA 2G3YA 3MLEA 1NVXQ 3CZQA 1G3UA 1BOFA 2FPLA 1YJ5A 4D25A 4AG5A 4IOJA 4LGMA 4HAVA 2WAYA 4C0BA 1G5RA 1H8EA 2ZJAA 4US0R 2JLWA 1XEXB 4QOSA 3ZGXA 1E2PA 3B1ZA 3P4YA 4A1FA 2QMHA 4XD7A 5KNDA 3KDSE 2ZI9A 5FOVA 1KNXA 3M6AA 5G3YA 2W2XA 4D80A 2QSYA 1NP6A 4OQLA 1IQPA 3KL4A 1Z8FA 2GCOB 4BZQA 3FPAA 4D2IA 1Z06A 1PLKA 4Q1BA 1P61B 1NG9A 1CR1A 3O8CA 1KKLA 2UZ3A 1KKMA 1KI7A 2GHIA 4TT3A 2Q3HA 1J8MF 2EQBA 3QXSA 4WOPA 4Q48A 5EE0A 4X8MA 4M1WA 2RGCA 5EUQB 4TMXA 4N0EA 1AKEA 4Y0VA 3U3JA 1XCPA 2OXCA 3CRMA 4LRWA 4B2IA 4DUGD 3AVWA 5DI3B 1P9WA 1UBFA 3RHFA 3THYB 1L2TA 2JCSA 1IXZA 2E87A 2J0UB 4MRNA 1XD9A 3IPYA 2ZYUX 1N0UA 4XJXA 4F92B 3ADDA 4FCTA 3X1XA 1YZGA 3KFXA 3I4LA 5JCZA 2Z83A 3U60B 4M1KA 4H1VA 1XD2B 1KJWA 3GMTA 2QM7A 1E6CA 3FFBA 1RRGA 2ZAOA 5A4JA 3M1IA 1SVWA 1MR3F 3NWJA 2GZAA 4B47A 3IEUA 1Q3HA 4LSGA 4WBSA 1E9FA 4B43A 4JMPA 3QKRB 3K70D 2LCFA 2IK8A 2IYUA 1T0HB 2IXFA 1U98A 5EE3A 5FL3A 3NXSA 1GUAA 4DRZA 4KFSA 1NN5A 2GVZC 4NU0A 2DCUA 5LD2B 1ZD1A 1AGRA 4QHYA 4F93B 2X1VA 2ORIA 3BB1A 3CX6A 3B8HA 3EX7C 1G7SA 1KSFX 2A5FA 2FX3A 3H86A 1U2RA 3PCRB 3VU9A 5HZKA 5D3QA 1JEEA 5JWHA 3TK1A 4ITRC 4Q03A 3P26A 2JLRA 1YQTA 1FPMA 1OF1A 3FFAA 1H8ED 4URWR 4TYQA 3ASYA 1R0WA 2ECKA 4CEHA 1O3YA 1KSGA 1VIAA 1IY2A 2WWGA 1KI1A 4ACBA 5KPDA 2HXSA 1W36C 2IUSA 3IIKA 2BWJA 3B85A 4ESHA 4LDJA 3SC3A 1RPZA 3P1JA 2CHGA 4HAYA 4X8HA 3ZQJA 4B2LA 1ZM7A 4Q4LA 4Q19A 2QQEA 1U99A 4YLGA 1ZC3A 3DM9B 1W36B 1Y63A 3AF1A 1IN5A 4UJ5A 3UKDA 4KHZA 2ZS9A 3EWSA 4FW9A 4LUCA 1EGAA 4V0KA 4JVLA 3BAFA 5AUQA 4UXIA 4PZYA 3T12A 2H5EA 1DG1G 3VNVA 4G5GA 1JQJC 3VHLB 1CJKC 4NCKA 1N6RA 3T61A 1EXMA 3OESA 3OZXA 2IS1A 4C4PA 4QGGA 2WWIA 3OIVA 1F60A 2YWGA 3QIAA 1ZC4A 5DHAA 4DLUA 2H92A 1MRSA 3BRWD 3G5UA 2IXEA 3JZMA 5AJZA 5HPYB 3GJ3A 2A9KA 4B32A 1KI4A 3T35A 1VCOA 4BLQA 1X86B 3O8DA 3ZIAA 1E96A 5G53C 1CJVC 1RYHA 4A2WA 1E0KA 2QSZA 4M1MA 2IYTA 3ICEA 1M34E 1KMHA 2C5LA 2F9MA 3NC1C 4MKGA 5JWOA 3K0SA 2VSOA 4BZXA 1TADA 3LD9A 2JJ8A 1XTQA 4KVGA 4QJ3A 2ZRHA 4LHYA 3OE7D 3EZFA 4Q7LA 2J9RA 2DWPA 1JNYA 2WKPA 5H70A 5HCIA 3WY9A 4EAQA 3VX4A 1JR3E 3A4MA 4TQ9A 5DYIA 1ZD8A 2WWHA 4CEIA 1VIYA 1GKYA 2XJ4A 3E5HA 3DMNA 4B76A 3HDTA 1JB1A 2RGNA 1E79A 2QI9C 1XNJA 5TXGA 1ZM4A 2QGNA 1PZNA 2RMKA 4KBGA 3EPHA 3CB4A 5AUPB 1KZGB 5FI0B 5J4VA 1VKJA 3KKOA 1MO4A 4GOJA 5FOWA 1O87A 5EP4A 3D7MA 2O8EB 1L4UA 4DJTA 3NBYC 4WZAE 3QXHA 3ETLA 2XOKD 3RLFA 1PVOA 1Z0AA 1X6VA 2PEZA 2W0SA 2VRWA 4MKIA 3ZVRA 1OB5A 3MWYW 1XEFA 4XSGA 2ZRMA 1W2HA 2CCKA 2NO6A 4A15A 1XBTA 2RH5A 3HP1A 1B23P 1N6HA 2PLRA 2HT6A 4M53A 2F3RA 3M0EA 1MRNA 3BH6A 3AP2A 2N42A 1JAHA 1KO7A 2JATA 1WF3A 2PMDA 2MMGA 3CBQA 1U0HC 2Z4RA 5JHGB 3OAAD 2J46A 3CO5A 1F2TA 4NYJR 1SZPA 4Q01A 4WXPA 3QVUA 1ESNA 1E2MA 4FMBB 1R8QA 4AI6A 1Y3AA 2XNSA 1I2DA 2KBFA 2GBLA 2ZETA 2CK3D 1G6HA 1P75A 3AUXA 4PO9A 3DOEA 5JWRA 3FHOA 4BGDA 1XEXA 1IY1A 3J81k 3DO6A 4R71A 1COWD 2ZIAA 3CR8A 2PL3A 1XEWY 2WPDD 4M21A 2HLDD 4Q18A 5UKDA 1VTKA 2W6IA 2ZRIA 1MKYA 4NCJA 4P31A 3QG1A 2JLZA 4TL8A 3SE0A 1YZQA 2IWHA 1DOAA 2NOAA 4RKFA 3R7WA 1M7HA 5J4LA 1LF0A 2CVFA 2CL7X 3SU8A 4DDVA 5KPJA 1RFLA 2GJ8A 2NIPA 2A78A 2D74A 3FWYA 4XD7D 1WQ1R 3N70A 2W2VA 3ZD6A 4G3XA 4TMWA 4Y0AA 4UKDA 2AN9A 1GVNB 2IA5A 1OXVA 5E4FA 3THYA 3SFVA 1UEJA 4OK6A 1R7RA 1W0JD 2ZU0C 3R9IA 2GCOA 2VSXA 5CJ2A 5BXQC 3C14C 5KHOC 2V9PA 3VAAA 3G82C 4HDOB 4R98A 2EYQA 4BPBA 1II8A 2GKSA 3WNDA 1GSIA 1RJ9B 3Q3JB 2F1HA 2BM0A 4LWZA 4OK3A 5TV2A 1HA3A 1SXJD 2GWHA 3DL0A 5EP1A 2Q6TA 4OI4A 1NI3A 1CF4A 1LNZA 4JLPA 5LBIA 4IOKA 4A8JB 4F91B 3OEEA 1E2NA 3RRMA 3PUVA 3NHBA 1VPLA 4HLQB 3TUIC 5JJKA 1B0UA 4MH0R 3NVAA 3WHKA 5L3VA 1I2MA 3O8BA 3SJBA 5FTNA 1DO2A 4URZR 4OQNA 5TARA 2XTZA 4Q7KA 4PAOA 1LB1B 2CK3A 4TMTA 1Z2CA 4NYIR 3W3AA 3D8BA 3RSOA 4YXWD 4LK2A 1R0XA 2YOGA 4U02A 5AJVB 4LJ9A 3UXMA 5CB6A 1WBBA 3MSXA 1AIPA 1CULC 1TU3A 1VG0B 4MA4A 1J99A 1R0ZA 3HPQA 2C04A 1Z6XA 3LXXA 1UAAA 4F38A 4QGHA 4KBFA 2RGXA 1G3MA 3HPRA 4TQUS 3WXMA 3LW8A 4F7WA 4BFSA 1L7VC 4A0FA 1KJZA 4AWXA 1OH6A 1EFRA 4HUQB 3I5XA 3RRZA 5JS7A 5BN3A 1CKEA 4LBWA 1KSJA 3ONWA 3AVQA 1J2JA 2A5YB 2YC2C 2VHUA 2F1IA 2YNMA 1GOTA 3LA6A 3QF7A 1N6KA 3TJZA 2BBSA 1WDTA 2P5TB 4KCGA 2YWHA 3CRW1 2HF8A 1JJ7A 5IF9A 2ZUCA 3SFZA 1ESMA 2GNOA 2ZRLA 3L0OA 5A0FA 3B1XA 1P2UA 5B30A 1T9HA 1FX0B 1F3OA 2QN6A 4QL3A 2O8FA 5FL7D 4IEIA 5AWFC 2QMEA 1XD8A 3W8NA 1NNEA 1FFHA 2OCYC 4C0SA 4DWJA 1DAHA 1FL9A 4FI3C 4ON9A 4NYMQ 3GLIB 3CIOA 3MAAC 4OK5A 1P7CA 1XP8A 2JJ1D 3T06B 5KSOA 1BMFA 4PHGA 1FNNA 1GRNA 1JPNA 2ZE5A 1Q1EA 3PFIA 5DN6A 1N5KA 2WMOB 3N2EA 1N25A 2FH5B 4BEJA 1X3SA 5EQTA 1NMZA 4JBWA 5FI1B 4KYIB 2O8BB 2VP0A 1KDTA 3IBGA 3A37A 4DBLC 3HU3A 4N3NA 4PC6A 1W0JA 5K8IA 4Q4HA 1TTTA 2QA5A 4LYHA 4TLCA 2ZM5A 1KIMA 2VP9A 1EX6A 1QHXA 2BMFA 3L0IB 1TEXA 5CM9C 1WMSA 2QP9X 3WMFA 4BE7B 1M2OB 3EXAA 2HCJB 3UMRA 4QJ5A 2VTKA 4DT1B 5FTLA 4I99A 2FWRA 2ZRJA 2WJIA 5GJWC 3QBVA 5JJLA 4MKFA 1NLZA 3B9QA 1QBKC 4IXNA 4K46A 2O5VA 2IYSA 4YMWA 2AFHE 3NBZC 4DSNA 2F1RA 1HUQA 4LJ8A 3PEYA 4AKIA 1QVRA 2NMVA 3GLGA 