2XTZA

Crystal structure of the g alpha protein atgpa1 from arabidopsis thaliana
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
349
structure length
341
Chain Sequence
MGSGIHIRKLLLLGAGESGKSTIFKQIKLLFQTGFDEGELKSYVPVIHANVYQTIKLLHDGTKEFAQNETDSAKYMLSSESIAIGEKLSEIGGRLDYPRLTKDIAEGIETLWKDPAIQETARGNELQVPDTKYLMENLKRLSDINYIPTKEDVLYARVRTTGVVEIQFSPVGEVYRLFDVGGQRNERRKWIHLFEGVTAVIFCAAISEYDQTLFEDEQKNRMMETKELFDWVLKQPCFEKTSFMLFLNKFDIFEKKVLDVPLNVCEWFRDYQPVSSGKQEIEHAYEFVKKKFEELYYQNTAPDRVDRVFKIYRTTALDQKLVKKTFKLVDETLRRRNLLEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of a Self-Activating G Protein Alpha Subunit Reveals its Distinct Mechanism of Signal Initiation
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords GUANINE NUCLEOTIDE-BINDING PROTEIN ALPHA-1 SUBUNIT
total genus 130
structure length 341
sequence length 349
chains with identical sequence B, C
ec nomenclature ec 3.6.5.1: Heterotrimeric G-protein GTPase.
pdb deposition date 2010-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 2xtzA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2xtzA01
1KI2A 2IYTA 3THOA 2BDTA 4KJZA 3OIVA 4PSAA 4Q9LA 3VR3A 3W6PA 3VX4A 1UKEA 3TH5A 3WHKA 3WY9A 1BIFA 1OXTA 4BGDA 3WXMA 4Q4HB 4A2QA 1QHHB 1FX0B 4NYIR 4DLYA 1Z6TA 1T6NA 2QM8A 4E09A 2GVZC 3U7HB 2FPKA 4P0TA 1TNDA 1MO6A 2IYQA 4PPQA 2HXSA 4RVCA 2QROA 1YE8A 1Z6XA 3CZPA 3UWKA 3PVSA 3LRPA 3CX7A 2HCJB 3V4RA 4OKSA 4XTRA 1FL9A 1KMHB 1ZM3A 4TT3D 4OHVA 2YYZA 3SOPA 5JECA 4IHQA 1NVVR 4C7OA 1S9DA 3GJ3A 1R8QA 2VF7A 1YZQA 5KDOA 2FH5B 2ZR7A 2K5UA 3QVUA 1HH4A 1G1MA 3ZDQA 1OKKD 1NP6A 3GLIB 3A8TA 2V6IA 2RGDA 1ETUA 4DKXA 4LGMA 1RRPA 2FPLA 2C8VA 1R2QA 1R7RA 2JDIA 2QBYA 1LY1A 2OFOA 3QVVA 2J7PA 4TL7A 2OFWA 3QBVA 2QQEA 3NKVA 1VKJA 1XMVA 1R0WA 4QBHA 3H86A 4WW0A 1KGDA 4XWAA 2JATA 3T06B 1CULC 1NIJA 2OCYC 5DI3A 1II8B 1MO3A 4W9MC 2QORA 3RNLA 1HEIA 4RD3A 2V7QA 1D6JA 1MRSA 1HUQA 2BM1A 2C9OA 5G53C 5BN4A 3W8NA 3L2OB 3T61A 3Q72A 4KI0A 2Z6VA 5JRZA 3KB1A 2REBA 2W58A 3K0FA 1SVWA 2VP9A 3HDTA 4ZO4A 4BFZA 3AVWA 3EZ9A 1GKYA 3BERA 1M7BA 2MSCB 4G1UC 4IVPA 3RS4A 1R5BA 1F5NA 2BKUA 2WJIA 1RIFA 2VHJA 4M1WA 3V00A 3W5IA 2WKRA 3GFPA 3KXKA 5HE8A 3BE4A 3KJHA 4NYJR 4KHZA 4NCJA 4PZYA 3B9PA 3EWAA 4UNNA 1AQYA 2YNMA 3TW8B 4A9AA 1MT0A 2Q9BA 4DLTA 2BCJQ 1SQ5A 1D9ZA 1U99A 2IEYA 2Z0MA 3FTQA 5J40A 4A8JC 2GZHA 2Q9AA 3THXB 3B1ZA 3L8ZA 1M8PA 2ANBA 2CK3D 1UADA 2ODEA 2ZYWX 4HSEA 2YOHA 3QKUA 1EGAA 1DAEA 2OZEA 1KK3A 3AF2A 3HU1A 5TB5A 1EFUA 4JLBA 3DMDA 1OXVA 1FW6A 2H7VA 4RD1A 3NHAA 2R65A 2IF2A 4P4TA 1MOZA 2HT6A 1W5SA 3QSYA 2FFBA 1MR3F 3DMNA 1CU1A 3ZS8A 4QKQA 5DE3A 3MFYA 1ZD8A 1OFHA 4NYIQ 2ORVA 5FH9A 1NY5A 1Z0FA 5D3QA 1OH6A 3PFIA 2ZUCA 3OEHD 3A1SA 1YQTA 5JFGA 3EPLA 2AR7A 3X2SA 1N6RA 1WDTA 5KPJA 3KZ1E 2L0XA 1QHNA 4D0GA 3KQHA 3B1XA 1JPNA 3HR8A 1JR6A 4D82A 2BBOA 5BW8A 2GK6A 2OESA 1SVMA 2QG6A 2RAPA 1DG1G 4LOAA 1KI3A 3U4QA 4QGAA 4BUJA 2ZJZA 2QL6A 1E2FA 2J7KA 3AP2A 2HF8A 3PUYA 2UZIR 2VL7A 2A30A 4HYYA 3TE6A 4LJ6A 4Z1MA 3QKSB 4R9UC 3AP3A 1G64A 3X1WA 2C9YA 4R7ZA 4BLPA 1Z08A 3MJHA 3N2EA 1U0HC 2YKGA 3BGWA 3DVLA 1II8A 1Y3AA 2R9VA 3UK6A 3EARA 1E9SA 5IF9A 3U2QA 4YXWD 5KSYA 1LW7A 1U81A 4PC6A 2XZOA 2F43A 1GG2A 3A4NA 4DCNA 1M1YE 2MMGA 3BFVA 2CJWB 4I1VA 4YDSA 2A5JA 4GOXA 4HDOB 1PV4A 4CEIB 1W36C 2F1RA 3VFDA 2A9KA 4I4LA 2RGGA 3KFXA 1E2MA 4GSYA 2QENA 1LNZA 4LBYA 2BMFA 1OKKA 2AXNA 1G8YA 1YRAA 3TAHA 5F9HA 2ECKA 2X77A 4MRPA 2DBYA 3PXGA 2ZRGA 4MUBA 1E2DA 2IS1A 1YZLA 3W6NA 4DCVA 1OB2A 5AUQA 2CLDX 4F4CA 2GJAA 1XPOA 4TTPA 2VQSA 3DEFA 2O5VA 2BMJA 2YC4C 4V0MA 4CEIA 4PHGA 5BQ5A 3FFAA 1DPFA 4A2PA 1GL7A 4DLVA 5TARA 1G3QA 3MWJA 4X8MA 4DVGA 2QRNA 5EE0A 1T8TA 1NBME 4HB4A 1XFAA 4JMPA 3KUDA 4UNQA 2IHYA 2QTVB 4D2IA 5ELXA 1Z6GA 3SBEA 1EFHA 2NO7A 3BC1A 2ZS7A 1ZU5A 4MGYR 3I5YA 2FSIA 3ZVMA 2RHMA 5CLQA 1GAJA 3BWDD 3BXZA 4H9GA 4BZPA 1FZQA 2VIIA 4KYUA 5HR5A 4BFWA 4MUAA 1OXSC 1D9XA 4V0LA 2GEDA 3NWJA 5KSOA 1E79D 5CYPA 2P67A 4D0LB 1KSGA 4URVR 5E95A 1X3SA 4KSCA 2O8DA 3K09A 1ZNYA 1DAKA 2ZAMA 4P31A 4MKIA 2HT1A 3BH6A 4AKGA 2W2XA 2ZSDA 3QF4B 1Z63A 2DPXA 1MV5A 2NQ2C 4FCTA 2D2FA 5EZ5A 3VHLB 3GLGB 4FINA 4UNPA 4TMVA 3OIUA 3GLHB 1QG4A 3A58B 4YQFA 5L3SB 3MG9A 2CHGA 2GJ9A 1Z22A 2I4IA 2VTKA 1UJ2A 2R6DA 5CDFE 4UNRA 2F9LA 3GLIE 2WM9B 2XEXA 3SR0A 4BFSA 1K5GA 2Q9CA 3KQUA 4IJMA 2GJSA 2RGCA 4GZLA 4TLCA 1W46A 4LHXA 1XB2A 2YV5A 3DZDA 1G21E 2DY1A 2Z4RA 4A0RA 3PEUA 4EIWA 3Q7PA 4TZ0A 5EUQB 2FFAA 2XXAA 4PR0A 5DYIA 3T1VA 2RGNA 1J8MF 2CVHA 1KY3A 1ZYUA 5EXPA 4NP6A 1JR3D 5BYKA 4WXPA 4EFLA 1CR2A 1JJ7A 1JPJA 1U8ZA 4EUNA 2BEJA 2JLSA 2CMKA 1DAMA 4TYQA 4OI1A 4ZIRA 2ERYA 1CKEA 4QNRA 4ZCLA 1RFLA 1QHXA 2BCGY 4Q7LA 2ZIAA 4OQXA 2F1JA 4LHVA 3SQXA 4II7A 3D31A 3REGA 3B8HA 1A82A 1SVIA 3FMFA 3QJYA 5FBWB 4AG5A 5LD2B 5DISB 2AX4A 1DO2A 4EPWA 2BVNA 3EZFA 1J8YF 2BV3A 1XTIA 4JT2A 4QJ5A 3IILA 1HQYE 2QPAA 1R5NA 4Y0VA 4TL6A 3W90A 2GEUA 3IIJA 2ZRDA 4P3YA 3IIKA 4AYWA 4CEHA 3CIOA 2LWIA 3BK7A 4Z8XA 5LB2A 2A3RA 1RYFA 2QM7A 