2XTZA

Crystal structure of the g alpha protein atgpa1 from arabidopsis thaliana
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
349
structure length
341
Chain Sequence
MGSGIHIRKLLLLGAGESGKSTIFKQIKLLFQTGFDEGELKSYVPVIHANVYQTIKLLHDGTKEFAQNETDSAKYMLSSESIAIGEKLSEIGGRLDYPRLTKDIAEGIETLWKDPAIQETARGNELQVPDTKYLMENLKRLSDINYIPTKEDVLYARVRTTGVVEIQFSPVGEVYRLFDVGGQRNERRKWIHLFEGVTAVIFCAAISEYDQTLFEDEQKNRMMETKELFDWVLKQPCFEKTSFMLFLNKFDIFEKKVLDVPLNVCEWFRDYQPVSSGKQEIEHAYEFVKKKFEELYYQNTAPDRVDRVFKIYRTTALDQKLVKKTFKLVDETLRRRNLLEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANINE NUCLEOTIDE-BINDING PROTEIN ALPHA-1 SUBUNIT
publication title The Crystal Structure of a Self-Activating G Protein Alpha Subunit Reveals its Distinct Mechanism of Signal Initiation
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 130
structure length 341
sequence length 349
chains with identical sequence B, C
ec nomenclature ec 3.6.5.1: Heterotrimeric G-protein GTPase.
pdb deposition date 2010-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 2xtzA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2xtzA01
5HCIA 1TUEA 1PVOA 2A78A 2Z6VA 1ZM7A 2W83A 4P33A 4TTQA 1WDTA 2QENA 2FZ4A 5BYKA 1AS0A 2Q9BA 4MKHA 3MWLA 2D2EA 1UADA 1NY5A 1NKTA 2QGZA 1Z0KA 1J2JA 2EYUA 4DC9A 2XXAB 1GL7A 2ZRMA 4C0HA 5FH9A 2WWWA 3K9LA 2WOOA 2IA5A 4PHFA 5JS7A 1VYVA 2Q3MA 4ACAA 3Q7QA 1XTIA 5CJ2A 1HYQA 3ICEA 1XEWX 1W4AA 4DEXA 5FBLB 2BBOA 1KK2A 2QZ4A 3A1SA 5DIFA 4OK5A 4QBHA 1T91A 2DY1A 3N5CA 4URYR 5HKKD 1E9DA 1E9SA 2G9NA 4JVSB 5EE5B 5CK4A 4LJ7A 2FPMA 4FXPA 1ZNXA 2BBTA 3GJ3A 4M4SA 2C95A 2XJ9A 2ZVPX 4PTLA 5DYIA 2BM0A 1E4YA 5AK0A 4AIIA 3LLUA 1FX0A 4IDHA 3OHMA 2EVWX 4AKEA 2KI5A 4PPFA 5JLJA 4A8JC 2ZRPA 4Z51A 1YZKA 4AI6A 1UBFA 4ILEA 1S9HA 1Z0JA 4DLXA 2Q6TA 1EFHA 3TKLA 3U61B 2BEJA 1E9FA 2VLIA 4A1FA 3HU2A 4PZLA 4B6FA 4KFRA 4Q7JB 5HTKA 1QRAA 3B2EA 2E1RA 5TXGA 4Z1MD 1NNEA 4QBFA 1E0KA 1KMHA 421PA 2WKPA 4IDOA 4DCUA 1ZC3A 2G77B 3MCAA 3VU9B 1V43A 1E3MA 2PJZA 1Q21A 1U8YA 2QSZA 1AA9A 1N6KA 4PPGA 4B6EA 1EFRD 1LS1A 5BXQC 1L4UA 2J0QA 4NONA 4X8HA 3H84A 1PLLA 4QHYA 4NCJA 2VYFA 3VR6A 4QGAA 4HDCA 4AYTA 1T3HA 1IJFA 2PZFA 2D62A 3AF0A 4JJKA 3L0PA 5L3SA 2NOAA 2DBYA 3TMKA 3KXIA 2W2VA 1GL6A 3OIWA 4YC7A 2QPOA 3CX8A 1H8EA 1KKLA 1XBTA 1RRGA 2ZR7A 4LWZA 1U94A 1KAGA 4A0GA 2GWHA 3BORA 3ZYCA 3MJRA 2VP9A 2CK3A 1JQLB 4KAXA 2O0KA 4HAVA 5KSZA 1OSNA 2WPDD 4X8LA 2IW3A 1FTNA 3NEYA 4DCSA 1R8SA 4U7DA 1VHTA 1JR6A 4XWOA 2JLYA 2CLCX 4PAMA 2C9CA 2J9RA 1TPZA 1II8B 3LQRA 1EK0A 4F4IA 4LHXA 1ZC4A 3VHLB 5EXPA 2GCOA 2V6JA 3BK7A 2AXNA 1VG9B 2J0UA 4C2UA 1AGPA 2A5DA 2OT3B 1ZJ6A 4JLPA 1TEXA 4RD0A 2ZPTX 1II0A 4JL5A 3AKDA 5FTNA 2OXCA 4Q66C 4B75A 1G291 1KI9A 3CLVA 2BMFA 5JZVA 1KI2A 1CR2A 5HZHA 2B8TA 4TZ0A 2F55A 3TR5A 1U99A 1JAHA 3THWB 3QKRA 1BOFA 4YONB 3R8FA 1IXZA 4F38A 1US8A 3PEWA 2JLRA 1KI6B 4F91B 2VSXA 1SQ5A 4RCZA 1CJTC 2CJWA 4Q19A 3U3MA 3EARA 1N0WA 1G18A 5C4GB 5J4HA 5DHAA 3DDCA 3DO6A 3P20A 1G3UA 2D06A 1OJLA 1N6HA 4LJ8A 1J99A 2HJGA 4WZAE 5HE8A 1S1MA 1VG0B 2QAGA 2ZI7A 1NVVR 1WB9A 2PCLA 5AJXA 1U9IA 3NH9A 3EPLA 4Q1BA 1VHLA 1ZBDA 3QOFA 2G6BA 1PJRA 3X1ZA 2B6HA 1QHHB 1BYIA 1G7RA 4NU0A 3UPUA 3QY0A 3NBXX 1MKYA 4RFVA 4Z1MA 4DXAA 3R8CA 3I73A 3CH5A 1NBMD 4D25A 4OYHA 3EWSA 2ANBA 2CLSA 2PEYA 1X86B 2P6NA 1EFRA 3FHCB 4WA7A 1E2KA 4HSEA 1KY2A 4KBGA 1BIFA 4IDPA 2P3SA 4GPTA 5E95A 4BFUA 1F2UB 2DFLA 1NJGA 2L0XA 4R71A 4NPHA 2JLWA 1SXJC 3PUYA 3PV0A 3AKCA 4NDZA 2ZJYA 4JYBA 1NL3A 1E2GA 4HDQB 3A1VA 3ECCA 2R44A 3QKSA 1D9ZA 1JECA 4EPVA 4OQMA 3IEUA 1I4LD 1KI8A 2QM8A 3DZDA 4Q48A 3X1XA 3SDZA 3DVLA 2V4ZA 1M7BA 3CPJB 4RKFA 2YWGA 3T12A 4UNRA 3KQKA 1NMXA 3PFIA 3C16C 4O3MA 3KKNA 4IOKA 4O0MA 5FPHA 4UXJA 3U6BA 3BH0A 3KKOA 3VKHA 4K8OA 2XTZA 2WPDA 4D81A 2V9PA 4QXAA 1D2NA 2V8OA 2QU8A 1BYUA 4TLEA 2I3BA 4PQRA 5DI9A 3IGFA 1TEVA 2R65A 3QVUA 3D31A 1D2MA 3W8RA 2JASA 4LUCA 4N3NA 4NH0A 3KUDA 2FFAA 4DSOA 4YQFA 3K9HA 2C99A 4JBXA 3RRNA 4PC2A 5F9HA 5JJIA 4POAA 4OJQA 4WW0A 1HY3A 1XF9A 2IWHA 1A2KC 3CUEF 2FSFA 5M04A 1W36C 4MKGA 1SGWA 3K70D 1QVRA 3K9NA 1JJ7A 1IOZA 1VCMA 2REXB 3AF2A 3EX7C 3K0CC 1T3LA 3WRYC 4IOMA 1G6HA 5EJEA 3TE6A 2J0SA 3W5JA 5H8WA 1BS1A 1AS2A 4Q47A 4LJYA 5L3SB 1ETUA 5KDDA 2D3WA 1SVLA 1HEIA 4BEJA 3GLFE 4ERNA 1NSTA 1FPMA 2RGGA 4R7ZA 1NN5A 4Q1DA 4U02A 3BD9A 3VKWA 2A5JA 5JSZA 1JR3A 2HLDA 2OCBA 3R7WB 3N70A 5HCNA 3W3ZB 4Z8YA 3K0AB 4B2IA 2ZRIA 2Z5FA 5H1YA 4DB4A 2IK8A 1NBMA 4TYYA 3A8TA 2GK6A 1F2TB 2E9SA 3PEUA 1GRRA 1Z0DA 3VTKA 2RGEA 2JDIA 2OFXA 4PC3A 5ELXA 4B47A 2AX4A 5FOXA 2NZ8A 4QM6A 4JLVA 1HE8B 1XFAA 1KI1A 2VTKA 2LCFA 4AURA 4BLTA 1IHUA 3W34A 2PX0A 2WVJA 2CL0X 3HP1A 1ZINA 4ZCLA 1ANKA 4HAYA 2XNDD 4F4CA 4FI3C 4EJSC 1VCNA 1ZM9A 4G5QA 5GJBA 3QUSA 4JKIA 2ZITA 2VF8A 4OQNA 2X77A 3QKRB 1G17A 4PSAA 3HPRA 4RJLA 5KNCA 3FHOA 4AG6A 3RAPR 1CKEA 3RC8A 1US8B 2PZEA 2BDTA 3CRW1 2IT1A 4MGKR 2ZI6A 4KJZA 1DAKA 3NC0C 4F93B 3QPVA 3AKYA 1NBME 4D4MA 4HLQB 2NPIA 2XJ4A 5L3VA 5DE3A 4QGFA 3BH6A 2OBLA 4RZ2A 1PUIA 4TMTA 3RS0A 2VP2A 1P61B 1RVDA 2QA5A 4QJ3A 3KJHA 4Q00A 4PC6A 5FR2A 2F3TA 2P5TB 4O25A 1Z6YA 2IYYA 4NYMR 1CR1A 4Q4HA 1ZUHA 1ZW6A 3RS2A 2BJVA 2QG6A 4B3FX 1HURA 2LKCA 2NPFA 3SOPA 3ZDQA 2F7SA 