1KK3A 1F2UA 4BFUA 1Z63A 3ZH9B 5G40A 5EXTA 1E2LA 3IBYA 3B6EA 1DELA 2BMJA 4TLEA 3PQCA 1D2EA 1S8FA 2RGGA 4Q1FA 1OHHD 4XWAA 1UDXA 3DDCA 1SQ5A 3ZS9A 4GL2A 5E7JA 2IS6A 2WWYA 2ZI3A 2OG2A 4XOIA 2B7CA 4KODA 4LZZA 4U00A 2YVUA 1N6PA 2C9YA 2CL0X 4DLWA 3AVVA 3NTUA 2PX0A 3MFYA 4LBVA 5AR1A 3A58B 2OCBA 4NYJQ 4O2LA 5JLJA 3ICQB 1NN0A 2JDID 1OH5A 2CVHA 3P32A 4TN1A 3RS3A 4Q7MB 2FSHA 821PA 2J0SA 4Q9LA 1P2TA 1Z6GA 2J45A 4A6PA 1XWIA 2C99A 1ZBDA 2F43A 4D81A 1H8HD 2J7KA 2LKDA 2MSEB 1XCGB 1E1RD 3IPXA 1QF9A 4KVAA 4QGFA 1J90A 1II0A 3BJIC 3CF6R 4V0LA 3ASZA 2FSIA 3JVUA 4ERNA 3X1YA 1NBME 4DEYA 5DIFA 1Q22A 2VSFA 4A4DA 4D4MA 2BV3A 5BYJA 3WHLA 1GG2A 1NL3A 3BH0A 2SHKA 4JKIA 4HSEA 1AM4D 1RRFA 1CIPA 2H1LA 4PQRA 3W3ZB 2ZE7A 4LV8B 3TAUA 5FTJA 1WE2A 1RC8A 5CDFA 2EFCB 2RGEA 3KXKA 4TMVA 1IAQA 3H84A 3GLFB 1SXJB 2FFBA 4HB3A 4JL8A 4I1SA 2QQ0A 5KUTA 2NO9A 4HLUA 5CM8B 2YINC 3PITA 3GCGA 4MGIR 3R9WA 4C0HA 4IFEA 1ZINA 1FMLA 4DB2A 2QT0A 1Z0IA 1ZM2A 4A82A 1TMKA 4EQ6B 1NIJA 3PEVA 4PHHA 4KO8A 2ZRPA 1E99A 1MO3A 1W4BA 4A2PA 5JEDA 3ZVNA 4US2R 1SGWA 2WBLC 2QU8A 2V4ZA 3OE7A 2WWFA 1OFIA 1MV5A 2ZYVX 1YHNA 3JVVA 4MGZR 1IHUA 1NVVR 1HE1C 3L8YA 1GWNA 1X1SA 3BFKA 1W2GA 1XPOA 2XITA 4TT3D 5LPNA 4E09A 2HCBA 2P6RA 3EW9A 4TL6A 2Y8EA 4L9WA 1IM2A 4M0LA 4LC0A 1W49A 1Z83A 5B57C 2V6IA 3BB3A 4LHZA 3AVXA 2C8VA 1T3SA 2FU5C 2OAQ1 4YC7A 2ONJA 3PG5A 3AB3A 1OKKA 4M1TA 3THXA 2FPKA 4A92A 5BN5A 3KJEA 3UPUA 4TL9A 4BRWA 4Z1MD 3UK6A 5FUWA 4MRSA 1P6XA 4FD2A 4RD6A 1H65A 2XX3A 3H1TA 5H68A 2REBA 2GJKA 4PPQA 2HUPA 2OT3B 2XAUA 2AXNA 4Z54A 4CVNA 1CR0A 1TF2A 3LBNA 4LC1A 4PPFA 1IJEA 5G3ZA 3GLFA 2QPTA 3T1TA 2YOFA 2RHDA 1E69A 3V4RA 1P9RA 3TBKA 1UDWA 4PTLA 4Q1CA 5JHHB 3L2OB 5DE3A 1KO1A 4KV9A 5CITA 2WVJA 1G7TA 2QMUA 4PR0A 4ZCIA 2JLQA 4EPTA 3PUYA 4OJQA 521PA 1SHKA 2HYIC 1S96A 3B78A 3FDIA 4PSVA 2BHRA 3M4YA 4EPWA 3FKSD 2CNWD 1DAMA 1IONA 1KK1A 1W4RA 3WBKA 2NZJA 4D4JA 3MCAA 4G0NA 3VMFA 2OEPA 1OPXA 5H1YA 2J1LA 2A5JA 3SI7A 3RDPA 4RD1A 2GAOA 1ZCBA 2ZJYA 1OT3A 2FN4A 2Q9CA 1E2IA 5P21A 3C15C 3CKLA 3I5YA 4IDQA 4RD4A 3BB4A 4BFYA 5AK0A 1E9AA 4EDHA 1SKYE 4B2PA 3C41J 2FG5A 3IGFA 4OBEA 1U81A 3BERA 1U9IC 3K0AA 1GIAA 1FQKA 3Q5EA 4RZ2A 4R7ZA 1Z0JA 3HYTA 4L5BA 5KNBA 5L3SA 4TYNA 3AVOA 2GCPA 1GM5A 1FNMA 1ONBA 2OCAA 2ZVQX 3K0CC 2VHCA 2RGBA 4TMKA 3QEJA 3FE2A 3FVQA 1Q1QA 3RC3A 3U4QA 2OBMA 1G21E 2O8FB 1II8B 1P62B 1ZNWA 4GFDA 4EPXA 4JZKA 4R2HA 5LB4A 2MSCB 1Z0KA 2VYFA 4I4LA 5FH9A 1W7AA 1FP7A 3BWDD 3GJ5A 3LV8A 4D4LA 1OJLA 4O2RA 4A36A 3A36A 3EC1A 1BH2A 4E03A 3U7EB 4EIWA 2GEUA 2BOVA 3MWKA 4O0MA 4Q9JA 1JR3A 5CIWA 4B3XA 1CTQA 2P0EA 1OIVA 1IN4A 2GDJA 2G1JA 3VU9B 4RFVA 3GEIA 3X1WA 4HI0E 3VHXA 4PX9A 5HE9A 1E9EA 2FSGA 5TMPA 1HTWA 4E5UA 2ORWA 3CF0A 1UFQA 4NP6A 3DKPA 2AX4A 4Q9KA 2ZJ8A 3LVRE 2XSZA 3KQHA 4QC2A 3L43A 2ZXUA 1HQYE 2JDIA 1W48A 5CLLA 1CJUC 2WJHA 4IFBA 3V4FA 4QBFA 1KAGA 2IT1A 4P4SB 1E2HA 4ESVA 3B1YA 2AWNA 2WAXA 2NTYC 5L3SB 5DNYB 5L8VA 4DDUA 2IEZA 3A1TA 4S35A 4GZLA 3OIWA 4KFTA 1U94A 1OHHA 5TB5A 4FMDB 1E9DA 2QORA 3RWMB 2QROA 4KITB 1SKYB 4HAZA 2I1QA 3OEHD 5FBRB 5CB8A 3KTAA 1KO5A 3I8XA 1T8TA 5HE8A 1NKTA 5JZVA 2IF2A 1Z07A 3KJHA 3VR2A 1F48A 1G17A 2KI5A 5G41A 2O8CA 2WJGA 2VHQA 4IVRA 5CJPA 5AJYA 3VKHA 4HB0A 1E1QA 1OV4A 1S3GA 2WOJA 1CR2A 3U3RA 1YZUA 4PFSA 2VP6A 4I1OA 4HZUA 3IKJA 1OSNA 5FUVA 2HF9A 2Z4SA 2ZR7A 5JJIA 2JIZA 4WA7A 3PEWA 2OESA 2QAGC 4V02A 2GA8A 3NKVA 2R65A 3PIRA 3GD7A 1N5LA 1DAKA 4P4UA 5L3RA 3TVDA 2IYZA 2O0KA 4CT4B 3U7FB 2IXGA 3QBTA 4FWIB 2O8BA 2DBYA 4I1VA 4DSOA 1WBDA 4BLSA 2DYKA 1OXTA 3LY5A 2GILA 4PANA 2GJ9A 1E2GA 1SULA 3DEFA 1UPTA 4AKGA 2QBYB 2OFOA 4Q00A 4BZPA 5FPSA 3NHAA 1OFTA 4ZIRB 1QHYA 4NPHA 4X8LA 1NG1A 1C4OA 1AKYA 1X8JA 2VA8A 5C1BA 2BC9A 5BWMA 3F5FA 2ATVA 4B3GA 1NN3A 3JZAA 3ZS8A 3D3QA 3RVBA 3EZ7A 4JBXA 1Z6YA 3PJRA 4H9GA 3TSZA 4AKHA 3U7HB 1NN1A 4BFWA 1W5TA 4HDQB 4BUJA 1GITA 1ANKA 1FTNA 2FFAA 2O8EA 3R9XA 1XZPA 2XJ9A 1WRBA 1KAOA 4EJSC 2BMEA 2ZQ5A 4JLVA 5KSYA 5FUYA 2W2TA 4G01B 1UBEA 3KTAB 1AGPA 4CIDA 2CMKA 1U9IA 2G77B 1ZM3A 4DKXA 3RNLA 5GJCA 3QY0A 3THXB 3QKSB 2A5DA 5J47A 2W58A 4WW0A 3K0EA 1EFRD 4PXAA 3I1FA 2A7QA 3TW4A 2XZOA 1NJFA 5HKKD 4RD2A 2ERXA 2GXAA 3VR5A 4A2QA 4YMVA 5KO2A 1X8LA 4KAXA 3X2SA 4DCNA 4CEJA 1ZP6A 4ASUA 2P3SA 4ABYA 1OXSC 3U44B 1E0SA 3R8CA 4WIAA 4B75A 2ZI5A 3IIMA 1VCNA 2Q9BA 3CNOA 5HTKA 1VECA 1TUIA 5BW8A 2QBYA 3ADBA 2WKQA 4MQBA 2JLXA 2PEYA 4EJSA 4JLOA 2WIAA 2YYZA 3U5ZB 1JQLB 4L8GA 2WWXA 5F9HA 1XTRA 3W34A 2XNDD 3ZZ0A 3THWA 1I4TD 3B13B 2NG1A 4KYUA 2JASA 1E2QA 1OB2A 1I4LD 1WCV1 1K5GA 2CE2X 1U8YA 2E9SA 2ZS7A 3OEED 5L3QB 2QGZA 2I1VB 1Q3TA 4C0JA 3Q8XB 4C2TA 1SXJA 4RFSB 3LFUA 2QP3A 2YV5A 3T5GA 3SN6A 4KSBA 3UG6A 4BFZA 1FW6A 4D4KA 3ND8A 2ZJ2A 1QHSA 4B73A 3MUFA 1Z3IX 2RCNA 4LBYA 4OHWA 3EAQA 2J5XA 3GJXC 1RRPA 5IT5A 2PZGA 1CJMA 4C30A 5FTMA 4JS0A 1TX4B 5EXSA 3AF0A 4W7SA 3WRYC 1KI8A 1J8YF 2VBCA 3MGCA 4ZDIA 1VHLA 4WAUA 3KX2A 4ZPXA 3L82B 4TWZA 4ZDKA 5F98A 3TR0A 1X8KA 2ZJOA 3TR5A 3GFPA 2HJVA 1XF9A 4FMCF 1ZYUA 