2ZE8A 3LAWA 4XVQA 1LF0A 4Q47A 4UQOA 3BJIC 2IXEA 3PIRA 1CR1A 4IRUB 2ZRMA 1P2TA 1FNMA 3CX6A 2ZREA 1E2HA 1E9EA 4OYHA 5B57C 3VU9B 4W7SA 1RKBA 3NH9A 2EWWA 3EPHA 4JL6A 4AKIA 2IS4A 5SZIA 1TTTA 1DADA 3K0CC 5DNYB 3C4JA 2J41A 2P2LA 2ZRNA 3FPAA 3I72A 2FSFA 4PQRA 1DBSA 1GDDA 2RGNC 2QGNA 1YZTA 3IIMA 4M1TA 3CM0A 3RSLA 1E9BA 3N70A 4QHYA 2QBYB 2REOA 2B8TA 2FN4A 3I61A 1RRCA 4D4LA 1UKVY 2DR3A 3PJRA 2H16A 1A2BA 3DL0A 3GLIA 2XAUA 4IVRA 4QBGB 1VYUA 1I4TD 4UKDA 4KFRA 1SVLA 4EJSB 3T5DA 1E32A 5B30A 3SE0A 2JLUA 1JQLB 1ZP6A 3AVOA 1L7VC 1XD2B 2YVUA 4LHZA 4C7OB 1P2UA 2NZJA 3UG7A 1EWRA 3QG5A 2HV8A 2Q3MA 1E94E 1PLLA 2VHCA 5G41A 2VLIA 4Q21A 1LB1B 1F48A 3GFOA 2W6JD 3VNUA 1KKLA 3OEED 2O0HA 3L0IB 5HTKA 4YMTA 3IQWA 1HT2E 1M6NA 1N6NA 1UBFA 2JLQA 4A36A 4OHYA 3NHBA 4M9QA 2ZJYA 4Q66C 1I4DD 5EP4A 4ITRC 5EUMA 3VR4A 3C14C 4C9BA 2IS2A 2QPTA 1AJEA 5KNBA 1SXJA 4CGZA 4L15A 4NCNA 3B7GA 1YZKA 2FSGA 4BLSA 4HUQB 2PT5A 4KLNA 2JLZA 1Z29A 1XXHE 3IBYA 1D2NA 3U3RA 4WVFA 2QMEA 1IN4A 2H92A 3SJAA 4FXPA 1KSJA 1UF9A 1OH7A 1T3SA 3TJZA 2FF7A 1KHTA 3NG1A 1IY2A 1M34E 4ZCMA 4BFXA 2IYLD 4NONA 1G5RA 3OAAD 4EPYA 1W36B 3QF7A 1G3IA 1P73A 3E1SA 4Z8YA 2XOKA 4ZIRB 4M9SA 1R0XA 3U61B 2OFXA 3THYB 1G8FA 2WBLC 3G82C 5JJIA 3M4YA 4OBEA 3T15A 3VR1A 1XJCA 2VF8A 2XXAB 4OK6A 1OFUX 1WXQA 2XZPA 4M1SA 4RCYA 3EPKA 3RSOA 2WMNB 1JALA 5E4FA 2ZRAA 5FBRB 1K8RA 4LJAA 3WNBA 3AVYA 3OFND 4F93B 1KI7A 1ZM4A 3ZQ6A 1AGPA 1KI8A 4DLWA 3FKSD 4B35A 2QMHA 1QHIA 1CJTC 3MAAC 3OHMA 4O3MA 4PX9A 1OT3A 4BRUA 2P6NA 2IA5A 2EFGA 3FB4A 2VHTA 4CT4B 2JIZA 1OH8A 4KBFA 3I8XA 1Z2AA 1AZSC 2JLVA 2KJQA 4HAYA 3TIFA 4DSTA 3GEEA 2JJ2A 2J5XA 1RVDA 3VX3A 2AHOA 1W0KA 3IGFA 2GJ8A 3AH8A 1YJ5A 2WWFA 2XTNA 2IXFA 2O8DB 4K8OA 1Q22A 1TPZA 4WZ6A 2PJZA 5JS7A 1DAHA 3B1VA 1KO8A 4MYHA 4KXFB 1SXJD 2G0NA 3GJ4A 1GL6A 1H8EA 1E2NA 5IDVA 3O8RA 3IQXA 1Q1BA 1KKMA 4LX0A 2WWXA 2O8FB 5E3HA 1H8ED 1JXMA 2H57A 3MUFA 4C0KA 1IHUA 1KSFX 1OLOA 5C18A 2RMKA 3SHWA 4B6FA 6Q21A 2YC2C 5E7MA 3WRYC 2PX3A 2CBZA 1I2MA 3AM1A 1GVNB 3P26A 4CF7A 4C4PA 5FPHA 3M0EA 2QSZA 2RKOA 3FMPB 2V55B 3U3JA 4AD8A 5KYKA 1SXJE 5TVKA 1KDOA 1RRGA 1CJMA 3FHOA 3SJBA 2IYYA 3R7WA 3SS8A 4HEJA 4TLEA 2RH5A 2J0SA 1AS3A 4XWKA 1NBMA 2KBFA 3H0KA 5LDDC 2P3SA 1XXHA 121PA 3CO5A 5HZHA 4PPNA 1UEJA 2CCJA 4RD6A 4GRAA 2A5FA 2EU8A 1S3GA 2ZROA 521PA 2KE5A 5FOXA 3WNCA 3K9LA 4PFSA 5D3MA 2XJ9A 2ODWA 4C0HA 4CIDA 2W6IA 2ZPTX 3F0TA 4ON9A 4B43A 5IK2D 4M4SA 2B7CA 5JS8A 1E9DA 2YWEA 4CRWB 4A6XA 1YVDA 3ZD7A 3W5JA 3CH4B 4POAA 4TYWA 3GLHA 3C15C 4TLDA 1OSNA 3GLGA 5FL3A 4US2R 2DFNA 1LF5A 2WWGA 4DJTA 1P62B 3TBKA 3RANA 4ZI3A 2CNWD 3C16C 2OUKA 2KSQA 4US0R 2EYUA 5J4KA 5A0FA 5J4VA 3NC0C 5JWOA 1XMIA 1ZMXA 1P7CA 3X1ZA 4B2IA 3U7GA 1E1RA 1M7GA 2PZEA 1UDWA 3QEJA 3TQCA 1QRAA 1H8HD 1TQ6A 5CYOA 1COWD 4DEYA 4G5GA 1JJVA 1BYUA 1H8HA 1OYYA 3LDAA 4RFSB 4XD7A 1S2MA 4GPTA 2Z43A 2ZANA 3OIYA 2D7DA 2B92A 4GL2A 1NKTA 4LYHA 3K1JA 1NG1A 1NVWQ 1T3LA 1WA5A 1RJ9A 3LXRA 4MRSA 2GDJA 5KNDA 3Q5DA 3BBPA 5TDHA 2O8CA 2DFKB 1XCMA 1N0UA 4OI0A 4NCIA 1HQCA 2GRJA 2ZS9A 3LBNA 1N5JA 3RABA 2VHQA 3AKDA 2OT3B 1V5WA 1T5LA 4EQ6A 2HJVA 2QSYA 2AK2A 4F92B 3CPHA 1G6HA 4BWYA 3EAQA 4ERNA 4XSHA 4XIGS 3X1DA 3AVTA 1JI0A 1XZPA 2C9CA 4LYJA 4TLBA 3X1XA 3TR5A 4A8JA 4KO8A 2W2VA 4G3XA 2HDNB 3QQ5A 3BAFA 3AB3A 3QEOA 4HLDA 4OQMA 2ZEJA 1XF9A 2XSZA 4LV8B 1HE8B 2WV9A 3TUZC 3I5XA 2AK3A 2PH1A 2UKDA 3ECCA 4NCHA 5G40A 4L8GA 5KOYA 3Q8XB 3MGCA 4LHYA 4K46A 2GXUA 1P5ZB 3RWMB 1J7KA 3VHXA 2ANCA 4EPTA 1KO5A 4DWJA 4NCKA 3LD9A 4TTQA 4A0GA 4DXAA 4YMVA 2F43B 2QZ4A 4OHZA 3TVTA 1VDZA 3A1UA 4C2UA 2ZJ8A 1VCIA 5F98A 1VCOA 1JEEA 5DI9A 3NDPA 4HUTA 1GWNA 1TU3A 1CRQA 1E2JA 1TF5A 1WRBA 5K8UA 1XTKA 3K8YA 2IC5A 4KU4A 1Z8FA 3QXHA 4UJ5A 5JSZB 3QKTA 4IOJA 4D4MA 3KKOA 4HZUB 2IYWA 1II0A 4FIDA 3I32A 4HLUA 4Q1FA 4KSBA 4AI6A 3GQBA 3L0PA 3B1WA 3BORA 2PEZA 3NBXX 5FBVB 4Q9HA 3KQKA 4LJ9A 1TF2A 3HJNA 4GMDA 2QE7A 1ZUNB 5EE3A 3QBTA 4C30A 1GITA 2PT7A 2SHKA 4LK2A 3K0FB 4EDHA 1KI9A 2C95A 4TWZA 1XMJA 4ARZB 3KKPA 5CITA 4JLMA 1TL7C 1P4SA 1QVRA 2VP4A 1MH1A 1VIAA 3BRWD 2Y8EA 2P0EA 3LLMA 4GP6A 1UEIA 2ZJBA 3MD0A 3W3AA 3UWOA 4X8LA 5FOWA 4BQSA 1XJ0A 4GP7A 4EPXA 1AKEA 3RS2A 3LFUA 3UPUA 3RS3A 3AF4A 4Q1AA 1I4LD 4PHTA 1LV7A 4HZUA 4U5XA 5JHHB 1FMLA 5EE5B 1VG9B 1YZNA 2IYSA 3ND8A 1QVAA 1JB1A 3DOFA 4B44A 1XTJA 2WOOA 1ZM9A 4QOSA 3U3MA 3O8CA 4P4SA 3LWNA 5FOUA 1W4RA 2QUZA 4ACBA 3P27A 4M53A 3QXSA 2WIAA 4RD0A 3TSWA 4DC9A 2BM0A 2BWJA 1R10A 3C8UA 1FOEB 4URYR 4BECA 4DUGA 1KMHA 4KVAA 4X8OA 1A4RA 1T0JB 2BJWA 4Q4LA 3ICQB 1CJVC 2ZRIA 3IO3A 2GKSA 2R62A 4YC7A 4NKRA 3Q85A 2D3WA 1X1SA 2D06A 3WBKA 4PAOA 1IY0A 1E2GA 4D6PA 1P9RA 3WMFA 4RZ3A 1S0UA 4J0QA 2JJ1A 1T91A 2B7BA 1XCGB 4NBSA 4PO1A 5TXGA 3MMPA 3SYKA 1NLYA 1CJUC 3TW4A 1S9HA 4KCGA 2ZTSA 4Q1BA 5FL7A 1ESMA 4BFYA 2Q21A 1NN1A 1ZW6A 2IF0A 3EG5A 3CPJB 4AWXA 5ANRB 3MLEA 2ZU0C 1RJ9B 1JXOA 4Q1CA 1ZAKA 4JLNA 1ZVQA 3CUEF 4U02A 1P61B 4HI0E 1N6PA 1G6OA 4B3XA 1G3RA 5JWRA 4YMUA 3T12A 2R6AA 3KTAA 2ZRJA 5BN3A 1X86B 4QBFA 