2XTZA

Crystal structure of the g alpha protein atgpa1 from arabidopsis thaliana
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
349
structure length
341
Chain Sequence
MGSGIHIRKLLLLGAGESGKSTIFKQIKLLFQTGFDEGELKSYVPVIHANVYQTIKLLHDGTKEFAQNETDSAKYMLSSESIAIGEKLSEIGGRLDYPRLTKDIAEGIETLWKDPAIQETARGNELQVPDTKYLMENLKRLSDINYIPTKEDVLYARVRTTGVVEIQFSPVGEVYRLFDVGGQRNERRKWIHLFEGVTAVIFCAAISEYDQTLFEDEQKNRMMETKELFDWVLKQPCFEKTSFMLFLNKFDIFEKKVLDVPLNVCEWFRDYQPVSSGKQEIEHAYEFVKKKFEELYYQNTAPDRVDRVFKIYRTTALDQKLVKKTFKLVDETLRRRNLLEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANINE NUCLEOTIDE-BINDING PROTEIN ALPHA-1 SUBUNIT
publication title The Crystal Structure of a Self-Activating G Protein Alpha Subunit Reveals its Distinct Mechanism of Signal Initiation
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 130
structure length 341
sequence length 349
chains with identical sequence B, C
ec nomenclature ec 3.6.5.1: Heterotrimeric G-protein GTPase.
pdb deposition date 2010-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 2xtzA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2xtzA01
1Z6AA 3RS3A 1OHHD 2CJWB 3AVVA 1RRPA 1NMZA 4HATA 3EWSA 1RYFA 5F3WB 4KFUA 1U9IC 3K9LA 1XMSA 2VHQA 3LD9A 2BM0A 5KDDA 5JWHA 5AUNB 4U7DA 1GNPA 1AZTA 1DAMA 2CNWD 3TSWA 1W4RA 3QXCA 2G6BA 3B7GA 2AWNA 3B1ZA 1G21E 2ERXA 3SE0A 4MKFA 1E79A 2NO6A 1TEXA 3F5FA 1JAHA 2XSZA 5B64A 4Q9JA 2O8BB 4G3XA 4B3GA 4UJ3A 2J7KA 1QHIA 1KSGA 1W1WA 3K70C 2PMDA 1COWA 4L9WA 4LHXA 2MMGA 1YR7A 1SKYE 4BFSA 1AQUA 2GEDA 2IW3A 3KKPA 4TLCA 3WHKA 2QT0A 2H18A 2XOKD 2AKAB 3FOZA 3AF2A 3LNCA 5AJXA 3NC1C 1TEVA 5BW8A 1U8YA 4YMSA 5J40A 1KI4A 4BFVA 5C1BA 4O2LA 5G40A 3I73A 1TQ6A 5H1YA 1CS4C 1E32A 1CR1A 1SXJE 3W8NA 4ZI2A 2CMKA 4DT1B 1N6NA 2BM1A 4A6XA 4GOJA 4HUTA 2YJTD 4OL0A 2HCBA 1E98A 2VHUA 3U3MA 4TTQA 2KI5A 4B44A 1U98A 3DHWC 1DAEA 1EFUA 2B8WA 3EASA 2FZLA 5SZIA 4A8JC 3U6BA 1OFTA 2WMNB 2NQ2C 1P60A 2P6RA 2IYXA 1IXRC 1SVSA 1E2FA 1S0UA 5JSZA 5CDFE 3A4NA 3NBXX 1ZIPA 1NBME 5L3QB 5EXPA 5AR1A 2F3TA 2AR7A 3GJ8A 3BBPA 2GWHA 1S3GA 2OFWA 2PL3A 3O8DA 2ZVPX 4DC9A 3TUZC 2ZYVX 1NLFA 4AYTA 1HT2E 2XITA 4B2LA 4PZYA 4JLOA 3SS8A 5AUPB 2ZRJA 2J41A 2ZYUX 3RVBA 1NMYA 1GRQA 1GIAA 2A5YB 2QU8A 3IIKA 4UXJA 1XPUA 2AN9A 4H9GA 3X1YA 2AK3A 2F9LA 5DSZA 2FU5C 2ZI4A 3CX7A 1Z0FA 3GJXC 4G5RA 1YR8A 4PTLA 3RS4A 4NPHA 3AGQA 3SHWA 3ZD6A 4XD7D 2AKYA 4EPWA 2JA1A 1E3MA 2R44A 2XTNA 1P73A 1NMXA 1Q44A 3WNCA 2GDJA 2DFLA 3FHCB 2BMFA 4EPYA 4G1UC 3GFPA 3PUYA 3GMTA 2WPDA 1CEEA 1JXMA 2PBRA 1NIPA 1XXHA 5IF9A 1OKKD 2GK7A 4EFNA 4YMWA 5GADl 4LHVA 4ZI3A 3QUSA 3SR0A 5JHHB 2WSSA 4PAOA 4C7OA 1ZRHA 3DM9B 4F92B 2JGNA 4PHTA 1D8TA 1R0XA 3TQFA 2BMJA 3K70B 2RGGA 1EFRA 4B2PA 1FZQA 3NC0C 4BLPA 3GLIB 4DLSA 5E7IA 2XZLA 4V0LA 1ZJ6A 2RHMA 2JLVA 1YJ5A 4LJ9A 4PSAA 4U02A 5AJZA 4DDTA 4YMUA 1UDWA 2P2LA 4NZYA 3A58B 4O0MA 1EX6A 5JLJA 2GA8A 3QPVA 4JLMA 3L82B 2QAJA 3RNLA 4P3YA 4A15A 1R6BX 2LKDA 4GOKA 3ZIAD 3ZVRA 5HR5A 1TNDA 4N0DA 2OCAA 4W5JA 5CYOA 5HZHA 2RGNA 4IVQA 2RHDA 1PVOA 5KDLA 3DOEA 2A30A 1E9AA 4V0OA 3WNBA 5B30A 1JPJA 1UFQA 2CK3D 4MYCA 2FSFA 3ND9A 2FJUA 2J87A 3C5HA 3WP0A 4IOLA 4C0KA 4B48A 2JDIA 5FOVA 1DBSA 4BLTA 1JNYA 1I4DD 4EQ6A 2ANBA 4QGHA 2OFOA 5FTKA 2B7CA 4DZZA 4BLRA 3NXSA 4WBSA 3DL0A 4KFSA 5FBVB 1RIFA 2RGCA 1UBGA 2IF2A 3TH5A 2UZIR 2ZRIA 1L2TA 3QY0A 1KI9A 2HF8A 3GEHA 4TN1A 5FOXA 4Q03A 2FFHA 1S9DA 2PLFA 3LWNA 4NCJA 1FTNA 4HLDA 1RYHA 1S9HA 4HAUA 4LC0A 1MABB 3EPKA 5JRJA 2VP0A 3Q9LA 4QG7A 1E2JA 3AGPA 3VAAA 4C0AC 5JMTA 3LX8A 1DAKA 1S2MA 3ZVLA 1SQ5A 1SXJD 1F6BA 4QNRA 2ZR9A 4A0GA 4FWIB 1D6JA 4GP6A 3IEUA 2OHFA 5J4YA 3FKSA 3CPJB 4WA7A 3FYHA 5EJEA 2BCGY 3Q72A 4PSKA 2ZAMA 1ZM3A 1H65A 1N6RA 1Z2CA 3Q3JB 1E0AA 1NF3A 1XTQA 2X8AA 4GFDA 2ONKA 3IILA 2ORIA 4II7A 5DISB 4BFZA 3Q85A 2OM2A 2DWOA 1NBMD 3TSOA 4E07A 4HEJA 1XJQA 4JJZA 1JR3E 2Z83A 1P2UA 1XEFA 4IVRA 2IYRA 1NVWQ 3CRMA 5BWMA 3FMFA 1M34E 3OE7D 4PC6A 4W9MC 1KOFA 1U0JA 4M53A 1FL9A 4G0NA 5DI9A 1Z63A 1KZ7B 1DEKA 3K0SA 3U4QB 3W6NA 3LXXA 4LBYA 5L3QA 3D31A 4LSGA 4U00A 1JEDA 1KGDA 3OAAD 2CXXA 2XX3A 5J4HA 1P6XA 4M1MA 5CB6A 2GBLC 2OLJA 3HPRA 4C0JA 3TJZA 2JLYA 1OIVA 3B13B 2YHSA 2ZUCA 1J99A 2QTVB 5ELXA 4CEHB 3AVPA 1G18A 4IDHA 3VR3A 2CEAA 721PA 4ZDWA 4HAWA 4LJ7A 5J4VA 3LV8A 3I1FA 1PLJA 1M2OB 4MQBA 3C15C 3MMPA 1FPMA 4D4JA 5IRCD 1OFHA 3BORA 4Q4AA 4RZ3A 2Q0HA 3WMGA 5KYKA 3VR5A 3D3QA 3ZYCA 2GCPA 4HZUB 4FI3C 4P4SB 5DHAA 2RMKA 5LB4A 5JS8A 4XJXA 1P62B 3AVUA 2G83A 4OK3A 3NG1A 2GJ8A 2QNRA 1NIJA 4Q19A 1W2HA 4R71A 4Q18A 3F0TA 3K09A 4HB3A 3IHWA 1TU4A 3JVVA 4B47A 4JLPA 4RFVA 4BECA 3QF7A 2WM9B 5JZVA 1PUIA 5EP2A 3ZZTA 2UZ3A 3ADDA 1MOZA 2YYZA 1PLKA 2G77B 5FUXA 4D81A 1KI3A 3VX4A 2HLDA 4IEIA 2O8CB 2X2FA 2IYTA 4TMKA 4EJSA 1UKYA 2BBOA 2MSEB 1G7CA 2FH5B 5CM9C 1G8FA 2RGAA 1KJYA 3UK6A 5L3VA 4WXPA 5LD2C 3GLHB 1UM8A 1R0ZA 2ZRKA 2FSGA 1E2IA 3A1WA 3EX7C 4ZKDA 4KAXA 4TT3A 3QXJA 4LC1A 2WIBA 1EWQA 1KI8A 4PPFA 2HXSA 1HEIA 1YZQA 1ZAKA 3KZ1E 5EUMA 3VU9A 1RRGA 3CWZA 4A1FA 2FX3A 2ZTSA 2ZE7A 2PEYA 4GZMA 4BRUA 2C04A 1I2DA 2XAUA 4IFEA 3SYNA 4Q9KA 3ZVMA 4V0MA 1M74A 2IEYA 2QORA 2RAPA 2C8VA 4NCKA 1D9ZA 3MWYW 2JIZD 1AJEA 1G9XA 1Q21A 4JMPA 1Y63A 3GEIA 3A37A 2QE7D 