2XTZA

Crystal structure of the g alpha protein atgpa1 from arabidopsis thaliana
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
349
structure length
341
Chain Sequence
b'MGSGIHIRKLLLLGAGESGKSTIFKQIKLLFQTGFDEGELKSYVPVIHANVYQTIKLLHDGTKEFAQNETDSAKYMLSSESIAIGEKLSEIGGRLDYPRLTKDIAEGIETLWKDPAIQETARGNELQVPDTKYLMENLKRLSDINYIPTKEDVLYARVRTTGVVEIQFSPVGEVYRLFDVGGQRNERRKWIHLFEGVTAVIFCAAISEYDQTLFEDEQKNRMMETKELFDWVLKQPCFEKTSFMLFLNKFDIFEKKVLDVPLNVCEWFRDYQPVSSGKQEIEHAYEFVKKKFEELYYQNTAPDRVDRVFKIYRTTALDQKLVKKTFKLVDETLRRRNLLEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANINE NUCLEOTIDE-BINDING PROTEIN ALPHA-1 SUBUNIT
publication title The Crystal Structure of a Self-Activating G Protein Alpha Subunit Reveals its Distinct Mechanism of Signal Initiation
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
total genus 130
structure length 341
sequence length 349
chains with identical sequence B, C
ec nomenclature ec 3.6.5.1: Heterotrimeric G-protein GTPase.
pdb deposition date 2010-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 2xtzA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2xtzA01
1BOFA 5FUXA 4ARZA 4JLNA 4RD2A 3TLXA 4B3DA 5JEEA 4NYMQ 4TL8A 4B44A 4CT4B 1FTSA 4BLPA 1NVVQ 4QXAA 4DC9A 1XB2A 2F7SA 2ZRLA 3PEYA 4BEJA 1P62B 1DE0A 1BS1A 1SXJC 2ZS7A 4HUQB 4X8HA 3TUIC 4W7SA 5JECA 4LX0A 5FTMA 3CR8A 2FPKA 3N5CA 4HATA 4RJLA 4TL9A 5FPTA 4B35A 3T61A 3QEJA 5FOTA 3RSLA 1FQJA 1PJRA 1ZC3A 4L8GA 5J4YA 4L9WA 4Q03A 4HEJA 4A2QA 1GFIA 2IT1A 4W5HA 4EPVA 3V4RA 4QRHA 1IJFA 3NWJA 5FL7D 3QKSA 1KI6B 1OJLA 5GJWC 3ZVRA 2BC9A 4GBMA 2ORVA 3C5HA 4ACAA 2I1VB 2XZLA 3CBQA 3CKLA 2BOVA 3X1WA 2H7VA 1KSGA 2JJ1D 3CNOA 2PT7A 1C9KA 1FUKA 2A5YB 3BFXA 3KKMA 3R9WA 3ADKA 3Q9LA 2O52A 1M34E 1CBUA 2F9LA 2ZJ8A 3DL0A 3WXMA 5C1BA 4MUBA 4Q1CA 2CMKA 3VKHA 4LJ4A 1MO4A 5CJ2A 1E69A 1OIVA 1TUEA 4PR0A 4UNQA 4KFTA 2D06A 2OHFA 2EWWA 5FFMA 3K09C 1GP2A 3HJNA 2AHOA 4EIWA 4LUCA 3ZD6A 4XWOA 3PITA 2FSGA 3A8TA 3RC3A 4Z8YA 1UADA 4LRWA 2F55A 4TMKA 2QSZA 1XJCA 2YYZA 2YWFA 2YWEA 3IHLA 4P31A 1O87A 4E5UA 2P5TB 5L3QA 2PLRA 1N5JA 2QRZA 3TUJC 2CJWA 1OYWA 4BRWA 2ZANA 2C78A 2FU5C 3SJBA 1GKUB 3EWAA 3I72A 4B33A 2IL1A 1KK1A 1KO7A 1X86B 1XD9A 3KFVA 1D2EA 2J0UA 1Z6GA 4M4SA 4PC3A 3W9YA 2F9MA 3SJCA 1P7CA 5KOYA 2GAOA 3X1XA 2IHYA 3CRMA 1T6NA 4LJ6A 1C4OA 4IVRA 3X1ZA 1R7RA 1SVKA 4WZAE 1MOZA 1YVDA 2IYRA 4LHXA 2F1JA 2MSDB 3QQ5A 5G3ZA 4LPSA 1ZD9A 2KI5A 2PJZA 4C7OB 4JVLA 3RS5A 4TMXA 4WOPA 1S4QA 3QSYA 4U00A 1TADA 3EG5A 1CJVC 3AF1A 2ZXUA 2A3RA 4HB4A 2B7BA 3W34A 4LJ9A 4XWAA 1KZGB 3E2IA 4LHZA 621PA 3LNCA 4TQ9A 5ANRB 4DEYA 2MMCA 2QPOA 2N46A 5EXSA 5KSOA 1E9BA 1DBSA 3LBNA 4B34A 2IX3A 1CTQA 2O8DB 1KNXA 1ZIPA 2GCPA 4ZIRB 5EP4A 3RRZA 1VHTA 4GSYA 4M9XA 4KO8A 3V9PA 4DKXA 5FTKA 5J4LA 1RJ9B 4IOKA 1AIPA 2WJJA 2ZR0A 2G0TA 3A37A 3JZAA 2J87A 4MGKR 4XWKA 1AGPA 2YHSA 5TVKA 2DB3A 2RHDA 3QE0A 2CLCX 3THYA 3QPUA 4RKEA 1DEKA 1G7SA 3BH6A 1GOTA 4NE2A 3M4YA 1LVGA 5FOXA 1TUIA 1JPNA 3ADCA 1ZCAA 1KGDA 2QQEA 3C4JA 2ZVPX 4HAYA 1MABA 4B48A 4JS0A 4RCYA 1RRCA 3BB4A 1Z6YA 2PCLA 4LBYA 5K8UA 2AN9A 2F1RA 3LLMA 2IYZA 5CLQA 4NP6A 3K0CC 2L0XA 3EC1A 4CEIA 2YOGA 2W0SA 2HV8A 2YOFA 4Q21A 2QM7A 5JHHB 3B1VA 4QFMA 5CYOA 1LY1A 5BQ5A 4TZ0A 4YMUA 1JQLB 1NBMD 4A8JA 3K0FB 4LC0A 3U6BA 2AR7A 4PX9A 4XTRA 2JLQA 2D2EA 4OQNA 2NIPA 2A7QA 5GJCA 1VPLA 2QP4A 1VCNA 1NLFA 4B2LA 2MSEB 5FTLA 1GDDA 5B64A 4KI0A 3DHWC 1CF4A 3KJIA 1S2MA 2BMEA 2NTYC 3B7GA 2QI9C 4KBFA 3X1YA 4LWZA 1K5DA 3B5JA 5DIFA 3R7WB 2QGZA 3UIEA 4W9MC 3FPAA 1HEIA 4FW9A 4ILEA 5JJIA 1M6NA 3MWKA 5KSPA 1DAIA 1N0UA 4M9ZA 3VR1A 1PV4A 1T0HB 1GNPA 2RH5A 3K9HA 2D4HA 4NCKA 1Z0KA 1E0JA 2NO0A 1P72A 1TU3A 2WPDD 4HAVA 5KUTA 1FW6A 2ZQ5A 4Q9KA 2VIIA 4URVR 1N0VC 5HZHA 3TR5A 5SZIA 2XXAB 1P4SA 5KDOA 1UAAA 1WRBA 5DI3A 3R9XA 4Q9IA 3OAAA 4JL5A 2DYKA 5BYJA 3U3MA 1Z0FA 3MG9A 1OXTA 4KFUA 5JRZA 4C9BA 2YWHA 1BYUA 1GL9B 2D74A 1G19A 2B92A 2BEKA 4Q7JB 1W2GA 4B3BA 1LV7A 4EFMA 3AUXA 4TTRA 2JLXA 2DFTA 1G8GA 1Z0IA 1W36D 3T5GA 4PZLA 1QVRA 3TSOA 2V9PA 3DKPA 1P9WA 2G1JA 1T5LA 1KI3A 1XEXA 4JZKA 1Y3AA 1IOZA 1KJYA 2CVFA 4CIDA 2Z43A 4WIAA 3U7EB 1VKJA 4OJQA 4IOJA 3VR3A 3X1DA 3U7FB 4GDFA 4JLBA 2V4ZA 3B85A 4GOXA 2GCOB 4BLSA 2BHRA 4Q00A 2QGNA 5JWHA 2XEXA 4DSOA 3O8RA 4NH0A 3P4XA 1KKMA 5HCIA 4YMTA 1E94E 1XTRA 4PSKA 2OAQ1 4R7ZA 5G3YA 4F38A 2QA5A 4D80A 3B1YA 2RGNA 1CLUA 1FL9A 2UVQA 5B30A 3TIFA 3ZDQA 2OCBA 2FNAA 3JVVA 4XVQA 5CB6A 2OCAA 1EFRD 1G1MA 1RZ3A 4IXNA 3RABA 1CP2A 2GILA 4EFNA 3DZ8A 4TLAA 3TR0A 1G8YA 1N6LA 3FOZA 1E1RD 3H0KA 2Y8EA 3EW9A 4RFSA 2IXFA 2X1VA 4ABYA 1PUIA 3VR5A 1A2KC 2WTUA 1QVAA 1GTVA 3QKRA 2XGJA 3IIKA 5CDFA 3UG6A 2GWHA 2J1LA 4ZCMA 5F98A 4OQXA 2KJQA 4LHVA 2VHJA 3W8RA 3SFVA 4D4JA 1J2JA 3SYKA 2OUKA 1G6HA 2AD5A 3A36A 3B1XA 3L0IB 2F6RA 3VQTA 5DI9A 1E9CA 4A0HA 3HU2A 2J0QA 2VL7A 4N3NA 5KTYA 3CR7A 4OI4A 2AXNA 3F8TA 3BRWD 4MKHA 1KI4A 2V1UA 2CNWA 4LI0A 2WOOA 2IS4A 1KSFX 3EAQA 4JLOA 1XTKA 1AA9A 1U9IA 2PH1A 1KTVA 3U3OA 5CDFE 4D4KA 3SBEA 3WNBA 2IA5A 2IYTA 1DOAA 4MA4A 5UKDA 1DAGA 1F2UA 2CDNA 4MKGA 4URXR 3REGA 3GJ0A 3Q7PA 1MRSA 3RYTC 3WMFA 3GP8A 1G9XA 2C96A 2ZROA 4XSHA 5SZKB 3AVQA 1E0AA 4QHSA 4XSGA 4FI3C 4B73A 2IUUA 1I4TD 1EWQA 2OBMA 