1NVWQ 3GEEA 1E32A 4L8GA 2ZI9A 1N6RA 3I72A 4V03A 2GZAA 5KSPA 3BFKA 4Q1AA 2H1LA 4DB2A 4QFMA 2X2EA 4MGIR 2GJ9A 2XOKA 2JJ1A 2PLRA 3EWAA 5EP4A 1NJFA 1NMZA 2GEVA 3SQWA 4Y0AA 2P67A 2EFDB 3ADCA 4YMSA 5FL3A 1TF7A 4V0OA 3WHLA 2GJ8A 1N6NA 3GJ4A 3NDPA 2NO1A 2JIZA 4ESHA 4B32A 4RFSB 2FFQA 2CL7X 3THXA 1CF4A 1E79D 3KKPA 2V7QD 1Z47A 5KDLA 3VNUA 4PC1A 4A6XA 4B35A 2R2AA 2JLSA 2ODBA 4F7WA 4RSGA 2YKGA 2REBA 5AR1A 3EZ9A 4ARZA 2H57A 2ZRAA 3R20A 1N0UA 1LB1B 3EIHA 2EFHB 1V5WA 2VEDA 3LFUA 3RHFA 4RZXA 2ATXA 3DOEA 3CRMA 1DELA 4JLNA 3GLIE 2GDJA 4NTZA 1Z0IA 2A5GA 3WP0A 5J47A 4Q1CA 3KUCA 3GLFB 1W5SA 4UXIA 2QMHA 2VQSA 3OEHD 1KJZA 4JZKA 3ZZUA 1XNJA 2H18A 2MSDB 2P0EA 2GVZC 2FE4A 2J87A 5GVRA 2GETA 2XNDA 1KNQA 3CZPA 1NI3A 3QBVA 3SHFA 1KTVA 2LWIA 2ORIA 3E70C 3HU1A 3WBJA 1VDZA 3PUVA 5TY0A 4NCIA 1WF3A 2EFCB 4HB0A 1YQTA 1NN1A 4NYIR 4MUAA 5EE9A 2TMKA 5AUPB 1W1WA 2JLQA 1D8TA 2GA8A 2IYLD 2SHKA 5BN4A 621PA 2KE5A 1GITA 2VSFA 2J46A 4L9WA 2RCNA 5CYPA 1E9CA 2W6ID 1RZ3A 3MUFA 5KSYA 2IS2A 3KKQA 1FUUA 3LA6A 3THOA 1VPLA 2JATA 2QQ0A 4ZV4A 2G1KA 4EKDA 3TR0A 2IYXA 4A0RA 4KO8A 4LYAA 4C0AC 1GG2A 1NG9A 4DZZA 3QVVA 4DSNA 4I1UA 4ON9A 4U5XA 4XSHA 3KB1A 4PX9A 1OYYA 1ZUNB 5DNYB 2IYWA 3RS7A 2ZANA 2XGJA 3LVRE 1NRJB 2C8VA 2FPLA 3NDBB 1UEJA 1Z6TA 2QQEA 3ZIAA 2ZR0A 4NYMQ 1TL7C 1OH7A 3AGPA 1T5IA 3EAQA 4Q18A 4Q7KA 3X1YA 1AJEA 4A36A 5KPDA 3IPXA 4EQ6A 2C2HA 2DPXA 2QE7D 4TQ9A 3UWKA 3GFOA 4BRUA 5BN5A 2H16A 2WJIA 2B7CA 3RWMB 4M0LA 5DI3A 1XP8A 2MSCB 3C7KA 2ZRBA 4LOAA 4FD2A 2BMDA 2YV5A 2FEOA 3G0HA 2X1VA 4K81B 1Y3AA 4F92B 5AJZA 1GTVA 2V1UA 1E79A 1XZQA 3WYAA 4KBFA 1NN3A 3GD7A 4HAZA 2XXAA 1GVNB 5EXSA 5FOUA 1W0JD 2GJSA 3QI2A 4DIDA 2VF7A 3I5YA 1OLOA 5DLQC 2YINC 4G5GA 5FPKA 3LQQA 4P4TA 2VHUA 1N25A 2ZS8A 3A36A 1ZMXA 5IK2D 4AKIA 5DH9A 2OAP1 1HQYE 1S2MA 1NG1A 1VG8A 5CDFA 1QHXA 2CHVA 1OXTA 2BHRA 3QG5A 2J5XA 2OBNA 4LCBA 4DUGD 1J70A 4GMDA 5JMTA 2NTYC 2XB2A 3GJ5A 3QXHA 5FBQB 5LD2C 2C77A 1F60A 1RFLA 2GCNA 3MAAC 1R0WA 1T8UA 3OEHA 1RPZA 2GAOA 4YDHB 1NLZA 3ZJYA 2B8WA 3ZGXA 4DT1A 3AP2A 4QL3A 3EW9A 4JBWA 1ZU4A 2F6RA 3FOZA 4RCYA 1LNZA 1ZM4A 2CNWD 4BFXA 4D4JA 4LC1A 1WMSA 2QAGC 2A5YB 1U9IC 1VKJA 4GFDA 3GLIB 1I4DD 1K6MA 5J40A 2RHMA 3K70B 3NG1A 4A8JB 2O8BA 3CKLA 2FPKA 1NIPA 1XMVA 2YC2C 4XTCS 3QBTA 2A3RA 2RGBA 3G5UA 1JNYA 3K0SA 2P65A 3DL0A 4MKIA 3U7GA 5JCPA 4GBMA 5J5CA 4DWJA 3LLMA 4NYIQ 2YNMA 1UBEA 2AR7A 1ONBA 5JI2E 2FJUA 1L8QA 1P2VA 1YZGA 1W5TA 4F4JA 4GOJA 4KYIB 4OKSA 2OXRA 1E96A 3CF2A 1EFTA 2A7QA 4RKEA 3IO5A 4JT2A 4PPNA 3K53A 2WAYA 3U4QB 1QBKC 4ARZB 2Y8EA 1IN5A 4IFBA 1OH8A 1G3RA 2IUSA 4M9ZA 2V54A 5CM9C 3UWOA 4LI0A 3T61A 3CX6A 2XAUA 2LKDA 2XEXA 1TNDA 4BLOA 2XSZD 1UDWA 4P4UA 3FFBA 1DBSA 4XD7D 3QXSA 5FFMA 2PBRA 3OESA 3D8BA 2QE7A 4FCWA 2EFEB 3VR1A 3H86A 3PVSA 3HJNA 3NTUA 2GK7A 3FFAA 1Q3TA 5JFGA 2C98A 4TT3A 4KSBA 2J45A 4PZYA 1G6OA 1E1RD 4TYQA 1Y63A 2IYVA 4US0R 2WSSA 5DISB 1H8HD 4AWXA 4QM7A 2W2XA 3O8DA 1J7KA 4HZUB 4OI0A 1TQ2A 2D74A 2QRNA 1S3SA 3MG9A 2CCGA 2VPPA 3AV0B 4QBIA 4M9QA 4R2HA 3P1JA 2CMKA 1ZD8A 4QGHA 5IK2A 4G5OA 3THWA 2QP3A 2C5LA 4OJKA 2YJTD 4DUGA 1KI6A 2FSGA 2ZAMA 2OFWA 1TF2A 2KB0A 1G4AE 2OILA 1XB2A 2ZETA 1FQJA 1G5PA 3MWYW 4B2LA 1E2PA 4W5HA 1P9RA 3AB3A 1W4RA 4FN5A 1HV8A 4RD2A 2R6AA 1CU1A 3H2YA 3JVUA 2YYZA 4N0DA 3B1ZA 5GVSA 1MRSA 4B3BA 1UKEA 4FINA 1M7HA 4QJ5A 3SE0A 1E0SA 3TW8B 1M1YE 4TSFD 3GEIA 4W9MC 5AUOB 1E4VA 1LV7A 1QHHA 2R6DA 3DM9B 5FI1B 3X1WA 2WJVA 4KXFB 3Q8XB 3PEVA 4IDQA 4U00A 4C0BA 2IXGA 3A4NA 2D7DA 1K5DA 5D3MB 3I3SR 3RLFA 4BLSA 2XNSA 1KO7A 3T5DA 1OFIA 4ZDJA 1WBBA 2G88A 4OHWA 4FMCB 2O0HA 3ZD7A 4HB2A 1Z5ZA 4N0EA 3WNBA 3B1VA 3SR0A 4BLPA 1F2UA 1X8JA 2RGDA 2ZSAA 3Q5EA 3GPLA 4PZZA 5CM8B 3KTAB 1T0JB 4A9AA 1MR3F 2O8CB 4M21A 3TW4A 2BCJQ 5K8LA 3MFYA 2IS4A 4RZUA 1XEWY 1Q1ZA 4QNMA 4XJXA 4ZKEA 1U0LA 2PX3A 1R0XA 1UBGA 3CO5A 2QP4A 3KJGA 1G3IA 1E1QD 1YJ5A 2CCJA 4GRAA 5BYJA 2AKAB 1FQKA 3AUXA 2H92A 1OF1A 2WMOB 1E0JA 1NVXQ 4PSKA 1MABA 3TUJC 2J7PD 3OIVA 2IXFA 4BFTA 2XSZA 1GL9B 2F3RA 2Q3FA 3WMGA 4XD7A 1IM2A 1DEKA 3BB3A 2KWIA 4D80A 5DN6A 3ICQB 4Q4JB 4I99A 4MRPA 4YXWD 4UQOA 4BFSA 2QPTA 1X1RA 2ZYTX 2ATVA 4DT1B 1W2HA 121PA 3K0EA 1QG4A 3VR4A 8OHMA 2JLUA 3RDPA 3UK6A 3KKMA 3TJZA 1SZPA 4GNKA 1AK2A 2WSMA 3P27A 2NO7A 4G1UC 4IOLA 3IBYA 2OFOA 2P5SA 2REOA 4L4UA 4MH0R 1XEXA 2ZJBA 4AG5A 1OIWA 1XX6A 3AVOA 1Z83A 3ZS8A 1XJ0A 2O8BB 3KQUA 2XTNA 1IONA 1XXHE 3CZQA 1ZNZA 3FGNA 2A9KA 4XSGA 2ZJAA 2Z83A 3L82B 2DFTA 3U3RA 1KSHA 1QHSA 2BEKA 2FEMA 3JVVA 1KO8A 3SFVA 3AVTA 1DAFA 1E6CA 3CH4B 4NZYA 2QNRA 1IBRA 3VX4A 5CLLA 4JVMA 4MRVA 3VFDA 3R9WA 2ZUCA 1GRNA 3UMFA 5A4JA 3UIEA 4WXRA 4TMZA 4TMVA 1Z0FA 4C9BA 1DG3A 3U5ZB 3RS5A 4EPYA 1QHYA 2F9LA 2R8RA 2ZRHA 1KK1A 2WJGA 1P5ZB 2GAAA 3IIKA 3ZD6A 4MQBA 2O8DA 1XTJA 4Q9LA 2OUKA 2D7CA 3R7WA 1P9WA 1U0JA 3CPEA 4MRNA 4HUTA 3PG5A 2GBLA 1SULA 2QT1A 3K0AA 2NIPA 1Q1EA 4V02A 1U81A 3J81k 2BBSA 1S4QA 4M22A 1N2CE 1F2TA 3MMPA 3GJXC 1COWD 1OKKD 2GXSA 2EW1A 1FW6A 1S1CA 2G0NA 4N1AA 5DSZA 2NQ2C 1E2JA 2ZI3A 3SZRA 2OM2A 4B73A 3REGA 3OAAD 3SJZA 5AWFC 4BECA 1OXVA 2OE2A 3GFPA 3V00A 3BGWA 4LSGA 1W4BA 1VCIA 1XTRA 4G3XA 1EXMA 3LBIA 1E1QA 1X3SA 5EUQB 4CGZA 4HLUC 2P2LA 4Q02A 4TTRA 1NN0A 1UM8A 2O0JA 3WBKA 2DCUA 4NYJR 2CEAA 