3SBEA 1AZTA 2GF9A 2VL7A 1XJCA 4B71A 4PC2A 3U4QB 3AVPA 1RKBA 4M8NE 1G8YA 4TLBA 1ZMXA 3SHFA 2PZEA 4P0TA 3HR8A 3GFTA 3UWOA 4IXMA 4JVMA 5DH9A 4Z51A 3K70C 1OH8A 4G1UC 1DAIA 2JJ1A 1COWA 5DI3A 3KUDA 2CXXA 1KDRA 2W0MA 4V0MA 2GJAA 3MWJA 2J0UA 2PT5A 4KFRA 4OQFA 4UJ3A 1AN0A 1R8SA 3PENA 3EASA 1N2CE 4EJSB 4UNRA 1E9CA 3LVQE 3SYKA 2DB3A 4CGZA 3EPJA 3MJHA 4MGKR 4ARZB 2KJQA 2X77A 1F5NA 2FZLA 2XNDA 2FJUA 1AJEA 1OIWA 3Q7PA 3EC2A 4K81B 2Z5FA 5FOTA 3QEOA 4A0HA 4UNNA 2PH1A 4V0NA 1P3JA 2OO7A 3EIEA 1R5OA 2ZI6A 1G4UR 4KU4A 3SHWA 1EWRA 4C9BA 4IRUB 4OHZA 4XTCS 1XPUA 1SXJC 1VCIA 4OI2A 3CX8A 5EZ5A 2ZE8A 2O8DB 2YWEA 1OLOA 1ZJ6A 2ANBA 1BIFA 4IDHA 4JJZA 1N6NA 5JS8A 2ZSBA 2NPFA 2R6AA 1XPRA 4JSYA 3QKRA 3CNNA 4GI7A 2P2LA 4JLKA 5KU1A 1ZU5A 2GCNA 2GTPA 4TMZA 2GESA 4X8OA 3U6KA 3UMSA 2Z43A 3W5IA 4P32A 2B6HA 2EFHB 4RJLA 2C78A 3W6OA 1SVIA 2PX3A 3DM5A 1UM8A 2QPOA 3IDQA 4C0QC 5J4YA 1T5IA 2C03A 2IUTA 1G18A 4LYAA 3AP3A 2O8CB 5GJVC 3THOA 4HDCA 1W47A 3QVVA 3ECCA 1NY5A 2BJVA 5CYOA 4Z8XA 4CEHB 4HZUB 1GNQA 1E2JA 2IYLD 5DYGA 4R9UC 5KTYA 3QSYA 1QDEA 3B82A 2YC4C 3TSOA 4B6EA 3W90A 1EESA 4PC7A 2WOOA 4TYWA 4TTRA 4EPYA 3ZYCA 2A30A 5JSZA 4B3CA 1XU4A 3SDZA 3OFNA 2F9LA 3B9PA 3BGWA 3FYHA 3LLMA 2UVQA 1KI2A 3C7KA 3EARA 3QPWA 3VQTA 1P2VA 1D6JA 4IHQA 3FHTA 3PUZA 2AK3A 5AUNB 5EE9A 2G0NA 1NMXA 3L8ZA 3KKQA 3ZZUA 3BORA 1VG8A 4TSFD 1ZNXA 4FMCB 1M7BA 1HH4A 1SVMA 4XWKA 3BD9A 3R8FA 4IKEA 1NIPA 2R6DA 3A1WA 3ZVMA 4M4SA 1QHHB 1W46A 5FUXA 3RS2A 3RS5A 3TQFA 5FR2A 1SKQA 3EWAA 2HYDA 4L4UA 4CF7A 3NG1A 4ZDWA 5DI9A 2IEYA 1DAFA 3AKEA 4NCHA 2HLDA 4Q1DA 2P65A 1MO5A 1VDZA 2JEOA 3GLHA 3K8YA 1GNRA 3AF4A 4MKHA 2WHXA 4TTPA 4DIDA 2YHSA 2ZRDA 2CJWA 3NBFA 1Q12A 1NVVQ 1HURA 2OBNA 4I1UA 4UXHA 2ONKA 1XXHB 2ZTSA 2DFKB 2D7DA 2ANCA 2KB0A 1GFIA 2PCLA 2XXAA 2AR7A 1ZUIA 1EFHA 3U3KA 3OAAA 3W8RA 1JJVA 1WB9A 4TZ6A 4Z8YA 3VR6A 1A7JA 4DEXA 4S2EA 3KXLA 1F6BA 1FTSA 4QHSA 4XVRA 2VF8A 1ZW6A 5ANRB 4O25A 2L0XA 3QJYA 4QGAA 3TSWA 4DCSA 1G64A 1C1YA 3TIFA 2WTUA 2HT1A 4PZZA 4IVPA 3AKDA 3BC1A 1KOFA 5DLQC 4G5RA 2P5SA 2KSQA 2OBLA 6Q21A 2ZI4A 3SQXA 2N46A 1DTSA 4DT1A 2ZANA 1SHZA 1AS2A 1ZD9A 2XOKA 1W44A 1AZSC 3LO5A 1QHHA 1XMSA 2QTHA 5IDVA 5C46F 1G41A 4NH0A 3CPEA 4F4JA 3RANA 4JYCA 1W36D 3LBIA 2QTVB 2CHVA 3T15A 3GLGB 2IW3A 3RS7A 2CL6X 2DY1A 2Q3FA 4LJ6A 2B8TA 3L0SA 3ZLJA 1E0AA 4KSCA 2KWIA 4RY2A 1ZVQA 3T34A 4BASA 2WM9B 2QMOA 1E79D 2QT1A 4IDOA 2PBRA 4RZ3A 3X1DA 1A2BA 1E98A 1F2TB 1G8PA 2H17A 2IS4A 2OE2A 2ZR0A 3C16C 5D3MB 3I73A 2OCPA 5L3QA 1KI3A 3HJNA 3B1VA 3KKMA 3NIBA 3LDAA 3LRPA 4DLRA 5CLQA 2DFLA 4LYJA 4QG7A 3NDBB 1KJYA 4HAUA 4NTZA 1M6NA 1CU1A 2ZRGA 3WYAA 3R7WB 5EJEA 2WZQA 1W1WA 4A0RA 2ASEA 4D6PA 3NC0C 3W5JA 3VR4A 3EG5A 5C4MA 4XTRA 3F3YA 1A82A 3KQUA 1JEDA 2QPAA 2CDNA 3H2YA 1N6LA 3QKUA 5FR1A 4ACAA 1E1QD 2ZAMA 3UG7A 1DADA 3BE4A 1S3SA 4ZV4A 3FKSA 4PC3A 1YE8A 2G6BA 5E7IA 3B1WA 1NVUQ 4G5OA 1CLUA 4GT1A 3CRRA 1GKUB 3I8SA 5IHPA 5F2EA 3A1SA 4ZDJA 1VYTA 2DPXA 4IDPA 2N1BA 2DFTA 2H7VA 1E94E 1OYWA 1G3RA 2QAGB 5HR5A 5IRCD 4CEJB 2CLSA 3W6NA 2GEDA 1R5BA 1GRRA 1E9RA 2RHMA 3TE6A 4A8JA 1Z47A 1GL6A 1R5NA 5JRJA 1KI6A 2YOHA 2IS2A 3RS0A 3DPUA 2WSMA 2AHOA 4D82A 3SBDA 2GBLC 1I4DD 3ZVLA 5C18A 2FDCA 2R6FA 1Z29A 4GPTA 1E32A 1P4SA 3KB2A 5DISB 3CX7A 2QRNA 1HV8A 1DG3A 1WA5A 1SVOA 3KB1A 1T3HA 4MRVA 3UMFA 4QM7A 2A3RA 2CE7A 5FOXA 3AGPA 4ZKDA 2Q9AA 2Q3MA 3K9LA 1CR4A 1OW3B 4TZ0A 4ZI3A 2VO1A 3AGQA 4RFSA 1Q57A 1PUJA 2CCGA 2ZRBA 3DHWC 3AVYA 5BQ5A 2XZPA 5EE5B 1ZAKA 4FCWA 4MYTA 2O8DA 4B48A 1Z0FA 2BCGY 3CUEF 1V43A 5GVSA 3QKTA 1L4YA 4ILEA 4W5HA 5KNCA 4DDWA 2ZRAA 5TVKA 3WMGA 3C8UA 2F55A 2D3WA 1NBMD 1CBUA 3K1JA 5JECA 1R6BX 2GXQA 4D26A 1TF7A 3BIFA 2AL7A 2R2AA 4TLAA 2HXYA 3AV0B 3F8TA 1DS6A 2J59A 4PQFA 2I4IA 1GKIA 4HUQA 2IYQA 1UKEA 5EXXA 3KKNA 2MMCA 4GNKA 4ZO4A 3BK7A 1K5DA 2WV9A 1L8QA 3VKWA 1G7RA 3EZ6A 2YZ2A 4YMSA 5C2JB 3K09C 4JLNA 1KI6B 4PAMA 1G8HA 1Q1BA 4TQAA 5LDDC 2P6UA 2EW1A 1N5JA 1A2KC 3NDPA 4C7OA 3AM1A 1XX6A 1YR6A 3TGPA 4D0NA 3QI2A 2OILA 2ZROA 1D5CA 1XRJA 3B60A 1GAJA 1E2FA 4DIEA 4U7DA 2ODEA 1WXQA 1Z0DA 2I3BA 5IK2A 4W5WA 2C95A 1D2NA 4ARZA 4DCUA 2IF0A 4LI0A 4LHVA 4MYCA 2BIFA 2DHRA 5HZHA 3GJ6A 4B33A 2V3CC 4Q4HB 1RVDA 3KUCA 1UBGA 1VYUA 2ZRKA 621PA 4LHWA 4RCYA 3TNFA 3EZ2A 1H8HA 3PUXA 2R44A 2F1JA 4XSHA 3QE0A 4FIDA 4XH9B 3VR3A 1JAIA 4QNMA 2VP2A 2JJ2A 4OHYA 2J87A 1Z22A 1XXHA 3W6PA 4YMTA 1LY1A 4IDNA 3MRSA 1N0VC 3K0AB 1LV7A 1UKYA 2XXAB 1F2UB 1FMJA 3WYGA 2AKAB 4LPKA 3K0CA 3H4MA 3U2QA 3GLHB 2O52A 4A6XA 1Z08A 3F0TA 2G83A 2D7CA 2H8KA 5SZJA 2Z0MA 4NHOA 1HYQA 1QG2A 2QM8A 1CS4C 4GP6A 2C9CA 3E70C 4HZIA 2IWRA 1Z5ZA 4LOAA 1BKDR 2BBWA 3AF2A 3QQ5A 2F7SA 2ZE6A 3T1OA 1TQDA 4XVQA 4R2IA 3K09A 3GPLA 1T6NA 5DHFA 1G19A 3IHWA 3GJ0A 4EUNA 1EX7A 2DR3A 2WSSD 1YR9A 1PUIA 1P73A 2W6JD 3BFXA 2JA1A 4JT4A 2W00A 4DDTA 2X2FA 4BFTA 1KMQA 4W5JA 4WVFA 4KJZA 2PJZA 4YXWA 4Q1AA 1N0WA 4IW3B 1XFAA 4QKQA 3WRXC 1OIXA 3TAHA 2WKRA 2PCJA 3PXGA 4C2UA 2QEQA 2Q0HA 5KDLA 3SS8A 1HE8B 3EZ9A 1PV4A 3LW7A 