1DELA 1VHTA 5AJZA 4ABYA 1L4UA 1RZ3A 3PR1A 4I1UA 1FQKA 4AURA 1X1RA 4DCTA 1G19A 2DWQA 4UXJA 4HB3A 1SHKA 4HAZA 1XPRA 5KU1A 4GNKA 1JQJC 1CBUA 1AS0A 2A7QA 4E5UA 2DB3A 5JJKA 1W4BA 2CHQA 4HLQB 2JLXA 3PITA 3RVBA 4HZIA 4EFNA 2F1HA 4KLZA 1QBKC 5FUWA 1SKQA 2J7PD 1JAHA 5JI3E 4FMDF 3FKSA 3LA6A 1E2EA 1BMFD 3MRSA 4WBSA 3VMFA 3VR5A 1FTNA 3KKMA 5JBQA 4ESVA 5AJYA 4CYMA 1GILA 3MWLA 4D26A 5EXSA 4N3NA 1CF4A 4LYAA 3QPVA 1DG3A 5FR1A 3KQNA 1Q21A 1OHHA 2WWHA 2O0JA 1FX0A 1XBTA 4B2LA 4JLKA 1G3MA 1Q1ZA 2XOKD 4MKGA 1XXHB 5H1YA 5SZHB 2QGZA 1U8YA 3EIQA 4M0LA 1E0JA 2J87A 1ZUIA 2UZ3A 1IXZA 5FUYA 3ZYCA 2G9NA 4C2TA 1TMKA 2G3YA 3P1JA 2O8FA 4CT5A 4WAUA 5AUPB 2FJUA 2J0UA 1G5TA 4G5SA 1T0HB 4US1R 5AK0A 4TMXA 3IDQA 4NMMA 1G18A 2JASA 3VKHA 3TSOA 4OJKA 2W0MA 3EPJA 3ZIAA 4RJLA 2QT1A 4OHWA 2C78A 4YMSA 2FGKA 2QTHA 1GTVA 2FPMA 3B9QA 3R20A 4Q4AA 2GNOA 1AN0A 3BFKA 3QNUA 4KODA 4ZI2A 5FOTA 1X8KA 1KJYA 1Z06A 2OO7A 2X19A 3QXCA 4GI7A 4TMKA 3SC3A 5UKDA 2CE7A 3THWB 4JBYA 5G3ZA 4R2HA 2Z5FA 3KQLA 4DDUA 4IXMA 3T1QA 3WYFA 1ZBDA 2GAAA 3WNDA 4CW7A 3U6KA 3H84A 4WXRA 1IQPA 4HB2A 3MWYW 1T9HA 4A15A 2GTPA 1E2QA 1L4YA 3RS5A 4DZZA 3B82A 4Q00A 3K0SA 2WMOB 1G9XA 1BOFA 1OPXA 4V0OA 5KDDA 3CNLA 4A4DA 2GWHA 2WJJA 1E2LA 4Z54A 5HKKD 2ZI9A 4XWOA 1G17A 1P60A 1S1CA 2BOVA 5H68A 2PEYA 3CKLA 1KTVA 1KJWA 1IBRA 3LLUA 3Q7QA 3LNCA 4HAVA 4BFUA 4DDVA 1U0LA 5AJWA 3TAUA 4FD2A 2QMOA 2BMDA 3CLVA 2VP6A 4V0ME 1X8LA 3P32A 1QF9A 3RS0A 5A4JA 2GETA 1W4CA 4IW3B 1T8UA 2A78A 3KUCA 1U9IA 3H4MA 4NPHA 5SZJA 3ADBA 3THYA 1D8TA 1Q20A 4MRNA 1N2CE 3X1YA 1TADA 1NKSA 4C0BA 3I1FA 2CCGA 1GM5A 2V9PA 1MO4A 3NDBB 1RYHA 1SXJB 2H17A 1W4AA 1W36D 3RS7A 1YU9A 3ICEA 4B3FX 2WPDD 3WP1B 4AYTA 2YWGA 3BB3A 4TYYA 3GFTA 3L0OA 4ZKDA 3UIEA 1QHYA 1Z3IX 2GILA 5AJVB 4JKYA 5CIWA 5CM9C 2OBMA 2OLJA 2V7QD 3I92A 4Q03A 3JZMA 1XZQA 2H5EA 4URUR 1U94A 1G7TA 1YKSA 2VHUA 4MYCA 3C41J 1N25A 2BBWA 1XTRA 4MGKR 4P4UA 5EP2A 2XTZA 3W9YA 4B47A 1UBEA 2IW3A 3CZQA 4HLUC 4D4KA 1Q12A 4HLCA 1OIVA 1VG1A 2N42A 1IN6A 1C4OA 2NTYC 3KFVA 5HZKA 2REXB 1TUIA 1Z5ZA 5M04A 4IEEA 1G7RA 3PUVA 3FMOB 3ETLA 5L3VA 4TYNA 3ZZUA 2GAOA 1C1YA 1SVSA 3F5FA 1WQ1R 1N0VC 2WAXA 3A1TA 3REFA 4TN1A 4N0EA 4ILEA 1E99A 2GBLC 3SU8A 2FSHA 2CXXA 2IK8A 4EAQA 4KVGA 2QA5A 2ZQ5A 3L43A 4DDWA 2XNDA 5L3QB 2OXRA 2F9MA 3BIFA 3LX5A 3K53A 4JVSB 1GRRA 4D25A 3RRNA 2R6GA 1XMSA 4GT1A 3U3OA 4TQUS 5P21A 4DDTA 2G88A 3JVUA 4PXAA 4CEJA 2VP0A 4DRZA 2B21A 2W2TA 2IYUA 3AKEA 4IXNA 5JLJA 4IDHA 4DCSA 1DEKA 1C9KA 3AUXA 3O8DA 4JVNA 3AF1A 3K70D 3QE0A 1VYVA 2OLKA 4L16A 2FU5C 1G291 5FUXA 2G77B 4Q1DA 2NO0A 4Q18A 3BD9A 2DHRA 4QHTA 4WIAA 1LS6A 1XD8A 2WWIA 1ZM2A 2J0UB 2FX3A 5FL7D 5FOSA 4NH0A 4DT1B 1CTQA 4LC0A 2JA1A 2OCPA 3RRMA 1K5DA 3SI7A 4P33A 4F4IA 3RRZA 3QI2A 5KSZA 3LBHA 1NJGA 1A5TA 4JZKA 3DDCA 1JR3E 4M9XA 1FUKA 1E9FA 1Q3TA 1YHNA 3CF2A 4KFUA 2QE7D 4M9ZA 5EP1A 3GLGE 3WHLA 2CHVA 1AK2A 3BOSA 1Q1EA 2A5DA 3AVPA 1WBDA 3IPXA 4ZV4A 3T5GA 2QNRA 4MGZR 2GZAA 2H8KA 4TYPA 1IY1A 1OF1A 4UXIA 5KTYA 4NYMR 3PENA 4TL9A 5CJ2A 5DN6D 4DBLC 2IWHA 1G7SA 3ADDA 2WKPA 2WSSA 4B76A 1KJZA 1N0WA 3NBZC 4GOJA 4LZZA 4AKEA 3O8BA 3GJ6A 4K81B 3DKVA 1P2VA 1ZNXA 1T3HA 4GOKA 1L8QA 2JLWA 4Y0AA 5FPYA 3EC2A 1IJEA 2JEOA 4OI4A 1KY2A 1KK1A 1XDBA 1KZ7B 5JJLA 2RGBA 4JT4A 4N0DA 3NC1C 1MABA 3AVQA 4FW9A 1XD9A 2TMKA 4PQYA 1NVVQ 1OXUA 2ZM5A 4I1SA 1EK0A 1KDPA 4KAXA 4M8NE 3I8SA 4Q02A 4BZXA 5CB6A 3ZVNA 3ZD6A 4DLRA 2VSXA 3VQTA 5G3YA 1I2DA 2FZ4A 4JS0A 5JRJA 2ODBA 3K70C 1QHSA 4F7WA 2VEDA 3KL4A 4AIIA 2P6UA 1KI6A 1W44A 1XEWX 1W1WA 2RB4A 4IDOA 3CR7A 4OHXA 4FMBB 2WJYA 2LCFA 1KK0A 5TMPA 1LS1A 4DIEA 5K8TA 4ZDJA 1G41A 1OIWA 4NYMQ 2HUPA 4ASUA 4FWTA 3VKGA 5AUOB 4QFMA 2CL0X 1CR0A 4HDQB 3W34A 4C0LA 2ZVPX 1QHGA 4QJ3A 1VG8A 1Z07A 2ZSBA 4PAMA 2X8AA 2ZITA 2O0KA 1NIPA 3AUYA 5JWHA 3TMKA 4C0SA 4OJQA 4QM7A 2XNSA 1UPTA 1E1QA 3IPYA 1DO0A 4FCVA 4S35A 2EVWX 5CLLA 1L2TA 1XEXB 4Q9IA 4KFTA 5FI1B 1DVRA 1JAIA 2FWRA 3D6TB 3GJXC 5CM8B 4Q1EA 1EFCA 2GXAA 2C03A 4L4UA 3UMSA 3QKRB 2CEAA 2CJWA 1YR7A 3TR0A 4JLDA 2GBLA 2FA9A 1Z6AA 1XWIA 1IM2A 1NVXQ 2F1IA 5J47A 4YONB 3ADKA 4UXHA 5J4LA 4Q48A 2H18A 4RCZA 4X8HA 4BE7B 1OFTA 4JVLA 1H65A 1OHHD 1NMXA 1MKYA 1OXXK 4BEBA 5JEDA 3D7MA 1QG2A 4PO8A 5FTMA 2R6FA 4MA4A 3LY5A 5FTKA 3NXSA 3ZZTA 1KNXA 1OW3B 1W0KD 2CE2X 5GADl 4JLOA 2D7CA 1E1RD 3GLFE 2F55A 3K9HA 2JGNA 4V0KA 1QZXA 4LV5B 3UXMA 221PA 4LJ5A 3QOFA 2ZRHA 3DHWC 3KJGA 1ZM7A 2ZRBA 1N5KA 3QPUA 1BO6A 1WCV1 3F8TA 4JYCA 4AC9A 3A1VA 2GCOA 3GD7A 1F2TA 2IWRA 5FR2A 2AN9A 5H8WA 4RZ2A 3PEYA 3L0SA 2AKAB 2EFEB 3B13B 1PLKA 1W2GA 2LKDA 4JKIA 5AR1A 1ZD9A 1W5TA 3WP0A 2ZJ5A 2GHIA 2VA8A 5EZ6B 1F2TB 4DLSA 1G4AE 2JCSA 4TT3A 2GCOB 4RD4A 1IXSB 5KUTA 2J0QA 2NO6A 2QAJA 4LBZA 4Q7MB 1IXRC 3OE7A 3H1TA 3SQWA 1R4AA 4JJKA 5FBLB 4O2RA 1Y63A 2XJ4A 2ZJOA 3SEAA 4PZZA 1Z47A 4FCWA 4OI2A 3ZLJA 5DYGA 1E0KA 4HDCA 3THXA 4QHSA 1R6BX 3GJ7A 2AWNA 2G83A 1COWA 1IN7A 2GF0A 1J2JA 2QTFA 5LBIA 3LVRE 1GOTA 2RHDA 3LQRA 3QIAA 2CLCX 4LHWA 3LX8A 2J3EA 2XTMA 4JLAA 5KHOC 2ORWA 1KAGA 