2J7PA 1EWQA 2G0TA 1JAIA 5J4LA 4IKEA 2HYIC 5HKKA 5JRJA 1AGRA 1EFCA 3VMFA 2AD1A 2N46A 4OQFA 1UEIA 4UJ3A 3T5GA 2C9OA 3JZAA 5G3ZA 3IKJA 3W3AA 5A5GA 3Q5DA 4L9SA 1E9RA 3L43A 1ZP6A 2QN6A 5D3QA 4TL7A 3AM1A 4BFVA 5G3YA 2ZSFA 3CPHA 2BMJA 2GZHA 3E1SA 2GKSA 1Z2CA 2WMNB 2RGXA 2Q21A 1A7JA 1G3MA 4A2PA 1JXMA 1YHNA 3ND8A 1G7CA 4PO8A 1CRQA 3EZ6A 1P6XA 2WOJA 3KB2A 5A0FA 3PXGA 4ZIRA 1UFQA 1XTKA 1GDDA 3TQFA 3VX3A 3HWSA 3ZZTA 4B48A 4BLQA 1JEEA 5SZJA 5JJKA 3LH5A 5L3RA 1YU9A 3W6PA 3WYGA 5F3WB 3SEAA 3RANA 4IVRA 4LYFA 3ASZA 3JZMA 3O8BA 5KU1A 1W2GA 4PXAA 1G21E 1C9KA 2KJQA 4G5SA 2AK3A 2H5EA 3BH7A 5B2ZA 3N2EA 2ZRGA 4L16A 4A4DA 4RFSA 4RD4A 2OESA 3AKEA 2EYQA 5LB4A 1A1VA 3C8UA 3M4YA 1XD2A 2CBZA 2YZ2A 4A0FA 1S3GA 1WP9A 1XXHB 4WOPA 1E2QA 2WAXA 4DKXA 1MABB 2QORA 1T3SA 5CYOA 1TQ6A 3QPUA 2H17A 2OCAA 2VL7A 1KSGA 5JHHB 1XJQA 1YZQA 1N3BA 3K09C 2ZYUX 2IHBA 1DAEA 4Z8XA 4E09A 1LTQA 4ZI2A 5P21A 1HT2E 2Z43A 1COWA 3IHLA 4MYHA 5TV2A 4XVQA 3P32A 2HCJB 4G0NA 2ZU6A 4B74A 1XU4A 4JYCA 2ZR9A 5F98A 3BC1A 4OHXA 2GJKA 1D9XA 3GLFA 4OI1A 3U6KA 3OAAA 4GI7A 4M9XA 2GNOA 4J0QA 1MO5A 2R6CA 3F5FA 1E2IA 4IVPA 1EG7A 1PLJA 2FX3A 2R6FA 4MDFA 4OQXA 1UPTA 4MRRA 2ZSEA 3G82C 1XEXB 2AXPA 4WBSA 1AKEA 3H1TA 4II7A 3CWQA 5IRCD 4KHZA 4DIEA 3HDTA 4RD3A 2J3EA 3ZS9A 3CRQA 3B9QA 3GFTA 1K8RA 2ZQ5A 4C4PA 4AKGA 4IEIA 2IBMA 5EZ5A 3I32A 2PL3A 2RGNC 3TVDA 1CLUA 1KDPA 1NSFA 1X8LA 2UVQA 3M6AA 4HI0E 4OHZA 1RYFA 5JEDA 4NYJQ 2O5VA 4IRUB 3B1XA 3VHXA 1OHHD 1P2SA 1OH6A 3EC2A 4ZCMA 1FOEB 3NWJA 1G8GA 1JJVA 1KO4A 1N6LA 4A6PA 1JXOA 4M1KA 5AJWA 1T5LA 4NE2A 3A1TA 1EWRA 4JLKA 4RD1A 3VR5A 4HB4A 1NLYA 3WP1B 3I62A 1DAGA 1GUAA 2DHRA 5J4YA 5KTYA 1SVIA 2ZRFA 2ZRJA 3AP1A 3GLHE 3WMEA 2NMVA 2O8DB 1WA5A 4KFTA 4LZZA 5KUTA 1KGDA 2HJVA 4I1OA 4KCGA 1G20E 5LB2A 1A2BA 2ZJOA 3Q85A 5E7MA 3GLGA 2ASEA 2OV2A 3C5HA 3UMSA 2A2ZA 1AIPA 4MITA 4ZCIA 1MRNA 3FKSD 5L3QA 1TTTA 1XPUA 4ZPXA 1RW4A 1VMAA 4IXMA 5SZKB 1ELOA 1M6NA 2Z4SA 4QOSA 1DAMA 1BO6A 1S96A 2QPAA 3CF6R 4OK6A 1U98A 3PITA 2BMEA 3A1WA 1KNXA 2PT7A 3F3YA 3T1QA 2ZI5A 1GSIA 1F5NA 3BB4A 3UMRA 3IUYA 1D2EA 1KI4A 3U3JA 1ESNA 2QM7A 3A1UA 4JIMA 2GTPA 1XPOA 3NHBA 3W5IA 3LRPA 1S9DA 5KHOC 4V0KA 5KOYA 2PMDA 2FF7A 2OO7A 3EIQA 4V0LA 2Q9CA 3W9YA 3C14C 3AF4A 2AK2A 3EXAA 3GLGE 3FWYA 4IVQA 3O8RA 3LW8A 2ZTSA 3LV8A 3MLEA 3DOFA 2QMOA 4DCVA 2ZJ5A 4DLZA 5JECA 3TUZC 3UANA 4EFMA 3FPAA 3BB1A 2ZI4A 3QF4B 4IFEA 4QRHA 4TLDA 3TSWA 1P72A 1QHNA 2JA1A 2G3YA 3AQ4A 2CHGA 5EQTA 3KQLA 3PUXA 2HT6A 2VA8A 2W0SA 4E03A 2W00A 1G8FA 3WNCA 4B71A 1LY1A 4ZIRB 2JLVA 2C03A 2GCPA 4MGZR 4O2RA 3GLIA 3THYB 1OFTA 2MMCA 4B43A 4TQAA 4C0LA 4KLNA 4Q9HA 4A8JA 4GOKA 1G16A 3F0TA 5K8UA 2IF0A 2IYQA 2YWEA 3GEHA 4LBZA 4QHSA 2QRZA 1BMFD 2CDNA 1ZYUA 4TN1A 5DHFA 3TH5A 1G9XA 4YLGA 4URZR 2WICA 2VO1A 1OHHA 1YZUA 3PJRA 1R8QA 2QTVB 1Z28A 3LBNA 1WBDA 2D4HA 2Z4RA 3RSLA 4LJAA 1YR7A 2GZDA 2VRWA 1U2RA 2BJWA 1XMSA 3EPKA 1OIXA 1XD2B 1QG2A 3U4QA 2OSBA 1OFHA 4V0MA 3U7EB 3A4LA 1DVRA 2NZJA 3NIBA 3EIEA 1SXJD 4GL2A 1PLKA 1ZM3A 1XRJA 4ZDIA 4PQYA 4BZXA 2DWOA 4DCTA 3K9GA 1QZXA 4HUQA 3B7GA 3P26A 3CBQA 3LXXA 1CIPA 4GSYA 4Q01A 4D26A 4C30A 4D2IA 2CL6X 3GCGA 4Q4LA 4KITB 1FMJA 2YHSA 2E87A 3PUZA 3TRFA 3FKSA 3ADBA 1G7SA 1DAHA 1P2UA 4CF7A 2P6UA 1M2OB 1N5IA 4GZLA 3D7MA 3D6TB 3B60A 1GKUB 3ONWA 3SYLA 3GLHB 5BQ5A 1HA3A 3X1DA 2YC4C 2ZREA 2ZS9A 3T34A 4HZUA 521PA 3AVXA 3RABA 1IY1A 2WJYA 3L0IB 4YDSA 4V0ME 2FGKA 3E5HA 4DHEA 4XTRA 1KJWA 3EG5A 1KY3A 5AUNB 4YMTA 2JLXA 1G1MA 1YR6A 4M1OA 1PUJA 1WE2A 1ZD1A 2JGNA 3FMFA 2NO0A 4FMDB 2CCKA 1UAAA 2RGAA 5JRZA 1KK0A 4FWIB 4A0HA 2O8EB 4AC9A 3V9PA 1W47A 2ZJ8A 1W36D 5B64A 4MRSA 2IYSA 5FL7D 2QMEA 3TAHA 5FOWA 3GJ0A 5L8VA 3FTQA 3LW7A 1GRQA 2X2FA 3DEFA 3HR8A 4PR0A 4HAWA 4Q7MB 5FUVA 3T1VA 4A2QA 5KSOA 3GLGB 2DWPA 4JVNA 4XOIA 3SU8A 4MYCA 5C2JB 1NP6A 1XTQA 3TGPA 1E2FA 5L3QB 2FDCA 2ECKA 5D3MA 5JWOA 1D5CA 3EPHA 4KVGA 3I1FA 1AN0A 4V0NA 2G1JA 2JEOA 4P32A 1DAIA 2WJHA 4CT5A 1CR4A 5UKDA 4TMKA 1RRFA 3TUIC 5IDVA 3LBHA 1RRPA 2V7QA 3KTAA 2C04A 2FFBA 4A15A 2O8CA 2ZRKA 2FN4A 5TARA 3AEZA 1YR9A 2ODNA 5IHPA 3TLXA 1GM5A 1MH1A 3O47A 2CLDX 4QKQA 1FUKA 1SXJA 4HEJA 2OLJA 1OPXA 1WQ1R 2N1BA 4DLTA 4Q03A 1PV4A 4Q9KA 5SZHB 2ZYWX 4PAOA 1YE8A 3CR8A 1GKIA 4BFWA 5FTLA 4AKHA 1AKYA 2KBFA 3WY9A 4URUR 5FTKA 1W7AA 2WBLC 1SVSA 4Q4JA 1KI3A 3RRZA 1YRBA 1RJ9B 3MWKA 1G7TA 4PO1A 3UG6A 2F43B 5KO2A 4IW3B 2F1JA 1QF9A 3EA5A 4ACBA 1E2DA 4XWKA 4Q7LA 3AVWA 1H65A 4LJ9A 1C1YA 2Z0MA 1T8TA 2F9MA 5EXTA 2R9VA 3X2SA 1TUIA 4Z54A 1F3OA 1YZTA 4HZIA 3H4MA 2PZGA 3RNLA 5C4MA 4B3DA 1RYHA 1KDTA 3DMNA 1NMYA 1SXJE 1U0HC 3PQCA 2W6IA 2HYDA 3PEYA 1DPFA 1T9HA 3U3OA 5B58C 4XH9B 5FUWA 1OH5A 2FNAA 3B82A 1KZGB 1JBKA 1FNMA 4ASUD 2ZRDA 3T1OA 4E07A 4PHTA 2OCYC 3SNHA 4CIDA 3QF7A 1I2DA 2IWRA 1VG1A 2ZUBA 1OB2A 2VH5R 4TYWA 5JI3E 1KJYA 3W6NA 2HV8A 3AGQA 1R2QA 2J7KA 1KIMA 4HUQB 2K5UA 4OK3A 4DRZA 4PANA 4LJ4A 2WHXA 3KXKA 1GOTA 1KO5A 5ANRB 2QT0A 1AZSC 4LBYA 4M1WA 3T15A 1DG1G 4IEEA 2GRJA 5J4VA 2QSYA 3WYFA 2CE7A 1G8YA 3ZH9B 4BLRA 1J8MF 3R9IA 4BPBA 1LF5A 3D3QA 3AF3A 5HPYB 4IXNA 3AVYA 1XWIA 4QHTA 2ORWA 2IYRA 1W0JA 3NEJA 2ONJA 5FBRB 5LPNA 4QNRA 2VIIA 3BBPA 4DLSA 3B5JA 2GHIA 2QI9C 3SJBA 5GADl 4LBVA 3GMTA 4FCTA 3SYNA 2YOFA 1G8HA 1VIYA 