2OXCA 5IF9A 2H1LA 2ZS9A 4ERNA 4WBSA 1S1CA 3QF4A 3SQXA 2PL3A 3TJZA 4PC2A 4TLDA 4P4SB 4XD7A 1HV8A 2X2FA 2WICA 2J0SA 3AVVA 4ZI3A 1UPTA 2VP4A 3F0TA 4DB2A 3N2IA 4EJSB 1RYFA 1X8KA 2R6AA 3LRPA 1FP6A 1H8ED 3GLGA 4U7DA 4US2R 3AP3A 1G6OA 4G1UC 4O0MA 5C18A 1AK2A 1FZQA 3BE4A 4QJ4A 5AJWA 1XEWX 2QAGC 2QRNA 3I1FA 3VR2A 2PX3A 2G0NA 3Q3JB 1A7JA 4TL6A 5AJYA 3GFOA 1SVIA 5HPYB 5JCPA 5K8LA 1AN0A 1SXJB 4Q1FA 2CBZA 2FFQA 2ZJAA 2NO9A 4TL7A 3BH0A 3EZ2A 1W4BA 1PVOA 3TMKA 2ZJYA 1JALA 5TXGA 1YR8A 4OK3A 4DUGA 3GLGE 4AD8A 1V5WA 1EFUA 2CL0X 1GL6A 1YHNA 3CLVA 5CLLA 4Q4AB 3SEAA 2N1BA 1FFHA 3K53A 2Z83A 3EPHA 1BMFD 1CS4C 2DR3A 4CT5A 1XJ0A 1H65A 1KI1A 1D8TA 2ZJ2A 4DLUA 3TQFA 5CK4A 1E9AA 5IK2D 4M8NE 221PA 3NEYA 3W6NA 1EWRA 3AVYA 3AKDA 4PPGA 4HAUA 1ZBDA 2PEYA 4XOIA 5D3MB 3WMGA 3IQWA 4ZO4A 2OCPA 3TNFA 2XZOA 1IM2A 2XOKD 2AWNA 2I1QA 2JATA 1SHZA 2JAQA 2GKSA 2Z5FA 3LO5A 3UPUA 4JBXA 2RGBA 1EXMA 3ND8A 3DZDA 5AJZA 4YQFA 1CJKC 4QGFA 2ZE6A 1NY6A 4KHZA 2GF9A 1J70A 2NZ8A 3GJ8A 2QAJA 3HR7A 1NN3A 4WXPA 2HYDA 3T12A 2AKYA 2JJ2D 4LOAA 4BASA 4URWR 2P0EA 1HE8B 2ODBA 5AUQA 1R2QA 1Q22A 3HU1A 4ZDJA 2JLWA 4M1YA 1E2PA 1M1YE 4PO1A 4Z8XA 5EXPA 2DHRA 2FF7A 2PZFA 3HP1A 2A2ZA 2WHXA 4M2LA 1V43A 3IHWA 5A4JA 1RC8A 2GJSA 1P5ZB 1TPZA 5A0FA 2VSOA 2IS6A 2ZAMA 2O8CB 3KZ1E 4B2IA 2OFWA 1NSFA 1SZPA 2FDCA 3O8BA 1Z07A 2DFKB 2C99A 1YJ5A 1CR4A 3PUYA 4NYIQ 5BN4A 2OM2A 2VP9A 2B7CA 1E6CA 4BUJA 3U3JA 4UNPA 3H2YA 1AZSC 1ETUA 1W0KA 2XNDA 4O2RA 4AKGA 1W46A 2GXSA 4JKIA 4IXMA 2C2HA 2HYIC 4GRAA 3C16C 1OHHA 1LFDB 2ZS8A 4HAXA 2PLFA 2RGEA 3QXXA 2R6GA 2H18A 1OSNA 1HE1C 1JR3A 3WRYC 4IDNA 4UXIA 2CLSA 4PQFA 2O0HA 1XPUA 3THXA 2E87A 1LNZA 1MR3F 1G7TA 2DWQA 2FZ4A 4P33A 3ZZUA 4HDOB 4NKRA 4I81A 5FOUA 5FH9A 3W8NA 3GLFB 1DO2A 4DLXA 1II8B 1OE0A 1I4DD 2F43B 2YINC 3C41J 5HTKA 4AURA 4UNRA 1EX7A 4FCTA 4NHOA 1AZTA 2WZQA 5LBIA 4RSGA 3LVRE 1Z2CA 1VCMA 1XXHB 2ANCA 3NHAA 4M53A 4BGDA 2XSZD 1KK2A 1W4AA 4D26A 2BCGY 3AQ4A 1JR3E 4LJ8A 3AGPA 2FFBA 3GJ6A 4HDQB 3KJGA 2FWRA 1TNDA 3PXGA 2WV9A 3GCGA 2GXAA 3LFUA 2XTMA 4Q4HA 1OXUA 2QL6A 4BFYA 4GL2A 1LF5A 3SHFA 3RRYA 1P9RA 2WSSA 1OH5A 3AB3A 4Q7KA 2C98A 3WHKA 2BKEA 1Z6TA 4HUQA 1HURA 4C0QC 3EXAA 1U81A 2Q21A 3LQRA 4GMXA 4TT3A 4C4PA 2DY1A 1N0WA 1L8QA 3CONA 2R65A 3Q7QA 5B57C 4HAZA 1FTNA 4I1VA 3ZD7A 4LYHA 3AKYA 3CF2A 3T1QA 1KDTA 3U60B 1NLZA 2GTPA 2R6DA 1YR9A 3OEHA 2FPLA 3EZ7A 4Q4JA 3VTKA 1F3OA 4ZDKA 1X8LA 2ZSFA 1T4GA 2VP0A 2Z6VA 2ZRFA 3CZQA 5JHGB 2ZR7A 2ZRJA 4ZCIA 1U94A 4GP7A 5FI1B 3U4QB 1E4VA 4WW0A 4WAUA 4TYYA 4DCSA 2ZIAA 4F4CA 2ZRCA 1M7GA 4G3XA 1QHYA 4PC1A 5FTJA 1J90A 5FBVB 2QBYB 4FCVA 4URYR 4BZQA 4A0GA 5J4VA 3IDQA 1YZUA 1ZUIA 1SULA 1IY2A 1R10A 4NYJR 2VHTA 4C0KA 3A4LA 4PHGA 3QNUA 4PANA 2OILA 2W0MA 3MGCA 4A2PA 3TE6A 4ASUA 1KO8A 3CO5A 1R0ZA 2ONKA 3NBYC 4FMCB 2PMDA 3IBYA 2RGGA 5E3HA 3A1VA 4FD2A 3G82C 1YZTA 3RWOA 2IYSA 2JLUA 4ZKEA 3QOFA 4P4TA 4KVGA 1E79D 3A4MA 4XIGS 1DADA 5KNDA 1N6KA 3BFVA 1NNEA 1R5NA 2C8VA 1P2SA 4R2HA 2JASA 2QUZA 3OE7A 1KHTA 4KXFB 3LAWA 3ETLA 3BB1A 4OKSA 2BJWA 1OLOA 2C04A 2QROA 4B3CA 1US8A 3WYAA 1YZQA 2VP5A 3FKQA 3TH5A 4PO8A 3PEWA 1KMHB 1QHHA 4RY2A 5CJPA 4Z1MD 2V55B 1T5IA 2VSFA 3DEFA 5DNYB 4C7OA 3OEEA 2AK2A 4DT1A 4DSUA 4TYWA 1VTKA 2BMJA 2KE5A 2R62A 4JLVA 4P4UA 3QXHA 2B21A 3LQQA 4A8JC 4TWZA 4BFWA 5H70A 2EQBA 2W00A 4K46A 1NJFA 2GAAA 2G83A 1KDRA 2OBLA 2ZYUX 1G3MA 1GNRA 3BWDD 5TY0A 1Q0UA 2OBNA 3TAHA 1L4UA 3O8DA 4JLPA 2O8DA 2YWGA 3NBXX 4C2UA 5AUNB 1FMJA 2IYXA 4CYMA 2OLJA 4RZ3A 2QNRA 3K9NA 5KPJA 4PTLA 2JIZA 3RS4A 2J7PA 4LZZA 1KKLA 1E2IA 4FINA 4QL3A 1KY2A 1WQ1R 3HDTA 2MMGA 3VHXA 1R0XA 1Z5ZA 2IYLD 1GRQA 1T3LA 4IDQA 5DYIA 1I4LD 1NMYA 2BM0A 3TQCA 3W5JA 4D82A 1Z3IX 2CHQA 5L3SB 3P4YA 2V3CC 1CRQA 2BMDA 2IXGA 4I1OA 2CL7X 2OSBA 2PEZA 2WWGA 2GBLA 4OBEA 1TF5A 2GJAA 1G8FA 4TMTA 3H86A 2GXUA 3KKPA 3THWA 1Q1BA 4L16A 1AJEA 2C9CA 3GMTA 1NLYA 4HZUB 4IFBA 5EP2A 2OLKA 2CCJA 3GEIA 1ESMA 4A9AA 3B1ZA 4AYWA 4XJXA 2WJIA 1EK0A 4B71A 3K0SA 3NC1C 2NO1A 4PHFA 5HE8A 4Q66C 5H1YA 4YMSA 2Q3HA 3EC2A 1XP8A 4XH9B 2B6HA 3NKVA 3T1TA 3EWSA 4Y0VA 2OV2A 3ASYA 2ZRAA 1P60A 4IVQA 3I3SR 1HH4A 1XTIA 3A1UA 4FIDA 1E9SA 3OHMA 2A78A 2V7QA 1LS1A 1PUJA 3UMSA 1AS2A 2W2VA 2P6RA 1X6VA 5FPKA 3G0HA 1E1QA 4A92A 2WJVA 3VMFA 3I8XA 2REBA 4NDZA 2ZRIA 5EP3A 5E7IA 4BFZA 4CRWB 5F9FA 2P6UA 1L2TA 3UKDA 1WBBA 1Q21A 1UKYA 4PHHA 4IOMA 3DMNA 2KSQA 2QAGB 2V54A 4OQFA 2DFNA 1H8HA 4WZ6A 2IWHA 3RDPA 2YC4C 3NXSA 2QG6A 3GFTA 4QBGB 3PUZA 3A58B 2HLDD 4DVGA 1YQTA 2HDNB 1T8TA 3H4MA 2QT0A 3KJEA 2QTVB 2AK3A 1X1RA 4LPKA 5AUPB 1OV4A 2V1XA 2AWOA 3TSWA 5HCNA 5EE0A 3QENA 3IILA 2G9NA 3MWLA 2VHQA 4JJKA 1ZUHA 2ZR9A 1AM4D 1N2CE 4UNSA 3KQUA 4TN1A 1OH8A 1ZNYA 4H9GA 1VYUA 4KCGA 2HCBA 1HQYE 2ZITA 3CM0A 3C15C 4DCVA 1ZU5A 4DIEA 1G18A 4IEIA 3SC3A 4I1SA 2IUSA 2WMOB 3I92A 1QBKC 3AKCA 2O0KA 1RW4A 1FX0B 1Z22A 5FL7A 4BZXA 5D3QA 2WKPA 5DH9A 1RRFA 1OFIA 1U9IC 2CK3D 2IYWA 2ZAOA 4QHYA 3SR0A 2HCJB 3ZVLA 2FMXA 1GRRA 4XVUA 2RCNA 2JJ1A 4JLAA 4FMDB 2BWJA 1HQCA 2ZSDA 4KFRA 1G7RA 3SZRA 4B3FX 4D25A 3ADDA 4GMDA 5C2JB 1NIJA 1DELA 1SXJD 3I73A 1D5CA 1G5TA 2IS2A 4DLTA 1G20E 1D2MA 3P32A 3U61B 3IQXA 1K8RA 4JYCA 1MO5A 3UXMA 5JBQA 2GHIA 1JXOA 1G4UR 3B1WA 3EA0A 4RZUA 4TMZA 1HY3A 4B76A 2O8FB 