3QOFA 3LFUA 2ZU6A 3TUIC 2AHOA 3X1ZA 1YZKA 1MABA 4LJYA 1RKBA 1XU4A 2ZRHA 3CRVA 3TE6A 4TYWA 4L9SA 2H5EA 2QAGA 4LJ8A 5AWFC 1OXVA 3NBFA 2YKGA 1K8RA 1IBRA 1XEXA 3KKMA 4C9BA 2ONJA 1P3JA 1Q3HA 2JLWA 3P4YA 3KXLA 3BFKA 3EAQA 2E87A 4JSYA 5DI3B 3ETLA 2EWWA 1N6PA 1WB9A 3TNFA 3CLVA 4TSFD 2GVZC 1JR3D 4Q1AA 3ZZUA 3TUJC 2B6HA 5KSZA 1IY0A 2PCLA 5HE9A 3SBDA 1VCIA 4C0LA 3WP1B 5EUQB 4LBZA 2ATVA 2VSXA 1ZCBA 3AKYA 3ZGXA 1ZCAA 4W5WA 1FNMA 1R2QA 3KUDA 3VQTA 3HYTA 1E2NA 1HY3A 5TV2A 5DN6D 4CEJA 1MV5A 2WJHA 2IL1A 4F91B 2QGZA 4PXAA 4ABYA 1PLLA 1IHUA 1W0KD 2Q9AA 3LH5A 2FV8A 4Q5IA 4D0GA 3M0EA 2ZS8A 1NRJB 1G3RA 4FIDA 2BKUA 1TU3A 2R6GA 3SJCA 1TUIA 4KVAA 4A0RA 3GLGB 1MO3A 3FKQA 1JB1A 3RWMB 3LW7A 5SZHB 2R6CA 3U3KA 2F1IA 1NG1A 3S1AB 4PSVA 4S2EA 3T34A 2ZR0A 3SI7A 1LF5A 2WZQA 2P67A 3BWDD 3CNOA 1FTSA 4NL4H 4LDJA 4GOXA 1WXQA 3I3SR 2UVQA 3BJIC 4MDEA 3D7MA 2OAQ1 1J8YF 1YZGA 3UMRA 1G16A 1N5JA 2BMDA 4Q4HB 4D6PA 5KTYA 1T9HA 2ZI7A 5FH9A 2JATA 4EDHA 3SEAA 1AS0A 5KU1A 1DADA 2QMHA 2NPIA 5FR2A 4AI6A 2VP9A 2EFDB 2R9VA 4DB4A 1NP6A 4NYMQ 1XEWX 3W34A 2PH1A 3EXAA 5C2JB 3NEJA 2VHJA 1IN8A 4UNNA 3IEVA 1KK2A 4ARZA 4ZKEA 3EA0A 3ZQ6A 4CRWB 2BV3A 3VMFA 1BOFA 4B75A 4BLSA 4TMXA 1DS6A 1OXSC 4AIIA 1RRFA 3CWQA 2FDCA 2D7DA 1XJCA 1GG2A 4D26A 5C18A 1G5PA 1KSHA 3TSZA 4YMTA 3ICQB 1HE1C 2DWQA 2NG1A 1QDEA 1AQYA 1HUQA 3EZ2A 2W6IA 4FMBB 5GVRA 4DCTA 3A1TA 3NH9A 4POAA 3PR1A 1LW7A 3DOFA 1KMHA 3UIEA 1TX4B 1XD9A 1HQCA 2X2EA 4OJKA 3LO5A 3FVQA 4NE2A 3LW8A 4MRNA 3VKWA 1FQJA 2WAYA 4F4CA 4LYJA 1RZ3A 1XXHE 2K5UA 1P9NA 5IDVA 2ZRGA 3OIYA 5FPYA 3WBKA 4K46A 3QKSB 2CHGA 3MGCA 2P5TB 1B0UA 3OHMA 1F60A 1VG8A 4HLUC 5EE3A 1P2TA 2WHXA 1G3IA 4A2PA 221PA 3NWJA 4HAXA 1VYVA 2AD1A 5J5CA 3RS2A 1EESA 1VYUA 2ZJYA 2QMOA 1E4YA 3HJNA 1LB1B 1KO7A 2FFQA 3CM0A 3GLFB 3MD0A 3THWB 4D0LB 1GVNB 3LLMA 1P72A 1MO4A 3A4MA 4ZDIA 2QPOA 4M9SA 4DB2A 1BYUA 2IEZA 1RJ9B 5B2ZA 3QXSA 2WV9A 2GXAA 2OO7A 2V55B 1EXMA 4CIDA 2VO1A 1ZINA 2GF0A 3KJGA 3W5JA 2G1JA 4MGYR 5JECA 4IOMA 2PJRA 1EG7A 4OI4A 2V1XA 1GKIA 3KQHA 4PC1A 3B8HA 4URZR 4R9UC 1WBDA 4HB0A 4QGGA 5FFMA 1E79D 3P26A 4OK6A 2VP6A 3LBIA 2XSZD 3A1SA 3LLUA 1G3UA 1SVIA 3OFNA 4IOJA 3I5XA 1O87A 2DBYA 2IK8A 4TYNA 1KNXA 4PQRA 2BHRA 1UAAA 4MRPA 1ZW6A 1GFIA 4O3MA 4UNQA 4YQFA 1IM2A 1JR6A 2C96A 2GCOB 2VTKA 3CX6A 1XF9A 3LY5A 2R8RA 2ZJBA 5DIFA 5EE5B 3REFA 4DDUA 3AVXA 1NVXQ 5IHPA 1IQPA 1BO6A 1E99A 1DO0A 2H7VA 1FFHA 2G0TA 2ORVA 1QHHA 1WCV1 1E2PA 2D06A 1GM5A 3SOPA 1E4VA 1NVVR 2W6JA 1JALA 1X8JA 3AQ4A 3NHBA 3PUZA 4Q66C 3CBQA 3CKLA 4OQNA 4S35A 1KAOA 4ON9A 1XPRA 1TL7C 2EYQA 1WA5A 4QHTA 1LY1A 4LX0A 3U44B 1E1RD 2ZUBA 1OXUA 1A2BA 5JEDA 3RRNA 4KLZA 4RFSB 1XPOA 2D3WA 1PJRA 3THXB 1J8MF 2FPMA 3S1AA 1V5WA 1T3HA 1BYIA 2ZR7A 3NEYA 2FFBA 1JI0A 4FCWA 4LYAA 1GP2A 2ODNA 2A5JA 4PPQA 3EPLA 4A92A 2YWFA 1FW6A 2XB2A 4NONA 2BKEA 1XJ0A 2V8OA 5SZJA 5JJLA 4US0R 2I1QA 2IYZA 3H86A 2W0SA 1TMKA 4NP6A 2NZ8A 1KI2A 4DJTA 3T06B 4XVRA 1S4QA 2W2VA 4PAQA 5DO9A 2W83A 2QTHA 1BH2A 2IYYA 4AG5A 3BB4A 1OIWA 3ADBA 1LV7A 4R2HA 4LHZA 2AL7A 5DE3A 4DIEA 2EVWX 1Y3AA 2XJ9A 2G9NA 3EARA 4MRSA 2GJSA 3MUFA 4Q1DA 3BFXA 1YZNA 1CLUA 3L0SA 3AM1A 4E03A 1CBUA 1EGAA 3TQCA 2WPDD 5EQTA 3BB3A 3D8BA 4KYUA 1ESMA 4WVFA 2C9OA 1XZQA 4J0QA 2KJQA 2IT1A 2VLIA 3CNNA 2V7QD 4Y0VA 3FGNA 4OK5A 3AEZA 2HDNB 1YRAA 3WYGA 5TMPA 2OCPA 4AYXA 2FEMA 5HCIA 4AK9A 4DEXA 4IOKA 5KSOA 2ZM5A 5EXXA 4B2IA 4WXRA 1Z28A 1KIMA 3UXMA 3RABA 5LDDC 4DLUA 2ZITA 4JT4A 4AKIA 2WJGA 2QI9C 1AS3A 1YHNA 4GT1A 2VH5R 4RCZA 5P21A 3R9IA 3BH0A 3T5DA 3ASYA 2P0EA 2YNMA 2F1JA 1N6OA 3B5JA 3K0EA 2ZE6A 3PIRA 2V6JA 2JCSA 3LBNA 3RDPA 1VIYA 3T1VA 1E0JA 3VKHA 2AXPA 2IYUA 3TKLA 2Z43A 5H68A 3C5CA 1OSNA 4TTPA 5FPSA 2ZRPA 3BE4A 4EFLA 3KUCA 4MGIR 3CIOA 3U7HB 4JVSB 2JDID 2QBYB 1AGPA 4AYWA 1U0LA 1VG9B 2GZDA 4MRVA 4QHYA 4O25A 4D2IA 4IDPA 4DDVA 3TW4A 2NO0A 3MSXA 5IK2A 1ODFA 1CJMA 5BXQC 2ZETA 4LJ6A 2QTFA 4LJ4A 1G64A 4DXAA 4M0LA 1S3SA 4Q21A 5H70A 2O0KA 1DAGA 3UG7A 1TF2A 3FMPB 4DSUA 5CITA 1CF4A 2ZSFA 3EPHA 3R9XA 2RCNA 3WRXC 2PMKA 3EA5A 3DDCA 3LX5A 4HAZA 2XNSA 4IEEA 3CH5A 4BZQA 8OHMA 5FL7A 5AUQA 3W6PA 4UNSA 4BZPA 1GTVA 1S1MA 5EE1A 1QG2A 1IN7A 1JAIA 1II8B 1UBFA 2C9CA 1SXJC 2VF7A 3PCRB 3QENA 3RYTC 4TMVA 2JLXA 2PCJA 4YDSA 3K0FB 1C9KA 1WQ1R 2I3BA 2HUPA 3AVWA 2FZ4A 2PJZA 1UBEA 1BMFA 4DSNA 5BN4A 2Q3HA 5KPDA 2WAXA 1GZSA 1KI7A 4KBGA 3R20A 4BE7B 1Z3IX 4YONB 2H57A 4EFMA 2F43A 4OHVA 4LHWA 2FEOA 2D7CA 4AURA 3EIHA 1WMSA 2W0MA 1AZSC 3SZRA 4RD4A 4QJ5A 2ZRCA 4PO1A 3P27A 2Q9CA 1C1YA 1Z6XA 4YXWD 5AJWA 3FDIA 3ZD7A 4ZCLA 4M21A 3T35A 2F7SA 4H1VA 5JS7A 4OHXA 3VKGA 1XMIA 2PX3A 4NMMA 4CF7A 3KTAA 1R5OA 1VCMA 2GHIA 2ZI9A 3QVUA 4JL5A 2IHYA 3V4FA 2YZ2A 1E6CA 1G6HA 3NH6A 1L4UA 4LY6A 4QFMA 3BFVA 2GTPA 2VP2A 4U5XA 1KI6A 2EFEB 3B1WA 4TZ0A 4A0FA 5DNYB 3X1DA 1F2TB 2VL7A 1VPLA 2TMKA 2SHKA 1NSFA 5KDOA 3PFIA 4PFSA 2FGKA 5CJ2A 2JJ2D 1ZYUA 4CYMA 4ZIRB 2F9MA 4LWZA 4YDHB 3RRMA 2Z5FA 1W44A 4L4UA 4C3ZA 3AV0B 1ZU4A 2ZSEA 3VFDA 3QPUA 4AG6A 4GBMA 3ZH9B 1OHHA 4LJ5A 3OEEA 5CB8A 3R8FA 2QPAA 4E09A 1X8LA 2REOA 1J90A 3UKDA 4OI1A 1ZM4A 1A5TA 1SGWA 2CJWA 3AVYA 2CNWA 4TQ9A 1G291 2J9RA 1SKYB 4C30A 1AKEA 4UXHA 1HYQA 1UF9A 4A8JB 1XTSA 2I1VB 2I4IA 5AJYA 1GILA 2IYSA 3NBYC 1U8ZA 3F3YA 