3T06B 1FP7A 1R6BX 3OIYA 1J90A 2HF9A 3SC3A 4GZMA 2EWWA 4JL8A 4KFUA 3QXJA 3UXMA 2WIBA 4CZ2A 1L4YA 4UNQA 1NVUQ 1TADA 4B3XA 4HATA 1E94E 1YZNA 4IJMA 4HAXA 4TWZA 3CX7A 3RRMA 4ZKDA 4MUBA 1NIJA 3ADDA 3QXCA 2CNWA 4K46A 1IAQA 4KLZA 5TMPA 3CRRA 4NHOA 3S1AA 3NBFA 2MMGA 3P4XA 4URVR 4NL4H 3UKDA 2GEDA 2V6IA 1IN4A 4LK2A 3A6PC 3HYRA 3AF1A 4ABYA 1KMQA 4I4LA 5CIWA 4PC7A 4X8OA 1ESMA 4EAQA 5JWRA 4S35A 1UF9A 4B76A 4AYWA 5J4KA 2YVUA 1IXRC 4ZDKA 2BWJA 3OE7D 3A37A 1DE0A 2RH5A 5CB8A 4DSTA 1H8ED 2ZRNA 3WHKA 2RB4A 1W44A 1HTWA 2IF2A 1CJMA 4HDOB 1QHIA 1E2NA 1XD8A 1FFHA 3BFXA 4DLVA 4DDTA 1RE0A 1M34E 3EASA 1L7VC 2AFHE 1R10A 3K0FA 1SXJB 3CNNA 1UJ2A 1XXHA 1IJEA 3F8TA 1XJCA 4UJ5A 4CEJA 1GNPA 2FV8A 1DADA 3M1IA 4UKDA 4EPXA 4UNPA 3IDQA 3Q9LA 4NP6A 4EIWA 2VP5A 2ORVA 3DKVA 4YMUA 1KDOA 1YKSA 4BEBA 2BVNA 4KU4A 4EPTA 3AVQA 4WZBE 1E1RA 1ODFA 1DO0A 1H8HA 1O87A 1VCOA 3CM0A 3KJIA 2ODWA 3DMDA 1I4TD 3WXMA 2AKYA 1KO1A 2QL6A 2VHCA 3U3KA 2ZM5A 1TAGA 1LW7A 4OBEA 3BIFA 1X1SA 1Z08A 1KHTA 2OLKA 4P31A 1ZVQA 2XITA 3LWNA 3KFVA 2FWRA 3L8ZA 2WIAA 1KAOA 3QG1A 2ZIAA 4IHQA 3I5XA 1II9A 4LC0A 3PR1A 1XCGB 4R98A 1RRCA 3HU3A 5FPYA 4IDNA 2QEQA 3K8YA 1VYTA 1TQDA 1W46A 2O8FB 3LVQE 1VECA 2HT1A 4JLJA 6Q21A 1I2MA 3K70C 2VSOA 4GP6A 3IHWA 4BASA 1XCPA 2GESA 4PO9A 3SQXA 4LPSA 3LAWA 4BRWA 3U60B 1W36B 3REFA 1VYUA 2DR3A 4C0SA 1TQ4A 2CVHA 4O2LA 5EE1A 2V3CC 4JKYA 5C46F 4IOJA 3NH6A 1MT0A 3A58B 1IN7A 1QVAA 4TSFA 4QG7A 3U2QA 5IT5A 3L0OA 2ERYA 2VBCA 1WCV1 4KI0A 5H68A 3AVVA 2EU8A 5JEEA 2F1IA 1G5TA 2ZVQX 3TK1A 3IO3A 3BFVA 3SN6A 2YOHA 3BOSA 1NKSA 3AVPA 1OYWA 2BCGY 3SHWA 2B92A 1AS3A 3IILA 4KFSA 1HH4A 3OE7A 2CHQA 4HAUA 2IYTA 1N6IA 2FU5C 4BZQA 1P9NA 3PIRA 2WTUA 4Q9JA 1TMKA 3OZXA 1E0AA 3GJ6A 1P2TA 3ADKA 1N5LA 1CR0A 2ZRLA 2HEIA 3LX8A 2DWQA 1NY6A 3TAUA 5G53C 4TMWA 1N0VC 2PJRA 4C7OB 1FL9A 2ZROA 1Z3IX 3ZVNA 4I81A 3BXZA 4C0QC 4CDGA 3BE4A 4OHVA 4WZ6A 4TL8A 4LHYA 4TQUS 4EJSB 2QAJA 1S0UA 5AJYA 3AUYA 3KQHA 2ZRCA 4LDJA 2A30A 4YXWA 3LO5A 4ZDWA 1Q0UA 2AWOA 3KXLA 5BW8A 2Q0HA 2XB4A 4OI4A 4RD6A 4MYTA 3QF4A 4NBSA 2BV3A 3SS8A 3W6OA 1N6PA 5BN3A 3NC1C 2QUZA 3QENA 1MO6A 2ZE8A 3QEOA 1GWNA 3S1AB 4CEHB 2ODEA 2RMKA 3L8YA 3ZVLA 2EQBA 3KX2A 3B85A 2UKDA 1M74A 3EC1A 4TL9A 4BQSA 3FE2A 1G4UR 3ZQJA 4NCHA 5G41A 3THYA 3B1YA 3TNFA 2HCBA 4Q5IA 1GIAA 3QNUA 3UG7A 5EUMA 4EPRA 4QBGB 2PMKA 3BRWD 3RYTC 1G64A 1XDBA 1XMIA 4FWTA 2GILA 2QY9A 4B34A 1B0UA 1UKVY 3QXXA 1Z8FA 4FMCF 5CB6A 1JR3D 2HLDD 4QC2A 4DJTA 1ZUIA 3TSOA 3AP3A 4NCNA 1O3YA 2FFHA 1HQCA 3K0FB 1IXSB 2QP9X 1L2TA 5FUYA 1K5GA 2WJJA 3EZ2A 4E22A 1GP2A 5FOSA 3TVTA 4D0NA 1CBUA 4M9SA 4CEJB 1X6VA 3SBEA 2JDID 5FTJA 4KVAA 1Z63A 3ZVMA 4H1UA 4JT4A 4LV5B 4JJZA 2FZLA 5EP2A 1VTKA 1SKYE 4C2TA 3EPJA 2BBWA 3IIJA 2RKOA 2J41A 1OKKA 2QMUA 5EP3A 4DDVA 4MKFA 2ZJZA 4DLRA 3CF0A 1P62B 2NO6A 3NVAA 3WRXC 2FSIA 2HUPA 2WKQA 3CONA 5EE0A 3CNOA 3OEED 3RS4A 1E9EA 2HXSA 3GLHA 1LS6A 3NBZC 4RY2A 3QSYA 3LX5A 4GT1A 5DGXA 2FH5B 3FMIA 4PSVA 2IHYA 5KNBA 2WWFA 4LJ5A 2FGJA 2KBEA 2C9YA 3B1WA 2FOLA 3C15C 4JLOA 5SZIA 4I1SA 4RVCA 4D0GA 1CEEA 1T0HB 2HF8A 3CW2A 5DO9A 1EGAA 2BKUA 2JJ2D 2ZJ2A 2XZOA 1FX0B 4KSCA 4US1R 1CJVC 2BM1A 2ZXUA 4DLWA 2WV9A 3B13B 5FI0B 1Z6GA 4P3YA 4HLDA 1SHZA 3I92A 3LXRA 4BGDA 1KSJA 3EA0A 1OXXK 3IQWA 1GZSA 1P7CA 2O8EA 1W0KD 5CJPA 4OHYA 3MSXA 4DEYA 3KDSE 1R0ZA 1KMHB 4LBWA 2J1LA 4D4KA 4PQFA 4PFSA 3CB4A 2XOKD 3SBDA 4XIGS 2JJ1D 1SHKA 3BERA 4TYNA 4Y0VA 4BZPA 2AWNA 4DBLC 2FA9A 2OZEA 1VIAA 3NKVA 3Q3JB 3E2IA 1JQJC 2ZE5A 2DFNA 3Q7PA 3SJCA 3I61A 3FB4A 1P60A 2JIZD 4R2IA 3WMFA 1MO4A 1R5NA 1P73A 4Q4AA 2V1XA 4LJ6A 1RIFA 2RAPA 3P4YA 3MD0A 4CT4B 4MGYR 1OW3B 3HR7A 1TU4A 4LHZA 2RGCA 5E7IA 1NLFA 1IN8A 3B6EA 2AHOA 3MGCA 3SI7A 5AUQA 5FPSA 1NVVQ 1OIVA 1HUQA 1Z0AA 3FYHA 1R4AA 5C18A 3FMOB 1ZCAA 4D6PA 5TB5A 1Q20A 4LRWA 4PHHA 2NG1A 3SJAA 5G40A 4ZI3A 1S8FA 5C1BA 4JSTA 4M1YA 2PT5A 4I1VA 3QIAA 1A5TA 1MV5A 1G3QA 4W5WA 2I4IA 4GDFA 2O52A 2GCOB 2A5FA 1KDRA 2QBYA 4LYHA 1N6OA 2J0UB 1E99A 1F48A 4P4SA 3KJEA 4OL0A 3GJ7A 1FNNA 2IL1A 1XMJA 1PZNA 4XVRA 1OE0A 2W58A 4C3ZA 2IS1A 2KSQA 5CIQA 1YRAA 2FG5A 2WWXA 3ASYA 3T35A 5H70A 5FBVB 1A4RA 1RJ9A 1ZU5A 2OG2A 4OQLA 4DSUA 3BJIC 3IQXA 2W0MA 3OEEA 5LBIA 2F43A 5GJVC 2WWIA 1JR3E 4G01B 5B30A 1OXUA 1KYIA 1MOZA 2VP4A 2WWYA 3MJHA 5LD2B 2FMXA 4H1VA 4Q1EA 1SKYB 2CJWB 2OCPA 3QQ5A 4E5UA 4B33A 3SYKA 1BH2A 1BKDR 2JJ2A 1IY0A 2QAGB 3C41J 1E9BA 1UKZA 3PENA 2G83A 4ITRC 1FMLA 2UZ3A 4JLMA 5FBWB 3N2IA 3DM5A 2WWHA 3KFXA 4PHGA 3U7HB 3QJYA 1W0KA 4LV6A 3IEVA 3ZVRA 5LDDC 1GNRA 3FVQA 3V4FA 821PA 3ZIAD 4FCVA 1YR8A 3BAFA 1KZ7B 1XD9A 2WWGA 5EE3A 3FDIA 3WNDA 4JLBA 1CP2A 1NF3A 2IUTA 3RS3A 2QROA 4R9UC 1ZNWA 2IC5A 2OHFA 1EX6A 1M7GA 3DKPA 3C5CA 1Z29A 4W5JA 1JPNA 1Z22A 2WKRA 3OIUA 1DTSA 2GJAA 5FUXA 4A92A 1UBCA 2OAQ1 5FTMA 2DB3A 4MA4A 1JALA 4DCNA 1KI7A 4D0LB 4G5RA 3QKSB 1CS4C 5JWHA 3EZ7A 3M0EA 2PEZA 1E98A 5GJCA 1E9AA 1WRBA 1D6JA 3QE0A 1G5RA 1EESA 1Z6AA 3KQNA 221PA 3TSZA 4EFLA 2ZSBA 3CNLA 4JVLA 4UNSA 1AM4D 2EFGA 3LNCA 1IN6A 5JJLA 2PH1A 4XVUA 1CXZA 1CTQA 3B9PA 3NHAA 1QHGA 1C4OA 1Q1QA 2RHDA 4L15A 4QGGA 1XTSA 3CWZA 2ERXA 2V55B 4C0KA 3FMPB 1A82A 3DPUA 4US2R 1U90A 3TBKA 5CLQA 1KKMA 3MWJA 1RC8A 5F9FA 1XCMA 2HDNB 4DVGA 2VHJA 3BS4A 1XPRA 2C96A 