4BLRA 1OE0A 1UAAA 5E7JA 1E79A 1ZJ6A 2NO1A 3T1TA 1G5PA 2CDNA 1XJQA 1M2OB 1TAGA 1AQUA 1A7JA 3UMFA 5GJWC 3Q5EA 3EW9A 1W7AA 2ORIA 2QP3A 1TQDA 2O8EB 2WZQA 3GEHA 3B5JA 4LI0A 4M2LA 3FE2A 1JBKA 3LO5A 2C99A 1W0JD 2AXPA 3H2YA 1LVGA 2DWOA 3I4LA 3QKRA 5J5CA 3K0AA 3SZRA 4OQFA 4LY6A 4L9WA 4PZLA 2XITA 1VIYA 4URXR 4WZBE 5EE9A 2BBTA 1XEXA 4B3DA 3GP8A 2VO1A 4B3CA 5FPKA 1KK2A 1NJFA 3GJ5A 5FPTA 1DTSA 1N3BA 1K6MA 1KDTA 1E9RA 1N5IA 4FMCB 1GUAA 4TTRA 3TKLA 1U98A 3IO5A 2GESA 3HPQA 2PLFA 3V9PA 1WP9A 4IFBA 2WJGA 4D80A 3K9GA 4LJ7A 5EP3A 2HLDD 4LSGA 2VP2A 4RZUA 5KNCA 4A8JB 2ZE6A 1Q57A 5AWFC 2CK3A 2HLDA 4FMCF 3KJEA 4O0MA 3HWSA 1EWQA 3IHWA 5JI2E 3U44A 1QHHA 3JZAA 3BB1A 1WE2A 1KI6B 2ZSAA 4Q4HA 5LD2C 4LJ4A 3FYHA 4MQBA 1XNJA 2ZJ2A 1S3SA 1EX7A 1CP2A 2HYDA 2F3RA 2CL6X 2JLRA 2OXCA 2AL7A 2OEPA 3AVVA 3WMGA 4PPFA 5BYJA 2DYKA 3SJZA 2KI5A 5K8IA 3IEUA 3AGPA 3FDIA 3OESA 2BHRA 2OSBA 5C46F 2EWVA 3AKCA 2WKQA 1KZGB 1ZUHA 3CRVA 3LW7A 2V8OA 3DZ8A 1DS6A 3JVVA 3P4YA 4LDJA 4MGIR 1Z83A 1ZIOA 3HU3A 5FI0B 2OBLA 4E07A 3SHFA 4ACAA 4TMWA 4Q19A 1J70A 2JIZD 2OCAA 1NSTA 3C5HA 2IX3A 4Q5IA 3DOEA 1CR4A 1X8JA 3QUSA 1KMQA 3ASYA 3FOZA 4MDFA 4QM6A 4A0FA 1P72A 1FUUA 2C2HA 2EW1A 4KYIB 2D62A 1GNPA 2P6RA 3PEWA 3B85A 3DKPA 4M22A 1BKDR 4JVMA 4BEJA 1F2UB 4WA7A 5SZKB 3B1YA 3QPWA 1CLUA 1GZSA 4Q4JB 1QDEA 1BMFA 1GRNA 4I99A 1E2IA 4DB4A 5EXTA 3AF0A 4S2EA 1E1QD 1CEEA 1FTSA 1HV8A 1P9NA 1S1MA 4DCUA 3S1AB 3PUZA 4PC1A 5D3MB 4RKFA 1Z28A 3R9XA 2FFQA 4B34A 4Q7JB 4XSGA 4PO9A 2QAGC 2CCKA 2Q6TA 1UKYA 2XGJA 2OE2A 1KO4A 4Q4JA 1AIPA 4R98A 3WYAA 5GVRA 3NIBA 1CS4C 2NPIA 5CIQA 1F2UA 2FEMA 4NDZA 4XVRA 5LPNA 1NN5A 2IXGA 3E2IA 4PSKA 1Z0DA 1IONA 3CWQA 4O2LA 821PA 3L8YA 1AM4D 4Q9JA 4DT1A 1EESA 4G5RA 4LCBA 1VHLA 2FFHA 3KKQA 4OQLA 4DSOA 4PC2A 2GXSA 3FVQA 1F60A 1S96A 1NL3A 4PTLA 3VR6A 1TEVA 3ZIAD 4CDGA 1YZUA 1NBMD 1Z0KA 3PG5A 4RKEA 4NL4H 3A6PC 1N6HA 4MDEA 2C04A 2NO9A 2W83A 4FMDB 2CVFA 4OQNA 3ZZ0A 3ADCA 1JECA 2OBNA 1AS2A 2ZI4A 4U00A 3U7EB 3BH7A 5BXQC 1WBBA 3EA5A 4JL5A 2FZLA 3VR2A 4JLVA 2PMDA 3Q3JB 5GVSA 3U44B 1G16A 4P32A 5DLQC 2XSZD 1XU4A 2H1LA 3UMRA 4DUGD 4KV9A 2WIBA 1E0AA 1FNNA 3QXXA 4DIDA 2PBRA 2C5LA 2V6JA 2X2FA 3MWKA 4GFDA 3NEJA 2GXQA 4KBGA 1VECA 4PPGA 4URZR 1G7CA 1KI4A 2IYRA 3UANA 1VYTA 1G8HA 5CK4A 3HR7A 4TSFA 4V02A 4RSGA 3R8FA 4JBWA 2VSOA 4BFVA 2P5TB 1P6XA 1KDRA 3ONWA 1UBGA 3EZ6A 2WTUA 4NZYA 3W6OA 2XX3A 1A2KC 1XD2A 2ZSFA 3ND9A 4DSNA 3CPEA 4ZDWA 1GFIA 2G1KA 4B74A 4TL8A 4EJSA 3LW8A 4FWIB 2HYIC 2VP5A 4NTZA 4Z51A 4YDHB 2OM2A 5KSPA 4DSUA 3A1WA 1W47A 1XTSA 4LPKA 2NMVA 1Q1QA 2ZS8A 3K0EA 3UG6A 3N5CA 2AKYA 3FHCB 2MMCA 3QG1A 2DFTA 3FMIA 3SBDA 1O3YA 3CBQA 3TNFA 1B0UA 1G8GA 1SVKA 4IDNA 2O52A 4QL3A 3VAAA 3EA0A 5B64A 4HAWA 5C1BA 3R9WA 2JJ2D 4TLAA 4ZCIA 4L5BA 4CZ2A 1E69A 1W0JA 5EE1A 3RHFA 3GLFB 3AVUA 3VU9A 421PA 3G0HA 1B23P 4B73A 3FFBA 1NF3A 4M1KA 4A82A 4I1OA 5JCPA 4HUQA 5IRCD 1OJLA 2QMUA 2JAQA 2NG1A 1II9A 3BFXA 2OILA 1P75A 1E98A 1US8B 1VG0B 4B75A 2FG5A 1DAFA 1T5IA 1GSIA 5DHFA 3HYRA 1KNQA 1ESNA 4DHEA 2IEZA 2X1VA 2GF9A 1WB9A 3T35A 2CLSA 2HJGA 4AG6A 3PCRB 4XTCS 1Z2CA 1KI1A 1R0ZA 3M1IA 5CJPA 3CRMA 3PUXA 4BLTA 4JSTA 1G3UA 3CONA 3ZGXA 1YR9A 2PL3A 2YWHA 4O25A 2ZUBA 4QG7A 1RRFA 2IBMA 4QGGA 1AGRA 1ZC3A 2AFHE 2R44A 3AKYA 4W5HA 1UDXA 4IVQA 2NPFA 1EG7A 4YXWA 5HKKA 2KBEA 2C96A 1D5CA 3RRYA 4ZDKA 1NG9A 2RGAA 2ZYTX 4BASA 2IT1A 4B48A 3GPLA 1Z6YA 1J90A 4M1YA 1XPUA 5DGXA 3WMEA 1Z0IA 3KJIA 4D4JA 5KDLA 1Q3HA 1W48A 5IHPA 3TRFA 1ZCBA 2R8RA 2ZRPA 3K9NA 4GBMA 3K0AB 3UKDA 5E7IA 3E70C 3BB4A 3WBJA 4IDQA 5EQTA 4C0JA 5DIFA 1E6CA 1LFDB 1VTKA 2O8EA 3RC3A 3F3YA 2YJTD 3RYTC 4E03A 5L8VA 2D4HA 2E9SA 3R9IA 3OF5A 1D2MA 4LBVA 4FN5A 3L82B 1KSHA 1OYWA 1R0YA 2WJVA 3TGPA 2ZE7A 3GJ8A 2W6JA 4JIMA 4XH9B 3CRQA 3IBGA 4XOIA 3TVDA 4OK3A 5DO9A 1DE0A 4MH0R 3UATA 5C4MA 2DCUA 5DHAA 4BZQA 1DAGA 1E96A 2I1QA 2ZR9A 4LYFA 2YINC 4OL0A 1U90A 4YLGA 3FHTA 3AF3A 4Z1MD 5FTLA 4MKFA 4BFTA 3C7KA 2C98A 2ZYUX 3U6BA 3TQFA 1V43A 3EC1A 3VNVA 2FEOA 1ZNZA 1PUIA 1U2RA 2ZE5A 4JYBA 3AV0B 1AA9A 1GIAA 2ZR0A 2J0VA 3CNNA 3VTKA 4JLJA 4TSFD 2PCJA 2KB0A 3KX2A 2ZJAA 1ELOA 4E22A 4XVUA 4Q01A 1YR8A 2VSFA 2QY9A 2IUTA 2W6ID 3CB4A 1NLZA 4QGHA 1RC8A 2V3CC 3AQ4A 1UBCA 1Z0AA 2BC9A 2QEQA 1F3OA 1BS1A 1ZD1A 2BMEA 8OHMA 3EXAA 2QAGB 2WWYA 2I1VB 3GEIA 2O8BB 2VBCA 2VH5R 2IUSA 2Z83A 3P4XA 4WOPA 2RGXA 4ZPXA 4LC1A 2R2AA 1IAQA 3TK1A 5KPDA 4C0QC 4MYUA 5EXXA 5AJXA 1TX4B 3HYTA 4H1VA 4QRHA 3MCAA 1EFTA 2A5YB 2F3TA 1FP7A 2PJRA 1E3MA 1VMAA 1SZPA 1CJKC 1M74A 4EQ6B 1MRNA 2AD1A 2DFLA 3WRXC 1TEXA 5TY0A 2W00A 4IOLA 4PC3A 3AP1A 5FFMA 5C4GB 3ZS9A 1F6BA 2O8CB 2QRZA 1A1VA 1AZTA 4JJZA 4FI3C 3DO6A 3HU2A 4PQFA 4B32A 2KWIA 4G01B 4UJ3A 2ZI7A 3I73A 2IUUA 3SDZA 3OIWA 3OEEA 4RFSA 3PEVA 1SGWA 3CNOA 4PC7A 2VRWA 3BH0A 4D0NA 3P20A 4PAQA 1E2PA 4DLXA 2EFHB 3EZ7A 2ZAOA 5LB4A 2XNDD 1Q44A 1GP2A 1HA3A 3PV0A 3ZJYA 3U4QB 1ZU4A 1SHZA 2JJ1D 3B78A 1XTQA 2OAQ1 3O47A 1KIMA 2V4ZA 4RD2A 4MRRA 5H70A 4F4JA 4LJYA 2LKCA 4Q9KA 3TUIC 4W5WA 1Z0JA 2OCBA 2PZFA 