5BYKA 2ZI7A 3QF4B 4POAA 1NVWQ 3O47A 3AP1A 4M9SA 3REGA 2BCJQ 1OYYA 5H8WA 3LNCA 2RB4A 2OLJA 4CEIB 1A5TA 2C9OA 4RD3A 1LVGA 4RZUA 2R6GA 2IUUA 1BYIA 1DPFA 1AK2A 1Q21A 4BEBA 3CONA 4TLDA 2FNAA 3GJ8A 4Q9IA 2R9VA 1UADA 2OXRA 5FL7A 4BLOA 3SJZA 1ELOA 2BVNA 3UANA 1T0JB 121PA 1OE0A 3CWZA 2WWWA 1DBSA 1SVLA 4JL5A 4DXAA 1S1CA 4JLDA 3VX3A 4LBZA 2V1UA 1JALA 3QUSA 3C5HA 2V8OA 3SJCA 4FXPA 4LJYA 3K0FA 1G6OA 2JAQA 3I62A 5EZ6B 5K8TA 2JLVA 2V6JA 2VIIA 3TUZC 4CYMA 1U0LA 5SZIA 3EA0A 4EFNA 1QRAA 2KBEA 4PPGA 1G291 4M22A 2ZITA 1MOZA 5TDHA 4GRAA 2QAGA 1IXSB 4NMMA 2J7PA 4PO1A 4OL0A 2IHYA 2VEDA 3LH5A 3HR7A 3TQCA 3L0PA 4GZMA 421PA 2EWWA 2ZYWX 2EVWX 2W6JA 3CH5A 3GJ7A 4Q7JB 2P6NA 3QENA 1K6MA 1Q0UA 2XB4A 3VNUA 4MUAA 3REFA 4DSUA 2WICA 4AYWA 1DAEA 4FMDF 4JLBA 4RD0A 3KKPA 1IBRA 4B44A 1A1VA 3FHCB 1KO8A 4C3ZA 2IX3A 2V1XA 5DSZA 2MSDB 2ZSAA 2VP4A 2PZFA 4ZCMA 4Q47A 4A8JC 4AURA 4ZCLA 3GLFE 3ZQ6A 3Q9LA 1NLYA 3CPJB 4HEJA 3EIQA 2DWQA 4DCTA 1YR7A 2XTMA 2FFQA 2ZRNA 1HQCA 1E0JA 3Q5DA 4RCZA 3K9GA 4UNQA 4AKEA 1R10A 3QOFA 1CEEA 4JKYA 1VHTA 2HJGA 5B2ZA 2QE7D 3CM0A 5KYKA 2J0QA 2PT7A 2KE5A 1KGDA 1GP2A 1US8B 1D9ZA 1Z28A 1XMJA 3IQWA 2FF7A 3S1AB 3K0FB 1ETUA 3SYNA 3KQLA 2JJ2D 2WJJA 4LJAA 2BEKA 5TY0A 2XSZD 1EK0A 3PR1A 2BM1A 4QHTA 2RGDA 2VF7A 3A4LA 1R4AA 1P60A 1ZUHA 3V9PA 1JXMA 1MH1A 2BKUA 2OM2A 2JGNA 3A6PC 5F3WB 4LV6A 1J7KA 4DHEA 2ZVPX 2E1RA 1G8GA 4JT2A 4Q02A 3T1QA 3U44A 5GVRA 3WYFA 8OHMA 2ODWA 3CWQA 3B7GA 1AS0A 5DN6D 1G9XA 5IK2D 1JR3D 2REXB 3RRNA 2ZSFA 2EWVA 1S1MA 2A2ZA 2GZDA 4URVR 1RW4A 2D62A 3GLIE 4W9MC 3THWB 3MD0A 2HV8A 2NO0A 3PVSA 5JI2E 1GRQA 1G7CA 2GZHA 2IYXA 2H18A 1R0YA 3I32A 2FPMA 3K9HA 4LHXA 1CRPA 2ODNA 1OH7A 4MYUA 4IVQA 4JJKA 5F9FA 2P67A 4B35A 4EKDA 1G5PA 4PPNA 1KTVA 3GEHA 3CNLA 5B58C 3MG9A 3HYRA 4C7OB 1KDOA 3EA5A 2ZUDA 3B2EA 4FINA 1M1YE 4YQFA 1ZRHA 2C98A 4OI0A 3D31A 4ASUD 1XD2A 4N1AA 4HB2A 3SQWA 2ZJBA 2NO7A 4EFLA 1IOZA 1NBMA 5KSZA 3KQNA 4KFUA 3WNCA 1LW7A 2R62A 3OIUA 1CP2A 1T4GA 1XTSA 2AD1A 1KY2A 1X1RA 2AD5A 1KDPA 4WZBE 3QXJA 2B21A 4HUTA 5FOUA 3RWOA 1DVRA 2D06A 1NJGA 1NY6A 3I61A 2REOA 1W0KD 5SZKB 3X1ZA 2IC5A 1KYIA 5AJWA 1W4CA 1MABB 4B74A 2Q21A 4YMUA 3SOPA 1TL7C 2FOLA 3WNBA 3KJIA 1LS1A 1XDBA 1G8FA 4Q1EA 4URUR 5E3HA 4C0KA 1QG4A 2BMDA 3CH4B 3LQQA 2D2FA 3IIJA 4P4SA 3AEZA 4PSAA 4YONB 5JMTA 1J70A 5FOSA 3SR0A 4BLTA 221PA 2LWIA 1T3LA 2ORVA 4Q4AB 5EP2A 2CHQA 4IEEA 1VMAA 2GETA 5AJXA 4QBHA 4DLTA 4DC9A 1XTIA 2ATXA 2FV8A 2PMKA 2RAPA 4V0ME 3QXXA 2C77A 1E9SA 1E4YA 2FZ4A 1XJ0A 2ODBA 3LBHA 3P20A 4M1OA 4LV5B 1XXHE 1RYFA 3OHMA 1FZQA 2VQSA 3GLGE 2ZSDA 3LAWA 1YKSA 3U61B 4NONA 3RC8A 2NO1A 4TYYA 4NL4H 1TAGA 1CJTC 1IJFA 3E2IA 1VCMA 1RIFA 3W9YA 5J4HA 2ZJZA 1EFCA 2OSBA 2OHFA 2XB2A 1OKKD 2B92A 2QY9A 3FGNA 2IL1A 2X2EA 3QF4A 4B3FX 5K8UA 2JIZD 4H1UA 5JI3E 2G0TA 5J5CA 4M2LA 3FKQA 3A4NA 1YRAA 2JLYA 2W6ID 3LX5A 3IHLA 4Q5IA 4TTQA 4TSFA 2FEOA 1E4VA 1OFUX 1ZUNB 3GFOA 1MABA 3ND9A 4OHXA 5LB2A 1U8ZA 4IOMA 4RKEA 4KLZA 2OV2A 1E2DA 1W5SA 1D9XA 3ZJYA 1SXJE 2C96A 4YDSA 2BDTA 1LFDB 1KO4A 4Q9HA 3T5DA 5JCPA 2B7BA 1P2SA 2WMNB 3DKVA 1YVDA 4LCBA 3QNUA 1Q44A 3IO3A 2O0HA 4PZLA 5FPTA 1VG1A 1XB2A 1KK2A 1HY3A 4A9AA 2BBTA 2OZEA 3A1UA 2ZS8A 3CLVA 5C4GB 1GNPA 5HCNA 5FBVB 2XTNA 4V0OA 4AIIA 4BLRA 1QVAA 4L9SA 4TYPA 1QZXA 4LJ5A 1KI9A 1JXOA 4Q4JB 4CDGA 1NSTA 4BWYA 3IQXA 3FMPB 4B3BA 5KSPA 5B64A 2TMKA 4GOXA 4BFVA 4DLYA 1UKVY 3NEJA 3QKSA 1UKZA 4WXRA 4JLJA 2GEVA 2GRJA 1LS6A 1JECA 4PO8A 5EXPA 2F43B 4AY2A 1NKSA 1RRCA 4O3MA 1GTVA 4MITA 2RKOA 2GK6A 4M9ZA 4NCIA 3DOFA 3FB4A 4KLNA 4P33A 1GL7A 1E1RA 1U8AA 5FPHA 5JRZA 1LF5A 5K8LA 3VKGA 1G1MA 3IILA 3I3SR 2ZPTX 4N0DA 2G88A 2ZSEA 4OI1A 3MMPA 5FBLB 3TH5A 1YZKA 1XTJA 4PSKA 4QJ4A 1D8TA 1Q20A 3IEVA 1P5ZB 1XTKA 4GMDA 2IYWA 4OQXA 1XJQA 3NEYA 5EE1A 5J4KA 2EYUA 2HEIA 1YU9A 4BFXA 4XWOA 2FA9A 1GZSA 3LQRA 1IN8A 3BXZA 1XMVA 1NRJB 1YZLA 1N5IA 2GF0A 4OQMA 3TW8B 3CRVA 2ZUBA 4C0LA 2G1KA 1US8A 3RYTC 3S1AA 5BN4A 2A5GA 3HU2A 1TF5A 4JYBA 1TUEA 4M1YA 3WP0A 1MO6A 1P9NA 1IN7A 2FGJA 1CXZA 3AVTA 1GDDA 2QP4A 4UXJA 2QAJA 4MDFA 2VP5A 4II7A 1DE0A 4Q4JA 3BH7A 4L16A 1OFHA 2NPIA 4PAQA 1R2QA 2XZLA 3AKYA 4E07A 2ZREA 2VLIA 3D6TB 5GADl 2DWOA 1JPJA 2BKEA 4NE2A 4QXAA 3EIHA 4OKSA 4JL6A 5GJBA 2C2HA 4EPVA 3UIEA 3DZDA 4NCNA 4CRWB 1HT1E 2AXPA 1D2MA 2GAAA 2V54A 1JR6A 1NMYA 2BJWA 2CNWA 3BS4A 3DMDA 3ZD7A 1V5WA 5A5GA 1ZM9A 2G9NA 2ZYTX 4DB4A 1FP6A 2J41A 1YZTA 1BS1A 3CRQA 3CZPA 4B6FA 2VHJA 1G4AE 3C4JA 1OXXK 3BOSA 4JVNA 4GP7A 4JSTA 2QE7A 1ZU4A 4FCVA 1TNDA 3OFND 3WMEA 4UQOA 4NYIQ 3GP8A 5FBWB 3EPLA 2QUZA 2YJTD 3I92A 4HAWA 4KI0A 3ZZTA 1FX0A 1TU4A 4QRHA 1BMFD 1UJ2A 4LYFA 3QPUA 3Q72A 4MRPA 4US1R 4RZXA 2IHBA 3GLIA 3H0KA 3KXIA 2NZ8A 1E2KA 2PLFA 1E2EA 2VHTA 3CW2A 1N3BA 3KZ1E 4GOKA 4OHVA 4QBIA 3WP1B 2CLCX 3QXCA 4PHFA 4GDFA 2XEXA 2J0VA 5FPYA 2QZ4A 2GXUA 4YDHB 1NSFA 2OAP1 5FFMA 4OJKA 2V7QA 1Z2AA 2PJRA 4P4TA 4HYYA 1M7GA 1P72A 4Z1MA 2W83A 1T8UA 3HU1A 3FTQA 3IO5A 3KJGA 4URYR 3RSLA 3FOZA 4MYHA 4FN5A 4JIMA 3GJ4A 4XIGS 