4II7A 3AH8A 2IYQA 3A1TA 2W6JD 3QBVA 5L3RA 1J8MF 4TYNA 3R8FA 3PENA 1ONBA 2V8OA 4ARZB 3CW2A 3PFIA 2CE2X 4IEEA 3CRW1 4FCWA 5EXTA 5CYPA 1FNMA 4DEXA 5DISB 2YV5A 5LD2C 3LD9A 4L5BA 3KJHA 4L15A 2BEJA 1SQ5A 1CR1A 2QTHA 3QKUA 3PR1A 1BYIA 5G41A 1U2RA 1YU9A 4PSAA 2XJ9A 5J5CA 3DOEA 2P3SA 4V0NA 1XCMA 3QIAA 2B8WA 2VH5R 2XB4A 2JDID 1R4AA 2E1RA 4LBZA 4US0R 4YDHB 4JLJA 3CX6A 1XTQA 1XDBA 4YXWD 3FVQA 4GI7A 3FHTA 1R5BA 4N0EA 1W1WA 2G3YA 4C0LA 5BN5A 3AV0B 2ZRPA 3UWOA 4TTPA 1TU4A 2QN6A 4EJSA 1DAHA 1VIAA 3L8YA 4IOLA 4LJ7A 3ZGXA 2TMKA 2YVUA 5CITA 2BBSA 4IFEA 4DLRA 5FPHA 4LHWA 1TF2A 4JIMA 1G16A 4JSTA 5DHFA 1XWIA 3NHBA 2QY9A 4DLWA 2IYVA 4M9QA 4DLYA 5H8WA 2BJVA 1XZQA 2Q0HA 3ZZTA 1E9RA 1QHGA 1F5NA 4C3ZA 2A5JA 4JBYA 3KQKA 3LH5A 4NZYA 2AXPA 3HR8A 5HE9A 3FHOA 5SZJA 3CX7A 3K8YA 1RRPA 5TDHA 3L2OB 3M1IA 1Q44A 3NH6A 4HLUA 5IHPA 4PPFA 2G88A 3LBHA 2VP2A 1P61B 5DLQC 1FP7A 4PAMA 3RANA 4MRRA 5HKKD 1ZM2A 3IO3A 2CJWB 5B2ZA 1DAFA 2RGAA 2FPMA 3WNDA 3FHCB 2G6BA 2I4IA 3QXJA 1DS6A 1S9DA 2J0UB 1W4CA 1OXXK 3Q85A 4LJ5A 3VR6A 5BYKA 5TMPA 1NN5A 2CNWD 3QUSA 1RYHA 3RS2A 121PA 2EFCB 2OFOA 3HPRA 1S96A 2BVNA 1XD8A 4J0QA 3ZIAD 2N42A 2HUPA 4NONA 3ZQ6A 4DHEA 1HT2E 1NY5A 5D3MA 4RD6A 3TGPA 1E2HA 1KMQA 2QPAA 4HLDA 4FN5A 3WRXC 1IBRA 1U8AA 1GVNB 4UKDA 2GEDA 2JGNA 3A1SA 1N6HA 4LYAA 3AVTA 5KDLA 1JBKA 1Z28A 4PC6A 1E2LA 1OKKD 1G3IA 2J5XA 1NBME 4DSTA 5L3VA 1E96A 1YZNA 2ZRHA 4GPTA 3PEUA 5FUWA 4KFSA 1CR2A 3DMDA 5J4KA 1II9A 3FMPB 3RWMB 3ZQJA 2RHMA 1YZLA 2WPDA 2ZSEA 3CX8A 1OT3A 3RS3A 2QMEA 3OF5A 1N6RA 2FA9A 3U6KA 1E2DA 3BIFA 4LHYA 3IEUA 3SBDA 3AVPA 1EFTA 2XJ4A 2Q3MA 4CVNA 2JLYA 3MJRA 3V4FA 4KJZA 4R98A 1Z63A 1J7KA 4TLEA 2HF8A 4BPBA 4O3MA 2C77A 3H84A 1D9ZA 4RVCA 2C9OA 1IXZA 3PEVA 3CB4A 1Z0JA 1P73A 2EFGA 2F3RA 4PPNA 3L0PA 1XD2B 3LWNA 5AJVB 3NH9A 4PXAA 3EPJA 3QXCA 4DUGD 4QM7A 421PA 5KSZA 1S1MA 2BBTA 2F3TA 2VEDA 3HWSA 4GOKA 4YC7A 4Q9JA 1WA5A 3QG1A 4CEIB 5F9HA 1IY1A 4N0DA 4IDPA 2YOHA 3I32A 4RCZA 3K0EA 2LKDA 3VNVA 1XZPA 4QC2A 4LV5B 4UJ5A 1N6PA 4A8JB 4N1AA 2GJKA 3W6PA 4F4JA 4RD3A 1F60A 1R0WA 1XPOA 4DLVA 1DARA 3WHLA 2ZI6A 1E9FA 1GKIA 2QE7D 1YRAA 1QG2A 3CWQA 2GK6A 2W6ID 4XVRA 3EASA 3EZFA 4KSBA 3GLFA 1II8A 2HF9A 3R8CA 2D2FA 2QPTA 2E9SA 4G5QA 1BKDR 1OW3B 1T3HA 4ITRC 1S9HA 5JS8A 1CJMA 4KITB 3UANA 1NKTA 2ZU0C 3L82B 1UKEA 2BV3A 1EFRA 2HEIA 2GETA 1XRJA 2REXB 3EIHA 5BW8A 4AKHA 1UEIA 1SGWA 1W4RA 2J7KA 5KYKA 1E1RA 5EJEA 3B13B 1AQUA 2KWIA 4EAQA 4AY2A 4G5RA 3KUCA 5A5GA 5DN6D 1SKYE 2ONJA 6Q21A 4NL4H 1OYYA 1I2MA 4QGAA 3CIOA 4PFSA 3GLFE 4Y0AA 3W3AA 5DI3B 4P0TA 3QXSA 2R2AA 4GP6A 3D6TB 2HJGA 3OFND 4JSYA 4P3YA 2P5SA 4AYTA 2PMKA 4PO9A 1QF9A 4FMCF 1W47A 3QI2A 5K8IA 2I3BA 4Q19A 4OQMA 5GADl 1KOFA 4GT1A 1U99A 5EE3A 2R6CA 4FWIB 1NI3A 1FPMA 3SOPA 3GLIA 1OFUX 3LBIA 1N5IA 1Z0DA 4M1OA 4AIIA 3KXKA 5JEDA 1PZNA 1RFLA 3U4QA 3U3RA 3MLEA 2ZI5A 4KYIB 4BFSA 4AG6A 1JR3D 1E0KA 3EARA 3WP1B 2BKUA 3KX2A 3VX4A 2FFAA 4OHVA 3CZPA 1ZINA 1IONA 3BB3A 4MGIR 1IXSB 1DPFA 3ONWA 1W44A 2QBYA 3KXIA 3KFXA 3C5CA 4E03A 2G1KA 3MMPA 4LV8B 4F93B 4BWYA 2IYYA 3IBGA 3L0SA 3QVUA 2XTZA 1FNNA 3FKSA 4ZPXA 3TBKA 3GLIE 3JZMA 3GEHA 1JXMA 3F3YA 1MH1A 4MYUA 1KDOA 3ZJYA 4DJTA 4HI0E 1E3MA 1ZMXA 4LK2A 3KTAA 5CIQA 5EQTA 1H8EA 4Z51A 1UBFA 3AKEA 5KDDA 2IXEA 1DO0A 3P20A 2QEQA 1W2HA 2F1HA 4M1SA 4RFSB 2QM8A 3WMEA 3BERA 3TSZA 1XU4A 2VF7A 4RD1A 3M0EA 4DDVA 4ZCLA 3K70C 3WY9A 3QKRB 3WNCA 2ORIA 2IYUA 4EKDA 2PZGA 3I8SA 1T9HA 4BE7B 4Q1BA 4HLCA 2WJHA 1OB2A 2GBLC 1AKEA 3O8CA 4B3GA 1QG4A 3AVOA 4MKFA 1N5KA 4G0NA 4HZIA 1KMHA 4QNRA 2A30A 2O5VA 4DIDA 1P75A 2CCGA 3VU9A 3PV0A 1ZC4A 3PUXA 5JWRA 1ZW6A 3OEHD 3KDSE 3CH4B 5IK2A 1ZVQA 3AGQA 2ERXA 3PVSA 2J9RA 4BECA 1G7CA 5LPNA 4BZPA 4UXHA 2IHBA 2X77A 2IW3A 1F2UB 4JT4A 1ESNA 2QORA 3QJYA 4M1MA 5TARA 5FBLB 3PUWA 2Q9AA 4AI6A 1TL7C 2XOKA 4IKEA 5JSZA 4R9UC 4RD4A 2ODEA 2NO6A 4EDHA 1JJVA 3ICQB 1CRPA 3DVLA 2ZJ5A 3QF4B 1NRJB 3THOA 1BIFA 5G53C 1P2TA 1Z6AA 3B2EA 4C30A 3RAPR 1Z8FA 4C0SA 2BIFA 3FFAA 3AF4A 3NVAA 4IVPA 3J81k 2RGXA 3K0AA 4OHWA 2FE4A 1OH7A 2ZRDA 2JJ2A 2JA1A 1GUAA 2ZPTX 4RKFA 1LB1B 4AWXA 1A2BA 2C9YA 4GOJA 1G5PA 2ZI9A 4DDWA 4YMWA 3GLGB 1VG9B 2GZDA 1Q20A 1E2FA 3RVBA 1HA3A 1U90A 4D81A 2OFXA 1OPXA 4HYYA 5AK0A 5P21A 2C5LA 4B43A 1COWD 3KL4A 1KNQA 1KI2A 4QKQA 4W5JA 3BD9A 2ZEJA 5LD2B 2JLZA 4HZUA 3H1TA 1GRNA 1UBEA 3EPKA 1X8JA 2JCSA 5JCZA 3ZH9B 4A0RA 3UWKA 4D0GA 1M74A 2AL7A 2J45A 1CR0A 1XMSA 4LDJA 2VHUA 1KI6A 2CHGA 4HUTA 1NN0A 1FOEB 4RFVA 4AC9A 4IJMA 2Q9CA 4I1UA 3I61A 3P27A 5ELXA 1OFHA 1TQ2A 2WWWA 4PPQA 4JKYA 1W0JD 1IQPA 1XTJA 2Q3FA 2D62A 3AEZA 4LCBA 4DWJA 3OEED 3EPLA 1G64A 2AD1A 4YMVA 4Q4LA 1B23P 4JVMA 3W6OA 2D7DA 3LW7A 1TF7A 1F2TB 1QHSA 2OXRA 3IGFA 4OQLA 2FEOA 2ZYTX 1G21E 2W83A 2OE2A 4A1FA 3ADBA 4PC7A 4KSCA 2FSFA 4D0NA 4NYMR 4ZKDA 4ESVA 1NVVR 1MO3A 1RIFA 2EFDB 1A1VA 3DOFA 4JMPA 2VYFA 1GL7A 4B75A 3U44B 4KLZA 1EESA 4X8MA 2X8AA 1WBDA 3K70D 3SN6A 2H17A 1IY0A 4FMDF 1KO5A 2ZE5A 4BQSA 3PG5A 3AP2A 1Z47A 1KI9A 3U2QA 2YNMA 2HXSA 4CF7A 3NDBB 5C4MA 1TTTA 1KAGA 4BFUA 4LSGA 5EE9A 4NCHA 4NU0A 5E7MA 3KKNA 3MRSA 4FMBB 3QPVA 5G40A 3GJ5A 2JJ8A 3CPHA 4CEJB 4CEHB 2IF2A 3LX5A 3GJ7A 4S35A 3TAUA 1R5OA 3GLHB 1E98A 2X19A 1D2NA 4R2IA 1GIAA 1N25A 3IIMA 4L9SA 4PZYA 3ZS9A 