3WXMA 1XMVA 3TLXA 1MRSA 1ZUHA 3IO5A 3I5YA 2EW1A 5AUOB 4Q7KA 1Z07A 4PANA 4JVLA 1P4SA 1T3SA 1G1MA 4QJ3A 2H16A 3A4LA 2WWHA 2JJ8A 3N2IA 3LDAA 1UEIA 1KY3A 1SXJB 1T3LA 3AF4A 3CW2A 3V4RA 3QNUA 3AB3A 1QHXA 3HPQA 5EP3A 2VA8A 4F93B 1E9BA 3FTQA 4CGZA 2ECKA 1E9CA 1P75A 1XD2B 2R62A 1GL6A 4BFYA 1Q1ZA 3ZVNA 1KO8A 2QG6A 2KBEA 1SZPA 2QM8A 1F2UB 3BERA 2QBYA 4KI0A 3EZ7A 3I4LA 3K53A 4TLEA 4TYQA 2GEVA 2YC2C 4A9AA 5JI3E 2QM7A 3WNDA 2O8FB 2P6NA 3U7FB 3ZJYA 4ZCMA 4XSGA 2WMOB 4DT1A 1FUUA 2A3RA 3MWLA 4RZXA 4ZV4A 1E9FA 2OCBA 2V4ZA 3QXXA 4V02A 3KKQA 2W00A 4BPBA 5JCZA 2J46A 1GWNA 5TY0A 1QRAA 4C0SA 1V43A 3PEVA 3O8CA 1X8KA 3MFYA 4N0EA 1U2RA 3W9YA 3X1XA 1E9EA 2KSQA 3NBZC 5DLQC 1IJFA 1RVDA 4GMXA 4IFBA 4MKIA 2WWFA 3AVOA 4PO8A 2JJ1A 2BBTA 3VTKA 4DUGD 5BN3A 2IXEA 5D3MB 5FTNA 3RS5A 2GRJA 1Q57A 2A5FA 1CR0A 2BJVA 1IAQA 2VSFA 4UNRA 5IT5A 4P32A 4ACAA 5KPJA 2FA9A 2PZGA 3CNLA 4QJ4A 3O8RA 3PXGA 4MYHA 4PHHA 4CDGA 2IS2A 5KUTA 1TQ4A 2O0JA 3WHLA 2VF8A 2A78A 1II0A 1ZNYA 1DG3A 1QHYA 2ZANA 4JL8A 2P65A 1VHTA 3PUVA 1E0KA 3GFOA 4MYTA 3LVRE 1I4TD 4FW9A 1KY2A 4KJZA 1T4GA 1TUEA 2ZRMA 1NN5A 2GVDC 2VBCA 2XZPA 4GP7A 1OKKA 1P9RA 1ZM2A 3GEEA 4LYFA 4Z1MA 1U9IA 3THYB 3LAWA 5FI1B 1IXZA 2GXQA 1Q12A 2VP4A 5A5GA 4JS0A 2GZAA 4B3DA 2NGRA 4JL6A 4LBVA 4Q01A 3VR6A 2RGXA 4A4DA 121PA 2MSDB 4B71A 821PA 1VDZA 4DDWA 4BQSA 1E2KA 3AKCA 2IWRA 2OXRA 1YRBA 5FUWA 4B6EA 3KB1A 4B43A 3NHAA 1UEJA 2VEDA 1CU1A 1J2JA 4HDCA 4RVCA 1OV4A 3B9QA 2A5GA 1ZM9A 1G3MA 1WP9A 4ZIRA 3GLIA 3I8XA 4WIAA 3TGPA 2X19A 1AA9A 3K0CC 3IUYA 2B8TA 2OV2A 4TLAA 3SDZA 4KBFA 1UBCA 3ADKA 1Z0KA 3TR0A 1IY1A 2WKQA 3TK1A 4HUQB 4DIDA 1ZNWA 3PUWA 1OFIA 4KO8A 4B3BA 1E2LA 1L4YA 2X1VA 2GJAA 3FFAA 2YWGA 2XGJA 2IF0A 1W0JD 2OXCA 4GMDA 4M2LA 4M1KA 4TMTA 1SKQA 2G0NA 4AWXA 2C78A 1BKDR 3OEHA 1R5BA 4Q48A 3TRFA 2WOJA 4NDZA 2XXAB 5FOUA 2W6ID 3T12A 4RD2A 1GKYA 1P9WA 4I99A 1XFAA 3H84A 4NCIA 4QHSA 1NKTA 1SVLA 2QN6A 2FFAA 4URXR 1OJLA 3BIFA 5GVSA 1OB5A 3UPUA 2ZYTX 3KFXA 3WYAA 3BC1A 3L2OB 2DFTA 2GF9A 3ZS9A 3FMIA 1UKZA 4TLDA 2GXUA 4NH0A 3G5UA 1B23P 2B7BA 1US8B 5DGXA 5FTJA 5CLLA 2J5XA 2O52A 3ICEA 2IYQA 1E2HA 2ZRAA 3PEWA 1RFLA 3DVLA 3CONA 3GCGA 3C16C 2QPTA 2IC5A 3PEYA 3B78A 3B1XA 1SHZA 3FE2A 2D2EA 4IDNA 1CKEA 1XEWY 4RD3A 3R8CA 3VR2A 1A82A 1AS2A 4QNMA 3QG1A 1P2SA 1W36D 3VNVA 2F3RA 1XTRA 4I1VA 2QEQA 3I92A 1EK0A 1NLYA 1OE0A 3P4XA 3CZPA 4M22A 1J7KA 5TB5A 2Z0MA 3PITA 5L3SB 2W2TA 1SVMA 1YU9A 2CL7X 1NBMA 3UWKA 3SU8A 1Q1EA 2GXSA 5F98A 2GAOA 4LBWA 5TDHA 2A2ZA 2AFHE 2QP3A 2IA5A 1XB2A 4FINA 3I62A 1DVRA 4QM6A 4V03A 1HURA 2GEUA 3BGWA 3DEFA 4LHYA 1DOAA 1KTVA 1XCGB 2WBLC 2DY1A 3KQKA 4MKHA 5EZ5A 3HDTA 3MAAC 2GKSA 4M9QA 1XD8A 3RS7A 2B21A 4B73A 4L16A 1TPZA 1KK1A 1GDDA 2EFGA 4QBHA 3SJAA 3U4QA 1GRRA 4W5HA 4XWKA 3OFND 2OBLA 1FX0B 4PHFA 4URYR 2FPLA 1VMAA 1AIPA 3RAPR 1W46A 4NYIQ 2WICA 3HU3A 1RC8A 3N2EA 4LPSA 1N6IA 4CEHA 3L8YA 4GPTA 4D25A 2ZS9A 4DLTA 5LD2B 4PC7A 4PR0A 5KNDA 3BK7A 5TARA 1GNQA 3GJ0A 4R2IA 3NTUA 5KO2A 3BOSA 2DFKB 3ADCA 3JZAA 4XWAA 5DYGA 2FN4A 1RRCA 4EPVA 2F6RA 2QRZA 4HZUA 2W6JD 1Z83A 3QIAA 3QF4B 4L15A 4P4SA 5JWOA 2JLUA 1Q1QA 3IBYA 2YOGA 4X8OA 4QC2A 4MDFA 2HCJB 1NN0A 1KO1A 1QBKC 1GOTA 2BBWA 2OILA 4LCBA 1E1QA 2BVNA 3PUXA 2J0VA 3BXZA 2CLDX 3CF6R 3SJZA 1IY2A 3EZFA 2BWJA 2LKCA 1Z29A 2N1BA 5FL3A 2O8DB 3DMNA 2RGDA 1P2VA 1W7AA 4PQFA 1NSTA 1W5TA 1UJ2A 2GESA 1E0SA 1HT1E 1KDRA 3U3RA 1YZLA 1VCNA 3TIFA 3T61A 3EIQA 3EW9A 2EFCB 4RCYA 5D3QA 1TAGA 1T5IA 2V54A 2GCNA 3IBGA 2Q9BA 5J4LA 4ERNA 2O8CA 2ATXA 4N3NA 4DCVA 2ZI6A 2ZVQX 4X8LA 2ZROA 4ACBA 3QBTA 4B76A 4XTCS 4FMDF 4CVNA 2G3YA 3IKJA 1G6OA 3WMEA 1IN5A 2ZIAA 2XNDD 1VIAA 3GLHA 2BDTA 4Q1CA 3AUYA 1NN1A 3AH8A 3A1VA 3ZQJA 2F1HA 2J0UB 3B82A 4FMCF 2CDNA 3FHTA 4BFXA 3KJIA 4BWYA 1H8ED 4AD8A 2BIFA 1MH1A 2JIZA 4LYHA 1NLZA 5FBLB 4FCVA 3C8UA 5FOWA 1TF5A 1VG1A 4JVMA 3ZZ0A 4PAMA 3G82C 1OH5A 5K8LA 3VNUA 1VKJA 2PEZA 4NU0A 2QA5A 1CJKC 3CPEA 1W2GA 4ZO4A 1UPTA 1LF0A 1JQJC 3Q5EA 3QPWA 4HAVA 1TF7A 4DEYA 2OE2A 2N42A 2PLRA 4QRHA 1CTQA 4JSTA 1R4AA 4NCHA 1T8TA 5M04A 1OH8A 1ZC4A 4IKEA 1Q0UA 2GBLA 3ONWA 3AF1A 1R5NA 1CR2A 3R7WB 4DSOA 1E9DA 2QP9X 4X8MA 4FN5A 4ASUA 1WRBA 2JLRA 2NPFA 4Z51A 4KYIB 4EUNA 1MO6A 1NN3A 2NO7A 2QSYA 1H8HA 1A7JA 2VP5A 3M4YA 5UKDA 4NYMR 3SC3A 2OUKA 4V0NA 4MGKR 2QQ0A 4I1OA 5KOYA 5EXTA 1COWD 2QUZA 3Q8XB 4TQUS 5CM8B 1M7HA 5DI3A 1NI3A 4GSYA 2KE5A 2O0HA 3CRQA 4GZLA 4QXAA 3HU2A 3CF0A 1KJWA 4CEIB 1Q20A 2RGNC 4BEJA 1E2QA 4OKSA 3IHLA 1XNJA 4NYJQ 1T6NA 2PX0A 1TQ2A 3JZMA 1G8YA 3KJHA 3NVAA 1D2MA 1W0KA 3C7KA 3CRW1 4KCGA 4AKHA 2C95A 3KXIA 4P31A 2JASA 4KLNA 3U61B 4M1OA 4URVR 1EFHA 2XZOA 5JSZB 1L7VC 5G41A 4EPXA 4QBFA 3RSLA 3MJRA 3SFZA 1ZM7A 2FF7A 4D4MA 3GLGA 1M7GA 4TYYA 4BUJA 3O47A 1PUJA 2R6FA 2YOFA 2ZRDA 3OZXA 4R98A 5TVKA 2R6AA 1IN4A 3IGFA 2QT1A 1OF1A 2ZS7A 2J7PA 3A36A 4UQOA 5FL7D 1W47A 2VYFA 4DCSA 1GSIA 2DFNA 2VHTA 4Q1FA 4IJMA 2WJYA 4JLVA 4RJLA 1ZBDA 5F9FA 4Q4HA 2CCJA 3CRRA 3PG5A 1BMFD 1XX6A 1CJTC 1C4OA 1BIFA 1QVRA 3EC1A 3QVVA 3RRZA 5JWRA 3MWKA 3HP1A 2E9SA 2VHCA 1GNRA 4CT5A 5GJBA 3OESA 2HJVA 3QKTA 4CW7A 3B1YA 2ZPTX 2OT3B 4PX9A 5HPYB 4CZ2A 1XMJA 2J0QA 1GL7A 4GNKA 5EE9A 1XXHB 2F55A 1X86B 1W49A 4WZ6A 3SHFA 1JEEA 4TLBA 3H1TA 4RKFA 2H1LA 2ZRNA 