2YOGA 5FOTA 1JEDA 2ZAOA 1AQUA 1CJKC 4HLUA 2XTMA 2I1VB 4LX0A 2W2TA 1SVOA 2UZIR 5EZ6B 4KV9A 3V4RA 3ZQ6A 1Z07A 4CEIA 3QPWA 3OF5A 1B23P 3LY5A 4X8MA 1EX7A 5K8TA 1J8YF 2JCSA 4WAUA 4AK9A 2YWFA 3GJ8A 3L0SA 5BWMA 1M8PA 1ZRHA 2Q3HA 1SVKA 4YMWA 2GXAA 3CRVA 3PCRB 4PAQA 2X19A 4DDUA 3ZLJA 5KNDA 1DS6A 5TDHA 2DFKB 4TLCA 2BOVA 1ZNYA 2ZEJA 3ND9A 1IY2A 1YVDA 4LPKA 5EP1A 5FR1A 4UNNA 3VKGA 2F1RA 4GP7A 4JS0A 1LF0A 4Q4AB 1AQYA 2GBLC 5E3HA 3IIMA 2JLZA 1XEFA 1BMFA 1E2MA 3B8HA 3L2OB 1P3JA 3VR3A 4HLCA 1JPJA 4GMXA 3QKUA 4A2WA 2ONKA 4Q1FA 5JSZB 3TIFA 5JCZA 1Z6XA 4GOXA 4WXPA 4DLUA 3VR2A 1GNQA 4AD8A 4BUJA 3H0KA 3U44A 1ZM2A 4CVNA 1LFDB 1W4CA 4S2EA 2B21A 2XZLA 4D82A 3MRSA 4LYJA 3BWDD 2ZE6A 5JS8A 2N42A 2ZSDA 2P6RA 2NGRA 3HYTA 3R9XA 2ZYVX 2XZPA 5KYKA 2IEZA 1G41A 4URXR 3CIOA 2GF0A 4ZO4A 1T4GA 1N5KA 1F6BA 3W90A 2QBYB 1P4SA 4P4SB 1TU3A 3RC3A 1KOFA 1XZPA 2IXEA 4TT3D 4AY2A 2AFIE 4H9GA 3Q72A 1Q22A 2WSSD 1WXQA 5CITA 1CRPA 4CRWB 2AN9A 1CJUC 1U8AA 4W7SA 3UATA 3I8SA 2NO9A 4M8NE 3HPQA 4BE7B 1GAJA 2W6JD 2YWHA 3LD9A 4Q21A 4TLAA 2OEPA 3RSOA 1CULC 2ZU0C 5B57C 2FSHA 3KL4A 2IYZA 3C4JA 2JAQA 3K09A 1SVMA 2MSEB 4UXHA 1R5BA 3IBGA 3NXSA 1KSFX 1Q44A 4NCKA 2H7VA 2I1QA 4PPQA 1N5JA 5E4FA 2D2FA 4D4LA 5JBQA 4TYPA 3FKQA 4KYUA 2ZE7A 1ZCBA 3SFZA 2VP6A 4JLDA 1E69A 1SKQA 1QDEA 3GQBA 3ZZ0A 5IF9A 1FZQA 2X8AA 1GKYA 4BFZA 4L5BA 4XWAA 1W48A 4EPWA 5K8IA 4JSYA 1R5OA 4Q4HB 5E7JA 3CR7A 2O8FA 3EZFA 4JBYA 5TVKA 1UKYA 2OBMA 4BFYA 3FHTA 1Q3HA 1ZIPA 4LV8B 4LHWA 4TTPA 2J59A 2QTFA 4FW9A 1G8PA 4MYUA 5CK5A 4YMVA 5EXXA 3GP8A 5FL7A 3OFND 4DDWA 4M1TA 5FOVA 1LVGA 2VHQA 4LY6A 2IUUA 2IS6A 2BKEA 1GILA 1ZD9A 2WM9B 2RGNA 1G19A 3ETLA 3K0CA 2ANCA 4TLBA 4B3CA 4EFNA 721PA 3T1TA 3PUWA 4RZ3A 4NMMA 4LGMA 4EUNA 1DO2A 3IPYA 3VU9A 3QEJA 1KK3A 2XX3A 1IQPA 1HT1E 4FMBB 1E2EA 3KZ1E 1U8ZA 5CDFE 3I8XA 4DLYA 2B7BA 2C78A 4JLAA 1X8KA 4B2PA 3AVUA 2EWVA 3THXB 5HE9A 4A82A 4AYXA 3VNVA 1SVWA 2CXXA 2AL7A 2GF9A 2PCJA 2IYUA 1YZLA 4MDEA 3AH8A 3U7FB 5JHGB 1FP6A 5HR5A 3LDAA 3RWOA 2HXYA 2CE2X 1TF5A 2IEYA 1RKBA 3QKTA 4M2LA 2PLFA 3DZ8A 3O8CA 4ESVA 2AD5A 1GFIA 1OFUX 1E2LA 3K1JA 2DYKA 4M1SA 1P75A 1JB1A 4Q9IA 1EFUA 2QGNA 2GEUA 2Q9AA 4M53A 5DN6D 3DHWC 4C7OA 4TZ6A 1OT3A 1E2HA 2GXQA 1HE1C 4EDHA 2BC9A 1II8A 4EJSA 4TL6A 2VHTA 3W8NA 2ZS7A 1Q12A 2WZQA 3VAAA 5DYGA 3RRYA 5FPTA 3TQCA 1TX4B 2BIFA 4NKRA 5HZKA 3VQTA 1OB5A 4CW7A 4CEIB 2W6JA 1T6NA 2ZUDA 4URWR 1R7RA 4FMDF 4QJ4A 4B3GA 4P0TA 3RVBA 1OXSC 2F1HA 4CEHA 2J0VA 2GXUA 1Z2AA 1R0YA 5F2EA 1DARA 4B44A 2R62A 4FIDA 4LHVA 1W49A 4HB3A 5GJWC 1Q57A 1ZIOA 2IX3A 5KPJA 4OI2A 4JMPA 1FTSA 2VP0A 4WVFA 4BWYA 2CVFA 2H8KA 1Q1BA 1MO3A 2JJ8A 4M1MA 4ASUA 3U44B 1OV4A 4WIAA 2GVDC 3NBYC 3OFNA 1ZAKA 4JL6A 4C0JA 1JI0A 3A4MA 5KDOA 2CK3D 1AZTA 4EQ6B 4CYMA 2R6GA 3B78A 4HYYA 5AJVB 3I4LA 4TMXA 1UDXA 2QTHA 1DOAA 1Z06A 5DI3B 4KODA
chains in the Genus database with same CATH superfamily
4RHYA 4NZ9A 4I0WB 1ZQ1A 2A78A 5JXIA 3IQHX 3L1KA 4ALIA 4BHTA 1AS0A 2X0DA 2Q9BA 2D2EA 1UPAA 1NY5A 1B93A 2JD2A 2QGZA 3KEFA 4P8RA 2BEVA 1J2JA 1FU8A 4Q3EA 4RJIA 5FUBA 3WQSB 1FTWA 2XXAB 1WJGA 3MS7A 2ZRMA 5AHWA 1N2SA 1MUUA 1N7JA 2FI1A 3AEXA 3BSYA 3BXOA 2WWWA 2R2GA 2PFGA 3HHPA 4G84A 5TPWB 4PHFA 2IA5A 3HA5A 1VYVA 1C9JA 3G0IA 3GHYA 3NIWA 1KZ6A 1XTIA 2CY0A 5AMXA 3ICEA 5C8YB 4H4CA 6GPBA 1D3AA 4B80A 2AOTA 3PXCX 4KRXA 3K5PA 4DEXA 1X1EA 4H3VA 3GL9A 1JIKA 1AO3A 2JRLA 1ESZA 1A5SB 1UWKA 4OK5A 2PKQO 1J25A 5IJXA 4BC1A 1T91A 1ND5A 1RWMA 3GLKA 3N5CA 4B83A 2BH9A 5HKKD 4NBNA 1E9SA 5BPFA 2I3DA 2GM9A 4D57A 2FY8A 3E7FA 1JIXA 3WYCA 4LJ7A 2FPMA 4DNPA 1ZNXA 3W3AD 1H1DA 1HLPA 2BBTA 3GJ3A 4R5HA 2C95A 3GLQA 2JPDA 3C3WA 3HH8A 2BE9A 2BM0A 5I8WA 2NUPB 3DMRA 3OHMA 2EVWX 1IUKA 8AT1A 1DKPA 4DM3A 5JT1A 5ENDA 4A8JC 2ZRPA 3W9SA 5HA5A 4KOEC 4AI6A 1FNDA 4ILEA 2QMYA 2KPOA 2D7JA 3UAVA 4PBTA 2VLIA 4A1FA 3LPNA 2GDZA 4PZLA 4KFRA 4XSVA 3EGEA 5CD9A 1CQJB 3AR7A 3FYUC 3K5IA 3DDOA 1GGJA 2BUAA 3NNDA 4MQEA 2GSWA 1RBQA 4CKEA 1I3KA 1YB4A 1E0KA 4DSZA 4DCUA 3V97A 3MCAA 3TSAA 1V43A 3J80A 4B6EA 2DKNA 3I9FA 4JR2A 2BKAA 1N6KA 4PPGA 2HC9A 5LXTF 2CHUA 1LS1A 3WLNA 3ZI7A 2O2EA 5BXQC 4OYRA 4DA7A 3K92A 1D8AA 4ONEA 1YS9A 5AXAA 1WB5A 4QHYA 1YI8A 2IHVA 2G82A 4ALKA 5LYYA 1B2LA 2Q4DA 2YCLA 1SKAA 2DUWA 3AUUA 3QW2A 4P3KA 3IELA 3DBIA 4BQOA 2DBYA 4S05A 4YA6A 4AZ3B 4IXTA 1M2HA 1KEPA 2XUPA 3CX8A 1K6EA 1UOQA 4HDMA 4JLWA 3OKPA 1H8EA 2PBLA 5DM4A 2XT9A 3GVIA 4IG9A 1JR4A 1U94A 2BFCB 5DYTA 2RE8A 2CDCA 2GWHA 2WHRA 3IR6A 4RVNA 1HQKA 2C3YA 3BG5A 3ZYCA 1QCCA 2O5RA 2VSNA 2M6KA 4X7PA 4YP7A 1JBQA 2O0KA 3RAGA 3H2IA 4HAVA 4ND8B 4YIKA 5F7JA 3UJ8A 4X8LA 2IW3A 1FTNA 3VSDA 2OAGA 4Z9FA 4B45A 4F9EA 2AG1A 2WFZA 3VNSA 3LSYA 4GM1A 4G6ZA 3RSFA 1TPZA 1SRQA 1X0XA 1ZC4A 1ZRNA 4MMXB 4HPXB 1C80A 2J6CA 5EXPA 3VHLB 1FMFA 4DR7B 4DYHA 2GCOA 2NAFA 3BK7A 2EDAA 3JYOA 5CUQA 1GQOA 3ESXA 4D9JA 4EYSA 4C2UA 2OUIA 1PDOA 1TJNA 3CX3A 3K1YA 2ZPTX 3M2TA 4F4HA 2EZ8A 5FTNA 3RYIA 4Q66C 1MIOB 1GRCA 1RJDA 2X7XA 2ZK7A 4Y1RB 4E11A 3PXBA 1KI2A 5ALMA 3P2JA 4CLDA 4TZ0A 3HZHA 5AK3A 2F55A 3A0UA 3WV5A 4MQFA 2J3LA 3QKRA 3HXQA 1L5GB 1BOFA 1UT8A 2FZWA 4J7AA 5BMVB 2J30A 3R8FA 2I78A 5EJ4A 4LE2A 4RFLA 4F91B 4IHKA 4RPKA 1WUHS 4IIBA 2H4HA 2J9YB 4IF6A 5EHGA 2CJWA 2JEZA 4Q19A 4RL6A 