3A6PC 2BM1A 3RS7A 3FWYA 2ZTSA 1AGRA 3KB2A 4M1KA 3U5ZB 1E2MA 4EPYA 5DGXA 1KK3A 1ZUNB 4WVFA 2J3EA 4OL0A 3T1OA 1QRAA 1NP6A 3QEOA 2BMFA 5DE3A 2VSXA 4ZIRA 2FX3A 1VMAA 3D8BA 1M2OB 1CIPA 4A82A 1RJ9A 1P2VA 2HT6A 5LDDC 3HYRA 1GAJA 3ICEA 2CE7A 3TKLA 2ATVA 4LYFA 3SU8A 4NBSA 3KUDA 1E0SA 4KV9A 4B2PA 4MKIA 1XPRA 1ZM3A 2IC5A 3A4NA 4QNMA 3ZZ0A 5EUMA 3GJXC 1K5GA 5EE5B 1KO4A 1WDTA 5GVRA 3I5YA 3QKTA 2XZPA 5DYGA 3RNLA 1E9DA 5CK5A 2BBWA 4E09A 1JR6A 1A5TA 1YR7A 4WA7A 1E99A 2ZSBA 2H8KA 3VX3A 3VAAA 2WOJA 4DLZA 1NSTA 3L43A 3KKOA 1D6JA 3GQBA 3UATA 4EPWA 1DAMA 1IN7A 4BFVA 1E79A 4NYJQ 2ATXA 1EGAA 4URUR 3K0FA 3NTUA 4Q4HB 2GZHA 1JAIA 3SJZA 4B47A 3GJ4A 3FGNA 1IN5A 4IDHA 4TLBA 1D9XA 4MDFA 2FFHA 3R9IA 3UMFA 1K6MA 3W3ZB 3VKGA 2RAPA 2ERYA 2CVHA 1YZGA 1KK0A 4BFTA 2O8EA 4HLUC 1YZKA 3AF3A 3HYTA 3PUVA 3R7WA 1W49A 1ZU4A 1E2GA 2WJGA 2XAUA 3WYFA 1OB5A 1NN1A 4AYXA 5J4HA 1NG9A 1AKYA 5IRCD 4Z1MA 5FBWB 3B60A 2ZRBA 4D6PA 1G3RA 3LLUA 4MH0R 1GM5A 2FEMA 1OIWA 3KQLA 3IO5A 2W2XA 3P26A 3KQNA 2J46A 1MKYA 4Q4JB 4EQ6B 5JFGA 1YKSA 4YLGA 3SS8A 3TVDA 3MFYA 3CRQA 2OCYC 4UXJA 3SQWA 2RMKA 2ZETA 1ELOA 2RGNC 4RD0A 2XXAA 3U7HB 3IUYA 1KSHA 3OIWA 3LW8A 3DO6A 5GJBA 4A4DA 5JZVA 2GA8A 3GFPA 1TAGA 2OAP1 4TSFA 1XEWY 3EA5A 3TK1A 3ZS8A 2FSHA 3T5DA 3MWYW 1IN4A 1SVSA 2IK8A 1CJTC 1L4YA 4CDGA 2O8BB 5GVSA 1VDZA 2A5FA 4DRZA 1IJEA 3W90A 4EFLA 3N2EA 3F5FA 1XFAA 5B58C 3CNNA 3VKWA 2A5GA 2IS1A 3DM5A 4PZZA 3NEJA 1HTWA 1AS0A 2VTKA 4WXRA 3BOSA 4UNNA 1GNQA 3MAAC 5KSYA 4B32A 1OXVA 1XEFA 1ZYUA 5C4GB 3PJRA 3UK6A 4BLTA 1Y63A 2PCJA 3U7GA 2Q6TA 2ZRNA 2VF8A 1HT1E 2WVJA 3LX8A 2MSCB 5FUYA 1GILA 3IIJA 3LXXA 3AF2A 2GCOA 2ZUCA 5JJKA 2DPXA 4D4LA 1JB1A 3EIEA 4DB4A 1G291 1R6BX 2VRWA 4HB3A 3B82A 4IHQA 5FPSA 3AVXA 3MJHA 1U98A 2QZ4A 1US8B 2R8RA 2FN4A 1W36C 1JECA 1GKYA 2GVZC 1QHHB 4M22A 2EYQA 4PSVA 3KB1A 5FBRB 1RVDA 1P9NA 5FTNA 4DT1B 1P2UA 2BCJQ 3RS0A 5H68A 1Q57A 3PIRA 2VHCA 1UBGA 3OIVA 3VHLB 2GRJA 3WBKA 1UJ2A 1Z2AA 1ANKA 3O47A 1E2KA 1IAQA 1G3UA 3BJIC 4ESHA 1RPZA 2J59A 1CKEA 4MRVA 5EP1A 1U0LA 3S1AB 1MRNA 1ZNWA 3OAAD 4ZI2A 5KO2A 3E70C 2LWIA 4QJ5A 1QHIA 3FYHA 3NBFA 1WXQA 2WKRA 5E95A 1WF3A 3OIYA 3REFA 3B9PA 3K9LA 1OFTA 1E9EA 2HLDA 2WJYA 3K70B 1N6IA 3BXZA 3OESA 4QGHA 1SVOA 2NOAA 2RB4A 1Q1QA 3EZ6A 5FPYA 1N5LA 4F92B 4JLKA 1KSJA 1TEXA 4KLNA 2ORWA 1XD2A 2Z0MA 4AKIA 1UDXA 3VNUA 2UKDA 3SE0A 2ZM5A 2FG5A 4KBGA 1W5TA 3FMIA 3THWB 4NPHA 1NMZA 3B6EA 1L7VC 3EZ9A 3QY0A 4E22A 5JI3E 3R20A 1CXZA 1IN6A 4Q9LA 5E4FA 4BFXA 1NF3A 1DG3A 3QG5A 1IXRC 4OHYA 1E2QA 2FSIA 2VLIA 5EXXA 4B3XA 5CM9C 2VA8A 3QKSB 4OI2A 3I4LA 3AM1A 4P4SA 2DWOA 2PJRA 4OJKA 5HR5A 1G17A 1RE0A 2OG2A 5EZ5A 4OI1A 1UM8A 4DXAA 2ZUDA 3D7MA 2NPIA 2WWFA 4F7WA 1G41A 4V03A 1S0UA 4HB0A 3HU3A 2CK3A 4DSNA 4WZBE 2C95A 1KZ7B 4ON9A 4OI0A 1TQ6A 2J0VA 2YJTD 2QENA 5KU1A 4DCNA 4HDCA 5J40A 4DCUA 821PA 1XBTA 3CWZA 1NKSA 2F1IA 1SXJA 5E7JA 2KBFA 2UZIR 2ZI3A 4MYHA 5KNCA 3TUZC 4TTQA 1AS3A 3LA6A 1XX6A 2IF0A 1T8UA 4B74A 1NJGA 4ZDWA 5L3QB 4M9SA 4Q4AA 4TLCA 2H57A 4Q47A 3SJAA 1F48A 2W6JA 2DCUA 2V6JA 4V0MA 1NBMA 2FV8A 4KODA 4HLQB 1GITA 4JBWA 2CHVA 2RGCA 4G5SA 1ZNXA 1WE2A 2RKOA 1KYIA 1SXJE 3NBZC 4M0LA 4JL6A 4NCIA 1Z29A 2CLDX 2P65A 2XTNA 521PA 3VR4A 1E2EA 1ZCBA 1EFCA 1Z0AA 2QQ0A 1BO6A 2IEYA 3MUFA 3TW4A 3T34A 1SVMA 1JJ7A 4JLDA 2NPFA 2VPPA 4IRUB 3I62A 4BRUA 5HZKA 3RRNA 1ZAKA 2JDIA 1U0HC 1NVXQ 3TW8B 5DHAA 1HYQA 1OH6A 4V0ME 4XD7D 1GWNA 2R44A 4JJZA 1KY3A 2ZSAA 4M1WA 1UDWA 3CUEF 4URZR 5EE1A 3K09A 2FH5B 3T15A 2QP3A 4H1VA 4YXWA 4TQAA 1ZM9A 721PA 4PQYA 4C0BA 2HXYA 1Q12A 4G5GA 1EG7A 5BN3A 3NC0C 2GJ8A 2IBMA 3LV8A 4UJ3A 2DFLA 3Q8XB 2ZRGA 2WIAA 4JVNA 2ECKA 4Q9HA 4S2EA 3ASZA 2WM9B 3NG1A 2WSMA 4QG7A 3GPLA 2ODWA 3THYB 5JMTA 4M1TA 2VO1A 2REOA 2WWYA 3ZYCA 3DDCA 2ZJOA 4D2IA 2O8CA 1BH2A 4U5XA 1J99A 1R8SA 2OZEA 1KJWA 2EFEB 3ZVMA 1MABB 3PQCA 1GSIA 3WBJA 2ZRMA 3SFZA 1LTQA 2EW1A 4MRPA 4QBHA 2WWXA 2H5EA 1XMJA 4MGYR 3AVUA 3RHFA 3CNLA 2KBEA 2ZJZA 2XNSA 2ZUBA 3BFKA 1Z08A 4B6EA 1GG2A 4L4UA 5JRJA 4NTZA 3IPXA 4K8OA 5EZ6B 5HKKA 5JJLA 4A36A 4A6XA 2WBLC 2BDTA 4K81B 1S3SA 3C14C 3M6AA 1MO6A 4A0FA 4GZLA 4B6FA 2QT1A 4MQBA 3PCRB 1SHKA 2ZE7A 2FGJA 1A4RA 3GD7A 1MT0A 2BBOA 3AVWA 4AKEA 3ZIAA 1QHXA 1VIYA 2O0JA 3UMRA 1Q1ZA 4Q18A 4V0KA 2F43A 2NGRA 3C7KA 4ZV4A 3Q5DA 1DTSA 4MUAA 1E4YA 2A5DA 1OF1A 4BLOA 2J41A 3CRRA 3MWJA 1JAHA 4TMWA 2B8TA 5SZHB 2W2TA 1JQJC 1XXHA 2XB2A 1B0UA 4IDOA 2VBCA 3FDIA 1Q1EA 3QF7A 2PT5A 4HB2A 4Q01A 2V6IA 1W7AA 1OKKA 1VHLA 2LKCA 3FKSD 2P2LA 3UG7A 4PAQA 4Q5IA 3EX7C 4LJYA 1Z6XA 4ZDIA 2GCNA 4NYIR 1NL3A 2YZ2A 5F2EA 1YRBA 5KPDA 4LC1A 4BEBA 2QU8A 3K0CA 1SVLA 4RZ2A 4R71A 3HPQA 2AFHE 2GF0A 3MD0A 1LS6A 3AUYA 4GZMA 1PLJA 3NIBA 5KHOC 3W5IA 5BXQC 3A1WA 1ZJ6A 5K8TA 3U3KA 1XXHE 2RGDA 3E5HA 5JI2E 1X3SA 4CW7A 1TQ4A 2D3WA 2K5UA 3BS4A 4NCNA 4GFDA 1E2NA 4D4MA 1PLLA 4E07A 1VCOA 4UQOA 1VYVA 1XMVA 4TMVA 2YC2C 1N6NA 3V00A 2AKAB 1W0KD 2XNDD 5LB2A 3ZVNA 1JEEA 4G01B 1XEXB 4EPXA 4DDUA 3EIQA 1OHHD 2G77B 4NMMA 1KAOA 1MV5A 4Q02A 4X8OA 1X1SA 4AK9A 2WAXA 1QHNA 3P1JA 3FFBA 1C1YA 2EVWX 2A9KA 3K9GA 1LF0A 2CEAA 4RZXA 3D31A 4X8LA 4JT2A 1QDEA 5CIWA 4I4LA 4YONB 3BBPA 1WCV1 1GZSA 4BLQA 4MYCA 2QTFA 1F2TA 3SYNA 5IT5A 1QZXA 2QE7A 1TEVA 5AUOB 4MGZR 2W6IA 4V0LA 