1J70A 2IYVA 4IVPA 4UNPA 3EIEA 1SVWA 2J0SA 1AGRA 3DMDA 4YC7A 5E7JA 1GITA 2R6DA 3VHLB 2FPKA 3NDPA 3LA6A 1DG1G 2ZE8A 2J3EA 1ANKA 2WSSD 3Q7PA 3BB1A 5ANRB 3GPLA 2QY9A 1SULA 4DLYA 3CO5A 1KSJA 5JCPA 1JJ7A 3AF0A 2NTYC 1EFRD 2HT1A 4B74A 1OLOA 2ZI5A 2XTZA 5FTLA 1R8SA 3M1IA 2LCFA 3QKSA 4OBEA 1ZNXA 2WJIA 4F7WA 621PA 2CLCX 2OESA 2V1UA 4B33A 1KK0A 4BLOA 3ASZA 4NTZA 3MLEA 4PO9A 5FI0B 2MMCA 1QHSA 3OEED 3GLIE 4MITA 1VYTA 4GI7A 2F1RA 3GLFA 5HKKA 2J45A 4EPTA 3THWA 3QQ5A 2E1RA 1AK2A 2Z6VA 4M4SA 2OZEA 1Z0AA 1MRNA 2NOAA 3L0OA 4EQ6B 1M8PA 1YZTA 2ODWA 2C77A 1RJ9A 1NJGA 4OI0A 1ZC3A 2HXYA 3DM5A 1VECA 3K09C 2QL6A 4KODA 3TMKA 1M7BA 1N5IA 4D4KA 5DYIA 4DKXA 4OHYA 3R7WA 1T91A 2J59A 4KVGA 3BS4A 1QF9A 3RWOA 4CT4B 2CBZA 3GD7A 3U3OA 1PV4A 1UDXA 2C98A 1KDOA 2H8KA 3B85A 4EJSC 2EU8A 1KO5A 4V0ME 4KV9A 2PT5A 2IS6A 1Z5ZA 4PHGA 3QSYA 2JAQA 1G3QA 1Z47A 1I4LD 4IXNA 4C0HA 3ZLJA 1XWIA 1MO5A 1W48A 1X1RA 3AP3A 3DZDA 2HT6A 2XJ4A 4CEIA 3KJEA 3M6AA 1SHKA 3CUEF 5CK4A 2GCOA 1N25A 1EFTA 1U99A 2PZFA 2V6IA 5E4FA 3A1UA 5E7MA 2CVFA 4KFTA 4I4LA 6Q21A 3SQXA 3K9HA 3QXHA 3BD9A 4HAYA 3FKSD 5K8IA 2IUSA 2J1LA 3AF3A 5CIWA 2VRWA 1G19A 3W3ZB 1XCMA 3KX2A 1YZUA 3UG6A 4YLGA 3B1VA 4PC3A 3IIMA 4HB4A 1IOZA 1G17A 4M9XA 4A82A 1E1RA 1GL9B 3AKDA 2WWWA 2QROA 2QGNA 1YR6A 4XSHA 1P7CA 2HF9A 3L43A 2H92A 2V9PA 3CR8A 4WOPA 1ZUIA 3WMFA 4WW0A 1ETUA 1JECA 4I81A 1UKEA 4AC9A 4DCNA 4QBGB 1G5TA 3U44A 3K9NA 1N0WA 3H2YA 3LBHA 1G20E 4C2UA 2VIIA 2OEPA 4RFSA 4OQXA 2ZAOA 3IPXA 2ZUDA 3ZS8A 4BGDA 3THXA 4OJQA 3VR1A 1JBKA 4HDQB 4QL3A 5EP4A 4BASA 3GFTA 1OH6A 2QAGC 2ZSBA 2JJ1D 1D2NA 3KFVA 1DAIA 2QRNA 4H1UA 4B35A 2WTUA 3VX3A 4HB2A 1JPNA 4PPGA 3I61A 2OLKA 4Q47A 4HLUA 3U3JA 3LQQA 4Q4AB 2FMXA 3GP8A 4UJ5A 5FPKA 1S1CA 4A6PA 2QSZA 2CHQA 1XTKA 3GJ7A 3EZ6A 4FCTA 4N1AA 2KWIA 1R10A 1E94E 1FNNA 3FHOA 4Q7MB 4HLQB 1S96A 1N6HA 4V0KA 5FBQB 3K0AB 2MSCB 2YOHA 3LXRA 3O8BA 1PZNA 4MRRA 4LGMA 4Z1MD 2EYUA 5SZKB 2V7QA 3UATA 3CZQA 1CULC 4TL6A 4BRWA 4JJKA 2WWYA 3AUXA 4DLWA 1CJUC 4Q4JB 5J4KA 2D2FA 1QVAA 2Q6TA 1ZP6A 3IQXA 4C4PA 3QKUA 1JJVA 5TXGA 3QI2A 1LVGA 4JLKA 4WAUA 2BMEA 1AM4D 1E9RA 1N5KA 2ZJ8A 1X1SA 1F3OA 1OXTA 3C14C 1ZIOA 2CHVA 5FBRB 4EJSB 1R7RA 3EWAA 4LV8B 4RZ2A 2XEXA 3K70D 1KKMA 2O8BA 1II9A 1D2EA 2RGBA 3KL4A 3W5IA 5LB2A 5CJPA 2WKRA 2EFHB 2HLDD 1CP2A 3BRWD 4M1TA 1MR3F 2YV5A 5L8VA 4P4TA 3VR4A 4AY2A 3DZ8A 4FMDB 3MCAA 4RZUA 4XH9B 2O8EA 3SJBA 1KSFX 2CL0X 1P61B 2XOKA 5AJVB 3L8ZA 4A36A 3E5HA 3DKVA 1EX7A 3VU9B 1K6MA 1XDBA 3CF2A 4X8HA 2WOOA 2R2AA 2C99A 1XBTA 5BYJA 4JLDA 3U5ZB 1HE8B 1KAGA 4FMCB 4TT3D 3UANA 3DPUA 1ESNA 5HE8A 4ZCIA 2D4HA 2QMUA 3GJ4A 3KQUA 3GLHE 1W4BA 4DLZA 3OEHD 2D62A 4IDOA 3Q5DA 2L0XA 4IRUB 4EIWA 4W7SA 2IHBA 4BFUA 3P1JA 3CH4B 3MRSA 2GAAA 3KQLA 1N0UA 1SVOA 2O5VA 3AVQA 5CLQA 2ZREA 2QAGB 1G5RA 1XEXB 3Q7QA 2ZJ5A 4KSCA 1LS1A 1N6LA 2ZJAA 1LS6A 4LZZA 2CCKA 5H8WA 1IJEA 2G88A 4DSTA 2AFIE 2QZ4A 1NNEA 1HH4A 4D0NA 3U2QA 3T1TA 4ITRC 3PV0A 2O8EB 1KJZA 1FMLA 2CVHA 5CIQA 1Z2AA 4DLXA 4TL9A 3B9PA 3WBJA 2WVJA 5FTMA 2ZRFA 3U60B 4JKYA 1W4CA 2KB0A 3EC2A 3TW8B 3RS0A 5KSYA 5A0FA 3DO6A 1II8A 4DCUA 1LTQA 3RC3A 3CX8A 4WZAE 1MT0A 3K0FA 1W36C 4Q00A 5KNCA 4B3FX 1F48A 3KXKA 5GJVC 4GL2A 4TYPA 1KZGB 4KXFB 4LJAA 4BLQA 4JBXA 2GETA 4TMZA 3QBVA 3RRYA 2BC9A 2BBSA 4B3XA 4CEJB 4XD7A 4YXWA 3DKPA 4OYHA 1OPXA 2C2HA 4Q9IA 5AK0A 4KITB 3N70A 3U7GA 4ESVA 4OQMA 3FWYA 1AKYA 5EE0A 1DELA 4B32A 1AN0A 3T1OA 1FMJA 4D82A 3KKNA 2Q3FA 1N0VC 4ZDKA 2IS1A 2CE2X 2DR3A 4NHOA 4Q1BA 1ZVQA 1M6NA 2BJWA 2ORWA 1G7SA 1KYIA 2WKPA 4RSGA 5DH9A 1NG9A 2WJVA 2XB4A 1NJFA 2P5SA 4URWR 2R65A 3GJ6A 3IIJA 4K8OA 4EKDA 2C9YA 4G5QA 4KU4A 4M1WA 3PVSA 2ODEA 1FP6A 2A5DA 3JVUA 1OIXA 2FSHA 3V00A 4JT2A 1Z08A 4Z8YA 4A2WA 4LK2A 4E22A 4HDOB 1U81A 2CE7A 2JJ2A 1RPZA 1X6VA 1Q22A 1CRPA 4BEBA 1LFDB 3GLGE 3GJ3A 1DE0A 1DO2A 1W4AA 4ESHA 4LUCA 4R7ZA 1ONBA 1JXOA 1F2TA 2ZYWX 1BS1A 5JJKA 2GNOA 4G5OA 1G7TA 1QHNA 2ZE5A 1QG4A 2QP4A 1Z0IA 4JLNA 3RHFA 1OFUX 3ZIAA 1ZNZA 2ZRLA 5G53C 2YINC 4ARZB 4EPRA 2GJ9A 3K0AA 1WDTA 3AP2A 2OG2A 1G4UR 2BCJQ 3KDSE 1RW4A 5FR1A 2CK3A 1E1QD 3QE0A 1A1VA 4Q4JA 4XVUA 4IHQA 4KHZA 1KNQA 3SFVA 4JKIA 4O2RA 1VHLA 5BYKA 3FMOB 1T0HB 1KMHB 2VSOA 4P33A 2JLQA 4ZDJA 3QEJA 3H0KA 2RGEA 1R8QA 4HLCA 4QBIA 4HYYA 2IXGA 4PQYA 5JRZA 2JEOA 4A8JA 2IBMA 1A2KC 4IW3B 3LRPA 2H17A 3LVQE 4KFRA 2FG5A 4AKGA 1ZUNB 4LRWA 4G01B 4DRZA 1G41A 1ZMXA 4K81B 2OBNA 2Q21A 2WWIA 1W5SA 4Q9HA 3T5GA 4QKQA 5LPNA 1E2MA 2FE4A 4LPKA 1P5ZB 3WY9A 4US1R 2CL6X 1SXJA 3CB4A 5FUVA 3IPYA 4Y0AA 3SYLA 4DHEA 4TZ6A 1W36B 2C03A 5EP1A 1CR4A 3TAUA 1DTSA 2RKOA 4JBWA 1E69A 4F38A 3H4MA 3AP1A 1Z8FA 1GKUB 2UKDA 1NY5A 4I1SA 3U7EB 5BQ5A 1XD2A 3OIWA 1HTWA 1ZD1A 1U8AA 3LQRA 5E95A 5FOSA 3W8RA 3SYKA 1K5GA 2CCGA 3NKVA 4QGFA 2IUUA 3P32A 3QJYA 4B6FA 1N5LA 5GJWC 4DWJA 1F2UA 3B6EA 1HA3A 5CDFA 4HSEA 2NIPA 1F5NA 4QM7A 1GUAA 3F8TA 2O8FA 2AK2A 4B34A 4US2R 3RLFA 3PQCA 4FWTA 4PZZA 4Z8XA 3D6TB 3IQWA 1O3YA 3RC8A 3GLFE 3OE7A 2ZJOA 2HEIA 4DVGA 1GRNA 3EPJA 5KHOC 2NMVA 4DBLC 5FOTA 4MGZR 2QENA 4G5GA 1FQKA 2EQBA 2XTMA 2DB3A 1KKLA 1QZXA 5HCNA 3OAAA 1RE0A 4BFTA 4TL8A 1FUKA 4DUGA 1TTTA 4ASUD 4OQLA 3CPHA 4Q7JB 1SVKA 1H8HD 3OIVA 3FFBA 3SBEA 1Z6YA 3MG9A 5G3YA 1OH7A 4DLRA 1UADA 4M1SA 4LI0A 