1FPMA 2DWPA 5J4HA 3LXXA 2WWWA 3TLXA 4IOMA 4ASUD 4TMTA 1E9CA 2ZYVX 1DARA 4MRVA 2GEVA 3A4LA 1JR3A 3RWOA 3D8BA 4EFMA 4DLZA 2IHBA 3AEZA 2NIPA 2Q3HA 2ONKA 4H1UA 4AYXA 4Q7KA 1ONBA 2HEIA 2ZXUA 2PCLA 1U8AA 5JMTA 5GJBA 2ZRCA 1X6VA 4LWZA 4UNSA 1HY3A 2O8BA 1R5OA 3D3QA 2NOAA 4P4SB 5FOVA 2PMKA 3TSZA 4A92A 2QAGA 3M6AA 5EJEA 2ZRKA 2FGJA 2WJHA 1AKYA 2A2ZA 4PSVA 2F6RA 1PLJA 5B58C 2ATXA 2OHFA 3T1OA 4B2PA 3AVXA 1TQ4A 5JEEA 1UKZA 721PA 4HAXA 5CK5A 1OB5A 2XB2A 1ZCAA 5FTJA 2EFCB 4ZKEA 2FOLA 3CRRA 4A2WA 3K70B 2V1UA 2YHSA 4W5JA 1R8SA 1HYQA 5HPYB 2V1XA 2NZ8A 1DAIA 1YRBA 5JCZA 3ZH9B 1MABB 2GK7A 3I62A 3VKWA 1OFIA 2MSDB 2VPPA 3MSXA 5FUVA 1T4GA 3KDSE 4BLQA 2FDCA 1XX6A 1J99A 1E4VA 1UM8A 5JZVA 1HURA 1PVOA 2YWFA 4AY2A 2YOFA 5A5GA 3IKJA 1FFHA 2Q0HA 1UFQA 1JEDA 1O87A 4QC2A 2BJVA 4ARZA 2XB4A 3QKSA 2AD5A 2IYZA 2ZSEA 3NEYA 4DLUA 4F91B 4NHOA 1LTQA 2J1LA 3A37A 3CW2A 2WAYA 4MYTA 3EASA 2WSSD 1RW4A 4EJSC 4TZ6A 1N6OA 3CRW1 4QJ4A 4EPRA 3NTUA 3SYLA 4HB0A 4RY2A 3MJRA 2J9RA 5F3WB 4LUCA 1TU4A 3R8CA 2JLYA 3HP1A 4GZMA 4JSYA 2D74A 4V0NA 5JSZA 3EX7C 2CL7X 2AWOA 5DI3B 4B3BA 1GNQA 3LBIA 1TF7A 1SULA 1XRJA 2HF9A 4IDPA 3E5HA 2FNAA 2G0TA 2IYXA 3LV8A 1Q0UA 2D2EA 4GDFA 3DPUA 4I81A 1NN3A 3ASZA 3QXJA 1FQJA 2N46A 5TV2A 1CRPA 2B6HA 2GA8A 3B6EA 5DH9A 1OH5A 2WVJA 5IT5A 4BPBA 4U7DA 3CF0A 2B8WA 4QNMA 2ZU6A 3IEVA 4L9SA 3T34A 4BRWA 4AK9A 4XJXA 1P3JA 2JDID 4HATA 3OFNA 3EZ2A 1E0SA 1N6IA 1U0JA 2ODNA 2ZI3A 3IHLA 2G1JA 2ZVQX 2ZRFA 4KITB 3EIHA 1KOFA 3SFZA 3SNHA 4NU0A 5CDFA 2BIFA 2J46A 3QENA 2W0SA 1VCNA 4QBIA 4LRWA 4A0HA 1GKUB 1CXZA 3OZXA 3CX8A 2WPDA 4B71A 1NY6A 3CWZA 3U7FB 4OK5A 4URWR 1XP8A 5HCIA 1RE0A 4LJ8A 3ZVLA 3OAAA 1YR6A 2YZ2A 3PQCA 2V54A 1YZGA 1TUEA 1EFRD 2A5GA 2C77A 3N2IA 4GMXA 4ZDIA 3B2EA 4F38A 1ZRHA 2WOJA 1NRJB 1E2KA 4YMWA 4R71A 3DM5A 3Q9LA 2FV8A 4G0NA 4CEJB 4B3GA 3EIEA 3LH5A 4IOKA 2OAP1 2GVDC 2IS6A 1SKYE 4G5OA 1VCMA 1IOZA 1NLFA 1NSFA 1XCPA 3GMTA 4TMZA 1ZC4A 1US8A 2X2EA 3K0CA 2E1RA 5L3QA 3U3KA 3RAPR 3OE7D 1PUJA 1HE1C 3EWSA 3KB2A 3FWYA 2VYFA 5L3RA 3SFVA 2GCPA 3ZQJA 4BLOA 4A1FA 2ZI5A 1ODFA 1W2HA 3GLFA 4MITA 5FTNA 5GJVC 1BH2A 4JBXA 3FGNA 4IKEA 4LPSA 4ESHA 1GKIA 1ANKA 3GCGA 2QI9C 3CR8A 4DEXA 4MKHA 2QPOA 1RPZA 5F9FA 2IL1A 1IJFA 2P65A 5B2ZA 1M7HA 3FKQA 2ZI6A 2QP9X 1W49A 2QT0A 2UVQA 4V03A 4CVNA 2F7SA 1P9WA 2QU8A 3DM9B 3ZVRA 3TUJC 4LV6A 1P2SA 2MSEB 4QGFA 3AGQA 4EPVA 1FP6A 4RZXA 3B60A 3GLHE 4R2IA 5JHGB 1PZNA 1GRQA 2J59A 1G8PA 5CB8A 2E87A 5BWMA 2WHXA 2J45A 1EXMA 5DSZA 2EYQA 3NBFA 5DN6A 1IN8A 3GJ0A 5AUNB 3RC8A 2HXYA 1EX6A 3R7WB 5J4YA 3U5ZB 3THWA 1KYIA 2ASEA 3WYGA 4DB2A 1EFRA 1NMZA 4M1OA 5FPSA 5HCNA 1E4YA 1OIXA 1SXJC 2HCBA 4Q4AB 4IFEA 4RFVA 1GNRA 1S4QA 4M21A 2YOGA 1XEWY 4JL8A 4CEHB 3NVAA 3PUWA 4HAUA 2Q3FA 3I3SR 4LBWA 2ERXA 1N6LA 2FMXA 1NN0A 3OEHA 4M1MA 2R6CA 1OV4A 5C2JB 1TQ2A 4PHHA 2ZRLA 2RCNA 3KKNA 4B33A 4C3ZA 1JNYA 4PANA 1E9AA 2BKEA 1D2EA 4XD7D 2QN6A 3QY0A 3U60B 2FE4A 1KO7A 3K09C 3HPRA 2N1BA 4B6EA 2PLRA 2ZETA 3LVQE 3J81k 2XZLA 4TQAA 1SVOA 2GJKA 2QP4A 3IUYA 3NBYC 4EKDA 2EQBA 4TQ9A 1HT1E 4KFSA 1HTWA 1KAOA 5FBQB 3G5UA 3SJCA 3CF6R 1VPLA 3KXLA 3A36A 3SYNA 1DOAA 2CNWA 2NGRA 3V4FA 1XEFA 3S1AA 3SN6A 1KO1A 1U9IC 3RLFA 4WZAE 2RGEA 2G6BA 4IEIA 2BBSA 3W8RA 1ZNWA 3RDPA 3W3ZB 621PA 1N5LA 4NE2A 4QXAA 2ONJA 2EFDB 1N6KA 1GL9B 5K8LA 4N1AA 2OV2A 1PJRA 2ATVA 2GCNA 5IK2A 1IN5A 3BS4A 5GJCA 2AFIE 2WSMA 5L3SA 3C5CA 4D81A 4C0AC 1NMYA 1FMJA 2GZDA 2Z4SA 2P5SA 3LQQA 1S8FA 1WMSA 3CH5A 4G5QA 2JJ8A 5F2EA 1NI3A 1BYIA 1ZIPA 1CIPA 4NYJQ 1G4UR 5BN5A 2ZUDA 4JLPA 2WICA 1WF3A 2I3BA 1ZINA 3QF4A 3KTAB 3NH6A 1G20E 2PZGA 4AKHA 2QQ0A 2BEKA 1MO5A 4PHFA 4A6PA 1SKYB 3KXIA 2PX0A 3A4MA 5KO2A 1NVUQ 2OG2A 2IYVA 5HE9A 1NNEA
chains in the Genus database with same CATH superfamily
1E3JA 1KI2A 2B8EA 3NJRA 4ZO9A 4NZMA 3OIVA 4PS1A 4Q9LA 5AI4A 4HH3C 3VR3A 3AUTA 4K5QA 1TT5A 3ZIUA 5AW3A 3TH5A 3WY9A 1RLJA 3GIWA 2HN9A 4Q4HB 2HGZA 5L6MB 2JFNA 4KRFA 1OLUB 5IN4A 3LHDA 4NYIR 2QM8A 2MINB 4RKYA 2OD9A 1QGYA 1J24A 4H7HA 3MWEA 3EZGA 4X9XA 4B4UA 5EQJB 3W5UA 2HXSA 2QROA 4AB1A 5BOSA 1U6IA 3G0DA 4PICA 3AXTA 2A14A 1LRJA 2HA3A 3C3KA 3C85A 2WJAA 5B12A 3D1VA 1YHYA 3Q6IA 3UWKA 3LRPA 2HCJB 2NVOA 3V4RA 5AIAA 1KMHB 4BKMA 2PQ0A 4PG4A 1NBEA 2FPGB 1BE0A 4I55B 2YYZA 4OHVA 4P5EA 3SOPA 5EXEA 5I8PA 5JECA 4FLMA 2HIMA 4RTNA 3P9KA 1NVVR 4C7OA 3KZOA 4OLFA 5A1JA 4HFNA 3TZLA 3SPXA 1ISGA 4ZJYA 3ISTA 3EFHA 4OH1A 1G1MA 4K6HA 5EIXA 1Y1SA 1BGVA 1N2CA 3CT4A 3FPLA 3DPIA 4KLAA 2O48X 1IUNA 1U1CA 2PSEA 4MZDA 5KYYA 4DCCA 1R2QA 3RK4A 1LY1A 2PMFA 3AQIA 1C3XA 4CV0A 3B2QA 5DYYA 3T7RA 3PDCA 4F9EA 3FSGD 3NKVA 4GXTA 1KMMA 1XMVA 1Y8QA 3S27A 3DMFA 4WW0A 3UHJA 2Y6VA 1ADBA 1O95A 1Z5VA 2DMRA 3OKCA 1CULC 3ENKA 2VWQA 2XY4A 4XWAA 1UANA 5DI3A 1II8B 3CIFA 4W9MC 3INNA 5D1NA 3E9ZA 3D7RA 4G4SP 4TQGA 4OYRA 1HEIA 1WTAA 2V7QA 2ZBUA 4RD3A 4LE2A 3SEFA 5ELMA 5BN4A 3DO8A 4G0OA 1YDEA 3QBEA 3NBKA 4FZ3A 5FWYB 4KI0A 2WSYB 3F8WA 3KB1A 3K0FA 3KKEA 4E2XA 4ECEA 5JRZA 3EZ9A 2J08A 5HDBB 1DX6A 3O90A 2BEUA 