4IXDA 3CCCA 1S2IA 5AVWA 3FOFC 1C1DB 1N0WA 4OXXA 4UUQA 1X77A 1GUBA 4HEA6 3HXTA 3OT5A 4HVAA 3DDCA 4AUMA 3DO6A 1GAEO 3MRTA 3WR5A 3O1IC 3K6SB 1OJLA 3S27A 1N6HA 1OLSB 4QTZA 2PZJA 1N2HA 2PCLA 4XLZA 3LUGA 3EPLA 3HV0A 3E18A 1EK6A 3NM5A 1H2AS 4FYKA 3LPMA 4N5MA 1ZR2A 3QIVA 4TRNA 3PX3A 4HFNA 1BYIA 1G7RA 2G76A 4FHEA 4NU0A 3ZE6A 3QY0A 3F73A 4Z1MA 2Q3LA 2YJ4A 3HE3A 1JWBB 4AX4A 5C34B 5C53B 3F9RA 4LMBA 4OYHA 2PEYA 1M10A 1X86B 3CN9A 4ARSA 3CJQA 1EFRA 2R6ZA 3FHCB 1JMVA 5B2FA 4HSEA 1EEXB 1ZRMA 4IX1A 2RI0A 1B42A 2RBGA 4C5CA 1QF6A 1F2UB 4R71A 2L0XA 1XYYA 1BD3A 1MB2A 3F7NA 4FFSA 1SXJC 5JS6A 3PUYA 4Y6RA 1PZGA 5I7EA 1U7TA 2XQKA 3F5SA 4JYBA 4JBNA 1E2GA 4WGGA 1RABA 1SQ6A 3FF4A 3E15A 3ECCA 1NSYA 1KOJA 5FHRA 4U7WA 2GHRA 3TKAA 1I6MA 1SRRA 3IEUA 3DZDA 5F64A 3WYBA 3KU1A 2V4ZA 1B8UA 4RKFA 4RQTA 2XHEA 2YWGA 5E6SB 3ZK9A 4DQUA 2V45A 3N8HA 1SIWA 3BL6A 4X44A 3DE2X 3L0CA 1GO2A 4QDXA 1IC6A 3KKNA 2W4IA 4IOKA 1TJ3A 4UXJA 1NJ5A 2P5UA 4MKZA 4N12A 4WRRA 5FFNA 5JJBA 3VKHA 2OQ2A 3DNMA 4KMSA 3DZGA 4D81A 4QXAA 3FM9A 3UWSA 1JGTA 2PIDA 4TLEA 5F77A 4PQRA 4DV7B 2R65A 2FPUA 3D31A 3DLCA 3K6KA 1A7AA 1RPTA 1T2FA 2VP3A 4G1VA 3QVLA 1BMDA 4LUCA 4N3NA 2GBCA 3AY3A 1DV1A 3ITKA 3ZJUA 2YJ5A 4I9UA 5IYZF 4DSOA 1UXIA 3Q5GA 1NM5A 1ZX1A 1H5UA 1HKUA 3UK0A 3ONFA 3K9HA 1XA3A 2W8BB 4TVBA 1JH8A 4PC2A 2ZIGA 2XR1A 3WMXA 2R5NA 4Y2TA 1ZI6A 1PJTA 5EOVA 4MQEB 5A9TA 4DDHA 1ZCZA 4PYLA 3N28A 4CGYA 3VYUB 4EHKA 2CWWA 4PG6A 4UVDA 4BMZA 1P81A 3B5IA 2BISA 4WFIA 2E4AA 3IOYA 5M04A 1ECCA 2TMDA 4MKGA 3W04A 1W36C 1JEYB 4DR2B 1JJ7A 1NDQA 2SKDA 2WQ7A 5JXWA 3HDJA 1OZGA 3B6IA 3FFXA 3H8JA 5F5NA 3G2QA 4C06A 4E70A 3DBLA 2ECQA 3CEHA 4CU5A 1YBAA 3HFGA 1UQRA 1HQDA 1O77A 1PTKA 3DWGA 3FNGA 3BYZA 4IOMA 3X2FA 4IICA 2UUBB 4NU8X 2J0SA 2P9QA 1JLMA 1XOIA 4JFRA 2R3SA 4LJYA 1SU6A 2BYTA 2Y3IA 3KU4A 5KDDA 1MXHA 4CMCA 4BEJA 4HDMB 4ERNA 2C1EA 2FP4B 3BRWA 4I4CA 3WGGA 4QTXA 4L78A 4KP7A 1L7XA 4O1MA 3ZTTA 2PYDA 3SZLA 1JHVA 4ECAA 3BD9A 2X15A 4IJQA 1T34A 1TMOA 2ETVA 2FN7A 2OCBA 5DNVA 4ZHQA 1DKMA 4HWSA 5HCNA 3DHNA 1WXWA 4G1CA 3W3ZB 4B2IA 4B0PA 2FOXA 4YROA 3P0FA 1NQUA 1RWOA 4MV7A 2Z5FA 3BICA 1T0BA 4PRKA 5H1YA 1NU6A 3C6MA 3GR6A 1NBMA 2I3AA 4EO4A 3A8TA 4JI1B 4D3DA 2E9SA 2PH7A 3PEUA 4XM2A 1GRRA 2OGTA 2P4SA 3Q6NA 1N2OA 3PHHA 4TTJA 4JJEA 1MOQA 1NW7A 2OFXA 5JYDA 1C8KA 2AX4A 2PWYA 3COSA 3OFVA 3AEUA 4A8HA 2L17A 1JEOA 5ILGA 2PMBA 3WX0A 4C0WA 2IYNA 4C87A 2QLLA 3H9QA 3HY6A 3W34A 4GLJA 5EMKA 4FR0A 4J91A 3RYIB 4ZCLA 2HQRA 3KYCB 3R6TA 1I7SB 3OLVA 4NG4A 4EJSC 4EY7A 3KOMA 3L4BA 3PCTA 4XEUA 1GY8A 4G5QA 3L0BA 5F4ZA 5K0CA 4KX3A 1QE3A 4JP5A 2X77A 3QKRB 4RJLA 4MIOA 2IHZA 3HPRA 1P45A 3F90A 1TAUA 1CKEA 3I9MA 4C88A 2PZEA 4QU5A 1QOZA 2LDXA 2IT1A 3T9EA 2ZI6A 3FCUB 4KJZA 5J63A 3UKJA 3DR5A 3NC0C 1LLQA 2H4JA 3M8KA 4M7WA 4F93B 6ABPA 5KAPA 3HK2A 2I80A 1NBME 4DE5A 1BCRA 2NPIA 4X92A 3W05A 1YDEA 3EVAA 2ZPUA 4DJEC 6CHYA 3UMYA 1MC4A 3BH6A 5F7ZA 1NVAA 1PKEA 3DAHA 3H3XA 1UEXC 1Q1AA 3HV2A 3LP6A 2J6BA 3A7EA 4F9TA 4HQ0A 1C9EA 2MYPA 3QVTA 1XYGA 3CW9A 2YXBA 3M6WA 1CR1A 1O95A 4EY4A 1ZW6A 4RZQA 2BJVA 5G1PA 4WDQA 3JQAA 2V7GA 4TS1A 2I2BA 1JQKA 2FMKA 1J1ZA 2DJIA 2XQGA 3C5VA 3H1FA 4PRLA 3LCUA 4C03A 1NMSA 1PQPA 4V03A 4HRYA 4HH1A 2GZAA 4EW6A 5K99A 1KC1A 4DB2A 2XUKA 4QFMA 4XUCA 1KFJB 1P5JA 3R7AA 2XUHA 3G9XA 2GAJA 5FCDA 3FLBA 1D09A 1NJFA 1D6MA 2GEVA 1CIVA 4WDRA 4FFNA 2G4VA 1JA0A 3HGTA 4Q9AA 4Y0AA 1P80A 1P31A 2H29A 2P67A 4FFLA 4YMSA 1WSDA 5A2GA 3ADCA 3QYAA 4V0OA 4YUVA 2GJ8A 3GJ4A 4DUYB 1ZMTA 2NO1A 4LVNA 4LOLA 4RFSB 2R47A 2I0FA 5BSUA 1RYYA 1QGOA 4BUZA 3JQFC 4DDMA 2CL7X 3R44A 3KKPA 4INAA 1DCKA 2XGGA 1DLIA 2OTCA 1A71A 5KDLA 3ENWA 3ZTYA 1UMCB 2EKBA 2J5RA 2PKCA 2R2AA 2FYTA 4LZOA 4F7WA 3HCAA 4ARBA 3RH0A 3MAGA 1IL0A 1V7QA 3VOSA 2ZRAA 3R20A 3EYAA 2IEDA 4NAUA 1N0UA 2OBYA 3KQQA 3S3TA 2CT8A 2W9XA 1R00A 1V5WA 3LFUA 4IGAA 4MTCA 3ZHTA 2L19A 4ZGWA 1VLQA 2IYPA 2VPYA 4IYJA 1UT5A 5TMDA 3SYMA 3VO8A 1BX3A 4GR9A 4JLNA 5HIIA 5BUCA 1JE1A 1THMA 2GFIA 3GROA 1HGXA 1MC8A 4NTZA 1MNAA 3TE7A 4ZYYA 2IGBA 4CE6A 4BU0A 3T7JA 3WFJA 4U6NA 3L7MA 5AYVA 3TD6A 2QMHA 3CTPA 1ZZEA 2VQSA 2HR1A 4JZKA 4EF5A 1QIDA 5BOSA 3IVAA 1E7SA 3PC8C 2P0EA 4LY0A 3QELA 3C1TA 3NRJA 2XNDA 3QBVA 5HUJA 3SHFA 5HUHA 1KTVA 3WLOA 3O31A 4M60A 2DG2A 4FZ3A 3E70C 4OQQA 4B79A 1UK7A 3WBJA 4ZOCA 5CD1A 3PUVA 5J2UA 5TY0A 5D3ZA 1LGYA 2EFCB 2ZJ1A 3JWJA 3O93A 3I42A 4NCIA 1MNQA 3LDUA 3TZKA 1ECJA 3GV0A 1N0IA 5AUPB 2H9IA 1W1WA 2GA8A 3GUUA 4DZTA 3WK8A 2J46A 1C81A 3H2ZA 2W6ID 4YRSA 4GPD1 1RZ3A 2AS0A 3NVDA 5EL0A 1GL3A 5AVOA 4CI0B 1RT9A 4KVFA 3GDFA 4JJ8A 3VHXB 3I64A 4LOJA 2QQ0A 4Q3BA 4DQVA 4OBXA 2IYXA 3FPJA 2XMCA 4JDPA 5CH8A 3TB4A 4C0AC 1SXGA 3KOOA 4X3CA 4F86A 1NG9A 1SCKA 5FLEX 4I1IA 2Z1DA 3DLIA 1EDZA 3QVVA 3SDSA 2ZBUA 3MJEA 4I1UA 5HK8A 4U5XA 3KB1A 1R0LA 3P8ZA 1NMQA 1ZUNB 4GVLA 2IYWA 3B1KA 4TKVB 4GD3Q 3FAZA 3RUEA 1GDTA 3WFZA 3WLQA 4GX0A 3Q41A 3GEPA 4L6AA 1Z6TA 5ITVA 4Q1VA 3VC7A 2NUAA 1P17A 2I3GA 4NYMQ 3MJ4A 1MB0A 1TK2A 3EAQA 3LM8A 1L5WA 3PSHA 4Q7KA 3HGQA 4ZALA 3TZQA 3X1YA 4HRAA 3VR4H 4A36A 3IPXA 3ZY3A 4EQ6A 1SCNE 2BFEA 3UWKA 1NXXA 4G63A 1NP3A 3AEUB 3H19A 1MAWA 1OWOA 2H16A 2B7CA 4EUEA 3Q3VA 4M0LA 3DV9A 4LOAA 1J7JA 4E1AA 3I0NA 2X1VA 2ZAYA 1FQWA 3STTA 4F92B 