5D3MA 3A8TA 5DHFA 4C0QC 5J47A 1Z22A 3V9PA 2NO9A 3IO3A 1T0JB 1OW3B 1QHHB 4TTRA 4FD2A 5LBIA 1S8FA 4I1UA 2GJKA 4XWOA 4Q9LA 1LNZA 2OCYC 5B57C 3HYRA 2IYLD 1DAFA 2Z4RA 2HYIC 2ZJZA 4IXMA 1ZD8A 1IONA 2FGJA 4NCNA 4MYUA 4PZLA 1FP7A 5F2EA 3U6KA 1N6KA 2CLSA 2DYKA 421PA 5CK5A 2PZEA 4IDQA 4JYBA 2P3SA 4Q4LA 3HWSA 2JLZA 3THYA 2DHRA 4A0HA 5JHGB 2OAP1 2ZU0C 1R0WA 2Q3MA 4JYCA 1XP8A 1WBBA 2V3CC 3OF5A 1YQTA 3TAHA 5A4JA 3HR7A 2ZRBA 1CJVC 1WE2A 2WIAA 2OBMA 4C2TA 2IYWA 4B3CA 2IXFA 3R9WA 4L8GA 4M8NE 3THOA 3X2SA 2A7QA 2J7PD 2AX4A 3SNHA 2ZSAA 3ZDQA 1IN6A 2ANCA 3CR7A 1E2EA 4TL7A 3UMFA 2HJGA 2WWGA 2GZHA 2VQSA 4XIGS 5HTKA 1NVUQ 3FPAA 2YWEA 1E2GA 3BH7A 2KBFA 2YC4C 5E3HA 3REGA 2FOLA 4GDFA 3RSOA 3GQBA 5K8TA 5HZKA 1XZPA 4OHWA 3EG5A 3QG5A 1XRJA 4TWZA 5FPTA 1DARA 1YE8A 2W58A 2ZJ2A 2JLSA 1Q3TA 3MWJA 3K8YA 2VPPA 2ODBA 1XTJA 3QKRB 1W0JA 5K8UA 4P4UA 1U90A 3NDBB 1FOEB 4HI0E 4HUQA 2WJJA 1A4RA 3GJ5A 3T15A 1L8QA 5EZ6B 5KNBA 4URUR 521PA 1KI1A 2ZQ5A 4Q02A 1R0YA 3W6OA 4ILEA 3KQNA 1EWRA 2LWIA 1MKYA 1U0HC 1NVVQ 1OXXK 3E70C 4MUBA 2Z4SA 2QE7A 3E1SA 4GRAA 1G8PA 4PPNA 3ND8A 4EAQA 2BEKA 2XXAA 4Q7LA 4BFWA 3W90A 4F4JA 4NYIR 4XOIA 1G8HA 1N2CE 1WF3A 2W2XA 1KDPA 2EWVA 4E5UA 1G8GA 5JEEA 5L3RA 4D80A 2REXB 4UKDA 2ZSDA 1NKSA 2WSMA 3PENA 1DPFA 1US8A 3TVTA 3FB4A 5C46F 2C5LA 3KB2A 4D4LA 3N5CA 5CYPA 2YWHA 3B60A 4JIMA 1T5LA 4LOAA 4P0TA 4OHZA 1Z06A 3A6PC 1Z0DA 1VCOA 1CXZA 4MUAA 5JFGA 3MJHA 4RKEA 4TSFA 1E2DA 3EZ9A 4QOSA 2GK6A 2NO1A 1JR3A 2D74A 1ZU5A 1XCPA 2RH5A 4XVQA 4ZPXA 3I32A 4TMWA 5HKKD 5FUYA 4BZXA 1YVDA 5L3SA 1G4AE 4FXPA 3IDQA 4A2QA 4NBSA 1I2MA 4RD0A 1E9SA 5FBWB 1KDTA 4JBYA 4WZBE 5DN6A 3VHXA 5GJCA 3L0IB 3QEOA 4JLBA 3AVTA 1D5CA 2FWRA 4MH0R 3HU1A 1NL3A 2GILA 2ERYA 4RD6A 1D9XA 3UWOA 2RB4A 3TBKA 3SQWA 4M9ZA 2BOVA 4HZIA 1N3BA 1CIPA 4MKGA 4F4IA 5IK2D 2X77A 2IS4A 2B92A 4C0BA 1NY6A 1Q1BA 4RY2A 5EXSA 1KMQA 3I8SA 3E2IA 3HR8A 2N46A 1ZD9A 3PEUA 3G0HA 4L5BA 4AKEA 2IUTA 5JBQA 1FX0A 1VTKA 3K9GA 4MA4A 3C41J 2DCUA 2ZEJA 2YVUA 1IXSB 1OB2A 1OYYA 3TR5A 1X3SA 4LV6A 2QMEA 3K0CA 1JQLB 1QHGA 3OIUA 3J81k 1CRQA 2A9KA 1DAHA 1ELOA 2REBA 4G5SA 3RANA 3WYFA 3X1WA 4Q1EA 2QQEA 2PT7A 5BN5A 1KO4A 2P6UA 2HYDA 2ZXUA 2HV8A 2F43B 1T8UA 4M1YA 5KSPA 5JI2E 5F9HA 2OFXA 4PC2A 1G7RA 3I72A 3QF4A 1YR9A 2OSBA 1K5DA 1E96A 4OQFA 2AD5A 3WRYC 3SN6A 4XTRA 3PJRA 1KK3A 3KKOA 1XTIA 2IWHA 1HQYE 4UXIA 4DLVA 1Z6TA 3KTAB 1M1YE 1UKVY 4JZKA 4RD1A 2O8DA 4JVNA 1TQDA 2G1KA 5C4MA 4OI2A 3K1JA 5B58C 3UMSA 5JJIA 4C7OB 5FPHA 5C4GB 1KI6B 2AWOA 3TVDA 5G3ZA 2XNDA 3BH6A 4LV5B 1Z6GA 4KSBA 3C4JA 3B2EA 2ZI3A 1YKSA 2DWPA 4TQAA 2BEJA 2FNAA 3P20A 2ASEA 2NZJA 4Z54A 3W3AA 2IX3A 2FSIA 4QGAA 2Y8EA 1EFCA 3QKRA 4NYJR 1OYWA 1HV8A 2DPXA 2AXNA 1H8EA 1Z0JA 3L0PA 1TADA 4JLAA 4YMVA 4JLJA 2WWXA 1GAJA 3BAFA 3ECCA 4NKRA 1VG0B 3AKEA 1OT3A 2J0UA 1KHTA 1U94A 3NIBA 3T1QA
chains in the Genus database with same CATH superfamily
3BTUA 1TLLA 4L95C 2R8BA 2ID7A 1NYRA 4NARA 4JENA 1JWBB 4ID3A 2HI0A 2QW8A 4Q12A 3OI7A 1VJ5A 2PR2A 4LJLA 1T9BA 3FCYA 3EMBA 4NJEA 2NO4A 3UUWA 4H7KA 3K9LA 2HDHA 3EQ6A 3DLPX 1YV9A 1U8UA 1Y7PA 2A0FA 1Y98A 1AZTA 3DDWA 4Q15A 3KYDA 1Q7TA 1W4RA 3K8ZA 1L5HB 2AWNA 3R0JA 4FT2A 3OHSX 3DBOB 3VH3A 1VIVA 4OQEA 2JI4A 3FVTA 2FWAA 2H3HA 1E79A 1XZAA 1T2UA 1MJGA 3CRNA 1MT3A 3LZ6A 2BM9A 4LVOA 5JDIC 5ENDA 4YHBA 5AXAA 5B64A 2XSZA 3FG9A 4G5FA 5ICSA 2R4QA 3JD2A 1WHTB 2CYCA 2IUFA 5H7XA 4UU8A 1ZVJA 1KSGA 2EL9A 2V59A 1XYVA 3AWDA 4MDYA 4O4JA 2XNHA 4CMEC 2E21A 2CY0A 5IYZF 1SKYE 2J9FB 4GGPA 4KXWA 1AQUA 3W8FA 1HFEL 3DLAA 3KKPA 4TLCA 4TKUB 1QGDA 3E22A 3WHKA 1QX4A 1XMPA 5A7HA 3LS2A 3EYWA 4OUKX 4FI3F 4NECA 5JSYA 2XUJA 1R4MA 5F7JA 3LTNC 1D07A 4CDNA 1J5XA 1GPH1 3CCCA 4MQFA 4AJ9A 1T8PA 4PSDA 4BFVA 5C1BA 1P4GA 4BNUA 3EXFB 3ZWMA 1FTQA 5DTEA 4LXYA 2BEUB 1U31A 4ATNA 4K2AA 4DG8A 5AVVA 4U7WA 3NDRA 1UT5A 3VSEA 2R3SA 3A0UA 2CMKA 2BM1A 4HX2A 4HUTA 1E98A 3U3MA 5FLKA 2KI5A 4B44A 3AFGA 2FUEA 1L7RA 3WQQA 3OP4A 1DAEA 1EFUA 5SZIA 2VDWA 1N3IA 2FRDA 4DF3A 1QQ5A 4HK4A 4GRIA 3WDKA 2W6OA 4AIRA 1SCBA 4O6VA 1SCKA 1KQ3A 3H2ZA 5CDFE 1NXOA 1T24A 1WU7A 3B6ZA 3BE6A 1QZUA 3D8RA 4W5NA 3GZJA 3UWPA 1W6UA 1NX6A 1T36B 2JZCA 3AI7A 2WG0A 3KEOA 4E5MA 1S3GA 2OZLB 2QTNA 3DVQX 2ZVPX 3D8SA 3O3OB 5K4AA 4AYTA 3MMXA 4OGKA 3F9CA 3SFTA 2NACA 1A5SB 2VDMB 4JLOA 3QWIA 4PYIA 4R2XA 1QE3A 4U8GA 2ZRJA 1E3DA 4L9AA 3GNTA 3AERA 1GRQA 4UXJA 3W79A 3OOHA 1MUUA 2AN9A 1JIKA 2PD4A 2QVYX 3G7SA 3PHIA 1WBJB 2FU5C 5LMCA 1DZIA 1DXQA 3CX7A 3MFQA 5EJFA 3VSBA 3GJXC 3RH0A 1V3QE 3AR2A 3D1LA 4CQMB 5ICGA 4G4SP 1TW3A 5JYCA 1GAEO 4CMIA 2PRJA 3E81A 4BWFB 4C2AA 4E70A 1IUPA 3DCYA 3H5TA 1XVLA 4QXOA 4XPIA 2OXTA 3QLUA 4CLEA 1Z17A 5MFZA 4C05A 1E6LA 4OBBA 5LQRA 4HX9A 1HC7A 2LBPA 4WLVA 2BMFA 3TGLA 2HA3A 1PGQA 3PUYA 1SD1A 2WPDA 3GMTA 3H5AA 3BSSA 1MCZA 4Y9TA 5AW1A 1CEEA 3ZCPA 3KOMA 4ZVVA 3P0RA 3AR5A 2C4HA 1SOMA 4E7PA 1YSCA 3ZGOA 5IF9A 1WQ4A 1N8TA 1VB5A 3GDFA 2RJOA 4N40A 4K9DA 5GADl 3A9CA 4JU9A 5I9NA 1U7TA 4ZI3A 1YE3A 2AJCA 1NNUA 4RENA 5CA1F 3RADC 1HYHA 3PHCA 3DM9B 1K7YA 1G8AA 2IV2X 3RVQA 4PHTA 2V7PA 3K6JA 1JMKC 2BMJA 1JXQA 2J07A 3FBTA 2GX6A 3RG2A 3VR6D 5CB4F 3T52A 5I7EA 1HYBA 4Y2VA 4FHDA 1J9GA 3L93A 5E7IA 3AIMA 1HEYA 3JWGA 4H60A 4QELA 3LM8A 4V0LA 3UJHA 2RHMA 