1ODFA 1XCPA 3BK7A 3E1SA 4GNKA 3ECCA 2QMHA 1M7BA 1CULC 2X2EA 2Z4SA 2P6NA 3DPUA 4XTCS 2EU8A 3T06B 2JEOA 5GJVC 3B78A 1PLKA 4BLRA 3U44A 2UZ3A 4KAXA 4JYBA 3Q72A 1J8YF 3C8UA 4TQUS 4DDTA 1WMSA 3CF6R 3L0OA 3FE2A 4LYJA 1UEJA 1VG1A 1KDPA 2WWHA 8OHMA 4PQRA 1O3YA 2OO7A 2LCFA 4EPTA 3BAFA 1EFHA 5JLJA 5DN6A 2WSSD 3FTQA 1W48A 1EX6A 1Z83A 2C03A 4CGZA 1XCGB 1UBCA 1XNJA 5AR1A 4HSEA 1N3BA 1WP9A 2GJ9A 3KXLA 3LDAA 1Q3HA 2GESA 3OFNA 2VQSA 4Q1EA 4TT3D 3RRMA 2VP6A 3GJ3A 4MRNA 4CEJA 1TMKA 4DBLC 2DBYA 3DM9B 4CEHA 5CM8B 3GLHA 1BMFA 4PAOA 5C46F 4OHZA 1G4AE 1NMXA 2GEVA 3FB4A 4FWTA 5DO9A 1G3QA 2ANBA 1S3GA 4M21A 2IWRA 1U8ZA 4EPRA 1RKBA 1W36B 3KQHA 4JL8A 1JPJA 5IDVA 3SNHA 4DCTA 2ZVQX 1CJUC 3TRFA 1YE8A 3GEEA 4JVSB 5FBQB 1ZM4A 4OHXA 2XITA 4LGMA 5AJXA 1NVWQ 4DZZA 2EWVA 2NG1A 2OT3B 3OZXA 4HAWA 1IN8A 1NVUQ 2IUTA 4QHTA 3X2SA 5FUVA 3WP0A 1SVWA 2GDJA 3GLHE 4TYPA 1I2DA 4FXPA 1AQYA 2H92A 5JS7A 5EUQB 1SKYB 2FOLA 4US1R 2WMNB 1Q3TA 4TZ6A 5L3SA 1KJZA 4A6PA 2JLSA 4ASUD 4QM6A 5CB8A 2GVDC 3AF0A 1ZIOA 3LVQE 3N70A 2FJUA 3RSOA 1HUQA 4OK6A 4O2LA 5JWOA 4QBIA 4LBWA 3SDZA 4G5OA 3FMFA 1KI7A 1ZD8A 3FMOB 4LBVA 2XX3A 4MITA 4F4IA 1VCIA 2ODNA 1G5RA 4KYUA 3OE7D 4H1UA 4OYHA 3OIUA 2ZE8A 2ZU6A 1S8FA 2EFHB 3BC1A 1UFQA 1SKQA 2ZI4A 2CXXA 1RRGA 4TYQA 4EUNA 3IEVA 4V02A 4W5WA 3L8ZA 4KU4A 2GNOA 3RC8A 4JLMA 3K1JA 4C2TA 2PX0A 1JNYA 1M8PA 1VYTA 1P3JA 5FOWA 1KI8A 4OK5A 4F91B 1Z06A 2PBRA 1ZP6A 3LXRA 4QBFA 2OESA 3IPYA 4IW3B 3GLIB 2CCKA 3CF0A 4D0LB 3I5XA 4EQ6A 3JVUA 1M7HA 1R0YA 1CEEA 2FGKA 4U02A 5FL3A 1DAKA 2NQ2C 2QSYA 3SYLA 2NMVA 1NIPA 1CU1A 1XTSA 2Q9BA 3ND9A 2JLRA 2D7CA 2JIZD 4PHTA 1E32A 1YR6A 2QAGA 2J7PD 4C0AC 1ZD1A 2CL6X 1TQDA 2FZLA 1T3SA 2QP9X 4Z54A 2R6FA 4QOSA 3BH7A 2XSZA 3CPEA 1FMLA 1ZRHA 2GXQA 4YDSA 5M04A 1TX4B 1T91A 2O8EB 2GZAA 2PZEA 2GK7A 3G5UA 2YKGA 1UKVY 1U0JA 3T1VA 1VG8A 2HT1A 2O8BA 3VFDA 1T0JB 2P67A 5FOSA 2OEPA 1OIXA 3AP1A 3LY5A 2JLVA 2EYUA 1F6BA 1G8PA 1NG1A 2NO7A 3KTAB 3QPWA 3QVVA 3TVTA 4NCJA 1WB9A 2WAYA 4LJAA 1JEDA 4MRSA 1E2JA 1COWA 1FUUA 1KIMA 2WKQA 2ZYWX 4CZ2A 4A2WA 3QBTA 3SHWA 1OXSC 3BGWA 4Q7LA 3SI7A 4MDEA 2ASEA 5TV2A 1DAEA 1DVRA 2DWPA 2W58A 4POAA 5F3WB 5DSZA 1ZM7A 1KO1A 4Q48A 1FX0A 2HJVA 3KKQA 4LV6A 4AG5A 5L8VA 1ZNZA 1U8YA 3D3QA 3RLFA 1II0A 4ACBA 4A15A 1LW7A 3CPJB 5TB5A 2Z4RA 3B8HA 2WIBA 1W0JA 5FR2A 2V7QD 1XMIA 4QGGA 5FOVA 3THXB 2ZREA 3VU9B 1E1QD 4LY6A 4V0OA 4C0HA 1W5SA 2GEUA 5J47A 4P32A 3IKJA 1UF9A 1VECA 2R9VA 2AX4A 2ZJBA 1FQKA 2AFIE 1XJQA 2QMOA 3DKVA 2SHKA 1R8QA 3MSXA 4O25A 3T35A 2ZI7A 4MYTA 3BORA 1H8HD 4KVAA 4C0JA 5JSZB 3S1AA 1A82A 3CH5A 1DG1G 1G8HA 1VG0B 3NDPA 4Q1DA 4EJSC 3CRVA 4Q1AA 2KB0A 5AWFC 3ZLJA 3Q5EA 4Q7MB 3MCAA 1UKZA 5LB4A 3WYGA 4TSFD 2ZYVX 2O8FA 1JI0A 2WWIA 3B9QA 1IHUA 5KNBA 4QJ3A 4I99A 2IEZA 1XF9A 5FI0B 2ZRKA 2QMUA 4DLSA 5BWMA 5FR1A 2NZJA 2H16A 1N6OA 1P6XA 3K0AB
chains in the Genus database with same CATH superfamily
3CLSD 5KVSA 4Y2VA 3M9WA 4B3DA 2LGJA 2CVZA 4BX8A 3CT4A 1FTSA 4BLPA 1N1MA 1MJGM 1T3ZA 2HK6A 1KBOA 2F7SA 1QORA 3QNMA 4BEJA 1BS1A 3K72B 2ZS7A 4IINA 4XASA 3WGGA 4X9XA 1RKUA 4W7SA 4OP1A 3NBMA 1ND5A 3DEYX 1MIHA 5FTMA 2DC1A 3UWPA 2DH6A 1AKVA 1I7PA 4ZARA 2HFKA 1RP7A 3B6JA 5FPTA 3K8OE 1M34A 3RVRA 3QEJA 1ESEA 4ND1A 4B09A 1X1DA 2X0JA 3MCWA 5K20A 3GP3A 1JR4A 4K9PA 4AY5A 5KTPA 2HKIA 2OORA 3FDFA 3PQ5A 1X94A 2R7MA 4OMUA 2ZSUA 1Q50A 1C7ZA 3UEOA 1XQVA 4IGAA 3MC1A 2XTAA 1NULA 3DS8A 5IKXA 3AERB 2P41A 4GBMA 5LR6A 1O5OA 2ORVA 1Z7BA 4G37A 3V8PA 4CHTA 3CKLA 4E3ZA 2BOVA 5HM8A 5LMCA 3V1KA 1K1EA 4XD2A 1ZIXA 3DYIA 3TYXA 3OJ0A 4GVLA 4X1KA 2FQ1A 3BFXA 3IAXA 4DA8A 5IMSA 3LCVB 2O52A 4V2UA 1GPUA 2F9LA 2ZJ8A 3WHIA 4E6EA 4FZVA 4Q1CA 2CMKA 3TOZA 2JBHA 1WOYA 3UGTA 4F71A 1Y8QB 2WHYA 4GXNA 1XDWA 1CUCA 4RAQA 5K0ZA 1E69A 1R6AA 3DWGA 4UNQA 5FFMA 1YAJA 2D06A 2OHFA 2EWWA 4OEHA 3K09C 2JI7A 5ADVA 2ZYSA 2N9UA 3QU2A 4EGFA 3F49S 4LUCA 5DGCA 1XLTA 3FVWA 2CXHA 2AG1A 3PITA 4XWOA 1H2ZA 1EDZA 3U4HA 3SF8B 1V3UA 2FSGA 3A8TA 3KYIB 3RC3A 3LHFA 3ERCA 1UADA 3CSDA 4LRWA 1JDJA 5EIXA 4TMKA 3UAWA 5EGSA 1XJCA 2PRSA 2YYZA 3FCEA 3O74A 4P31A 1O87A 5CCDA 2L19A 2A58A 3UAOA 1OYWA 1QMPA 4BRWA 1XNRB 4O59O 1GKUB 1Z2OX 1BWQA 3SJBA 1U63A 4B33A 4WCFA 4RACA 2I1WA 2D7JA 4PYQA 3VNSA 5CUQA 1PHPA 2V7PA 5EFZA 5M5BA 5DLDA 4GZ3A 3NEPX 4FEYA 3W9YA 1QQ7A 2F9MA 4F9EA 3PC6A 4ZAWA 4MVJA 3QP9A 2GAOA 4WNYA 4Y1RA 5B36A 5M7EA 2F90A 3OX3A 2V7EA 4IIUA 4D8XA 4CN8A 1GADO 1C4OA 3FYUB 4E7PA 1UQRA 1SHTX 1DX9A 2NLOA 2YVQA 1XUOA 3BSYA 4FYWA 2VEOA 4IMPA 4P5PA 3GPCA 4LHXA 3ETGA 1CT9A 3LYUA 2Q1UA 2TMGA 4YRLA 3ZOKA 3G8AA 4RQAA 5KYXB 2LE0A 5BO5A 1USWA 1YJCA 4WOPA 3TNLA 1ZLXA 1TADA 5FYDA 1Q6YA 3ZYZA 3DAPA 4C4SA 5CDUA 3PF9A 2C5EA 2BPOA 2WJ3A 4LJ9A 4XWAA 2GYVA 3E2IA 1YT5A 1BMQA 4LHZA 5FCDA 3S68A 5ENDA 3QI7A 2MMCA 4DA7A 4WFJA 2N46A 5KSOA 3RIGA 1MB9A 2O8DB 1GFWA 1F0KA 4BDTA 5C81A 2NU7B 1W8DA 3FPCA 3NZEA 4N0QA 3V9PA 2ZIGA 3IQGX 4J90A 1SZCA 2HU8A 1CEQA 3KFLA 4UBOA 1W5AA 5FQNA 1ZVVA 2HRQA 4A1OA 1VKNA 4X65B 2AVNA 2G0TA 2IZ6A 3HUTA 2J87A 3NBUA 5CT4A 1N8SA 5E1DA 5EEGA 3TW6A 4DR2B 5HK9A 3CR3C 2GR9A 5KVCA 5I7VA 1J5EB 2FZGA 3QPUA 3CKKA 1G7SA 3BH6A 1FJXA 1P2FA 4JI8B 8MHTA 1EAYA 1YOVA 3M4YA 1LVGA 4NE2A 4R2LA 2I6TA 5DWDA 1CRZA 5ITWA 5KJ6A 5FAKA 1OLUA 3VR0A 