3PEUA 3TUJC 5FTKA 4LPSA 4AYTA 1DAGA 1TPZA 1W0KA 3KQKA 2J7PD 2D2EA 1YZNA 4LX0A 3TLXA 1DARA 4NDZA 5JFGA 1U90A 1G5TA 2VPPA 3OF5A 1GILA 2RGAA 2B8WA 3QPVA 1KSHA 4I81A 1TQ6A 2CEAA 3N5CA 1Z6AA 2V55B 4TL7A 2CBZA 5J40A 3TMKA 1K8RA 2X8AA 5M04A 1S4QA 5LD2C 2AFIE 1ZNZA 4NZYA 2R6CA 1KNQA 2ZRFA 3ZDQA 4HATA 3VFDA 4B3DA 4BLPA 4V03A 5FBQB 5KDDA 5EUMA 1OXUA 2FMXA 4AD8A 3SJAA 5E95A 4GSYA 4J0QA 2FGKA 1FUKA 4Q4AA 5KOYA 3UWKA 4DUGA 721PA 3GLHE 3KFVA 1G3IA 4LY6A 4EPRA 3EPKA 2NGRA 2BEJA 3GEEA 3U3OA 4CW7A 2IYVA 4AYXA 1PLJA 5CK5A 4URXR 3AVUA 1ZNYA 3PUWA 1MT0A 3RABA 2YWFA 3DZ8A 4HLCA 5DGXA 4OYHA 1Z6TA 4DLZA 3PV0A 5FPKA 2GVDC 1KZ7B 4JVSB 1PJRA 1EG7A 1UBCA 3AH8A 1NLFA 2ZR9A 3G0HA 3NH9A 2UKDA 5JSZB 4FWTA 3I72A 5E7MA 2AK2A 3N2IA 3A8TA 4MGYR 4JLMA 3DVLA 4Q66C 3SZRA 2F6RA 2HDNB 3TKLA 4F4IA 3NH6A 3K70B 2OLKA 4PQYA 3BFVA 3ADCA 3WBJA 1XZQA 3LLUA 4LJ7A 3SEAA 4BQSA 2LKCA 2WJYA 2WSSA 1TQ2A 3UATA 3FMIA 2JLUA 2ZEJA 4E22A 4AC9A 1IN6A 4DCVA 2ERYA 1N6IA 1KK0A 2WPDA 2CJWB 2YKGA 1VG9B 3AKCA 1AQYA 4P3YA 1Q1ZA 4WZ6A 4B34A 1YRBA 2QRZA 1QHGA 1S9DA 2EFDB 1ODFA 1PLLA 4G5SA 1NF3A 1RZ3A 2O0JA 1AA9A 3FMFA 4KXFB 4QFMA 1SVKA 3LXRA 2IYRA 1VYVA 3FMOB 4BRUA 1AS3A 4PC1A 4EQ6A 1XCMA 3U7GA 3T1VA 2R8RA 4IOLA 1FOEB 1FUUA 1SVSA 2RGNC 1N6OA 3HWSA 2CLDX 2H57A 2WJVA 4D0GA 4M9XA 2DFNA 1S2MA 3VR1A 1FQJA 4NBSA 2XGJA 2ZRCA 1E3MA 4G5QA 3MJRA 4XVUA 3Q7QA 1KY3A 1GL9B 4QNRA 1E9BA 1TQ4A 3AUYA 4MRRA 4AG6A 3V00A 4AK9A 4M1SA 4BECA 4ZIRA 3K53A 5HKKA 4CZ2A 4HLUC 3RAPR 2AWOA 5DO9A 1DEKA 1JBKA 4PHTA 1EFUA 5CK4A 1IXRC 1JI0A 3LWNA 4JBYA 1CRQA 1EWQA 4HAXA 4C0AC 4K8OA 1TEVA 4NYMR 2IBMA 1XEWX 4Q21A 1EFTA 1AQUA 3AQ4A 1XMIA 4QBGB 1M8PA 1ZIOA 4MDEA 1M74A 1G3QA 3GQBA 3CPHA 2EFEB 1YR8A 4RVCA 1S0UA 4UNSA 4A0GA 2QL6A 4F4CA 1KMHB 2NQ2C 3P27A 4GMXA 1UF9A 3IUYA 2OFWA 4DSTA 3O8RA 2VH5R 3B5JA 2FFHA 1U0JA 2FE4A 4NKRA 1DO0A 2FSFA 1RE0A 5D3MA 3R20A
chains in the Genus database with same CATH superfamily
3A6FA 3ZHBA 3IX7A 2ZJ5A 1V6SA 1B8NA 2LBPA 3S2IA 4OYYA 4YT5A 3PXCX 4ZYYA 3E3OA 3ONEA 4RESA 4YRSA 1C7ZA 3NV9A 4HLDA 5K20A 4XM1A 2XUZA 2I4NA 4D0LB 4DLXA 2EJCA 4F5WA 1A4RA 1QH8A 1ZBQA 3N8HA 2NT4A 5DNDA 3SNHA 1RXUA 1UR5A 4LG1A 5F7ZA 2RIPA 3R1IA 2D2VA 4Y2HA 3PYXA 5DX8A 3U62A 4YCCA 4FFMA 5JXWA 1BWSA 4GBMA 5ILQA 3F7TA 2A4MA 5AUOB 2WIBA 5LUBA 2JFHA 1R74A 2IYFA 5FIUA 1TRHA 5DYNA 4JLAA 3TIIA 3PFCA 2HPAA 1T5LA 1LEHA 5B7QA 3MWLA 3URMA 1GUYA 4L3WA 4WKOA 3UV6A 1E5LA 1E66A 2GXSA 2ZSJA 3ES9A 2BGUA 3D8SA 5B1DA 3ZDYB 1G20E 3E22A 2EFGA 3TOVA 3DZGA 4OHMA 4BO3A 2I76A 3I64A 2BBOA 2KM1A 1DI0A 2OY0A 5EP3A 2VUUA 4IVNA 4WLOA 3VBEA 5SY4A 3IE1A 1UEIA 4DLSA 1FVOA 4IFIA 4HYTA 4AKIA 4EFMA 3V3KA 3H4TA 1PJ8A 4WV3A 1L7NA 3P4XA 2KPOA 3QUQA 4QDUA 1YZFA 5DX0A 1FU8A 1NW4A 1L3CA 1LXCA 1UINA 1WP9A 2I0FA 3FYUB 3H8JA 1RXEA 1W9HA 3PI7A 4NEGA 5ELXA 2IOYA 2GK7A 2GCGA 4XASA 4RK0A 5A6SA 3PZBA 3UXYA 1Z5NA 2P2DA 4B8WA 4JHXA 1BYUA 3IUJA 4M9QA 2QNRA 2QV0A 2XEDA 3V2UA 1E7RA 1PK9A 2ODPA 1RI3A 3PQ2A 3KQKA 1TZCA 1ZIPA 1I7QB 3NJRA 1FUYB 5GZ1A 1KZ1A 4TLLB 1WMFA 4RK6A 1IBKB 2HMSA 3I0ZA 5IT4A 4DR6B 4LGMA 1TPYA 5DWDA 5K2MA 1OLXB 2J5BA 4QQFA 3T4XA 4G65A 3DD5A 1ZSNA 1V8BA 1U3TA 3STHA 2CBXA 4ZJUA 2P77A 2H85A 3IAM6 1VJDA 4JUIA 4Z0HO 1XEXB 4QOSA 4JP2A 3B1ZA 1HO3A 4XD7A 1AK9A 3LDFA 5FOVA 2DJ5A 3M6AA 1GYRA 1TM5E 1M1UA 1W1IA 1WVGA 2OQVA 5B3LA 5IXJA 2MIIA 2YY6A 4I36A 1WR8A 2JHFA 3PNQA 5GINE 3JQ8B 1K0UA 3M89A 4QICA 1YB2A 1IJBA 1L5RA 4K6OA 5FBHA 2ZAGA 4QDJA 1F4VA 4BZQA 3BGSA 4D2IA 3V1TC 1ZR2A 1AKWA 4N7MA 1PLKA 4YJHA 3PFKA 2Y4OA 4PCLA 1P61B 4Q1BA 4LXGA 1U5BA 1UKCA 1KI7A 1XQWA 2Q3HA 2EQBA 5EE0A 3ZV4A 1CX9B 2MJLA 5AXBA 4DC0A 4OJYA 1I9GA 2RGCA 4TMXA 4BAGA 2QQFA 4P98A 2VBFA 5TMDA 3U3JA 4KZPA 3KT6A 4B2IA 3TZKA 3TTSA 5DI3B 1P9WA 5BMVF 1RLUA 2JCSA 3CUSA 3G0IA 4L1KA 1DEXA 4HUJA 1NRXA 2J0UB 5HMLA 1AMUA 2ABWA 3ADDA 2YZMA 2B1GA 1YZGA 2MT9A 2P79A 2PKXA 3U60B 1AHIA 3BIJA 2PPVA 3HJRA 4RQTA 1XD2B 1KJWA 3JQEA 3UTCA 4B3IA 4H15A 5B5SA 1UBMS 1EM8B 1QFJA 2QM7A 3N8IA 1E6CA 1RRGA 2P2YA 1EQAA 4CCSA 2I4OA 2Y77A 2ZAOA 3M1IA 5DCLA 3NWJA 5IU6A 3ITKA 2F4NA 3KDPA 2GZAA 3F96A 3HVHA 1Q3HA 1PW7A 1YACA 4XUEA 2JF0A 4L3VA 4LSGA 1KZHA 4YRZA 2JHAA 3IOEA 3OTOB 1M8FA 1XR3A 2RHWA 2ZUWA 4JMPA 4TGLA 1B4DA 2LCFA 4N5NA 1T6ZA 3DVRX 1V25A 1L5OA 3PNYA 1T0HB 4K9MA 2IXFA 4KXYA 4PCVA 5FL3A 2BH2A 1J0CA 3SDSA 3OUTA 2GVZC 4H0CA 2DCUA 4P0PB 4MI9A 4QHYA 2X1VA 1SZDA 2BFDA 2ZIUB 3LT1A 3P96A 4LX8A 5DK6A 5LA6A 3CX6A 3HCBA 5REQA 1Z88A 2BPOA 3R74A 3EX7C 4D9NA 2A5FA 4N01A 3PCRB 3E81A 2BKAA 1XZ8A 2M32A 3F6EX 3JR3A 3MB8A 3UJ9A 1UDCA 2MYUA 5AVOA 1B1CA 3FFAA 4OAQA 3LCJA 4URWR 5M7EA 1XU7A 4TYQA 2ECKA 5FA8A 2REQB 4HTFB 1OCEA 1X1EA 5FJIA 4EHKA 2HXSA 4XPIA 1JQBA 4ARAA 1E3SA 4W5OA 4LNUA 2O7RA 1X1CA 3QYFA 4XIYA 2AH5A 4KGXA 3P5BA 1EHIA 4PLGA 4Z4CA 2CHGA 4HAYA 4KQ2A 4X8HA 2XNCA 5G0UA 4B2LA 5BR1A 2VQFB 2VF4X 4Q4LA 1M33A 1SQ6A 4TROA 3EF3A 2J08A 2Z2JA 3AIKA 3EBPA 5EIBD 5CFPA 2ZTLA 2VLBA 3AF1A 5EPEA 3TPZA 4MW4A 3U3DA 2PRIA 4KHZA 5E8JA 