3JYQA 2IUFA 4G1UC 4MRMB 3K6RA 4QUDA 4XD2A 3KZKA 1F5NA 3S8EA 2HSJA 3I8OA 1RIFA 2H2GA 1OV6A 4HAIA 4ZZ3A 4BPRA 1NFFA 2WKRA 3EGOA 4MQEA 3VO2A 3BE4A 4MA0A 4NYJR 4D6XA 5CA1A 4D8YA 3B9PA 4RM2A 1G0NA 2LXNA 4UNNA 4ZT5A 2J5KA 3EISA 5CVVA 4CLDA 1HDEA 3IH5A 5BWLA 3SF8A 3AR5A 4OMCA 4Y7CA 3KSMA 3UV7A 1GCUA 2MWMA 3E9DA 3B1ZA 4PAGA 1M8PA 2ANBA 2CK3D 3DV9A 3JATB 5IMBA 5LP6A 3CVWA 1LVHA 3K8ZA 1DAEA 4ID9A 4KQWA 5AVTA 1KK3A 1SCJA 1UK6A 4IKPA 3V80A 1TMYA 3JQAD 5ILOA 5TB5A 1A7AA 1U0GA 2GN8A 4Z99A 3DMDA 1OXVA 1FW6A 4J75A 3QU2A 5DNAA 5HIAA 2JA2A 4IQFA 3C3AA 3EMBA 4ZOCA 5JDCA 3J7AC 3BICA 2CJYA 1JA1A 1T35A 1EGHA 1YOVB 1AHNA 3DMNA 2CB9A 3EY4A 4QKQA 1QU3A 1ZD8A 1OFHA 1NY5A 2W8BA 3LQKA 2GN6A 3OQHA 4MARA 2IV2X 2R6JA 5G0WA 4B8ZA 2DXIA 5F7ZA 3KOOA 1QC5B 1KDYA 4I3GA 2XMGA 1YQTA 1K63A 5JFGA 2X4LA 1NDUA 2JAOA 4QFBA 4YI5A 3IR7A 5CA1B 4S3MA 4D98A 4DBVO 3S81A 5DHRA 5L53A 2DR0A 3B1XA 1NUTA 2BMWA 3KQHA 1XOIA 2D1FA 3V3TA 2OESA 1SVMA 3L7MA 2RAPA 2FWIA 3DKRA 3PYXA 4FGKA 3L6CA 3OKPA 1BQEA 3P0RA 1K7YA 2JBAB 4YRRA 1BEZA 4B4OA 3U4QA 2KHZA 4QGAA 5DHTA 5AVXA 2ZJZA 2QL6A 2J7KA 2WA2A 5SYMA 1WP4A 4ZI7F 5KTSA 2UZIR 5ALIA 3VR2D 3QE9Y 4R1SA 4LJ6A 3NWOA 4G1VA 2H5IA 5DK6A 2X0EA 4E5VA 1U63A 4DG5A 2C9YA 4R7ZA 4C7MA 1X80A 2D5AA 4AF6A 4Q15A 3T5BA 4QWMA 3DVLA 1II8A 1PS0A 1EK5A 1R9MA 4W7HA 4WFIA 4X54A 4H2DA 3UJDA 5KTTA 2IIVA 4OHRA 3G2NA 3WAKA 2FLVA 3FPJA 2QPLA 5DYTA 5EUBA 4B8YA 1U81A 1Z6PA 2F43A 3A4NA 1H2EA 3JQQA 5E7QA 2MMGA 3AILA 1X1EA 4G6ZA 1PG0A 5HEKA 1CDEA 1PJSA 2GYWA 3V97A 1PV4A 5HYVA 4CEIB 4C4XA 4LDQA 2A9KA 2HR1A 2W6NA 1E64A 2GD1O 4X93A 3ODGA 3KFXA 1WY5A 2P4UA 2PIAA 4E5KA 2QENA 1CZHA 1LNZA 1UINA 2XIQA 1TCUA 3BXEA 3IJ5A 2BMFA 3OEWA 3PGMA 1GQOA 1QP7A 1UMDA 3BDVA 5IKOA 3HXKA 1YRAA 6ADHA 1M76A 1U2ZA 2HO5A 1MZVA 5MDHA 2Q4OA 5F9HA 1AGYA 4MYDA 1NXQA 1XK7A 4MRPA 4O08A 3OC6A 1UFRA 2P4EA 3DC2A 1NW8A 1PGOA 3PXGA 3G89A 3KR1A 3IPAA 3OTOB 1SVUA 2R96A 5EIHA 2Z2XA 5F64A 2QLJA 1C7QA 4MW7A 4R1PA 4F4CA 4RKRA 1EWYA 2BUBA 5BOSB 4ENRA 1XPOA 3VOSA 5T64A 1A76A 5BQ5A 4O4LF 3NUQA 4WUVA 4A2PA 4QUAA 4KWHA 3ESAA 2F17A 1G3QA 3BK2A 3DCIA 2MINA 5I9BA 4IKOA 2JI7A 3GFGA 1RRVA 2QKYA 4XX0A 4UNQA 1A98A 1XFAA 4JMPA 3KUDA 4WL0A 3EZXA 2IHYA 1H2BA 5ELXA 3R7BA 1H93A 1QQ5A 1GDHA 1EI9A 2DQ4A 1I6MA 1EFHA 3TG8A 3DNMA 1ZU5A 1DMSA 3VA7A 2CZQA 2RHMA 3ZVMA 4WEQA 5FEMA 4H9GA 4BZPA 1KYVA 1H4VB 2V7PA 1I4WA 2XQJA 1IWBB 1PJTA 2IY9A 2J48A 3NANA 4KKVA 3A1FA 4EELA 4ISCA 2IOYA 1BCSB 4MUAA 3G8YA 8ABPA 4RHYA 5IVKA 1D9XA 4UNIA 1G5FA 1VHDA 2GEDA 3NWJA 4V0LA 3ZH2A 1E79D 5CYPA 4D0LB 1WETA 5P8WA 1XQ6A 1R16A 1ARZA 1XKQA 2QTAA 4KSCA 5C9ZA 2O8DA 4ARAA 2ZAMA 3DZCA 4BC1A 2HT1A 4QWWA 3BH6A 4WBNF 2XYPA 4FDMA 2DECA 1DJMA 4AKGA 1Z63A 3LQ2A 3F6SA 3LCMA 1FXWF 1C7JA 1M1XB 3UB2A 1MV5A 1RRMA 2NQ2C 4CG1A 2O54A 1DWPA 2D2FA 2F67A 2W90A 3LKDA 1UMCA 4GPBA 2QM0A 5EZ5A 5AK3A 4FINA 4JVOA 2PU7A 3SSMA 1QG4A 2V7BA 4F9GA 3M6FA 5GQSA 4AJKA 3FFTA 4CM1A 1LPMA 4CQLB 5DGTA 4OA8A 1BE8A 1IB0A 1RKUA 2C0PA 5EIWA 4Y18A 3N76A 1N8SA 2CHGA 3R0JA 2WC1A 3VZRA 1BXRA 3CC8A 2RIPA 5BYAA 2EFYA 2R00A 2V7UA 4JOBA 2OTCA 3RTGA 1VKHA 1XN1A 2WM9B 3SR0A 5CBPA 1KRXA 1K5GA 1OT5A 3B3GA 3KQUA 2O7NA 3QVMA 4TLCA 3Q3HA 4GZLA 4EYSA 5FD8A 2H1CA 1JSZA 1M6VA 1V48A 1XB2A 4R3UC 4OLBA 1EVLA 1UBLS 2NO4A 1KBQA 1SPBS 5A3JA 4TZ0A 4EYQA 3WIEA 4RANA 4TSRA 2CVHA 3VYVA 3TOZA 1XQ9A 4RY0A 1TYCA 3F96A 1JR3D 3LF2A 3Q1KA 4Y2HA 1JJ7A 4AY5A 1ZQ1A 4EFLA 5BYKA 1C7EA 3UH1A 3VPCA 1NXTA 2JLSA 3CFYA 1F4PA 3DNPA 5AHWA 4G63A 4OI1A 2X13A 3DMPA 4PLFA 2XDWA 3TSYA 2PO7A 1P5RA 3ZCTA 4C22A 4OXQA 4EHHA 2F1JA 4LHVA 4C08A 3SQXA 3GD5A 3K15A 1RKXA 2WFMA 4WKNA 4IZIA 2H65A 4KH0A 5C81A 3G0IA 3QJYA 5LD2B 1EDDA 4H4DA 2NUTA 5J5VA 4G24A 1CFJA 3CVOA 2FKNA 3DE6X 2JKZA 2XUHA 3CH7A 2J07A 3L4SO 4JT2A 2QPAA 2XIJA 1R5NA 2C5AA 2FZKA 1H6BA 4TL6A 3W90A 4E5YA 3GRYA 3I9FA 2ZRDA 4P3YA 2E4XA 2JD1A 3OCZA 1OJ7A 4FUTA 4HMQA 4HWOA 4P83A 4Z8XA 1IZ7A 4CIAA 4E1BA 4PGMA 2OGZA 1G2OA 2QM7A 1WABA 1UFVA 1RC0A 2FOIA 1LF0A 4UQOA 1JFFB 3PIRA 4OSOA 1CR1A 4IRUB 3KG2A 1CUBA 1P2TA 3D2AA 3RYHB 1FFGA 1E9EA 1N2JA 3AU8A 4OYHA 1H2FA 2E48A 1NR1A 4W7SA 3VGJA 1RKBA 4C43A 2EWWA 4I46A 2QIOA 2IS4A 3ROGA 1FQWA 4UMDA 5B3LA 1S2GA 3GUVA 3K0CC 1EJ6A 3C4JA 3RTAA 4B7AA 4G0YA 4J9UE 3I72A 2XCOA 3VTAA 3IIMA 4M1TA 1I1QB 4MP6A 3CM0A 4QXMA 1A2QA 2A88A 2QBYB 3BMOA 3GV0A 1GNSA 3BJZA 3F3MA 2CXOA 3G7UA 1Z4NA 4UCFA 4B6JA 1UKVY 4D4LA 3MTIA 4GC5A 3WK9A 1GZ7A 2OV6A 3DL0A 4KRYA 3HR4A 3GLIA 1PNOA 1M3SA 3H19A 3OEYA 4KIWA 4MR8B 5B30A 3VSEA 3RH0A 5DZSA 5JAIA 3QWAA 4J1QA 4AY6A 3AVOA 4WXMA 2QSUA 1KIFA 3IERA 3DOUA 4LHZA 4EOGA 2FN7A 5HM8A 3HV2A 4IIJF 1HR0B 3L8DA 1GHTA 1P2UA 1CD5A 4R8MA 2ZIVB 4E08A 3W3AD 5DGCA 2Q3MA 4FFSA 1E94E 1PLLA 1QRRA 4K9DA 2VLIA 1H3NA 4J7AA 3ZHYA 2VF5X 3K92A 1F48A 4UEJA 3VNUA 1ABBA 3X2FA 1KKLA 3ROMA 3HNPA 3KLBA 3O3CA 5ARCA 3RREA 5HF6A 3L0IB 5HTKA 3Q7TA 3L1IA 4BFCA 3HCRA 3HL0A 3ZGLA 5GAJA 4LMRA 1BFUA 1M6NA 4A36A 1WX1A 2Z8ZA 2ZJYA 4GEGA 1D6SA 1KETA 2XGGA 4Q66C 4ZPJA 5EMNA 