3TTTA 4HAYA 3ADCA 1BW9A 3JQGB 3UT5B 4DIUA 1PR2A 3BB4A 3BQMB 1Z6YA 3QTBA 4LBYA 4ZI5A 1WPGA 4IBOA 4KR9A 2AN9A 4HGNA 5C0OE 3LLMA 1Z8NA 2OBFA 4KK4A 2HK8A 1U7UA 3K0CC 1KRWA 1P0MA 3GR6A 1PJ4A 2HV8A 3CVUA 1FFDA 3RSCA 4UHFA 4QFMA 5CYOA 1LNQA 5DB4A 4YMUA 2CJFA 3T9CA 3OKFA 2BF4A 3PA8A 4LC0A 2MSLA 4WK2B 4B79A 3PTZA 4F3NA 3FSGD 5DNUA 3BMCA 2EGHA 2NIPA 2H2FA 1O97D 3C43A 3D81A 1VPLA 4R68A 4NBKA 1VCNA 1VBMA 4B2LA 2MSEB 2NP6A 4ND8A 1E3SA 2ZT7A 3JQAA 5B64A 1A0OA 4RVOA 4FPXA 1CUDA 1WZ2A 3KJIA 4AY2A 1JA9A 1S2MA 1TUGA 2HMYB 2NTYC 3B7GA 4L4SA 1W5EA 4NFSA 3R7WB 5JS1A 2QGZA 4W9MC 3MMSA 3FPAA 1PGQA 2HSEA 2CEKA 2ZDGA 4MJ7A 2CFTA 4FDAA 2IHUA 4G5YA 2XEDA 2F9FA 3VZCA 4RTRA 5GV7A 3T3OA 4XYMA 4PN7A 3MWKA 3N2ZB 1QVWA 1WZIA 4GKBA 5AOCA 4Y2HA 1W94A 3GP5A 3O38A 4EF5A 1MEEA 3K30A 4R8SA 3OECA 2W2LA 2X7HA 4DMLA 2RH5A 2WT4A 4CCYB 1PK8A 5K7SA 2RI0A 4IP0A 5AW1A 1TU3A 3HEBA 4HAVA 2DU8A 1SBCA 4AJIA 3X1JA 2OOSA 4DOMA 4BWGA 2O3UA 1Q91A 1M66A 4LF4B 4F9FA 2JVKA 2KQUA 4OGWA 2PK3A 2O3QA 4TV9A 5DXAA 5SZIA 1P4SA 2DRIA 5KDOA 1IJKA 4I6GA 1MNQA 2XB6A 3PD0A 1CUWA 3PQ4A 1P4RA 3HV0A 4BKOA 3AESA 4H6VA 2VRCA 4JL5A 4YCCA 5D00A 3EXFB 3AJ8A 3VUFA 3OZSA 1JJIA 1Z0FA 3R5SA 2OHOA 4J1NA 1Y9JA 4P7GA 4E5NA 5GZ6A 3GJSA 4CL2A 1XQ9A 1H6CA 1W2GA 2LBPA 3UHPA 3O3OB 4INZA 1CY2A 3AUXA 4L8FA 2PIAA 1Z0IA 3WA6A 1W36D 1PS8A 1E61A 4DIMA 4ZHQB 2V9PA 4JC8A 4ZXFA 3DKPA 2G1JA 3SJ7A 1T5LA 4R9VA 4CMEC 5EPUA 1Y3AA 3PQEA 4WI1A 4KLRA 3B8EA 2WNHA 1T2EA 2RDMA 2AJDA 2Z43A 4OU5A 1UINA 4OXKA 4NI5A 1V7PC 3U7EB 3KM0A 3UJ6A 4AF8A 1RAHA 2BI7A 1RPNA 2VN8A 3SQNA 3VR3A 4AP5A 2Z5VA 1I2BA 1PT6A 2FZKA 3B85A 7MHTA 2GCOB 3UHOA 2BDEA 3CBGA 3NDJA 3NW9A 4KO3S 3Q3GE 5JWHA 3S5UA 3TVYA 2NQ8A 3KLMX 1IHPA 1ISMA 3IB6A 1E94E 3LPNA 4R7ZA 5BT9A 4F38A 2O8EB 3LZ6A 1IJBA 3EN0A 2QA5A 2FI1A 3VSDA 2FKNA 3QWAA 1FLNA 2PKQP 2ZPUA 5K3EA 3TIFA 1MD9A 3ZDQA 1P39A 2FSVC 2FNAA 1A2QA 4KQCA 1JLRA 1C9YA 2C4KA 2EDCA 3IXMA 1L3IA 4PZ0A 1KQGA 1ZKDA 2GILA 3HK2A 5EQFA 1J42A 4EFNA 3U49A 3AEUA 3UMGA 3PNMA 1XRSB 3FAZA 5IC4A 4GLBA 3MJVA 1BCSB 1Y82A 2Y8EA 3EW9A 5IDYA 2C0QA 2X1VA 2WB4A 2BGLA 1J9EA 3PFCA 1HDYA 3VR5A 4G0WA 2BFPA 2GYUA 3WYCA 2JGKA 4PW0A 1A2KC 1C2YA 3W3AD 4MS4A 2Y1EA 1GTVA 3KDAA 3QKRA 1L7OA 1GA6A 3IIKA 5CDFA 4ZJUA 3T8YA 2J1LA 1B7GO 3USCS 2QWXA 1RQNA 1M0EA 1P1IA 3RUHA 2Q5HA 3ZE2B 3G17A 2YIVX 2H1CA 4RY8A 3KLNA 4N7JA 1GU1A 3HFRA 4XQ9A 2BE7A 5T3YA 4EG8A 2FWPA 3EY4A 3MNFA 4MLZA 5ICEA 4MKRA 2CD7A 4EJSC 1OREA 5JS6A 2NZVG 3S55A 3OCXA 5AW7A 4OI4A 2YFYA 3F8TA 3CX3A 2JKZA 4F5WA 1QO7A 1T9KA 4MKHA 4ETNA 1TT7A 5IJAA 3WK4A 1BS2A 2JAXA 2LRHA 4LI0A 2AC7A 4CV3A 3BJZA 3AX6A 5EJ8A 3IAS1 4U2DA 3IMFA 3U3OA 2DF8A 3QMPA 3OM0A 2VDJA 3SBEA 3WNBA 4LE1A 2IYTA 1TCAA 3AEYA 4MA4A 4WZBB 1ZMOA 2FPXA 2VNAA 4MKGA 1IWPB 4URXR 1OBFO 3W5SA 1U80A 1YE3A 1Z75A 1RXYA 1KBQA 3D7KA 4NMLA 1PJ3A 3D7SA 3HA5A 3OF2A 3AVQA 4RMNA 4XSHA 2CUKA 2IY9A 4BB6A 2KPOA 2QL9A 3G9TA 3PQDA 4KG7A 3SX4A 3WKAA 1TCBA 1S1CA 5FBKA 1RLOA 3TJZA 4PC2A 2VJDA 4LJKA 2PUWA 4IG4A 4TLDA 4I66A 3T41A 4S05A 4R69A 2H2AA 2X2FA 4FOLA 2WICA 2J0SA 2DHDA 4QPDA 3PDCA 4W6ZA 4Z0HO 1B16A 1C1XB 2I4TA 2JGEA 2C83A 2O2SA 1YIAA 1H8ED 2BFFB 3IUNA 2GPBA 1B73A 3AP3A 4G1UC 2BE9A 4YJGB 4EHBA 4AQ7A 5AHRA 5AJWA 3OICA 4YVFA 1E58A 4ZI7B 2H2DA 3B3AA 3ETNA 4EY3A 2PX3A 1RJDA 4EY5A 2G0NA 3M5DA 3TFWA 4I4CA 1UBTS 1SVIA 4ITUA 2VOEA 4AZ3B 5J2UF 2VG8A 5CNMA 5CMLA 1WSDA 3PRHA 2FFQA 2ZJAA 3KT8A 2QJOA 3ZV3A 3D64A 6REQB 1MEJA 2EX1A 2HRBA 3NMUF 3GLGE 4AO8A 1EFUA 4IVNA 5IBRA 5C52B 1K3UB 2ISQA 1GL6A 1AUQA 1MT3A 3CLVA 3TQOA 3EPHA 3LC7O 1GR1A 3G2NA 4KOEC 1D7OA 3MWEB 1VJTA 13PKA 5FDFA 2ZJ2A 4J7XA 2YV1A 1V1MA 3HCOA 5IP5A 1NMEA 4EHIA 3NNNA 1ORVA 4JBGA 1VIDA 5DBHX 4KOAA 1EWRA 1Y7IA 2R47A 4IWXA 2Q62A 4H15A 4NZOA 1T2CA 3AKDA 1P1BA 4HAUA 4LWOA 3PSAA 3ZD8A 3KVYA 2JI9A 2C0PA 1Z4IA 1UDCA 5DGIA 4HRXA 3F6SA 2QG4A 1D03A 2CMFA 3TNFA 5FWNA 4PIMA 2I1QA 3N2LA 1H2BA 2JAQA 3ETCA 4WKGA 2AOTB 3RSGA 1EFPA 1M2KA 3ND8A 5AJZA 5EMKA 1AKQA 2BUCA 2VPXA 4QGFA 4FIZA 1O6FA 3TOCA 3ZHVA 1J70A 5K4AA 4R0MA 4M99A 3HKEA 2P4UA 4QU0A 4JFAA 3JQ8A 4P7BA 3A3NA 4WXPA 5BR1A 1U7OA 3ILSA 1N1GA 3T12A 4CR8A 4OQYA 4ZTUB 3IDOA 5DCUA 2AKYA 2JJ2D 1V26A 2UUAB 4WZZA 4H7IA 3KPUA 2ZTLA 4WN9B 3E9QA 3VC1A 4YEDA 4YJ2B 4URWR 2IODA 2A67A 1H2WA 2H2WA 5CGZA 5BMVB 3F2VA 3CGGA 1Q22A 1RZVA 3HU1A 4I8XA 5E4TA 1M1YE 1YDWA 2XT6A 1PJLA 1HNXB 5LNK1 3Q3VA 5K03A 3IHWA 5A4JA 2IS6A 4Y9SA 4PXYA 2D5IA 4QOHA 1OFGA 1UT8A 3E9CA 3KWMA 1MG5A 3FXAA 2QRLA 4TKUB 3IVRA 2V3WA 3VAYA 1UOOA 2BUBA 2IZ1A 4BP8A 3O8BA 2DFKB 4P86A 4XLTA 1CR4A 1V1RA 3PUYA 5J2TB 1NQXA 2OM2A 3A7EA 2VP9A 5H9WA 1P33A 4G5XA 3EOAI 5EKDA 4BUJA 1J07A 3BWVA 3T7EA 4DR4B 1AZSC 4AKGA 1GQ2A 1W0KA 3OT5A 1EI9A 3A3YA 3KD3A 4O2RA 1E6UA 4KN9S 4YRCA 4XQEA 2C2HA 1MVLA 3QX8A 3NVKI 5EHQA 4CDMA 1D2AA 4HNSA 3WAGA 1NJ2A 3L5KA 2W4MA 5E3JA 1EK2A 2EX4A 9ATCA 1JG4A 2HGZA 4BMZA 2H18A 3FYCA 1M2OA 1OSNA 1CB7A 1FDTA 1HE1C 4CMGA 4NXNB 2CLSA 4PQFA 1PZXA 2O0HA 3NKFA 3GG9A 2PXCA 3KALA 1MR3F 2B4AA 3I2IA 2DWQA 1F0PA 1EX1A 3RBVA 2J3DA 3CMCO 4GPEA 1QO0A 4PQGA 4Q3BA 1QIJA 2AG8A 4JYPA 2GZRA 2JJMA 3NHKA 3C3JA 3W8NA 1DBIA 1DO2A 1NATA 1PKXA 1CY7A 3G89A 1W6UA 2G28A 4FCTA 1G0NA 1VSTA 4O6VA 4RVGA 1O9GA 2WZQA 