3PNLA 3ONFA 1YJ5A 4PSAA 1DC5A 1H0SA 1UDWA 1YE5A 2JD2A 2QYTA 4AZ0A 5JLJA 3I4FA 4IIVA 2BFNA 3NHLA 4MRMB 3E0XA 1YB4A 3O38A 4P3YA 2LKDA 4MW6A 3TLCA 3MTEA 3F4BA 1R3UA 3LKVA 5AW7A 2RGNA 1UBSB 1UPBA 1I8TA 1NXXA 4IVQA 5G4KB 1T2DA 4RFLA 2EW2A 1ENPA 3H2KA 4UE6A 1MIOB 4Y1RB 3WS7A 3KPUA 1P4AA 4V0OA 3V2UA 3QV2A 4X6UA 1JPJA 4NDAA 4FFBB 2FSFA 3D3WB 3L7DA 3V7NA 1FTYA 3A05A 3L7AA 2VXBA 2RAUA 3C5HA 4Z4HA 5C52B 1CUJA 1JAYA 5BO5A 2Z3VA 3SWWA 1JNYA 2A84A 4GOLD 2B7CA 4DZZA 2DT5A 4WBSA 2RHTA 4KFSA 4GQIA 3E9MA 5FBVB 4ZO8A 5CEFA 2H63A 1D1QA 5FOXA 3GEHA 3T7SA 5C80A 3HB7A 3PFFA 5LYJF 1AGXA 1QP0A 3E9YA 5T6MA 4GF5A 5AVJA 4CF4A 3I2FA 3ISJA 1S9HA 2Q50A 3PZRA 1V48A 1SZDA 3MIIA 3EPKA 2FXVA 3CXRA 2Z2ZA 2FW6A 4FDUA 3LZDA 4AJLA 3MS7A 2IBSA 3SJ7A 3TJRA 4UOEA 1EHCA 3VAAA 1D8AA 5JMTA 3D1JA 3UHOA 4D9GA 4C7XA 4O2BB 3RS9A 2P68A 3KQPA 4G1FA 3JWIA 3ZKAA 3ZVLA 1NV9A 2VK8A 2UU9B 1F6BA 4J75A 1U3UA 3ICPA 2ZR9A 4A0GA 3MJDA 3TLMA 1TK9A 3LMKA 3URMA 2I0FA 3TD2A 4PSKA 2CL5A 1K4KA 1GCUA 1ZM3A 1JKFA 4KOEC 1H65A 4BQQA 1AMOA 5LQKA 1E0AA 1NF3A 3ROTA 4YN3A 4RC9A 1G20B 4OMCA 2Q6KA 3FLAA 3PPYA 3Q12A 4GFDA 5F73A 2ORIA 1SBCA 2C8KA 4ZT3A 7REQA 3EGXB 5AIAA 4W1RA 3TSOA 4E07A 1WCYA 4RTLA 2XZDA 3DC2A 4A91A 4I55B 4JJZA 2QJRA 3A11A 1CY4A 1QANA 4IVRA 1SQ6A 3RQIA 3PDIA 1GV1A 4F97A 4Z7JA 5BOSA 1WHSA 4KWIA 7YASA 4KXXA 1VJTA 1OX4B 1UKBA 4X94A 1VPTA 5KJFA 2ECPA 3E61A 1EUQA 1LZLA 3FW1A 5DM2A 1FL9A 4II3A 5DI9A 3FRIA 3W5SA 4F3YA 5J43A 1Z63A 2I7CA 2CLLB 4H7HA 1N2XA 3RBXA 1VPDA 3KZOA 2Q4EA 4KIGA 4U00A 4BV2A 2XX3A 3R75A 2AMLA 1Z13A 3GJSA 4BFLA 4EW2A 1DIBA 1P6XA 3AYZB 3A32A 4C0JA 2PMFA 4EB6A 3B13B 2YHSA 1WG8A 2ZUCA 4N0MA 3BILA 1J99A 4O8ZA 2QTVB 4IDHA 1T1EA 4IL5A 1H69A 3K20A 1R50A 1FFEA 2YMQA 3OOWA 4HAWA 5EJ9A 4KG7A 1GNSA 1G5QA 2CHEA 4XDYA 4L8WB 5L45A 1RYNA 1H0HA 3FUTA 3K1ZA 3IAFA 5IRCD 2PH7A 4GECA 3WMGA 2XUGA 4ZV9A 5KYKA 3D3QA 2O4UX 4ZVQA 3ZYCA 5FD8A 1Z56C 2H1FA 1KA9H 2UUPA 2X4DA 3ZKWA 2I5PO 5EVJA 3FCCA 3LC7O 2RMKA 3AU9A 4U7PB 4WADA 4PN3A 1JHOA 3CUTA 1UWKA 3TB4A 4Z0HO 3EMKA 2AN3A 3T4PA 4GVPA 3P0JA 4YRTA 1TGYA 1NQ5A 2PUHA 3VPXA 3I34X 4Q19A 1B3RA 1A76A 1MXHA 2DUJA 1JTEA 3MCUA 3QOXA 5HDBB 5LQMA 4WY2A 3I1JA 4MYRA 4PYNA 4W9NA 5IC5A 1W9HA 1C3EA 1TU4A 1WR8A 2P30A 3AFOA 4OYYA 4RFVA 4I36A 4Y2XA 1XO1A 2ORYA 2DBQA 5IKOA 2YXLA 5EP2A 1YAJA 3HKDA 2W42A 3AC0A 4KNVA 1U2PA 3GIDA 3H9UA 4QGBA 3T0FA 4DZTA 3ZCUA 3R3UA 4PX5A 2YYZA 4KLRA 1GU7A 3G9XA 4QOJA 3AEYA 3UGQA 3ISVA 1KI3A 5KX5F 4J1TA 4G2NA 2HLDA 2Z5GA 2V7EA 2BSQA 5KMGB 4TMKA 2MSEB 2HRBA 5CM9C 1F5SA 1G8FA 3C5WP 3QVGA 3R6WA 1PJTA 3DH0A 1KJYA 5JMWA 1RQRA 4Y67A 4E5DA 2LR0A 1TKRA 2Z6QA 1R0ZA 3G7UA 2FSGA 3A1WA 1RWKA 3KSBC 1DDIA 2Q8PA 3CUUA 4OTZA 4E31A 4B6RA 3C2QA 3FYTA 1M54A 4KAXA 4XCVA 2CHFA 2I67A 3E23A 2WIBA 1EWQA 5H82A 3AUAA 5PGMA 4H3SA 5DJ5A 4HC4A 5DRYA 1QAQA 3I30X 4UDNA 1YZQA 4MV8A 3DLIA 1N1GA 4MCIA 4PZEA 3VU9A 1QIHA 1RRGA 2IOFA 1IZ9A 1EVZA 2V9ZA 3H5OA 4D8TA 2ZE7A 3R3VA 5K0ZA 5KNBD 4GZMA 5BSKA 4C6TA 3T3GA 3LYUA 2Q5LA 2RONA 3C1AA 1I2DA 2XAUA 3QVLA 3K05A 4IFEA 3DKRA 1YUBA 3L5OA 3ZVMA 4PRZA 1P5JA 1XKXA 3SKYA 2FFRA 4ITVA 2QORA 2YQ4A 4NU8X 4FX5A 2OHJA 3KPVA 1AJEA 3KJXA 1BFUA 1R0BA 1G9XA 2O7VA 3ELBA 3I09A 4GPEA 2I2FA 2ZIVB 3GEIA 3LP6A 4HTFB 4JOCA 1M2FA 3JSXA 3ZBPA 2VUSA 2ZU6A 1A71A 1FDSA 3INGA 2CF6A 2FCRA 3ZE6A 2IDJA 1AU9A 1F12A 1FVFA 2AHOA 3ZBTA 1CVIA 4AULA 2IUYA 4GYYA 4WVLA 4FFMA 3KKKA 4K88A 2CKDA 5CNKA 3LYLA 1XU4A 2OBXA 3A6GA 1M6VA 1TAQA 1IEVA 2XODA 4L9SA 1SCNE 2H5EA 2QAGA 2XB6A 4LJ8A 1QIIA 3NBFA 1BHJA 1VFNA 3ZD8A 1FFSA 1K8RA 1XAIA 4C9BA 5JCJD 3EHDA 2I2WA 2NXJA 4ZJUA 1W581 1AKTA 2A1UB 5FFNA 3KYJB 3I9JA 2JLWA 1V1RA 3OPQA 2P4UA 1LSUA 1PWXA 2R8OA 3KXLA 3P96A 4RK5A 1GFSA 3S2FA 2JI7A 4H6XA 4MULA 4JSYA 2FSVA 3UMMA 1CNEA 1RJEA 1OFVA 3CLVA 3S8EA 2XF8A 3JQ9C 4Q1AA 1Z74A 2RGWA 4UM8B 5BQPA 4ALIA 4BVEA 5KREA 2B6HA 1YKGA 1NM5A 3CQ9A 1THMA 3O8QA 5AKKA 3HLTA 3TZKA 2O3TA 5CT8A 3WP1B 3DCIA 4WN3A 4LBZA 1YI1A 2OXFA 4QOHA 3CTMA 2UUBB 1ZCAA 1HNNA 5LP6F 2ATEA 4MINA 4X3OA 2Z95A 4IQ4A 3KUDA 4ZEOA 2H29A 1SWWA 2JGLA 4XLTA 1MV5A 4ZVTA 4OMFG 2QGZA 4F91B 2XKBA 2ACEA 3C6MA 3FPSA 3EBOA 4RPLA 3T8YA 3Q0TA 1U2DC 2DQYA 2FTKE 4MB2A 4Q5IA 2Z8XA 4D0GA 1NRJB 3GAZA 4FIDA 3EGWA 1JR4A 3L07A 2R6GA 4G97A 4I66A 3I83A 4KVAA 1GTRA 3G6WA 2G7MC 2NUTA 1FXUA 3GPCA 1TUBA 1XQ9A 2IE0A 3FKQA 3PKZA 5EKUA 4QFCA 1VE1A 2BHTA 4XRRA 2OO5C 3BG5A 4HN2A 4ZVMA 3Q2KA 1KH3A 3D02A 4KZPA 1J9ZA 2R6CA 5KC9A 3H17A 2LIVA 4L02A 1NG1A 4NZNA 3U3KA 3A14A 4E2YA 5LQAA 4WA8A 3NJRA 7ADHA 5FXMA 3ZJVA 1O5OA 2H0RA 1LX7A 3E3MA 3KAQA 4LDJA 1O96A 4LW8A 5B3KA 1VZ3A 4G0OA 3L01A 2OAQ1 4DWOA 1J8YF 4TRRA 5EN4A 1BHSA 3RSZA 3U09A 2YQZA 5KTYA 1AQIA 4XUGB 4CKBA 3UHAA 3OM1A 2JATA 1YUNA 3SC2B 3SEAA 3HRKA 2QMHA 4ZK6A 1EEXB 2A0KA 2IPNA 1ZQ1A 4WY8A 1PHPA 4AI6A 1XFDA 1QTQA 2VT3A 2R9VA 4DB4A 4UDXX 3DAYA 5KHLB 1ULUA 5IZ4A 2NLOA 3UQYS 3ETHA 4S1WA 3TI9A 3ZHCA 1V5EA 4ARZA 2FQWA 3WL3A 5LMNB 2RIPA 2BV3A 1KJNA 3VMFA 2Q2WA 4B75A 4P7FA 2BKVA 4AIIA 4KQXA 4YCMA 1MF7A 2IITA 3FRHA 2FDCA 5FWXA 3IJ5A 1PNOA 1VJCA 3PGMA 3ZWDA 5C18A 3TB6A 2P9YA 1FPQA 2NG1A 4Q37A 5GVRA 4H1WA 2W6IA 4J7AA 4ZEMA 4GWKA 4POAA 4Z86A 3PR1A 1QQTA 3WBBA 4NBWA 2WSYB 4R8MA 3QFTA 1JFLA 3F73A 