1GZ3A 1NR5A 3EZGA 4JVLA 1XQXA 3BAFA 1KP9A 1NONA 3T12A 4BWGA 3VNVA 4KUEA 2XCTB 3N76A 3B3JA 1N6RA 1RPNA 1GA4A 4HPJB 4L28A 2FN8A 1EXMA 4EW6A 3ZHXA 3AJDA 3OZXA 4BDSA 2CSUA 5DT2A 4QGGA 2NYAA 1FP1D 1MC4A 1VJ0A 2WWIA 1Q11A 3EGOA 3PXBA 5HX7A 1RKQA 2O3RA 1ZNQO 5NLLA 2IXEA 4Z0PA 1B00A 3BULA 1UP6A 2OVFA 4B32A 1W19A 5ES3A 2RAVA 5I9SA 4Z2AA 1J1IA 4C4ZA 4CR6A 4RTKA 1BN6A 1SH7A 1GU1A 3OVMA 1ISIA 2NUAB 4P82A 2Z6AA 1BHQ1 4UTNA 3LCMA 3UXEA 2I6UA 3PJEA 5C7LO 2W11A 1JEOA 1FTWA 3DLBA 3IAS6 4ECEA 3ICEA 1R6XA 1AZLA 3NC1C 4MKGA 4TZTA 1OD6A 4TWRA 5JWOA 5DNEA 1AUOA 3LD9A 2C88A 1J5EB 4N5IX 3EZFA 2FRDA 5H70A 4RTPA 4DN6A 3F98A 3ORSA 3PE3A 2HWYA 3NAQA 1JR3E 3UWPA 2J9ZB 5AVXA 5IDWA 1ZD8A 4KQKA 1L7BA 5JAUA 1E18A 5CD1A 3E5HA 5TQ2B 5BSWA 3PLNA 4CM6A 2YJZA 3O75A 4PWYA 1E79A 1Y7PA 2QI9C 2ZWAA 1T2EA 2XA2A 1X3LA 2AQKA 3JY6A 1W5EA 3OJOA 4L8YA 2XKJE 2BGGA 4G89A 1ZUD1 5IARA 4KNYA 3WV4A 1U0SY 1KZGB 1Q0RA 3QW4B 1QH1A 1TIKA 2IYEA 3EBLA 4GOJA 3AM4A 1N0HA 3GFGA 2O8EB 4DJTA 3STUA 1ESEA 3ETLA 4CQJA 2DP4E 3VVMA 2XOKD 1PVOA 3REOA 4AJHA 2YJNA 2W0SA 3LXMA 2JCGA 3A9TA 2P91A 4MMXB 3HKEA 5K7SA 1NVDA 4PNZA 5BN1A 2W22A 1QH8B 3T3GA 3MIIA 1W2HA 3IA2A 2NO6A 4A15A 3CJQA 2A3NA 2XHZA 1SCJA 3JD3A 3FPHA 1N6HA 3L46A 3OPXA 4L0CA 4MW2A 1KQOA 2VTVA 1UC9A 2GBIA 2I78A 1N0IA 4MUMA 2ONCA 4N3BA 2AMVA 3NMUF 4B4KA 2F3RA 1OLUB 4EY8A 2N42A 1JAHA 2P9BA 2QZPA 3ILVA 5T4HA 3V7NA 1FIUA 1Z4LA 4MLZA 5AHRA 3CURA 2FJ0A 4L2IB 2ZCVA 4PLZA 2PMDA 1R8YA 4QYIA 1XNGA 3OOEA 1DKRA 4F56A 4YV1A 1Q0TA 3AQIA 4U2CA 4WNYA 2WT9A 2Q8NA 2J3JA 3L8EA 3FWHA 3MUNA 3PR3A 3QNWA 1R8QA 4AI6A 2XNSA 1Y9EA 2WHQA 2GBLA 3AZQA 3D8UA 4H77A 5D85A 4BVAA 5AW0A 1LSUA 4GE3A 4D8XA 2BFPA 1D4OA 3OX3A 1G6HA 4Q3OA 3A6DA 3DOEA 3MCZA 2FEAA 2XUOA 4ZHQA 3INGA 4QDKA 5AW5A 3B36A 3FHOA 5JWRA 4TXHA 2JGJA 3N2YA 1F8FA 1SUSA 2I3GA 4R71A 1G8JA 1R4ZA 3E3NA 3CSSA 5FO1A 2HLDD 3P9CA 4HPWA 4M0MA 4RVGA 3RM3A 2QR5A 3UNXA 4CKWB 5M2QA 5A0TA 4C4SA 3QVXA 5I7WA 1VTKA 3C3DA 2EIXA 5BVHA 4P31A 4RHCA 2WAMA 3EXHA 1Y6FA 3M7IA 1R4MB 5D5PA 3NAMA 5J4LA 2AYXA 4MKXA 2CN1A 3L0BA 2CVFA 2CL7X 3IAFA 4QU5A 4DILA 5KPJA 1QIIA 3FCEA 1ZXBA 3N0TA 2GJ8A 4Y2GA 2WHYA 1DC5A 1EE1A 4ENQA 5CBKA 3FWYA 1OBCA 3W78A 1FYWA 1BW9B 5JC1A 5LP6C 1WQ1R 4FC7A 1HL7A 3W1WA 3RAGA 3OQMA 1FFEA 2GZMA 3FA2A 5IVDA 1OXVA 3DR5A 3PEFA 5E4FA 4N5MA 3SFVA 3O3NB 3VBCA 5ITZB 1R7RA 1W0JD 4MPPA 1OXMA 4F5EA 4FGLA 5U9CA 1DCMA 1IZYA 3S1SA 1K7EB 4HDOB 3AR7A 1U0FA 4R98A 1AB6A 3ZWDA 1E1KA 4R6WA 2ISQA 3UJDA 3WL7A 3M1YA 2GKSA 1KVRA 1RLTA 4PZ0A 1ADGA 1Y48E 3AF5A 3WNDA 3Q3JB 2H31A 1DIGA 3V9AA 1C4KA 5EWLA 3GG9A 3CGGA 3WIOA 4D9IA 1NI3A 5FHQA 4EYEA 2B34A 5LBIA 3DT8A 3OEEA 4I3GA 4I5IA 5DU2A 1PN3A 2WD9A 2V7BA 3DWIA 1L0BA 4MR8B 1VPLA 3DF9A 3BE5A 4PG6A 4QJIA 1RI4A 4OXIA 4MH0R 2IDMA 4NS4A 5JJKA 1BDJA 1A9XB 2GJ4A 2C4UA 5HHTA 2WDPA 4IZ6A 3S2GA 3NALA 4Q7KA 4PAOA 2CK3A 4JEUA 4YPOA 5LP6A 3WQBA 2A14A 3D8BA 3PTZA 5HSGA 3VPFA 2CLMB 5ESDA 3GB9A 5AJVB 1N1DA 4M0DA 3UXMA 5AK3A 4ETMA 3O93A 1WBBA 4DM7A 3F4KA 1TU3A 3FPEA 2NUBA 1J99A 1R0ZA 2Y93A 4E30A 4TVKA 2C04A 3OA2A 4BNUA 3RJMA 3SM9A 2XDWA 5H3CA 3LXXA 3RPEA 2HHAA 2D1FA 3O8LA 1WUTA 4OHCA 4QGHA 2F2TA 2P9ZA 4UTPA 3DL7A 3HPRA 4H7EA 3LW8A 4ZU6X 1L4BA 2QR3A 1GG8A 1JLLA 1L7VC 3PEEA 1KJZA 4GHWA 3RSZA 4AWXA 4BFSA 4BNGA 4ZT7A 3HADA 3KSAC 3I5XA 5JS7A 3BMOB 2GASA 3B2NA 4ITVA 3D8HA 1ORIA 2P9HA 1ZL2A 3AVQA 3EQZA 2A5YB 2VPWA 2TMGA 2YC2C 3S27A 3M34A 2F1IA 1PWXA 3DUWA 1EBFA 2UYOA 1GOTA 1QTIA 5LQSA 1E5VA 3TZBA 3TJZA 2P5TB 2VHZA 3PUKA 2YWHA 3DG9A 2HF8A 4S1VA 5IF9A 4TRJA 3SFZA 1R4NB 5ALMA 5DTMA 3L0OA 5A0FA 2XT9A 5B6JA 5B30A 5K3EA 3I1IA 2QN6A 1C1DB 1F3OA 2W2OA 3NGLA 4QL3A 2HSZA 2QB5A 2W2PA 2O8FA 4M0KA 3ZD8A 2H4WA 1XD8A 5ALGA 4JC0A 3WSWA 1FL9A 3H18A 3RT9A 2F1KA 4ON9A 4DA7A 1RLIA 2X13A 1P7CA 5JYEA 4PX2A 4Y6LA 1JXQA 5KSOA 3QVSA 4PHGA 3VYRB 3OT1A 5T8KC 5DN6A 3CB2A 1N5KA 1J6UA 2WMOB 2Y6UA 4NV0A 4RM2A 4ALJA 1X3SA 5B1SA 1T5DX 3JALA 2R5FA 1E6WA 4WH0A 3NUZA 4C4YA 1NMZA 4JJ8A 3QSGA 5FI1B 3OZRA 4KYIB 2OHGA 4DQUA 1EDZA 3ZE6A 5LKAA 3IBGA 1SC4A 5BQXA 4DBLC 4PC6A 1W0JA 2PGDA 4NMXB 2Z5GA 1O94A 4Q4HA 1JYFA 2GZRA 2QA5A 4BX3A 1DEAA 4JQYA 1DHRA 4PG8A 2VDRB 3OQOA 1RCTE 1MBZA 4YXWD 4JD5A 3D3JA 1JILA 3BXPA 2RGUA 3WMFA 1N1MA 1IY8A 2VYVA 1RNLA 3K0KA 3M9XA 4QJ5A 2VTKA 4DT1B 2ZQYA 4I99A 4NE9A 4IL5A 5C7YA 2BSQA 4RY9A 2DPYA 3G5LA 3QBVA 4AG3A 2FK7A 1OBOA 4H2DA 4HWSA 4DMLA 2F3SA 3H87A 1NLZA 1BVYF 4IXNA 4K46A 1MJNA 2O5VA 2IYSA 1CUYA 4YMWA 4BJ6A 3NBZC 1IBLB 4EF4A 4DQDA 1HUQA 2NW6A 1SRQA 3RVQA 2HK7A 3C0KA 4HF7A 5LN1A 2NU9A 4CMIA 1KK3A 1F2UA 1Z63A 1GPLA 4L5CA 4DJEC 3IBYA 2EERA 3TGLA 3RYHA 3O5AA 2EKQA 4TLEA 1R66A 1S8FA 2RGGA 3KTOA 1OHHD 3L3BA 2J6BA 2QJFA 4V3CA 3R75A 5CXUA 3QFTA 1U0NA 2GN9A 1SQ5A 3ZS9A 4GL2A 5E7JA 3PSAA 3OKCA 1DG9A 4XOIA 4XIJA 3ZHCA 4U00A 3H1EA 4P35A 1YKGA 5F7OA 1OPRA 3NTUA 1DJMA 2IEIA 1GRCA 3O1HB 5EJMA 3UAZA 5ICSA 4LBVA 4UC0A 2PH3A 1VSBA 4L76A 4NY1A 3T7SA 2NXCA 4Q3NA 5EZYA 2HMAA 5FEMA 1YE3A 3RS3A 5AM2A 