3L49A 3T4PA 3T54A 2IEIA 2BHNA 4BNJA 3CF4A 4QU5A 2IOFK 2XVZA 4M53A 2C94A 2IPMA 5F7OA 3IVGA 4WL0A 4YR7A 2M6SA 2I3AA 4MQMA 4I3HA 1AC5A 5A9SB 5KYUA 4LJ8A 3QPAA 1KGSA 4AVYA 4CL3A 5F12A 2J3QA 1KETA 4MI6A 3PXGA 3TIXB 4XEUA 1M5UA 3KK0A 2C2YA 1MHPA 4WH0A 5CJJA 2QJFA 2QVXX 2XUIA 3EMBA 3WGMA 1OXUA 3OY2A 4D4GA 4MO2A 3FNHA 5BSRA 3RRYA 2WSSA 5FFNA 3IBSA 3AB3A 4Q7KA 1IQUA 3SHFA 3O4HA 5JS2A 3U7JA 1UZLA 1USGA 4YO8A 3UYLA 3LQ1A 3OKCA 3STYA 2I80A 1HURA 1L5OA 2B8EA 3EVBA 1RWVA 2Q21A 1V2HE 3LQRA 2OLEA 4PRZA 3AEXA 1GV0A 3CONA 2CB9A 4YP7A 1SQGA 2YIJA 2OGSA 3R3ZA 5F76A 4F1KA 3DWFA 2E4ZA 4NZPA 1GEGA 4NR0A 3VPBA 4HGRA 5IZ4A 3PA6A 3ZD7A 4LYHA 4XJTA 3T1QA 3DVAA 1OLXB 5B55A 3OEHA 4NH4A 2FPLA 4P80A 2W42A 1F3OA 3EUEA 4N7RA 2L69A 1T4GA 2VP0A 1DB3A 2NNLD 2Z6VA 4I55A 4ZVSA 4BVAA 3IURA 2AIRA 2ZRJA 4ZCIA 4GP7A 2YQZA 5FI1B 5LZ4A 2F3PA 1ETHA 3UCFA 4BO7A 3AR9A 2HX1A 5E3IA 1L4BA 3BWEA 3WX0A 5LKRA 4TYYA 3WDMA 2ZIAA 3CURA 5KNDH 2XYHA 5CIYA 1L4GA 5I7OA 4MWOA 1QHYA 4NSNA 4PC1A 1J90A 1LKZA 1VGQA 4C4AA 1U4NA 4PG7A 4BZQA 4A0GA 2BLLA 4ZQGA 2WTAA 3CY6A 5IYZB 1QGUB 3SIWA 2DQZA 4OG2A 1ZUIA 4II2A 3GJQA 2BFWA 1SULA 1ZH4A 1ZOIA 1R10A 3NBQA 4RVNA 1VYHA 4M86A 5K0LA 4C0KA 3NIWA 4PHGA 2I22A 4JBIA 4KN5A 4Y2QA 2W0MA 1BXGA 2QR5A 3FWNA 3B36A 3G0IA 1I0LA 1KO8A 3U3ZA 4ASUA 5BSWA 1YI1A 2VDWA 5C53B 2IHNA 1N4DA 4BGEA 5A06A 2FX5A 2RGGA 1E89A 1DHTA 2G76A 3L1VA 4X71A 2IYSA 3CUTA 3RWOA 4CQMD 5NULA 3A32A 4EARA 3V3KA 4B3RB 3F98A 4M8LA 2HO4A 2RJ3A 4LIPD 1E79D 5ALOA 2AJ8A 1DADA 1NUSA 3BFVA 2GPWA 4G0PA 4DRXB 3BSFA 2G4CA 4CLRB 2PRIA 4DGSA 2AR9A 4R2HA 4BHTA 4LF6B 2F1OA 2JASA 2VPWA 3KSBC 3G9ZA 2FZWA 2BRUA 3LAWA 2XVYA 3RSQA 2AFIA 2XWSA 2C04A 1OLOA 3PRJA 3ZJVA 3QJ5A 4GH5A 3AFIA 4GL4A 3G5LA 3RUEA 3HO8A 2VP5A 2QM0A 4AQDA 3ROKA 3ZDYB 4IH4A 4PO8A 3PEWA 2D2VA 2XYVA 3E7DA 5CJPA 1W85A 4DMFA 5JDCC 2V55B 3Q9UA 3R5TA 4NLLA 2C3UA 5DMHA 5CFQA 3CLTC 3U1VA 2Q27A 4IWYA 3KB6A 1PWYE 2AK2A 2JGRA 3CZAA 4GI1A 3C1AA 4O4JA 5GY7A 5LU9A 1KEEA 2R62A 3PHGA 4P4UA 1RR6A 3A6DA 3MS7A 3LQQA 3NYQA 4GNRA 1NTOA 4INPA 4TWZA 1E1KA 2UZ1B 3HA7A 3OKAA 2A9RA 4ZAFA 3W2EA 4BFWA 1ZGGA 2PH7A 3E8SA 1U0EA 3UXEA 1H6AA 3BKWA 3AMVA 3ZV7A 1U1IA 5TY0A 5CBKA 2BFEB 4GPD1 3RSZA 5CG1A 1L4HA 3O8DA 1QOZA 2X1HA 2DUUA 3K0BA 3PS9A 5AUNB 4MLPA 1ODKA 5JT1A 2WD7B 5TLSA 4HN4B 5BSEA 1I3OA 5L6MB 1WKVA 4PTLA 3QW4B 2JIZA 2EERA 4FKBA 2XVMA 1E2IA 3ROGA 4XWYA 3ED1A 3NALA 3HDTA 5CLIA 1Z5ZA 2G7MC 1N3IA 2WHPA 1T3LA 3JVDA 2PBZA 3KDPA 1BHJA 3PSHA 3NWBA 4RJIA 5L3SB 1XZDA 5IABA 1B0AA 5J63A 2V3CC 1PWXA 2P9CA 4NEQA 3OZTA 3DOUA 3TRDA 3Q5GA 1WUKS 5H02A 4KDRA 1T2FA 4RVFA 4FKZA 2OV8A 1G8FA 3F46A 4RULA 1J0AA 1RQPA 4ZC1A 3H86A 4KV7A 1SWWA 3IE1A 1BFKA 1F4VA 1VPTA 3THWA 5E0KB 4ZVNA 5HIAA 3AI3A 3GMTA 2GPNA 1KF0A 1OV6A 2PGDA 2B7LA 3BUSA 5BORA 1U2SA 2OBBA 5D1NA 4IGIA 3W8EA 3E9RA 1CW2B 3B1ZA 1LRKA 5CTAA 4OLJA 2WW8A 3M6FA 1LLUA 2NSHA 4MVJD 4D56A 4HGOA 1ENZA 1PJCA 3FPEA 3AJ9A 1TO1E 3BIJA 1Z5PA 2D1SA 3ZUPA 2WFAA 4DA9A 5JANA 5ISMA 2FHPA 4Q3KA 1T8PA 1GZ4A 2Q3HA 3P2OA 2B6HA 2OV2A 2BP7B 4N3AA 1G38A 1RLMA 1KC1A 1MAUA 4CG1A 2Z95A 1F8XA 1O5TA 2X2OA 3CNHA 3QVTA 2BKVA 2R1VB 1V41E 3B52X 4I4IA 3K6SA 1RXSA 1Y6RA 1ZKMA 5JVDA 2Q49A 2HNKA 2FQYA 1MA0A 4FYMA 1CUFA 2X0KA 2REBA 1FRFS 4GAEA 1VMIA 2ZRIA 3FA2A 3DMFA 3FCOA 1FNDA 1GJRA 2FPWA 3JU3A 4KDEA 3HCEA 4KQ1A 2RK6A 2PSSA 4ZQHA 1WBBA 4Y30A 1IBKB 1WV0A 4IOMA 1TIKA 2P5UA 2QAGB 3K1ZA 3QUQA 2DFNA 1H8HA 4UTXA 4GS5A 4YRDA 5KHLB 4JI1B 2YC4C 3RU3A 4E5PA 3NXSA 1RCTE 4Z9AA 3JQ7A 4DAOA 5C1PA 5LWHA 1O77A 2XNKA 5JU6A 2UVPA 4HKTA 4M89A 5TX7A 4IKPA 1NF2A 4UUNA 4HVAA 4GE0A 5C8ZA 3KJEA 1BEZA 4BNTA 2W98A 3EMVA 3GHHA 1SU7A 1X1RA 5TPZD 4FEAA 1OXBB 4EMBA 3PNVA 3QYJA 5EIBC 3A3KA 3TSWA 5AW8A 1F4LA 4U5QA 4G4GA 4WA8A 3QENA 2XPCA 5LJIA 1KE2A 4TXHA 4HWOA 1U8FO 1LA2A 3OFSA 1OBOA 2BFAA 2E4WA 2RH8A 4A23A 3NWPA 3PHHA 4UNSA 2OC9A 2B20A 4KQGA 1RM5A 3SXPA 3F9IA 4MWEA 4WKOA 2IV3A 4IYJA 3L6OO 4DCJA 1JLLB 1KERA 1GPH1 4H9GA 4BGUA 3KUXA 3C15C 1GSAA 3JZDA 4MCJA 5T4HA 1YDFA 4M98A 4N5NA 3MRVA 3MOIA 4ZU3A 4MPDA 1EK1A 4I1SA 2P30A 2Y6VA 4L6AA 4CGYA 5AESA 3UUFA 1C3JA 4IDBA 3AKCA 1K6IA 4WCDA 1HL3A 1A5SB 1G20A 3PGKA 1FRQA 5FL7A 8LDHA 5I7WA 2ARKA 2K7ZA 4S1PA 2WKPA 3NGLA 1RRFA 5K0CA 3DNFA 1L4EA 5IN5A 5HUQA 2Q2QA 4N9QA 2HCJB 1MG0A 4XVUA 2AOUB 1GQQA 1Y6GA 2JJ1A 1IZ7A 1TUBB 1V71A 3HBLA 2A84A 3LBAA 4FQ5A 4MYDA 3IODA 3SFTA 1LSJA 1JDNA 1YDHA 1JDTA 2XNCA 3FY4A 4M3NA 4JP2A 1F3LA 2QTNA 5EHIA 1NIJA 1DELA 2LZ0A 3RU9A 5KNCD 1J5XA 1G5TA 2KM1A 5DW3A 4XB2A 2WG2A 3JASA 3U61B 4ZOCA 1WR8A 3EW7A 2G17A 3N76A 4JYCA 1MO5A 4UU0A 3RVJA 3UXMA 5J3JA 2LVBA 3B1WA 3H9QA 1MBZA 3IKVA 1C3LA 2NYRA 2P1ZA 3FOFC 3BRQA 4RZUA 1PR5A 2GSDA 4LHSA 4D3XA 5LP6F 2OK8A 3HKBB 3RAEC 1E3WB 1XF1A 2J4CA 3GQBB 4HS4A 5L53A 5TQ2A 3EXEA 3Q6IA 5IJZA 4L2IA 1E2BA 2NM0A 1J8MF 4TYNA 2AG6A 3PENA 1ONBA 1UCFA 3ZI0A 3CW2A 3P8ZA 4Q9AA 2CE2X 4E1AA 2A1TS 4E0BA 2QNBA 4ZI7F 2JD1A 4FCWA 5EXTA 5CYPA 4B17A 4L5BA 3KJHA 4NRDA 2DHQA 3FUVA 1BFUA 3L8CA 4H7EA 1ZMBA 4PLHA 1AXEA 1CETA 1SQ5A 2J9FA 3LUFA 4MGEA 3N8GA 3QLVA 1TTHA 1PR9A 3NT5A 4M7OA 2G71A 4CLXA 2XMQA 3RUAA 1UJNA 2HWXA 3OCYA 5J5CA 3ZWWA 1X38A 1R6TA 2CHFA 4JHLA 4V0NA 4G4SO 1M34B 1D2RA 4RLFA 1RVV1 3UMVA 2D8AA 