2VNSA 1NJ2A 1EVYA 1FA9A 3TXAA 5CA1B 3P52A 4NE2A 3M3DA 2JGDA 2CUZA 1PRYA 3LBFA 4H18A 4OXQA 3JU3A 2Y05A 1N2JA 4LYJA 1RZ3A 3FMGA 3T3PB 4RLFA 5B37A 5GTDA 1Q3KA 3OWXA 1BW9B 2K5UA 3EA4A 5IDVA 3VSCA 4V3CA 4BQNA 3LLVA 1IM5A 1D2CA 1KJQA 2K2WA 3LHSA 3O0TA 4K46A 4UAJA 4ZWNA 4LC9A 4E13A 3DDNA 1YBHA 4NWIA 4P2BA 3FWNA 1B0UA 4HWOA 3FA2A 3OHMA 3ZCQA 2OD9A 4BTEA 2AF4C 5EE3A 3MYYA 1P2TA 2WHXA 3PS9A 4FX2A 1G3IA 5GV8A 3T99A 4A2PA 221PA 4BY9E 3RS2A 3NMUF 3HJNA 3BXXA 4IJ5A 4R41A 4RACA 3B6IA 3LKZA 4G26A 2FFQA 3B2NA 1XUOA 1I3LA 2VSNA 5CXQA 3HNRA 3C4VA 3GEBA 3MD0A 3QLTA 4MJ3A 4IINA 3VI3B 3Q8LA 4UTRA 4GL2A 4QYMA 2I54A 2JRCA 1JHXA 5JAIA 1QV6A 2FZVA 3BMXA 3FAZA 3HCRA 2PV0A 1BYUA 3M1LA 1RJ9B 4JJ6A 5I4CA 5FTWA 4F1WA 1ULTA 3FX2A 4CIDA 2J6HA 1Q7EA 3AEUB 3G5MA 3KJGA 1JQAA 1YWGO 4MGYR 1NXPA 4ZVRA 5ER9A 5JECA 1PVVA 3L1HA 2PJRA 1EG7A 1ORIA 4JX9A 4OI4A 1TYAE 1U2SA 4PC1A 3B8HA 3D4PA 3K3PA 3UHFA 1TLFA 2CN1A 2A35A 2I7DA 3CC8A 4HB0A 2O2EA 5ECWA 2DX7A 5K0CA 4F1JA 3MCZA 1EE2A 3H7IA 2VP6A 2ACWA 3EVCA 3MS2A 1PS8A 1M2VB 2PX2A 3ADPA 3Q6NA 3WL5A 1ZJWA 1C8VB 1O87A 3W7BA 1KNXA 1RBQA 3EQ7A 1L7MA 4N5HX 4GC5A 1GFIA 2D1QA 4YQFA 1WZNA 4YRIA 4ML3A 1OC4A 4MV7A 1JR6A 2C96A 2GCOB 2PSHA 2V8BA 2VTKA 2ZATA 4RZHA 5DIFA 4IUCS 3REFA 2D0DA 4DV3B 3I6YA 4BN5A 2NU8B 3W4KA 1DFIA 2UUCB 3FPHA 2EBUA 1W9MA 5JNRA 4D74A 4Q3OA 4XJVA 3EGVA 1V1MB 4GO1A 1SFRA 3TR6A 5AM3A 2VPWA 3FDZB 3KSZO 1JGTA 1K8ZB 1NFRA 1N2OA 1NVVR 1PW5A 1QGUA 2H4HA 4NK5A 3AQ4A 3PUZA 3TPCA 3WA6A 4CL0A 4CR8A 2QN8A 2FPGA 5DLYA 2FEAA 4Q66C 2X0EA 1F8XA 3JALB 4XVHA 4DXDA 2DHQA 2G17A 2FZEA 3CKLA 4ARVA 5JD3A 2EG9A 2Z3WA 1RJWA 3DQPA 3QMVA 4H7PA 1HE2A 1TL7C 2YZ7A 1WA5A 2GFIA 4ZOLF 3ZUPA 5D00A 2ZUBA 1KC3A 5IASA 4NFLA 2CMDA 3V8EA 1N5DA 2R7AA 3Q2IA 1P7VA 1QXSA 1H2YA 4FGUA 4HDMA 1T3HA 1VZ2A 2ZR7A 1GFZA 3L1UA 5KYWA 2FFBA 2YV4A 1GP2A 2ODNA 2A5JA 2X42A 4A92A 5A3RA 3PRKE 4NONA 1XJ0A 1CD5A 1YCFA 2PDAA 4KPUA 2C4VA 2I1QA 3GGSA 3QYPA 2W0SA 3BREA 5DOZA 4EG0A 3I9MA 2O23A 4XVRA 3IP9A 1S4QA 4KI7A 4QO7A 3R0ZA 2QG9A 3LI2A 4YAIA 2QTHA 2RG7A 3ZCXA 5KNCH 2F1KA 1RWOA 1MVNA 1VMKA 3ADBA 2YZMA 2WPNA 5FV4A 3TS1A 2VYNA 1ENYA 3I5AA 1H6BA 4N9WA 5DE3A 5A3QA 1SXPA 1ODKA 2Z08A 4LDRA 3FLMA 1X1QA 2G9NA 3EARA 4ZI7A 1NJ5A 2B8NA 2B35A 5DCWA 1BA2A 4UMFA 1Q83A 3FF4A 5B3AA 1ZITA 3MUFA 1O9HA 3KPJA 3BFXA 1YZNA 3EEIA 4KIWA 3NIFB 1T26A 3L0SA 2Y92A 3AM1A 1CBUA 1EGAA 3SX2A 1CNMA 3BXOA 3TQCA 1WCIA 2V4UA 2XUFA 3BB3A 4KQHA 3BJZA 3D8BA 2ZYAA 2XZTA 5AXCA 3QU7A 3WMRA 1XHFA 1F7VA 3VUEA 2OCDA 2JFBA 1T1GA 3G9TA 1T5HX 4RY9A 2WNIA 4J0QA 3DEKA 1CDZA 1X3LA 3CNNA 2V7QD 2YUIA 3CJTA 4H59A 1MVLA 4OK5A 4YRMA 4AQDA 2NU7B 4C14A 1Y37A 1BXRB 2HDNB 2HX1A 4B2YA 1MQ8B 3GA0A 3PIDA 4MVJD 1HOTA 2C5FA 5K05A 4GLBA 4Z0PA 1A97A 4AYXA 2FEMA 3DE6X 1ISGA 2GD0A 2RBEA 1WXHA 1TA4A 5KX5B 1I36A 4DCMA 2DPGA 2JL1A 4A16A 5KYNA 1KIMA 4X1IB 5LDDC 5DHQA 4DLUA 4BIMA 3KJFA 2CDRA 4N7RA 2ZITA 4DDMA 2FZCA 4MMZB 4NR0A 3T5DA 1YZFA 2PBLA 3RAJA 2GBCA 3LP8A 2IXTA 1RYZA 2W2LA 2R8EA 2HWYA 3IX7A 3K0EA 2B4AA 4L6CA 2JARA 1U4SA 1TM5E 5KSWB 5E3JA 3DAFA 2PWBA 3RDPA 4DCOA 3VYSB 1M5TA 3WGMA 1C8KA 2IYUA 3T5CA 1NSYA 2WHEA 2Z43A 3P9CA 1LWNA 2VSYA 4FBMA 3IELA 5CXXA 5FKJA 4I4CA 5HUQA 4RTOA 4CMHA 2W6NA 1KIAA 1CZHA 2ZGVA 1BQEA 5DT2A 1T4BA 2JDID 4TWAA 2QBYB 3LUAA 1YCDA 1AGPA 2XA2A 3CB2A 2Q6LA 1GXSB 3HZOA 4AYWA 1V7QA 3CH7A 4D2IA 1TJNA 3TW4A 3PJGA 1ODFA 4BEVA 2PUBA 2QTFA 3KQMA 4LJ4A 4EATA 3QWAA 4WLEA 2G09A 1V16A 2IXAA 4DREA 3AG6A 5ALJA 5E6UB 3UB4A 1ZGGA 1DAGA 4JU8A 3UG7A 3FMPB 3IESA 3NT5A 5CITA 3ZDXB 3JPYA 1AHHA 3T3IA 3TZHA 4CWAA 3MILA 1B8VA 5HTOA 3NAQA 1XLTC 1LLUA 2BFPA 3WRXC 4B48A 3DDCA 4IIYA 1NVDA 3LX5A 4GKKB 1FU4A 2WFLB 4TVBA 5F4ZA 2XNSA 1DKRA 1GPDG 2JVJA 1JQKA 1RTTA 3GAFA 3GRUA 3JXEA 2J5BA 5FL7A 5JARA 2B5OA 4MUKA 4QYIB 3LY8A 4ZVUA 4P83A 4GQAA 5EE1A 5ECDA 3RASA 1BOOA 3CX4A 4FHZA 3T94A 1IN7A 3MRVA 1UBFA 1CX9B 3PCRB 3TZ6A 2VBFA 2PCJA 4NENA 4G0VA 2PD3A 3OE5A 1SCDA 1UBEA 1BMFA 4NEHB 7ABPA 1E7SA 4MS3B 2Q3HA 2FQ1A 5KPDA 1TA9A 1M1YB 5GAJA 5T6BA 1I2CA 4BE7B 1CE8B 2OHXA 5HF5A 4EFMA 4GM4A 5LP6B 2QRKA 2X1HA 1ZK3A 4OHVA 1Z2DA 1EHIA 3RTCA 1J56A 2AG5A 4AMGA 4IKPA 1FXWF 1WMSA 3KV1A 4AURA 5LVAA 3WZ2A 2IZ1A 1LFAA 1LZKA 2ZRCA 3P27A 4NIMA 4OXYA 4PO1A 5BV7A 4HH0A 3RPEA 4TXMA 3NBKA 5IEJA 3QX7A 1S2NA 3LT2A 4WKBA 1ABFA 4M21A 2F7SA 1Z15A 3VKGA 1HRKA 1QHFA 1UAGA 3RYCA 1INLA 2B4YA 4MQ5A 3DLCA 1L5NA 3K9CA 2IPAB 3VZDA 1U0EA 3KTAA 2Q99A 3PYLA 1B2LA 3DDZX 2OGSA 1O5TA 4FYHA 4L50A 2ZI9A 3QVUA 3V4FA 4FLEA 5CFRA 2ZIFA 1R64A 3EGEA 1XQ1A 1OWOA 4LY6A 4QFMA 1M6EX 4ZQHA 3WDLA 2NVWA 4EO7A 1G2QA 4QFBA 1TZCA 3FN4A 1TLTA 4A0FA 5MFPA 3OTOB 1BKSB 1WSAA 4FR0A 2SKDA 3AXSA 1VPLA 4EVRA 1XRSB 1Y4ZA 1XVAA 2OVFA 2YRWA 3ICWA 3PFIA 2CW5A 4PFSA 4R6XA 4P6VF 3QE9Y 5DYTA 1UJ6A 1S2OA 2QR5A 4ZARA 5G0SA 4NFSA 3NP7A 4C3ZA 3MCTA 4HJRA 4KR3A 2C2MA 1B74A 2H2DA 3VFDA 2PWZA 3A1NA 1RXWA 4DTIA 1IHYA 1N2EA 1DNPA 1NT4A 1O94A 2CUNA 3O4JA 3A6HA 4GBMA 4MR9B 3RS8A 3OEEA 3WGKA 4BTVA 3W5BA 1E6UA 1VP9A 4K28A 1G21B 2QRMA 3NHPA 2QPAA 1UZLA 2P78A 1OPRA 4E09A 4UBIA 3BK1A 3MWEA 4EGJA 1LI4A 2AQHA 1MW8X 3ENVA 4ZC1A 1ZM4A 1ZCJA 2JW5A 2GN8A 1FFGA 1UBNA 4GI2A 4W8GA 5I01A 3FYUC 5GONB 2V65A 1DRUA 5HJEA 1E4OA 2J9RA 4DJ5X 