1EUZA 4FGZA 1LDMA 1GTVA 2MTBA 3CZ9A 5AJZA 1E79A 3OEWA 2GRUA 2JGMA 5CNKA 5EVJA 3B20A 4PFJA 4C43A 1EG2A 2EW2A 3HCFA 5EXSA 3CE9A 1PJCA 3FNFA 1IUPA 1K8ZB 1P4GA 1X7GA 1Y1PA 4DIDA 1G2OA 1OLOA 2YINC 1ISRA 2RG7A 2DH6A 2O1SA 1KPHA 2QQFA 2H11A 2VHUA 3GRAA 2IXAA 3A36A 1Q0SA 1U7XA 2DECA 2VTDA 4QAJA 5IK2D 1BVYF 2VHWA 1HQYE 3ANXA 5CPFA 4S04A 1Y9DA 1VG8A 2X0KA 2Y2UA 1WOMA 2VJMB 4ZQBA 1C7IA 4TLMB 2P8JA 4UHDA 3QG5A 1U7OA 2J5XA 2OBNA 1TK9A 2NTYC 4GSKA 3ZHQA 3VU1A 2H07A 2PD4A 5MFPA 3MINA 3PE4A 5FBQB 5L4NA 2C77A 1RFLA 1WW2A 1YS7A 4K88A 1EM6A 3JAWB 2GAOA 4YDHB 3IV7A 3V7YA 4BNHA 4BO8A 2K7ZA 2O7QA 4AY3A 3AP2A 4DT1A 5LKRA 4U5QA 1J06A 1E7QA 1FSGA 1V1RA 3B38A 1ZU4A 5L3ZA 2NUBA 1S2LA 2Q2WA 3ICWA 1LNZA 1L7BA 1LRJA 3GVHA 2G17A 4U63A 2B8NA 1JIUA 1CZRA 3CRZA 4XGKA 3SGLA 3WB9A 2EC5A 2DXIA 3B3QA 3D54D 1TM3E 1DQNA 1U9IC 1VKJA 5A6VA 4X45A 3G0BA 4PG8A 1RXVA 4ZFNA 4ALJA 1NTRA 4FMPA 1QR6A 4N8EA 5JC8A 3MJSA 1UIMA 3CKLA 2FPKA 1NIPA 4LYGA 1HK7A 2O8BA 3H2GA 1FXUA 2YN0A 2RGBA 4XJTA 4Y6GB 5IC5A 4AZTA 4YRIA 2D1TA 5M5BA 2P65A 1KE2A 5IH3A 4MUJA 3EDYA 3RJ9A 5JCPA 2XYHA 4WD3A 3VDMA 1W5FA 1DU4A 5LN1A 1KU6A 2AR7A 2QYTA 4KH1A 1L8QA 3IDSA 3V2UA 1NQXA 3GLUA 1W5TA 4KYIB 4OKSA 3V6MA 5BNIA 3HLTA 2Y4OA 4GOMD 5E6UA 4AJJA 5BV7A 5BW4A 1RAEA 4EHHA 1XQWA 2QNIA 4PPNA 3RTGA 5DZSA 4YQZA 3U4QB 1QP7A 1XTPA 4BNDA 3TX2A 4NCBA 2QAIA 4GMFA 4RAOA 1E5VA 5CM9C 4OFBA 1WS6A 5CW2A 1PE0A 2VNKA 1QOQB 3CX6A 3DTYA 2XAUA 4LI0A 4ER5A 2O5EA 2M98A 1V5IA 1TNDA 3EJWA 2OO3A 3IPCA 3L9WA 4TTSA 5T6BA 3RS8A 5K45A 3FFBA 3V4VB 3HCRA 1MV8A 1PJBA 3DC2A 5FEMA 4YPFA 3OESA 1YAJA 3DL4A 1FDOA 2BT4A 3LQYA 5C8ZA 2CLEB 4KL8S 3H86A 3PVSA 1XUOA 3JYQA 4WKOA 2D0OB 3T9CA 4DF3A 1JSXA 4KSBA 3LFTA 1YB5A 1HSZA 4TYQA 1E1RD 4YP9A 1KFBB 1Y63A 2IFTA 2PWZA 3QELB 5B58T 1LQTA 5GZ1A 3ZUPA 1OBCA 4AWXA 2FWJA 2ZIEA 2W2XA 4QUAA 4OTZA 4HZUB 5K8CA 4BQFA 2Q41A 3HUUA 3V2GA 4OI0A 1I80A 1TJYA 1TQ2A 4I9HA 2JF0A 3WNVA 3UJ3X 1VHDA 1ZXLA 4M9QA 2CMKA 2Z09A 5ES3A 1ZD8A 4BVBA 4D5GA 1ACMA 4UBIA 2HMYB 2GS9A 3THWA 2QP3A 2HSEA 2MYUA 2VTBB 4RS3A 4PM4A 1RZRD 2QRUA 1XZMA 4X61A 4DUGA 2FW7A 5ECDA 3KQMA 4B5KA 4JXJA 2OFWA 1TF2A 3O8QA 5LKAA 1DT3A 3PUIA 1I7QB 3K1AB 3GG2A 1DXQA 1VIMA 4L07A 1I1HA 2B83A 2REQB 4Y9RA 4UNIA 4YUXA 3OWOA 4FN5A 1Z0ZA 4PG5A 4RD2A 2AA3A 5EZYB 3ZDZB 5DM70 3E4CA 4XWYA 3WK6A 2YYZA 3MOIA 1QV7A 4ETMA 5HS4A 4QVKA 4EA8A 4N0DA 4LXHA 3RSSA 2PNFA 1AN9A 3MOSA 5EIBD 4B3BA 1GAWA 1KP9A 4A23A 1URPA 4PIPA 3SE0A 3TLEA 1X0VA 3TW8B 1VB3A 4EKGA 1X1AA 4IIVA 2DSTA 4W9MC 5EIOA 4R6WA 1E4VA 1QHHA 4XCVA 5CVJA 5FI1B 2Q3CA 2X6QA 3NS7A 2NUAB 3SC4A 2WJVA 1XKTA 1T43A 4OM7A 4RA6A 1DIGA 2NUTB 5TEWA 4AUKA 4C0BA 1UPUA 4ZHQF 1WMFA 3ZHBA 2QTGA 2HMTA 6LDHA 2BFEB 3COWA 4CTKA 1DRKA 2J3DA 3RLFA 4BLSA 3T5DA 2FN9A 4ZDJA 3HABA 2G88A 5TJ9A 1Z4LA 3ESBA 1ZG3A 2VHXA 4FMCB 1Z88A 2HGZA 4NNOA 2I4TA 5LNK1 1XC7A 2XVXA 1Z5ZA 4N0EA 2AV6A 1UDRA 2P2NA 4DQ0A 2ZYDA 1PQWA 1X8JA 2ZSAA 3C8HA 3DVAB 3S5UA 4LRUA 3GIWA 3P9QA 2VJYA 5JD5A 2YJ6A 1MR3F 1RQ2A 4IIXA 3UOWA 2CMFA 3I9LA 4QNMA 4ITVA 3PYLA 4P5EA 4CWAA 1Z5PA 4CFZA 3RT1A 1UBGA 2W90A 4MCIA 1NXOA 4GRAA 1YJ5A 4BMNA 5IKPA 1NGSA 3K8OE 5J3JA 4J4HA 2H92A 5JV5A 3MK31 1E0JA 4PSKA 4WGFA 1JLLB 3GI1A 2Q3FA 2H2HA 4J49A 1IM2A 4R4JA 2P3LA 2UZ1B 4BNIA 1PQ4A 3E3AA 2NVUB 4R3NA 3LUDA 3MINB 3VSBA 3ICQB 3D7RA 3VR5H 4FFVA 2VTEA 3S1LA 4EGFA 3C7DB 3IVRA 4PYIA 3N74A 2PKXA 4Y2JA 1X1RA 1XQVA 1NVEA 4DT1B 2J9GA 3FZYA 3T7EA 3EMKA 2H63A 4O33A 4FOTA 1FLVA 4I55B 2HDHA 1M3SA 1VJ0A 5FQOA 2JC3A 3E0XA 3HA2A 2JLUA 3B6ZA 2X9LA 1XMPA 3DDHA 4TTIA 3OUUA 4IOLA 3K70B 4PYRA 3IBYA 2OFOA 2P5SA 5JBIA 4R1LA 2Q5QA 4L4UA 4WNAA 3LKVA 4MH0R 1XLVA 1XEXA 1HRKA 2BEWA 3E48A 3ENVA 5ESDA 2VPIA 1XX6A 1J8QA 2VYVA 1BQ3A 1RBMA 1LPBB 1Z83A 5FYQA 1LLUA 3MXTA 5H16A 2O8BB 3U48A 4JSRA 4KACA 4Q4DA 3NI2A 3KSZO 4MGHA 1XXHE 2FQ1A 4QFCA 5BRNA 1Y8ZA 4JP2A 2A9KA 3UA4A 4HMPA 3LY8A 2I33A 5HGXA 5I9IA 2Z83A 2HWWA 3PGA1 2M6LA 2ZT6A 4ND2A 3P9XA 2FR0A 1J23A 3TFQA 2BEKA 2FEMA 1DJMA 2QM0A 3JVVA 5JSYA 4I3HA 4CTJA 1DAFA 1CG6A 1SVNA 2PUVA 1KY4A 4CQMD 4IH4A 4LDPA 5CDGA 3BD6A 1IBRA 3AETB 4G0OA 3N87A 4MRVA 2AMJA 4NC9A 2F59A 1GRNA 2ZUCA 3UMFA 3UNXA 4HF7A 4BNDB 2WAAA 3MUEA 4WXRA 2RHTA 1SURA 1Q16A 1JAZA 1K92A 1DG3A 3ABSB 4F9GA 3RS5A 3GRZA 4EPYA 3DT6A 2R8RA 2J8ZA 1KK1A 2WJGA 1P5ZB 2CV2A 1LU9A 2AMYA 4J1SA 4G1FA 4UEOA 3DKIA 2HJSA 4FS8A 5L7WA 1ZEJA 4L4ZA 4MHTA 1JDPA 4QYIA 3QU9A 5E1OA 4F6CA 3ULKA 4OF4A 1Q1EA 3BKWA 1YDHA 1U81A 3NPMA 4KIJA 4C4YA 2BBSA 4EY6A 1S4QA 5ALDA 5I8PA 1R88A 5LSAA 2QF7A 1SELA 3GJXC 1COWD 4ME6A 4BKRA 2P1ZA 4R51A 4O5OA 1S1CA 5DBFA 4EJ6A 3I39X 4E5VA 2ST1A 4AW9A 1A8SA 2O7RA 2UUOA 1BKYA 1Q0PA 2ZI3A 4B73A 2OM2A 2VNSA 3FG9A 5AWFC 3SJZA 1XFDA 1T0UA 3OMLA 3D3WA 3GFPA 3OZVA 2DETA 3FTEA 4EVRA 1N2JA 4IINA 2CNDA 2G70A 3Q0IA 4XGIA 3QU4A 1U5BA 3ZXXA 2KMLA 1VCIA 3FHLA 1V3UA 3LBIA 1E1QA 1R18A 2P3OA 2ZAGA 4OM8A 1ONPA 5EUQB 3ZQ4A 2OCIA 1TZBA 1RQGA 4YAGA 2PUBA 4ISBA 3S0JA 2IXDA 1JQDA 1TFRA 5CIYA 2BGGA 3IR5A 1KP2A 2FUKA 4V3BA 3TM4A 2O3UA 4OG2A 2IUEA 4QO7A 4JH0A 4HWPA 2ORED 4N39A 1T24A 4FGUA 4E51A 5J2UF 4OQFA 1ZN2A 4UJ3A 3WGNA 4D9CA 3OLQA 3O8QB 5G3ZA 5A5GA 2NZWA 3Q5DA 4WA8A 1U0NA 3I62A 4NE9A 4BMVA 3M5PA 3TYXA 3MW8A 1ESDA 4OMDA 1J8VA 