2JDID 3KOZA 4EB6A 2GAIA 2ENWA 2E1RA 4LBZA 2EP7A 3LWDA 2RAUA 2A9VA 4US0R 1XTQA 3G13A 1PCXA 3WLHA 2GCIA 4OHPA 1V6CA 1FMTA 2ZRQA 3IEIA 3FHTA 3MTQA 3ZGZA 1GZ6A 5FIUA 1E8NA 2G3YA 3DA8A 3M5WA 3IQEA 5BN5A 4MB2A 1R64A 1WHSA 1NFRA 2ZRPA 3AV0B 3ZEIA 2IKQA 2QN6A 3LGAA 1Z82A 2JI4A 4IOLA 1HMPA 2YVUA 1ESDA 1NDQA 1QDUA 2BBSA 3AILA 1ISRA 4IFEA 5F1YA 3VYTB 2AT1A 2QJWA 2ZR8A 1Q15A 1EE2A 3JAKA 4LHWA 3CZ9A 4QODA 2WF7A 5FPHA 4AIRA 1ML4A 4B5LA 3NHBA 4EI9A 2JD2A 2PX2A 1DFGA 1N33B 2PZ8A 4TWAA 2J5BA 2IYVA 1X7GA 4DLYA 1O8CA 4NOLA 4HX5A 3GT7A 5EYPB 3B20A 3QLJA 4UOEA 3QU9A 2I9PA 1DJQA 3M4NA 3P45A 3FSRA 3ESAA 2B1QA 4NZYA 2OXIA 5IDWA 1P7ZA 3E4CA 3L2OB 3SAJA 1DJPA 3HB0A 2Q5QA 3M1IA 2Q2VA 2F8SA 4IF4A 4LVCA 4LY9A 1UK8A 1ADCA 5IHPA 1M5RA 3IEMA 4AECA 2JGMA 2WDZA 4LECA 2GCEA 1Q2XA 4Q0MA 1TA4A 5A5VA 5BMVF 2FX2A 1ZISA 3RANA 3UHJA 3ZD9A 3FOWA 1E6MA 4ZVUA 3QVXA 4UBJA 3NAGA 3DP9A 3WNDA 5BY2A 1EK6A 3E1KA 4QVKA 1I6LA 2I4IA 4FJ2A 1L5KA 3VR5H 3VTZA 1S9DA 4S0XA 1OXXK 3SLKA 2I67A 1TC2A 1ZH6A 2PIDA 3AR7A 1QZZA 3IAM6 2ATIA 3E8XA 4BMOB 1BFDA 1FS4A 1J0CA 1TK3A 3RS2A 1QQ6A 3TL3A 1QHFA 2OFOA 3H1PA 3ZIAD 4BGIA 5DGDA 1DLIA 3HNOA 4D46A 3NC4A 1FXWF 1NY5A 1HR0B 4K88A 5J2TF 3ZE1B 2RG7A 2IE0A 1DQPA 1FUIA 2CXTA 3GCZA 3TLZA 1HYHA 4L73A 1KMQA 1ZZEA 2PYDA 3BYZA 4Z9YA 2QVLA 3RYFB 1TECE 1U8AA 3S2EA 2A14A 2WF5A 2I4MA 3WRXC 1DIOB 4UKDA 4QOEA 5KJEA 2PS1A 5BNTA 3WLAA 5TGZA 3AVTA 3KSDO 4IV5A 4FBGA 4KMRA 3RHSA 1Z28A 3N07A 4PC6A 4JEMA 2ATCA 2GF2A 1WXXA 5L3VA 2B5WA 4ZO7A 2IEAA 4GPTA 2SCUA 1CR2A 1C81A 4MO9A 2EX0A 2VVTA 1JHMA 1YZLA 2WPDA 3DDNA 4YDQA 1ZN7A 1QXSA 4IIFA 3H1EA 3BWBA 2F00A 1N6RA 2FA9A 5BQ3A 3PVZA 1P8JA 5G4KA 3R5HA 1XRLA 1EFTA 3RC1A 2CL5A 1MEOA 1P80A 1UR5A 2XJ4A 5GPBA 4FEEA 4OMFG 3KVNA 1W30A 4K6FA 3I58A 4OBWA 4OKIA 2QQ5A 3MJRA 3D1VA 4KJZA 4EO4A 4HV4A 2JLYA 2BDUA 3GPBA 1J7KA 2P7IA 3IMEA 4RXMA 4FNAA 4CLOA 1RZRD 1XZ8A 5CLHA 4QDZA 5H83A 1C8BA 4HRYA 4P7JA 2JZNA 3UCXA 1ZOOA 1YOVB 3ROFA 2ZBDA 3LRTA 1OLUB 4HUJA 1JB9A 5JZBA 2EFGA 5IAAA 2O1XA 1FIUA 3L0PA 3LWNA 1UZAA 4P34A 1XTPA 5AJVB 1NQWA 3NH9A 4BNZA 1HDZA 4DARA 3DZHA 5KSZA 4J07A 4L7VA 2QXTA 2F3TA 3HWSA 3ITEA 3F78A 4GOKA 2FPRA 4H2DA 4YC7A 3V9AA 1IIRA 1JYEA 3PFBA 3QG1A 4Q9JA 1Z8HA 1IY1A 4IDPA 1LX7A 5J5VA 1JWBB 2BSAA 3LNTA 3VNVA 3D5QA 3C3AA 2HQ1A 4LV5B 3WZ2A 1LLCA 4NV3A 1N6PA 5CCEA 5HMLA 4ZT3A 4F4JA 5FPQA 3EE6A 2JAUA 3QPCA 3GFBA 4DLVA 3BMCB 3R5XA 5AIAA 3NQ41 4WWHA 4GPIB 3WHLA 2ZI6A 1GKIA 3N75A 3GJTA 3OPVA 1RRKA 4R3WA 1QG2A 4ND8B 3PQ3A 4UUAA 3JQAB 4Y0NA 3K9FC 2I1LA 3K92A 3EZFA 1Z3CA 2HQSA 5T6BA 1II8A 5D5PA 3ZK9A 1XMQB 2QPTA 4S3MA 2E9SA 1BKDR 3EOZA 4NFLA 1W9HA 1XXLA 4IKOA 1K98A 5JS8A 2RONA 1CJMA 1Q0PA 1JQDA 1RMQA 2IRWA 1LC3A 2BV3A 4AP9A 1EFRA 1X39A 2HEIA 2YUIA 3UM9A 1EXDA 1QK3A 3LK6A 1XRJA 2REXB 3EIHA 3NCHA 4EYKA 4AKHA 4N0MA 4WNIA 3AYZB 2YRFA 1WIWA 3MA0A 4P3XA 3BGDA 1EP3B 3C6MA 1W4RA 2I0FA 3LCUA 5KYKA 1A9RA 1CNFA 1E1RA 5LQAA 5EJEA 5CRIA 1AO3A 2KWIA 1BU5A 3Q7SA 1A8SA 2Q1TA 1FTWA 3BWXA 3KUCA 5FA8A 3GHYA 3WK9A 4A6DA 5DN6D 3ED5A 4P3KA 4DABA 4NL4H 1OYYA 1QOQB 3E9DA 4TV9B 5IYZF 3GYGA 1IVYA 1EBUA 1ULAA 2D54A 3MAGA 4FYHA 4X6YA 5F2KA 4Y0AA 1JHUA 3GLFE 1N5OX 2R2AA 4GP6A 2EDAA 3AESB 3PVCA 3QKWA 4JSYA 4P3YA 2P5SA 4QTUB 2HMVA 5LOVF 1QH9A 4UBIA 4CDNA 3PLAE 1RHMA 3QIVA 4XUGB 3V8QA 1JH8A 3VXKA 2MYTA 2ZPAA 2H7CA 5CBPA 1W47A 4RM3A 4BAUA 5BQFA 3DHNA 4Q19A 4HQKA 1KOFA 4ILKA 1X7XB 1MTZA 1O95D 2YXBA 2O2CA 3K32A 3OCWA 4C2BA 3MFQA 2IU0A 1H0HA 1NXXA 3BRWA 2RHBA 3FCAA 3NT2A 4HFRA 1TMOA 1FSFA 1NVKA 2DQKA 3DDZX 4HSGA 3GLIA 1H2EA 4HWPA 1XV5A 2X23A 5F1OA 1CNMA 1N5IA 3PKZA 4M1OA 4F2PA 1I7DA 1BVRA 2AMYA 1PZNA 1RFLA 3FWKA 4FYKA 3X44A 1GKLA 3U3RA 2NYAA 3A9WA 2GASA 3WL5A 1D6NA 4KYIB 3SM9A 4AG6A 1ZK4A 3EARA 5TJ9A 3NV9A 1E1DA 2H2IA 2BKUA 1GUDA 3KX2A 4LRTB 3KOUA 4Q3OA 4UDNA 3W5UA 4B2YA 2I4RA 1F06A 1IONA 2BKLA 2EJUA 3CZPA 4E13A 4F85A 3ONWA 2QBYA 3EWIA 4H7KA 4B7CA 1QO0D 2MU1A 3D4BA 3L7IA 4DYDA 2R6HA 4E03A 3PF8A 4FDTA 3BL8A 4KIFA 5DK6A 5C3MA 4AAYA 3QVUA 2XTZA 1FNNA 3U7IA 3JZMA 3F3YA 1MH1A 1C3OB 2NV6A 4MYUA 3FYSA 4RTNA 3SEZA 2H06A 1BD3A 1RE1A 4MKXA 3R75A 2IOHA 1GPNA 5TQJA 1X92A 2B0CA 4KX5A 4GBED 4RPHA 1UBFA 2BSXA 2IXEA 1QU3A 1DO0A 2GPYA 2N0SA 1KA9H 1WSAA 3AEUB 4KX3A 4F56A 4OQQA 3AUUA 4ZYLA 2QEQA 1M6VA 1IG0A 3OD5A 4MXDA 4GX0A 3R9KA 1XU4A 2VF7A 1IG3A 3HLTA 5JSFA 4MGHA 3VU8A 1K27A 1Q7TA 4Y8VA 3K70C 2Z09A 3QKRB 4MS4B 3K4HA 5DEOA 3V48A 4M38A 3JR3A 1BE1A 3HSYA 4CMEA 5CLJA 1W1UA 5J1TB 1MF7A 2EKQA 4LF5B 2IYUA 2FW8A 3DL2A 3FGZA 3RADC 3NAZA 3QZUA 1J6UA 4BE7B 3JPYA 4MV4A 1FDWA 2HJSA 1E5TA 2O5RA 1QG4A 3TINA 4MIOA 3UMCA 2H85A 2J6HA 5KOJA 1U3WA 1JRLA 2JKYA 1KMHA 5D7BA 1U4OA 5FV4A 2PMFA 4I1YA 2PNJA 1EJ0A 4WUTA 4QNRA 3HM2A 2O5VA 1P75A 2CCGA 5G1NA 4CNBA 3RRBA 3VU9A 3M4XA 4EUFA 5IXYA 2WF6A 3NT4A 1G2PA 2CXUA 3CH4B 3KDSE 3OEHD 4GLFA 4PYKA 4RPLA 5IK2A 2J9RA 2EJWA 4GYJA 4BECA 4NICA 1XLWA 4MQ6A 4UXHA 2IBTA 2IHBA 2B5OA 3HABA 4IDFA 5EKUA 3CE9A 3VOBA 3VVBA 2WKSA 1V9LA 2Y6UA 2E6UX 2QHXA 1IU9A 1CX9B 2DQ4A 1QB7A 3B2NA 4PNPA 3RFCA 4AI6A 2XOKA 4R9UC 3P5SA 5BSMA 3WLSA 4RD4A 3L05A 4EDHA 1CRPA 2HMAA 4RMGA 5JAOA 2NT4A 3FRIA 1JAXA 1NRJB 2FEAA 2MOKA 4HNUA 5F98A 5A02A 1P2TA 3RAPR 1RQXA 5F4BA 1Y6ZA <