4DJAA 1FS4A 4C30A 1XPJA 2XQVA 5AXBA 4F2PA 2O19A 4UXHA 4A8JB 2NV0A 4MOWA 2DPYA 2C3MA 2G28A 3F6YA 3V8NA 3V6LA 4CDRA 4EUKA 2X1MA 5JNSA 2XLCA 1R12A 3SHVA 3NBYC 4OHUA 2WJAA 4BMDA 1CK4A 1XMVA 4H16A 4JP1A 4O4JF 1ODTC 4KL8S 1A1SA 2OHHA 3I5YA 5AUOB 2RH4A 2H1OA 4ZO6A 3E5RA 2H2IA 3PUJA 4JVLA 1FJHA 1T3SA 4D45A 2Z2KA 1DDOA 3LDAA 1VIMA 2AHRA 5IBRA 1AKWA 1GTG1 2ILVA 5BMVA 3SHQA 1FLAA 2K7FA 2NZYA 4YRDA 1JA1A 3IVXA 3A26A 1IHOA 3ILSA 3FTQA 5F4BA 2Q3DA 1BCSB 1E9CA 2R62A 3GFGA 2LDBA 3AUFA 4I5IA 4BFYA 3GNSA 2VWQA 4A8HA 3ZVNA 4JHLA 1F0YA 2QVBA 1M0SA 3AYXB 3ENWA 1Z12A 5ALFA 2JGMA 1Y5LA 3BERA 4TRJA 3SKVA 2HQSA 3EZ7A 2PTHA 1HDCA 4H4DA 4QUDA 4R51A 4J0JA 3WMWA 4P22A 2XUOA 1HDGO 2XVAA 4K9QA 2R86A 4DT1A 3HE3A 2J09A 4HPXB 4XQ0A 5COQA 4YV0A 2OCBA 1U1DA 2VJLA 2O54A 4J9UE 1S3FA 5BSUA 2PHZA 3HDVA 2P9CA 3I9NA 4R8SA 1GWNA 3LPCA 1V43A 4PRYA 3MFYA 3PFHA 4N0EA 1U2RA 4TRNA 5KYVA 3P45A 1RHMA 3GLSA 4ZJYA 3T3MB 4FZJA 1TFUA 2VH2A 1Z73A 3A3PA 4IFBA 4N4AA 4MKIA 4FYIA 4QUEA 3KFLA 2WWFA 2ON6A 3IODA 3HTXA 4FGLA 4ZYWA 3LG2A 3R40A 1Q11A 1EHYA 3OCCA 4ALMA 4DUGD 4Z7QB 2YVAA 5BSVA 3VUFA 4XA8A 1Q57A 2A5FA 4CI9A 5GWXA 4P7GA 5IT5A 5JADA 2Q5EA 3ZE0B 5KPJA 1E5DA 2N0SA 3GPIA 1TJPB 3R6TA 1LBEA 3ZCSA 2XB8A 3CNLA 4QLOA 4QJ4A 2BAGA 3WV4A 3NM5A 5CVVA 2PKRA 3DMYA 2O0JA 3R5XA 4ZT7A 2HW8A 4RE6A 5IU6A 1QYRA 4DR7B 1UQTA 1ZXLA 1VHTA 3PUVA 4IJKA 1H93A 3GFOA 3Q10A 4O8CA 4IIGA 4LN1A 3LVRE 4CXMA 1VRVA 4BX8A 2AJLI 2P9HA 4L0CA 4KJZA 3QE4A 1T4GA 1VA4A 4ME6A 1ADCA 2GVDC 2PWYA 1H2XA 2VBCA 5KTSA 2XZPA 1OKKA 1R16A 3AM3A 4D4HA 1FMTA 3THYB 3BHNA 3JSAA 1BVYF 1EB8A 3LAWA 3ORHA 3PC7A 5FI1B 2INGX 2O3QA 1IXZA 3I6QA 5FI3A 2W4IA 2OTCA 3UUGA 2C4MA 4X5OA 4B3DA 5IABA 4M86A 1QYIA 3CO0S 3LIIA 1N1EA 5CDGA 2Y1FA 4A4DA 1WPQA 4EUFA 3IHTA 4BQSA 2JFGA 1RWPA 1E2KA 2HC9A 4RETA 4EB8A 5LKRA 5F1YA 1UEJA 1QTIA 4X44A 4CMEA 1E58A 1C0LA 3GR6A 1UEXC 4FFSA 1G3MA 2LDXA 2ZZNA 3GQBB 3IPAA 1KR5A 1W29A 4UM5A 2XT0A 4BKRA 4U9IS 1NLUA 3K0CC 2ZDGA 2Y1OA 2OV2A 4TLAA 5HGXA 1E5QA 3L8FA 1E6KA 4E5KA 1H05A 2I2BA 4JDUA 1YIOA 2EL7A 2NTNA 4R1OA 2WKQA 4FGJA 3FWZA 3NHYA 4BNDA 1NYQA 1VSBA 4RO0A 1E2LA 3NOQA 3JR7A 2OUIA 2UVDA 3IT2A 1GPBA 1XZHA 5A4DA 1W0JD 2IF0A 2O07A 3I52A 2XDQA 3OJOA 1JHVA 1E2BA 1SKQA 2XH8A 1F0PA 3G9ZA 4MQMA 4OFWA 4OP3A 2BPOA 3SSNA 3VVLA 5BN1A 1BKDR 4QUJA 4Q48A 2P1ZA 4JI1B 4RLQA 1GKYA 5B36A 4IIBA 1OI4A 1JQ5A 1QS0B 1XFAA 1Y4AE 2XECA 4NCIA 2AOTB 3TIXB 1JIVA 2QN6A 1OB5A 1N34B 1QQAA 4KRGA 2DC1A 5IKXA 3WYAA 5F2KA 2P2GA 3C98A 1UKZA 2P2YA 3B36A 3VPSA 2NP6A 2H1HA 2X2OA 1OVGA 5FTJA 4F1KA 2UYCA 4FN4A 3GRFA 1JQ3A 2FPSA 2J5XA 2BDEA 1Z8HA 2O52A 1E2HA 1P4JA 3WZLA 4IXDA 1RACA 3DVLA 1PGJA 3SZGA 2QPTA 5DB4A 2VJMB 3PEYA 3H04A 3KSAC 1SHZA 2O3SA 4N6GA 4DMGA 2H9YA 4O5OA 5EWMB 3VVBA 1L7OA 1KBOA 3GT4A 1A82A 4ZAZA 1UM9B 3VNVA 2V7XA 3ZWWA 1XTRA 3OJFA 5TGZA 4CIBA 1OE0A 1LVUA 1OLXA 1TFRA 1U9ZA 1W4ZA 2XNCA 3MN1A 4FR5A 4IRXA 1W5FA 2VJAA 3ZWOA 4BVJA 1Q6ZA 4BVHA 3UWKA 4G1CA 4MVYA 1M83A 1Q1EA 4U9HS 4X3PA 3SY8A 3WK6A 2DFVA 2GAOA 4LBWA 3WO1A 2RD2A 3PWKA 3Q6IA 1QIJA 2FUNB 1JDPA 1BFKA 1QJ4A 1XB2A 1WM1A 2IA5A 3DWIA 3O4VA 2R11A 3A9RA 3QBDA 3QVJA 3CEAA 4FINA 5B1DA 3ZW8A 5LFAA 1L4GA 4M0KA 4V03A 3BGWA 1ECBA 1BQ3A 4YCLA 5DULA 1KTVA 3I2JA 1XCGB 4E2ZA 2DY1A 5ALIA 4MKHA 3OWOA 3PC8C 2IPMA 3HDTA 2DWCA 1XCOA 2QUIA 4LWQA 4FOOA 4NBRA 4UD6A 3COYA 4C07A 5H16A 3RFTA 3D4OA 4L16A 3KLBA 5I9SA 4AN0A 5DKFA 1XRLA 2OYCA 3QWBA 4QBHA 1T5TA 3U4QA 2GN2A 4XWKA 3UGTA 5K3OA 3DPSA 3V5NA 2FPLA 1JG7A 1ITZA 1D6MA 1JFFB 3LUHA 1VMAA 2YWDA 2C7OA 3NTRA 3DEYX 3ID6C 3FNBA 1RC8A 5BURA 2GM5A 4CEHA 4GPTA 3CKMA 2HM7A 3AU8A 4FYJA 1VDMA 1F4LA 4L72A 2UXBB 3KSMA 2WYHA 4LI3X 4YMGA 5KNDA 2QIOA 3BK7A 1RQ2A 1SHTX 2C0CA 1GNQA 3GJ0A 5TARA 1PD0A 2ID4A 4UVEA 3A2MA 2DFKB 2FEKA 2COEA 3L06A 3JZAA 3FZNA 1ZX1A 4L3WA 3EF3A 4MVJP 4QXRA 2XDAA 4XWAA 1Q1GA 3H6KA 3O3CA 1RRCA 1JIUA 3ZHQA 4LJRA 3O95A 1ZAYA 2JFQA 3H3JA 1JYFA 5JZ9A 3AUJB 1H5QA 3QLVC 3RTAA 1E5VA 4E5YA 4MROA 4QC2A 4BFCA 3W5AA 1NN0A 2O2DA 1QBKC 1WMEA 1GOTA 2YY7A 3AFNA 3LX6A 3R0XA 4WKGA 3UBMA 4CFSA 5REQB 3I53A 4CTKA 1VLMA 5BRJA 1AB6A 3Q41A 1D0VA 4K6HA 4FNGA 3EZFA 5K1ZA 4BMXA 2OD7A 4REQB 3WJ1A 1A8PA 4KIUA 2F48A 5I8PA 4RTNA 1UBKS 3OIGA 4E5PA 3DMNA 4KJXA 4EOGA 1U7WA 1YNSA 1W7AA 1E2UA 1UJ2A 2GESA 2POCA 1HT1E 4L08A 3FJYA 3CWCA 2NTEA 4NICA 4TWRA 4FUTA 3EIQA 4RCYA 1CZLA 2EFCB 1MNQA 1OOEA 4FOSA 5ALUA 4ER5A 2GCNA 4O4LB 1RHJA 2Q4DA 3ELYA 2XCUA 4PG6A 1CNFA 2EF1A 4R8LA 1PWZA 4JEMA 2R1VB 4RVUA 3GCDA 5T64A 2IHZA 3L18A 4XTCS 4FMDF 3IE2A 5LZ5A 2X14A 1PQ4A 2R6HA 1QKIA 3QW4B 4YMIA 3WMEA 1H6AA 1UZUA 2XNDD 2VQDA 2WA2A 4GRDA 4EEKA 1GY8A 1IIRA 4OMDA 5C8VA 5AKLA 4JXXA 1IVYA 2V7GA 1HEUA 5KTKA 4BBAA 3ZHUA 1NN1A 1YFZA 4MS1A 4ER3A 1XRPA 3ZQJA 2F1HA 2J0UB 1DWOA 1QFZA 4FMCF 1K7EB 1JF8A 2FEPA 4FLFA 4MZXA 2CDNA 2OC4A 1NRWA 3MT9A 5A2QA 1Y1RA 3KJIA 4BWYA 3LUPA 4CM9A 1CRLA 4JJEA 1ZH0A 1KAEA 2JIZA 4JAVC 2B94A 4LYHA 4FCVA 4KYTA 5SICE 1JKMA 1D1SA 1TF5A 4NJEB 4HWPA 4E32A 5JAMA 1O08A 3B9RA 5A06A 3G0CA 2CLKB 2R5NA 3A6KA 2PEZA 4HFRA 1UH5A 4NU0A 3VR0A 2V7UA 6LDHA 1JUDA 5CLIA 1UXGA 2AFIA 2EBHX 3G8CA 3Q5EA 3KYDB 3MOIA 3MTIA 4GH5A 4HAVA 4J7XA 2N42A 2PLRA 3JYNA 5DYNA 1CTQA 3N0WA 1LVHA 4BB0A 3VMMA