1U0OC 5AW5A 1RQXA 2QIOA 2VDWA 5I47A 4Z7NB 3E1SA 3OLWA 3PNLA 2JI6A 4EELA 5F2KA 1K0FA 2RGXA 3R0QA 9LDBA 1ZGHA 1G3MA 4ZVOA 1BRMA 1JXMA 1YHNA 4RIIA 1I3CA 1NXPA 5CYGA 3EZ6A 1LV8A 4XJVA 1P6XA 3I6IA 2OHIA 3DFMA 4ZIRA 4RA6B 1L7MA 3TQFA 5A0VA 2XCIA 1OXMA 3HWSA 3ZZTA 1AMOA 4TV8A 3K73O 5SZJA 1BOOA 5JJKA 5IT4A 5F3WB 1OGIA 3EPPA 3SEAA 5ITWA 4IDGA 1SPBS 2P11A 1H22A 4GE3A 4W6ZA 5C7OO 4MR7A 1U6JA 5IJ0B 1BEEA 3JZMA 4RVFA 1G8SA 1YL6A 2ZDGA 4LE0A 3PDIB 3ZNPA 1YBVA 4FR5A 4ND4A 5EFZA 2KJQA 4G5SA 4BBZA 3T9BA 1RRKA 2AK3A 2H5EA 5B2ZA 2B78A 3NAZA 2LE0A 1LCIA 3GBSA 2ZRGA 3L8GA 1Q7RA 4L16A 4ZO7A 4YAIA 1DIBA 1XDSA 3Q6IA 4RD4A 4QEZA 1BHJA 1YK1A 5EMJA 4PW0A 5BV1A 5LB4A 3P9IA 3R76A 2AZTA 3C8ZA 2Q7XA 3C8UA 4CMBA 3H13A 1E58A 2YZ2A 3GN2A 4OBBA 3SQNA 1WP9A 1XXHB 1UFVA 1E2QA 4N3CA 1SUFA 5BYBA 4M8IA 2QORA 3H6GA 1PR6A 3QFSA 5CYOA 4C4SA 1TQ6A 3QPUA 3KQSA 1CRLA 2H17A 5IULC 4OMFG 3FXAA 3R5HA 4HGQA 4JIGA 3STWA 3KETA 3FMGA 2B4QA 2WDZA 3DPSA 4JJAA 1L7NA 4Z8XA 2ZDHA 4E09A 5LMUB 5E1BA 4F5DA 4ZI2A 1CDOA 1WPGA 5TV2A 3RFTA 4CCSA 4QPNA 1UXGA 2I4NA 4ZC8A 3UJBA 1U3FA 2L82A 5AH0A 4D9MA 4D9IA 1HL7A 1XELA 3FPGA 2RARA 3FGOA 3IXMA 5AXCA 1RAAA 2GTHA 2GJKA 2W4QA 2V3VA 5CLIA 4EA7A 1D9XA 1JV2B 1TAHA 2DPMA 3Q9UA 2ZCVA 1JA9A 3O2SB 1JU9A 2P9CA 2E1PA 4ZICA 3LIPA 3D02A 3A6EA 4PYJA 1MO5A 5COQA 4ZQFA 4IQGA 4IVPA 1PLJA 3P9SA 1NE7A 4N47A 3MGAA 1M67A 3HJUA 4W1PA 4MRRA 3EFOA 2ZSEA 1XEXB 2PTGA 1G20A 4ZQCB 1JUDA 3WQQA 4GGPA 4IS2A 4MVJA 3ZXSA 4CIVA 2WB2A 3H1TA 2HQBA 3WRWA 3GWZA 3L40A 4R8KA 1OI7A 3DZBA 3HJRA 4MS3A 3TRIA 1JG1A 3WO1A 3WA7A 2B5OA 2CNOA 1Z75A 1GU0A 4U9UA 2J3EA 2E82A 5E2IA 3USCS 3GFTA 3USZA 1TM1E 3BEDA 5FDFA 3LTNC 2ZQ5A 4YV2A 1DBQA 3L7KA 5EZ5A 4I50B 4G1MB 3TVDA 4CDNA 1GAQA 2UVQA 4HI0E 5JEDA 3O75A 3D5TA 4LW8A 4UTRA 4Z6KA 5J2TA 1CV2A 1CT9A 4A91A 1P2SA 4H7DA 1CZHA 3EC2A 4L8LA 5SYNA 2BF4A 4M98A 5I7RA 1G63A 1A9XA 5LDHA 3GHHA 3ER8A 4X97A 1YH3A 1K7FB 1KO4A 1U9JA 1Y5MA 4PF1A 1JXOA 1QFYA 1Z25A 3R3UA 4MPDA 4D0RA 5GINE 1MPXA 5K0JA 3UAGA 3A31A 1GPAA 1K9VF 1DNPA 3VR5A 2O59A 4G81A 1UBMS 3E58A 3JQ6A 3LRTA 5JO0A 4F2PA 2ZRFA 1LLCA 3WMEA 5GTDA 4KXMA 1GPDG 2B4TO 2QZ9A 2UVPB 1C7EA 1N1GA 5F21A 5KUTA 3GPBA 4U7FA 1PDVA 1PWZA 4KCGA 1G20E 5K0BA 3JRWA 2EKQA 4H35A 3Q85A 1EM8A 3PR3A 1OILA 5FO1A 4JQCA 3UMSA 3T3PB 3KSAC 1E3JA 1GT91 1MRNA 3FKSD 1QVVA 1TTTA 1M1XB 1M76A 2ZUWA 3LT5A 5DLYA 1KVSA 4OFZA 2PQ6A 3V1NA 2VJDA 5SZKB 1ELOA 1M6NA 1P77A 2DOKA 4GOOD 1VJDA 2C42A 4FGWA 3DXYA 4OK6A 3PITA 1BD4A 2BMEA 3D3WB 3A1WA 3JQBA 3A10A 2PT7A 5BSHA 4MCAA 1IRXA 3CZRA 4R01A 1M8GA 1V9SA 1WCYA 4K6KA 1GTRA 3RUFA 2JGJA 4R7TA 1CUYA 1KDYA 2TECE 1TM7E 4KDEA 2QM7A 1QX4A 4M0FA 2JGEA 3PGJA 4TXNA 1SIBE 4RK4A 4CM3A 3W5IA 1ZAYA 1N1MA 1S9DA 2DBQA 3GQVA 1X7YB 1C29B 3NETA 4PBRA 1M9NA 3UV7A 3T3OA 2GN6A 2PMDA 3W9YA 2R00C 2XI4A 4IEFB 4RM3A 4DIKA 5FADA 1L7AA 3FWYA 2F9FA 4IVQA 5GV7A 2C57A 3HVKA 1O08A 3MLEA 5JECA 3TUZC 1I94B 3E53A 2P6OA 2ZI4A 3MPUA 4IFEA 4RY9A 1UIRA 3OURA 3MWDA 1YXMA 2JA1A 3AQ4A 5EQTA 2CHGA 1RVV1 4B4OA 2Z58A 1X7DA 3H8WA 4CMEC 4RM2A 3KQLA 4E03A 2RFLA 4P0PB 2HRBA 4B71A 1IEXA 4ZIRB 2DQZA 3WGLA 5JAMA 2ZJ3A 1ONOA 5H3CA 2PYIA 5EESA 3KVYA 2IPMA 2OZPA 4G1EB 4ZPJA 1YKGA 2WDPA 5IW8A 3AR5A 3GLIA 4Z1OA 1QGYA 5KC8A 2JBHA 3ORFA 3NWEA 1B7GO 1WXXA 1HDRA 2MMCA 4KQ6A 3GJZA 2JA2A 3T3EA 4C0LA 4NZNA 3LZCA 4QDTA 3C2QA 2ID7A 3BHIA 4PX2A 3O9VA 4ZOEA 3FY4A 3ZOZA 4AKTA 2IF0A 3JD2A 4LBZA 2PX8A 1L4GA 1EH5A 2H2GA 4K9KA 3G8AA 2Q4RA 4TWJA 3TQIA 4YLGA 4DGQA 5FWAA 3PJRA 4RY0A 4ZRNA 1L1RA 1Z28A 2WIFA 3LCCA 1PHPA 2CJFA 1WBDA 3LCJA 5ALRA 1MJFA 1YR7A 3IOBA 1FVXA 2VRWA 2JGRA 3UENA 4EG1A 4UHEA 2Y05A 4L3WA 4LVUA 1IPFA 4FBMA 3V7UA 4MKRA 1OFHA 4V0MA 3BMOA 3A4LA 3RVNA 3U4IA 2B2CA 2QN9A 1ABEA 2JH3A 3ANSA 4WK4B 2JIRA 3EIEA 1SXJD 4AN0A 3F4LA 1C0KA 2E37A 3AG6A 3AHEA 5FLYA 3T7RA 4E7OA 1NQ5A 4EG5A 1Z74A 2ZB8A 1QZXA 2YWRA 1JT2A 3B7GA 1U28C 3CBQA 4Q01A 4D26A 4YHHB 4D2IA 3OJOA 4KJXA 1CUBA 3PXEA 1OX4B 4Q4LA 5A2QA 1DJLA 4KITB 4DR6B 4XVHA 4XGQA 3ADBA 4YLYA 4YV0A 3H1EA 2KHZA 5AW7A 4CF7A 4A2CA 3N59A 5A7HA 2R11A 4L8FA 4F56A 2SCUA 4OGFA 4DCCA 2Q8NA 3ZY2A 4CTMA 3FWPA 3D7MA 2BR5A 3QHAA 3VM6A 1GKUB 1R6AA 2M1ZA 2ZTMA 5BQ5A 4EA6A 2ZREA 3PF9A 4IHJB 3SBOA 1N8TA 2ZS9A 4HWTA 4E5YA 3T34A 521PA 2JVJA 2I2WA 1RDFA 4YUAA 5EJ2A 2WJYA 4CQLA 1M72A 3IDFA 2CV1A 1ZCFA 3EGIA 5AM2A 4QXOA 3I52A 4V0ME 3QUTA 5DWDA 2EFJA 1J2TA 3A4YA 4ND3A 2PUTA 2B1IA 3DZJA 3PUHA 1GYQA 2YQ5A 3EG5A 3HKEA 4XTRA 4YMTA 2BP7A 5AUNB 5J2TB 5C8DA 2JLXA 2YH2A 3HSKA 1PUJA 4MS4A 2JLBA 1TKCA 1V26A 2CVQA 1L5OA 2IHUA 1WE2A 1X1DA 1EJBA 3BXGA 2NO0A 2YWBA 3HKBA 4GXQA 4REMA 5TS2A 3RRFA 2RGAA 3KUXA 5EA2A 5LA6F 1JZQA 3NV9A 4FWIB 4XA8A 2O8EB 3U7RA 4KPEC 5I51A 4O4HA 1VJCA 2FRVA 2GYUA 3KAKA 2E21A 4HG2A 4CODB 1RAHA 2B1GA 2IYSA 4MHSA 4PX3A 3FYSA 5FL7D 2LV8A 4CU2A 1U2ZA 1JG6A 3TAHA 4ZAGA 1DQYA 4HFMA 3GJ0A 4HFJA 2ADFA 1XLTA 2VK2A 3R4VA 2B3TA 4UD6A 3OU7A 1SR8A 4XFKA 2Q0SA 2X2FA 1SUWA 5EGNA 3V1TC 1XVLA 3DEFA 1SO8A 4PR0A 5CU7A 4O08A 5IVPA 1EM8B 3PC2A 4A2QA 1EX9A 1N3IA 5CA0A 2VQ3A 3DF7A 1K98A 1J09A 3PFHA 4LFBB 5DYNA 1E2FA 3WJ2A 2H2AA 2FDCA 1UUFA 1UJ5A 1CUIA 5KYVA 3Q1LA 3A9VA 1IOVA 5GM2A 3ZC3A 4P32A 2BEUB 3VTZA 4RVGA 3VHQA 5CEFA 3EMVA 2NU8A