3IDOA 4G67A 4C9BA 5EPEA 1VJ0A 4L5YA 3QX3A 1AJEA 4M0DA 4NCNA 4QUGA 4WK4B 5ES3A 5TGZA 4CHTA 1YL7A 3OPMA 4N12A 5H81A 4CIWA 2Q1YA 2VZ0A 1JSLA 3I0MA 4YP1A 4RF4A 1OI4A 1XE3A 1BJTA 1WZIA 3IBYA 4FBMA 4MWSA 1O94C 4XXHA 3L8GA 3OQBA 4CMAA 3N8HA 3AIMA 1IN4A 2G1UA 4ZMRA 4FXPA 3VSCA 5HRCA 1Q0PA 1KSJA 5C8XA 1OH7A 2XTAA 2FF7A 3NG1A 4YO8A 1QFZA 2Q2OA 3OAAD 3QYPA 1PX0A 1VBKA 3OZIA 1W36B 2X9NA 3BCRA 1P73A 5EY5B 1YK0A 2P1RA 3DF9A 2ZAYA 4M9CA 1W1IA 3ADOA 4LOIA 1G8FA 4YI3A 3G82C 2Y9MB 3NRCA 1EWKA 2ST1A 3G68A 1XJCA 1BHQ1 1KF0A 2VF8A 1NE7A 3BWMA 3TIVA 3VR1A 1WXQA 2XZPA 2YHUA 2XXAB 4RF3A 1AXRA 1YCDA 2XA1A 3CGGA 4JP5A 1JALA 4Z0HO 5EJ5A 4ZVSA 1C1XA 2C54A 3OFND 1M2VB 5BV1A 3MYYA 2E2WA 2XA9A 4LC9A 4NG5A 4DLWA 2H2IA 2BI4A 3HKBB 4P3OA 1DINA 1PT7A 2I6XA 4I2NA 4TOIA 4Y1FA 4RIIA 4YIKA 3UGTA 3L5OA 1DC4A 3OHMA 1L1QA 1M1ZA 2HC9A 2Q49A 3G49A 3QYFA 4AZ3A 4UZFA 2OBXA 4PX9A 5CPBA 4RHTA 2I76A 2EFGA 1YFZA 2IA5A 2VHTA 3RGGA 4MS4B 1XXLA 4NU8X 2RC5A 4NZPA 3OX4A 1ODTC 3PNSA 1MFZA 1Z16A 3CZAA 3QUAA 4H7EA 5I7AA 4EY6A 4DV6B 3E84A 4C88A 4ZOEA 4QOEA 4KQ6A 1LEHA 2KJQA 3KD2A 4XYMA 5DMHA 1GGNA 1LBSA 3GEEA 2JJ2A 3T7IA 3VVCA 3ZDZB 2AHOA 4D9NA 2GJ8A 4Q4CA 3UK2A 1RWOA 2FMTA 4DYVA 4L28A 4WZ6A 1VSTA 4EZEA 5JS7A 4GOND 3B1VA 2ZW9A 4KXFB 5KQRA 2G0NA 3GJ4A 2Q29A 3N6XA 2ZGVA 3F67A 3TRIA 1H8EA 3M6XA 10MHA 1E2NA 3ESQA 3EEIA 3OLQA 1SC4A 4OHUA 4J2HA 5DCWA 1Q1BA 2XNCA 4YGXB 3QE4A 1TGVA 1RYYA 5CA0A 1IHUA 4BWFB 4CTNA 2RMKA 3SHWA 4B6FA 5BR1A 1NTRA 1JLMA 1TCCA 3EHDA 3FM9A 4NF2A 5E7MA 4BMPB 3AM1A 2BGIA 3WRXA 4N9QA 2QSZA 2RKOA 4DCGA 1OXMA 3S3TA 5KYKA 1U31A 3G2QA 1YCGA 4UBKA 4YMLA 2G8NA 5K0JA 1RRGA 1VE9A 2L19A 3FHOA 4FHGA 3BEOA 2IYYA 1XZJA 4P53A 5K3OA 2C97A 2C8LA 2OAEA 2P3SA 4NV3A 3DXZA 4AY3A 1TJ3A 3X1MA 3CO5A 4BX3A 5LZ4A 2YQ4A 1RXVA 1K6EA 3TCKA 2EL7A 3L1HA 4RD6A 1OX6A 1U2GA 3WGMA 4L4XA 3GFVA 1OROA 1XQYA 2GTIA 1JEYB 1SK8A 1ZL0A 4QASA 4DRXB 3WNCA 2OBFA 2VCHA 2ODWA 4QXQA 1OI3A 2VSYA 1GZ3A 4TV9A 5ILQA 4UM5A 1O6ZA 2XECA 3LG2A 4YCJA 3T0FA 3UVEA 1XWFA 1K06A 1ECLA 2Q1UA 3ZD7A 4D96A 4MPTA 4PLVA 5DULA 1UPFA 4E5MA 5KOHB 4TYWA 1T10A 2I99A 4NZOA 3W3AH 4DUPA 3PNPA 4H0FA 5DWVA 2VI5A 5FL3A 4US2R 1LTHR 3IPRA 1V5FA 1OC2A 1IVNA 2WWGA 3KIPA 3GXOA 1EFDN 4NFHA 5ULLA 1LTKA 3F78A 4I7EA 2EQ5A 4YV0A 5I3CA 2C5GA 2G70A 2XUAA 4C4YA 4JMLA 4G1BA 4MUEA 2DSTA 3UNXA 1OX5A 4US0R 4YJ3A 5EI5A 2EYUA 2ZT8A 3MUNA 2R25B 5J4KA 4U0KA 1R15A 5A0FA 1NLUA 1TVMA 5FWAA 1QKKA 4GX1A 3A4YA 4AXBA 5JWOA 2AFHA 2EJWA 2WE8A 3WGOA 2YV3A 3X1ZA 1VFNA 1M7GA 4FGSA 1UDWA 3EQZA 3WK5A 4W63A 4DEYA 4IH4A 3VR0A 5AXCA 4DNQA 2XYQA 1EPUA 1QX3A 2FMUA 3AFGA 1H8HA 2VRCA 3G0OA 3LDAA 3NBAA 3SM3A 1YIDA 4IHJA 2VZLA 2WG0A 1S2MA 3B9RA 4MR7A 5CGQB 1IWOA 3RSGA 1CZRA 1PFGA 2AMVA 2Z43A 2ZANA 3BFPA 4X66B 1DAPA 2N3ZA 4GL2A 3UCFA 2REQA 1NVWQ 3D8UA 2Q8QA 3EOZA 4W1SA 3FI9A 4JQSA 4MRSA 3WLKX 5CVTA 2DH6A 1KWKA 2DFKB 3B6MA 4RHUA 4V3CA 4MUJA 1GGFA 1XCMA 1XTUA 1N0UA 1PJ8A 5E3JA 3IS3A 4MWTA 2ZS9A 2OC4A 3NM6B 3B5EA 1SB9A 2HJVA 2QSYA 4I9FA 4F92B 3TOSA 3GPBA 3DGEC 4AMYA 3NBQA 3EAQA 4BWYA 4N03A 4OB6A 4P80A 3AVTA 4H18A 4BX9A 1BE6A 1P1JA 1UK8A 2AA3A 2C9CA 4HV4A 1EZ1A 1NUPA 1S3FA 5LZ7A 1QYVA 2B3TA 3KPWA 4KO8A 2VJQA 2W2VA 4E2ZA 3IEPA 3QW4B 3AB3A 4LV8B 3ILYA 1B7GO 1HE8B 3L7LA 4KGZA 4DQUA 3SDBA 3LK7A 2P6RA 1JG1A 2G5CA 2H29A 3B38A 3KSDO 3N05A 4ICIA 4FR0A 4KKXB 1HQKA 3Q8XB 4L8GA 3MGCA 3WHIA 3WVNA 5B6IA 5TPZA 4I1PA 3DS8A 2QRUA 1QR6A 1NUSA 2WYVA 3QE2A 2H4FA 2ANCA 3CLRC 1KO5A 1FDWA 4YRPA 1VB3A 3VHXA 4NCKA 4N0QA 1G1AA 3BWEA 1ZVMA 4DXAA 1FP4A 1OBVA 1OTXA 3KU1A 2BT4A 3CKYA 5JNLA 2ZJ8A 4C2UA 5F98A 1CIVA 2UXCB 2G04A 2DSNA 1CC1S 4YAEA 3LP5A 4HTFA 1ZCJA 2B1JA 2HMAA 2FJ0A 1FYDA 4OF4A 2IC5A 1L5ZA 1Z8FA 2QYOA 4I9HA 2C4VA 2E37A 3CCFA 3ICOA 3ENVA 3QKTA 2OYRA 4CCYB 2IYWA 5HK9A 2RHRA 5FNVB 3I32A 4FIDA 2FQ1A 3E82A 3OLVA 3DHNA 4AI6A 1GPAA 2P9ZA 3JQ8B 3KQKA 4B7XA 1C3OB 1UWCA 1TF2A 3ENQA 5KI6A 1V1JA 3HJNA 1WW2A 4KXVA 2RHTA 3K2IA 2DOKA 1WMBA 1A8UA 2EIXA 1JG3A 1RSZA 4C30A 2SHKA 4FOPA 2HNAA 1P31A 1KI9A 2C95A 3A1CA 2JARA 3TTUA 2QVBA 3PKZA 1JHQA 2QTZA 1FS4A 3PQ5A 3R09A 1XMJA 1IE3A 3GEPA 4WOCA 3I37X 4PX5A 1ZVKA 5CITA 4AJIA 4FJ0A 4L95C 4W5NA 2P0EA 4E7PA 4OUDB 1ZOSA 2ZQZA 5THXA 3Q98A 1UEIA 3ZGOA 4NVRA 5FAKA 4Z2AA 3ABQB 3H6KA 1Y4UA 5ENDA 3EEQA 4R1UA 1Q2UA 4X5OA 4J9VA 3UPUA 1IG0A 4Q34A 2O6LA 4Q1AA 1PF7E 2HHAA 3LUJA 3ILVA 1D2HA 1NOKA 3WGYA 3Q40A 3UK7A 1I0ZA 2H31A 2Q07A 1FMLA 5C31A 1G6KA 2L17A 3JQAA 4FGJA 1QVAA 3KBOA 4IF6A 5TJ9A 4I5GA 1RHRA 2GF2A 2WOOA 4J7CA 1W9MA 3IC5A 4P4SA 3U3MA 4MR9A 5CFNA 1LI5A 4JC5A 4ACBA 1IM8A 1R4NA 1D0VA 1FDUA 2GPNA 1X92A 4HFRA 4UHFA 4JT8A 2GFHA 4AJJA 3U48A 5JRJA 1ZZEA 1MEJA 4RD0A 1GXSA 2GPAA 2BLLA 1L8AA 2GZMA 1FOEB 2QUIA 2V6GA 3C8UA 1P7ZA 3LX4A 3OTHA 3PYMA 4BECA 5LP6B 2PMCA 4D56A 2H8GA 1CR6A 4RPLA 3PPVA 3U4HA 1SU7A 2JVIA 5I5GA 4D0RA 3WB9A 3PHCA 2D6FA 2JHGA 4KI7A 5ALPA 1NQUA 1V7CA 5JCOC 2D3WA 4DMRA 1JDBB 2D06A 2VNIA 3ET5A 1J5EB 1IY0A 3SVLA 3ICVA 3JX9A 4P2GA 3KK0A 3WMFA 2IZ7A 