3I5MA 4Q7MB 1GTRA 1MB0A 4Y2RA 1P2TA 5I7HA 3I6QA 2J45A 4L75A 3HKEB 1NZJA 1ST2A 1UAGA 1ZBDA 2ZBRA 3PXDA 4GXNA 4D81A 1YNOA 2J3QA 1GFZA 4JX8A 1AKTA 4GC5A 4E7OA 3IPXA 2XDAA 4KVAA 1UMBB 3OE4A 1E89A 3CF6R 5A4IS 2XCUA 3TB4A 1SG6A 3ZY6A 2CFCA 2I99A 3X1YA 1NBME 4D0SA 4HDNA 2VSFA 4A4DA 1AY0A 3PD1A 3EUFA 2VDLB 2N9UA 4HG2A 2H6EA 4ZALA 4ECAA 4GPIB 1L3IA 5E6RA 4ZT5A 5A5FA 1GG2A 5HOEA 1CEYA 3R3XA 1KJJA 1KC1A 2WHPB 1AM4D 1RRFA 4PQRA 4YRPA 1PJSA 3ERCA 2ZE7A 1E92A 1OTYA 3GFRA 2ZFUA 5FTJA 3S81A 2WP8J 1P2GA 1T2VA 2AZ4A 1VMDA 1L5YA 4ZOLB 1DWQA 2HRZA 4HB3A 3GU3A 4MGIR 3R9WA 1ZS9A 3DAFA 2GZ3A 1MQSA 4IFEA 4CV2A 4JI8B 1Z0IA 1WCYA 1ZM2A 3IV7A 4O2AF 1HFWA 1SCDA 1RWWA 2WF6A 3DD1A 2IZ0A 3N28A 4OPMA 1E99A 4UEOA 4A2PA 3KJNA 2QX6A 4RTSA 4UHFA 4R54A 2IZ1A 3IS3A 3KYIB 3NDIA 1R6DA 1OFIA 4JB0A 1A9TA 5DN9A 1MV5A 3BRSA 1TJYA 3JVVA 1HL3A 1NVVR 5BVHB 3BFKA 1XPOA 1J7JA 1JE1A 3DEKA 1G6Q1 4LRUA 4E09A 5LPNA 2P6RA 1FFBA 3C5VA 2HA0A 2Y8EA 2PKQO 4DCUA 3ANMA 4LC0A 1Z83A 3UMCA 2D5CA 3EXHC 3LQ4A 2V6IA 4JN6B 5KB3A 4LHZA 1O6BA 2GYUA 4P54A 2C8VA 4IDEA 2OAQ1 4E5YA 3KDAA 2CVQA 4Z3DA 3KZKA 4GBED 2KHZA 4A0QA 1QH0A 4EH1A 3SP1A 2LCQA 2FPKA 2I2WA 2UZ0A 3KJEA 1UJ4A 4KO3S 4TKLA 4X92A 3NKLA 3USZA 2DPMA 3RUCA 2P7HA 4MRSA 3NDJA 1DQSA 1IUPA 1H65A 5EHNA 3V55A 4L07A 4UMDA 4N49A 5A7GA 3OCJA 4UUBA 2PH7A 1C4XA 5E0OA 1AX9A 3S28A 2Y1XA 5C52B 1TA9A 1Q74A 2HUPA 2DPGA 1TB4A 2OT3B 2W2KB 3T5PA 2XADA 5FXMA 3TLZA 4LC1A 3LBNA 1BQEA 2RAUA 4KE7A 4ZOAA 1ZMOA 4PPFA 4WOCA 1VGQA 2I3DA 2PG3A 5HQ3B 1K3FA 1FTYA 2EL9A 4K9NA 4JJ6A 4REQA 3FHJA 4WOKA 1TKAA 1R6TA 2PL9A 4PTLA 3ZWYA 1V16A 3O8OA 3G0DA 3AFHA 4UTZA 1LDEA 4KV9A 5H0IA 5JHHB 1A9XA 4L3OA 2VOEA 4PR0A 3ZEAA 2DETA 2JLQA 5TNXA 1BRMA 3HUEA 4DARA 5LP6B 2D5AA 3D0RA 4OJQA 521PA 1I7NA 4LWQA 4BNJA 2JPDA 5ALVA 4JYMA 1HDZA 2BHRA 2EIHA 3A9UA 4CTOA 3M4YA 3F5SA 1L1EA 2F3PA 3IDZA 3HN7A 4EYQA 3H0CA 4LMBA 1PV2A 1F12A 2W2LD 1Y3BE 4NABA 2ZULA 3MCAA 5JSKA 3VGJA 1BE8A 1U28C 2WFLA 4BVHA 3EIUA 4DDHA 1KF0A 4HDMB 4RD1A 3VSDA 2GAOA 1OT3A 5P21A 1SAYA 4AJPA 4LKOA 1V11B 4LMRA 1KJQA 2DSTA 1BDMA 1BAPA 4GWGA 1NP7A 3DAOA 3FB1A 1XYGA 3R3HA 2QD2A 4IDCA 1Q77A 3BB4A 3JPYA 2CUKA 4BMDA 5T4BA 2BRUA 3VHRA 4ZI7A 1YCGA 1G4HA 3C41J 5B1IA 2JGRA 2Z3VA 4MV0A 4WJZA 2I6XA 4LC9A 1NWHA 4D4GA 1U9IC 3K0AA 3Q5EA 1W88B 1YOVB 1SUEA 3HYTA 3ZJ4A 5KNBA 1SWWA 1QPZA 1HQKA 2V3CC 2GCPA 1TFUA 3EDQA 2H2FA 1FNMA 2OCAA 4AKSA 1H6CA 1RXCA 1WBJB 2CFIA 4H7PA 3DDUA 3WGGA 1CQWA 4GF5A 4FB5A 2Q2VA 2M1ZA 3H9GA 4GS5A 1U9YA 5KHLB 1Q1QA 3RC3A 1L9XA 5A3JA 4F5DA 2O8FB 1T2CA 1NYRA 4EPXA 3X1KA 3ROTA 4PM4A 4R2HA 4RETA 1GCAA 1QM5A 1S6YA 1Y89A 1Z8DA 2ZPAA 2XMPA 4DQVA 1NVEA 1T24A 4I4LA 5JDCA 1FMFA 1WOMA 1W7AA 2I03A 3SF0A 3LV8A 2IDJA 1NF8A 3BWDD 3GJ5A 3GFFA 5E3IA 4C07A 1CUJA 3I9NA 5AQEA 3KOZA 1O4VA 1VIVA 1SK9A 2GEUA 3M81A 3B48A 4O0MA 1JR3A 2VATA 2QKYA 4TV8F 1IQRA 1GCGA 2NPOA 3T7DA 2HKIA 5JSFA 1GARA 1GQ2A 1CTQA 3Q88A 4Z86A 4RVNA 2J4CA 1J00A 3HSSA 3RBAA 1QAQA 2PUJA 3B9BA 1J56A 3GEIA 5LYYA 3SHQA 4U63A 2MSNA 1MFZA 2CMGA 1UQTA 2Q5EA 1NUAA 4PX9A 4UHEA 3VHXA 3W3AH 3PUIA 4XW2A 4GGPA 4R7TA 4BNLA 4E5UA 1W8DA 2YHUA 1UFQA 4MQUA 4Z9BA 4NP6A 5C0OE 2AX4A 3KE8A 2GAJA 1CD5A 1Y4UA 1Y82A 3LVRE 4G56A 3HWRA 3KQHA 2ZXUA 1PEDA 5BO5A 4TV9A 1HETA 3QWFA 4XE5A 2BN4A 4O2AA 1OC4A 3NIFB 4FQ5A 3V4FA 5BVGB 4QBFA 1ABFA 3OURA 3QBDA 3V2GA 2IT1A 3OTHA 1YNSA 4P4SB 5HJ5A 3O84A 4ESVA 2CXUA 3PPIA 3FOCA 2EG5A 2JIBA 2NTYC 4RXUA 1QFXA 2IDZA 1DKLA 1VBFA 1VXOA 4DDUA 3A1TA 4L9AA 1QAMA 2EEZA 3DWGA 3JV7A 3ZV7A 2PLAA 3GD5A 3MT8A 4FMDB 1OV6A 2YRWA 5TB5A 4CU2A 1BRTA 5AW8A 5I47A 3UOGA 4JEMA 2I1QA 4FN4A 3Q4GA 2VPZA 3FGZA 3I8XA 1T8TA 2O2JA 3NUGA 1F17A 3FY4A 3AMVA 3GZJA 3C8MA 2AYYA 4HWGA 3F90A 1E5QA 1U3VA 3FCAA 3SZUA 4E2XA 1SBYA 1F48A 5MFZA 1OTHA 1EVEA 2VHQA 4KI7A 4OJTA 5CJPA 3VKHA 5MN6A 4G84A 2QRVB 3U3RA 1CR2A 4OG2A 4EA7A 2VP6A 2I2BA 4UHHA 4B83A 3HB7A 1OSNA 2PWBA 2HF9A 2R11A 2R7MA 4WXEA 5AYVA 4WA7A 5JJIA 2OESA 3D0OA 4FUQA 5DF1A 3NKVA 3L7MA 3PIRA 1E1NA 1XLWA 5IP5A 5AOCA 4AJOA 2YMQA 3EXIA 4KUHA 2YJ4A 2ZKLA 3U7FB 2AVNA 1A76A 1PTJA 3QBTA 1H6DA 1ULZA 2GHTA 2VWQA 1A4UA 4FWIB 5JZMA 5IBPA 1KQGA 1R0SA 1OXTA 2HDWA 3EA4A 2R6HA 3BCRA 2J6HA 4MCIA 1SULA 4PSCA 1FFWA 4KPUA 4QX6A 4FFOA 1ZGJA 5JVDA 2PXXA 3R6GA 2QBYB 3C2QA 5JU6A 5AP9A 4CLOB 2Y2UA 1OFTA 3ZCXA 3VOAA 3NC4A 3PA8A 3TFWA 1VXRA 2HTEA 3DZHA 1AKYA 1X42A 1X8JA 3CG0A 1JIKA 3RK0A 5KOJB 3F5FA 2ATVA 1NN3A 1VE6A 4KDCA 2FWJA 4FMPA 4JBXA 3RVBA 1Z34A 3V6MA 1PL6A 4K9LA 3TSZA 4AKHA 3TBFA 3HYSA 1QQBA 2I66A 4BFWA 1U7UA 5LU8A 4JODA 2X3FA 4ARUA 4B79A 1QYWA 4B46A 2DEUA 3HCNA 2CW5A 2QN9A 1WRBA 2BMEA 2ZQ5A 3FLAA 4JLVA 4TS9A 1PZMA 5BQPA 4XUGB 3ZBUA 4CM4A 4JU8A 2P9JA 5AKXA 3TXXA 4KDEA 1AGPA 1DDOA 1Q0PA 2QL5A 3O26A 4M1QA 3PUJA 4JJ4A 1Q0SA 4BMVA 3L1HA 4AZSA 4FM9A 1ZM3A 4DKXA 4RMIA 3RNLA 4DM3A 4OIFA 5ALRA 3T94A 5TGZA 1JHMA 3H8SA 2CWDA 2I62A 2QVLA 3LMKA 2PFKA 4H27A 4LQCA 4ZREA 1EFRD 1DV2A 2A7QA 3TW4A 4JXXA 1NJFA 2OCDA 4DV4B 1H3EA 3HSYA 2WTMA 3KAJA 4RD2A 2KYRA 4CM1A 1I1OA 4ALMA 4YMVA 1M8JA 1JH9A 3ENQA 4CG2A 4FOLA 3LE8A 1RCUA 4N03A 1X8LA 1YFKA 2C5SA 1FP4A 3X2SA 4CEJA 1CJCA 1ZP6A 2P3SA 1OXSC 5KTSA 3DE0X 1NF2A 1Y5LA 3R8CA 1R8XA 3MT7A 2D8AA 3IIMA 2XCSB 3WGZA 1WXGA 4CM9A 5HTKA 5D7BA 1TUIA 5ARBA 4HYEA 4IYRA 2JLXA 4P7FA 1G8AA 5AOBA 4JLOA 1K6IA 1KAHA 1WW8A 2DKOA 5LVAA 2YYZA 2HOQA 4JA2A 4JNKA 5K3SA 1U0EA 7ADHA 5D2CA 5IJ0B 1L7XA 3K35A 5F9HA 2X1MA 3THWA 1Q19A 3OJ0A 2IIQA 4WFJA 4N6OA 1DLIA 1OB2A 1E2QA 3IMGA 1SXIA 1JZQA 1T6YA 1TECE 4ZT4A 4CM7A 4ETWA 4CHTA 3FTPA 2B8EA 2IU3A 1V3UA 1YS6A 1K5GA 2CE2X 2F1OA 2JKVA 4W99A 1FEZA 1J2EA 4ZA2A 5HOQA 2O2XA 4WADA 2O05A 1NURA 4J8PA 4O29A 4C2TA 1SXJA 5JMWA 2I8LA 4G8JA 2QP3A 2YV5A 2YS6A 1P5JA 3WBBA 1MNAA 1HQDA 3NCTA 5BMVA 3NHZA 1OZGA 4C4TA 3KP1A 3F7OA 3V8VA 1I6MA 5L53A 1J0BA 4OHWA 4J0HA 3FVVA 1LBTA 13PKA 4RMJA 3EAQA 1CF2O 2J5XA 2I6GA 4IKOA 4NESA 4LVNA 5IT5A 3SMVA 1T4CB 2RCYA 3MMXA 2DSNA 1J5PA 2Q46A 3HA7A 2X9LA 4W7SA 5FADA 1T36B 3NBKA 4WNCA 3ZX4A 1CQXA 3ED5A 3FYTA 3JQ8A 2PAFA 1VHLA 4DIUA 4ZPXA 1O94D 3F4BA 1ADJA 5F98A 1EVKA 4JENA 1RMYA 3BUSA 5I48A 1XF9A 2VK4A 3ICCA 3QMVA 4FLFA 1AZTA 1FFSA 2VL7A 1XJCA 2QI9F 2KX7A 4X45A 3CUUA 2QRMA 2FPPA 4KNVA 3P9XA 1EFVA 1K4MA 4QYSA 2AI2A 4S1OA 1PG2A 3SQDA 3L4EA 3TLKA 3N0VA 4XYLA 2SCUA 4B3TB 2CGEA 3UWOA 1U5AA 1CF9A 1CNEA 4YYZA 3H2JA 3ZEIA 3WLQA 1DAIA 1T43A 1W88A 2YXBA 1COWA 3ID6C 1XVIA 3QWAA 5DI3A 2FY8A 3VO1A 1L5HA 1PBTA 2J0UA 5K45A 2OB2A 1V9SA 4LRYA 3W2GA 1R0KA 4EJSB 4UNRA 1SXGA 3KHSA 1D8AA 3LVQE 4H3SA 2DB3A 4CGZA 1WU8A 4MGKR 4ARZB 2B99A 3BXEA 1M0WA 2H07A 3ZVMA 1FRZA 1OIWA 1T1RA 2XDYA 3FH0A 3EC2A 2P5UA 2BONA 4JROA 4PN7A 5I45A 2H4JA 4UNNA 1L4MA 4C6TA 1N5RA 1RWMA 3QU4A 3AR6A 4J0FA 2PANA 3NM4A 4HX2A 2JGDA 4K6GA 4W1RA 5JD3A 1JIVA 4RDCA 5FUMA 4GAEA 3QLJA 4OUKX 5A05A 1XKQA 1QGYA 2O1EA 1RBYA 2QUJA 3HZHA 3E5MA 3EULA 1UJNA 3P9NA 1K6JA 3GBSA 1X7WA 3DNFA 1FFXA 1XPUA 1SXJC 1A8PA 2ZBEA 1FDIA 1CP3A 4YHBA 4EG5A 4EG4A 3G59A 2CHUA 3TMYA 2O8DB 2VWGA 2VAMA 5TPZA 3LKVA 4BFLA 1N6NA 4P4LA 1OY1A 1JYEA 3VPSA 1U04A 3KAKA 5ARCA 3CNNA 1PEYA 1XQYA 4K6FA 3L8MA 4JJIA 2WWVD 2XVXA 2C3YA 2GESA 1XVLA 1IXKA 2H2HA 2X5XA 3H2BA 4X8OA 4C20A 2PUGA 1PFVA 1X0XA 1SU8A 1L8XA 1MD9A 3ZBTA 1HOXA 1VGRA 5F1KA 3U4GA 4P32A 2B6HA 3MQFA 4WCVA 3REQA 1JRLA 1IZ9A 2PX3A 4WCDA 5J4YA 1AHPA 4M7PA 1T5IA 2C03A 1G18A 1XTVA 2VK8A 3BJEA 4UUAA 2J67A 1CUGA 2AHRA 1T4DA 3F6CA 5KKAA 3AP3A 3R44A 4Z7QB 2O8CB 3QEKA 3JYQA 4HDCA 3M83A 3ESQA 3DLIA 3BTSA 2BELA 3QUAA 3QVVA 4CE6A 5CYOA 4Z8XA 1A97A 4F6CA 5IJ9B 4CEHB 3I30X 4B6EA 1DIAA 3A6EA 3VDQA 1TAUA 1LTHR 4IMPA 1E59A 2LTAA 3QVTA 4PC7A 4RBNA 4TYWA 3W2TA 1J1ZA 4DEVA 2WW8A 4F72A 5JSZA 1XU4A 1UMDA 3W7VA 4FZVA 4XIIA 4EM6A 3B9PA 2I4MA 2UVQA 3V80A 5KNDH 1XRPA 3R5SA 3GA5A 4JGBA 4F3KA 1M72A 4CI9A 2PUAA 4DJ5X 4F5ZA 3FHTA 2HBRA 5SV2A 2AK3A 3LJKA 2FKAA 5AUNB 2QRVA 2IIBA 3EEOA 4BO8A 3UPTA 1WXHA 4GYWA 3JQBA 4XDYA 3L8ZA 3IBTA 1Z33A 4FC6A 2VJBA 5EJGA 5A7FA 3ZK9A 1Y6RA 4KXMA 1ZNXA 3IFSA 4N7RA 1M8KA 2YW2A 1U65A 1JPUA 3A14A 1SURA 3L1KA 5AVZA 2FXVA 3L0ZA 4I9HA 3EH1A 2PKQP 1B8OA 4G5XA 4IKEA 3R8FA 4OX9B 3T95A 5DKFA 4QUJA 2ACEA 1P7YA 3JYPA 2JD0A 3RHSA 2OCXA 3WGLA 3TLJA 1OWNA 4MSUA 1L8OA 4ZDWA 3D7SA 2IEYA 1DAFA 2RE8A 4N8SA 2UV8A 3R0IA 3B3GA 3FCCA 4F2GA 1LSSA 2HLDA 1VA4A 2Q4OA 2P65A 4FZ5A 4G9BA 4XGIA 5ECDA 5EXDA 5EOVA 2JEOA 3DEZA 3PIIA 3BJRA 4QPJC 1RI1A 1H23A 4YQZA 4LDRA 4BX2A 2YHSA 2ZRDA 3LKZA 3R7NA 3INNA 3C98A 4OM7A 3RYCB 1DAOA 4X95A 5KCMA 7GPBA 5IUJC 2DTDA 1P77A 1VB3A 1BVUA 2RI6A 4NBUA 4KXQA 3UC9A 5LOVA 1S01A 1XXHB 1SMKA 4NK5A 1BGWA 2ZTSA 4FOSA 4MS3B 4WK6A 5F5LA 3M6XA 3KL2A 3DMHA 5TQ0A 3HL0A 2O1XA 2PCLA 1LUAA 1OGJA 3N7UA 2OGWA 2C7RA 1CCWA 3PFHA 5ALNA 1YVUA 1ZUIA 1NW6A 4NFLA 2XWJI 2ZTMA 4RYLA 3W8RA 4CM4B 1WB9A 3ESAA 1V2GA 3HGTA 4LY0A 5DM0A 2BGWA 3DOOA 3VR6A 4JR2A 2D0OB 4E0BA 3KXLA 2XUQA 3SJUA 4HSGA 2BHSA 4NMLA 4U6SA 1QP0A 1HPLA 4QHSA 4A26A 1YASA 4KQ9A 4OQYA 1OX6A 2V5UA 2VF8A 1PJBA 1ZXXA 1WABA 5ANRB 5I7SA 3OTWA 4B4OA 3KVNA 5KIAA 5JCJD 1A2OA 1C1YA 1J4AA 1G64A 2IPMA 3TIFA 1C0PA 2AZTA 4PZZA 4XUCA 4IVPA 2C20A 2H1SA 4KXLA 2A0YA 1ADCA 3H1BA 3RQIA 1K3TA 1U8XX 1UXIA 2VCHA 3BC1A 3QWIA 4GRIA 4LRSB 6Q21A 3AUUA 1JDZA 2Q4RA 2QIPA 1DEHA 2F9FA 4DQKA 1OLUA 3AU9A 3QHAA 3U4MA 4I4IA 1O97C 1YWGO 3SQNA 1AS2A 1N78A 1BE1A 5EC8A 5ENZA 2GYVA 1GPWB 1W44A 2KQUA 3GQVA 1QHHA 1XMSA 4IHAA 4Y1EA 1C8KA 5IDVA 4DWOA 1QCZA 1E8MA 1Z4KA 3ZHRA 4E7PA 3HZZA 1K88A 2AG5A 4JYCA 2X76A 3C4QA 1QCDA 3GG2A 3LBIA 1GAEO 5DHSA 1JH8A 1SZJG 3CPSA 3EGXA 3TLGA 3WYNA 3EGVA 4LJ6A 1E0AA 1VMKA 2B8TA 3DONA 5FDFA 5JT1A 4EKEA 2CLLB 5T57A 1BDHA 4DCCA 4QNNA 3ZCSA 1FUEA 4LOKA 4JJ7A 1E79D 1H0KA 4FHGA 2PBRA 3MRVA 2C0QA 2GLUA 5CH5A 3RGWS 4AUKA 4DTIA 1VKZA 4Q7QA 2VQEB 5COBA 4DV5B 1F2TB 1G8PA 2HJHA 3L7LA 5D5HA 3RLIA 1JT2A 4LNAA 3C16C 5B37A 5D3MB 5U4XA 2M6RA 1TJ4A 1F0PA 3OFVA 4I7EA 4RLHA 3LDAA 1PQUA 1X94A 2ZB4A 4P38A 4WOJA 1ECCA 4QG7A 2CXNA 1KJYA 1JZSA 2IHVA 3PFFA 4JWTA 4ZC8A 5LCXA