1KQPA 1S0UA 2AN5A 4ZVMA 3SYKA 2CNKA 5AKHA 1KVSA 3EH1A 3FF4A 4Q1BA 5FL7A 2FZGA 4EVSA 2Q21A 1U4NA 1CEQA 2J4FA 4R9NA 1NFRA 2BSXA 1JYSA 1FUYB 4KQFA 1S89A 4WXEA 4AWXA 3EG5A 3FROA 3PQ3A 1C8LA 4J1TA 4NQRA 3CRZA 3OY2A 5JFOA 3F46A 3FMVA 4EA6A 5DBGA 6PFKA 4BXOA 2VJYA 5F52A 3ZNPA 1F7VA 3KV3O 4U02A 3BXXA 2NU6A 1DFIA 4X20B 1N6PA 2XDAA 3EJ6A 3H8SA 1G3RA 4G9BA 4U9IS 2WM2A 4IIFA 1LW6E 4YMUA 3D5TA 2GK3A 2ORED 2R6AA 4KWTA 4WN9B 2JHAA 5AVUA 2VHZA 3UYKA 1NHGA 1KQFA 2HWUA 2A0YA 2FLKA 2XRYA 2UZAA 2C7GA 4AURA 1X1RA 1XZAA 4Z9BA 3TM4A 3I12A 3ZW7A 3PD1A 1RMQA 3HKEA 4UBNA 5EQFA 1SIUA 4TRNA 4BMZA 4FEGA 3SGLA 1XPRA 2FXIA 4MIOA 4UCWA 1YBFA 2I2CA 1HZJA 2H9AA 3T9DA 4UQPA 1CBUA 1AS0A 3AG5A 4ZN6A 3BILA 4HLQB 3U1BA 3RVBA 3IKTA 3DLTA 4EFNA 1QBKC 5FUWA 3PQ4A 4DLKA 3O8OA 2OXFA 4FMDF 3RTBA 4RZIA 3FKSA 1ODJA 1E2EA 3MRSA 1Z36A 4WBSA 2BISA 2LBPA 1V9SA 1VSQA 3H05A 5AJYA 2LIVA 1Y1LA 2QZSA 4V2IA 3UTDA 4G41A 1Q19A 2ZJ1A 3A6HA 1W25A 1H2AS 1CY2A 4JLUA 5LVAA 1GKKA 1V3TA 4N3NA 1FJXA 3QPVA 1DG3A 1BAPA 4QNNA 1M9NA 1Q21A 1OHHA 5CG1A 3FLMA 3UJ9A 2Z5LA 3Q12A 1KEEA 3VR3D 1E7QA 3FDZA 1Q1ZA 4MKGA 1FXUA 3SIXA 2X23A 1Q83A 4LQLA 3NOOA 1QVZA 1CV2A 2UZ3A 3ZYCA 4CQMB 1IXZA 4PYQA 5JXGA 2E6UX 3NHUA 2Z9DA 3TM5A 4ZO8A 5EIEA 1VL5A 1LQTA 4WAUA 1O5IA 2AFIA 1NBAA 2FJUA 5HILA 5BSRA 5BVGB 3TZKA 1H0KA 2H11A 3NIGB 3V4OA 3ZWAA 2AXQA 4E14A 1G18A 2QE6A 3QFRA 3TLYA 5IULC 1U3CA 3QVSA 3GZ4A 1EB9A 2R7NA 3NKLA 3VH4A 5ESXA 3GDGA 3ZIAA 3PT5A 3G2OA 3FNQA 4OHWA 3L0ZA 5SY6A 3JD3A 2R0QC 4OG2A 1QV6A 2PXAA 3T95A 5LM3A 1GTVA 5FQOA 5JXWA 1ICIA 2JLCA 4ZI2A 4YJ2F 2I71A 5FOTA 3F7NA 1KJYA 2PZLA 1GFSA 4EENA 1OX4B 3H42B 4GI7A 3LBYA 4TMKA 2GBFA 2RIRA 5UKDA 3THWB 3DBVO 1U04A 1YMQA 2FEPA 1WXHA 4YQEA 3TEFA 1YQ9A 3OCYA 4E5PA 3BCUA 4L0CA 2P91A 3WNDA 4CW7A 1N2ZA 5JG7A 1BRMA 3H84A 1IQPA 4HB2A 3MWYW 1T9HA 1KJ8A 3K1ZA 1QDUA 1E2QA 4JHLA 3GP8A 5IW8A 1ID1A 3Q3VA 5FYDA 3WRYA 1P77A 2WMOB 5CT4A 5FLXA 1AUOA 2AFRA 4JBNA 4V0OA 3ABZA 5CR9A 4D9KA 2CZCA 5KDDA 3OLYA 4ENUA 2WJJA 3VI4B 4RPKA 4P36A 4Z54A 1R9NA 5HKKD 3GAMA 2QZZA 2Z5VA 1P60A 2BOVA 2KLHA 4GLJA 5DGHA 5H68A 2PEYA 3SKXA 4IGEA 4J0GA 4BFUA 4C4SA 1NRIA 1R0SA 2BGKA 3Q7QA 4HAVA 4QPZA 4ZAFA 1U0LA 4FD2A 1X39A 2BMDA 4GYKA 1MAUA 1SXIA 2LV8A 4LQDA 2E5LB 1EDBA 4NY1A 2H1OA 3FRIA 3ITNA 4EX7A 3NRBA 4HDSB 2A78A 4IW3B 3EFOB 1U9IA 5JPIA 2GBCA 3ZU4A 1D8TA 3MGGA 4YFVA 4TWRA 1RXEA 1Q20A 3B53X 1ACMA 3GCZA 4ZU3A 1N2CE 2WJWA 5DTJA 3RIHA 3U39A 4Z4GA 3ZTTA 1Y6GA 1WXEA 4HR7A 3UF0A 1KA9H 1TZMA 4IMIB 4MW5A 3H5VA 4ZALA 4INJA 2XGSA 4BRSA 3J81A 1SOAA 4B81A 1A8HA 4C2AA 4JI0B 4AYTA 2CDCA 2OGSA 2P90A 3BB3A 4PWYA 3NP9A 4TYYA 5I4CA 4KL8S 4DDKA 4ZYLA 2C7QA 4JGGA 4OHPA 3BTVA 5G4KA 3A6LA 4I5IA 1T4CA 3VV2A 3FPEA 1ZH2A 5EWMA 3I42A 5KX5B 4ZRDA 1JTVA 4J0HA 1NXSA 5TQ0B 5CM9C 1CRLA 4BKOA 1XZQA 2VCYA 2DUNA 2Q5FA 5AKKA 2VHUA 1ULAA 3C41J 3Q0TA 1HDZA 5C5IA 1NVAA 1OA1A 4P4UA 5C0OE 1U5CA 1GYPA 2OP0A 3QPAA 4D4KA 2I91A 1VYHA 1Q12A 1A9OA 1OIVA 4JODA 3OM0A 4N54A 3RD5A 5KQSA 2B36A 2N42A 4WCFA 4YR7A 2BKXA 2R1VA 4GW3A 4F12A 5M04A 1R66A 1FMTA 1WD5A 4WLEA 4I2VA 2VNJA 3I2JA 1JHUA 2OVBA 4UD2A 1XO1A 4NC9A 1GPJA 4QPDA 3ETLA 5DXJA 5U4QA 4D9GA 2VUUA 3MELA 5A2GA 5JD6A 3MTJA 3O8LA 2MOKA 4Y1EA 3W7AA 3JVDA 1L3CA 3D4OA 5BW6B 3UMYA 4LVCA 3A1TA 4F2WA 3PGVA 3NCTA 3QA9A 3REFA 5HRUA 4OB8A 1JT9A 4FYPA 1B3RA 1GFWA 2G17A 3ECSA 3NHFA 3WGGA 3I01M 4DTIA 5T67A 3KWJA 1QV7A 3SU8A 2BFEB 2FSHA 3ETDA 4CKEB 4ZGWA 5JR3A 3GA0A 4KVGA 4DDWA 3LHSA 4CNQA 2I6FA 3K9CA 2XNDA 4GR9A 3JQDA 4KYVA 2F9MA 2QVYX 5H02A 5EHGA 4AW9A 3CVUA 2WQ7A 4JJ8A 1QFYA 2FRDC 3U3OA 3QBJA 4PO3X 5P21A 1E7YA 2D0OB 5BSHA 4FE3A 1L5MA 3HUEA 4PXAA 2W2TA 2IYUA 2BEWB 2I6SA 3J7TA 4R8SA 5DCLA 3WL7A 3IVXA 4IDHA 5B7PA 1WUHS 2C57A 1WLSA 2CGEA 2NWQA 1IQ0A 3TI9A 3JQBC 1WIWA 5KYUB 1DEKA 1ISIA 2CFCA 3AUXA 3NX4A 3ZE2B 3P9IA 3RUCA 3K70D 4L16A 2JGLA 2W2MA 3DCJA 5I8ZA 1G291 1G2PA 4Q1DA 4AIRA 4LN1A 3ST7A 3UUEA 2DHRA 1DCFA 3ZE9A 1LS6A 3E8MA 3ZD8A 4NK5A 1QU2A 2MT9A 1ZGGA 3PGKA 1WHSB 3K71B 5BORA 2VA9A 1P1BA 1Y34E 2XLCA 5DYWA 5DX8A 4DLLA 1CLEA 2P30A 3RRMA 4HPWA 5E1MA 1I80A 2P6MA 1RI1A 3RRZA 2I33A 4YQZA 2BRUA 2QDKA 4Z1OA 1IL0A 1NJGA 5L6LB 3U09A 3ZTWA 3JQGB 2FR0A 1JR3E 4M9XA 2JZOA 4JP3A 4PYOA 3WKBA 1W94A 3HH8A 3AO0B 1UZAA 3G9ZA 2H00A 3K5WA 1AK2A 3BD6A 3JVIA 4JEHA 1Y3DE 2EXXA 3ER6A 3LYLA 4MWGA 1AK9A 4MVJF 3RYIB 1C1DB 1IHXA 3RJMA 1KZYC 2RHWA 1ZGAA 4B2YA 2TMDA 4RHCA 5DT9A 2GBGA 1Z68A 3ASUA 2QVXX 5JBIA 2HMUA 1Z56C 1XVIA 4ZV4A 3T5GA 2QNRA 2GZAA 2H8KA 2F3PA 1IY1A 1SUCA 4PYLA 1JBQA 3KC2A 5DM0A 5AOVA 5KTYA 4NYMR 1JXAA 2TSYB 1EUCB 2ADFA 3VAZA 5DN6D 3HB0A 2X9LA 3F9RA 1X19A 2VTDA 2X6RA 3GUYA 5F5LA 3A2LA 1A7KA 3RUDA 5C8YA 2UUBB 4LIPD 4TGLA 4AKEA 4AXXA 5CDYA 3G2PA 3GJ6A 4K81B 5E38A 3DKVA 4GG1A 3RODA 4Z0PA 2PWAA 1W2WB 5LJIA 1ZNXA 3G85A 1I4OA 1P5FA 1T3HA 1YL5A 1YZHA 4GOKA 3CCCA 2Q0XA 3M4ZA 3QMMA 3HB7A 4CMHA 4INPA 1XU9A 2VNKA 5HIJA 1XJ5A 4CBVA 5EZYF 4XVCA 2XHEA 5JW6A 1IJEA 3JCZA 4OJNA 4IIBA 5AI9A 1T1IA 2V7EA 1ABEA 3ZKWA 2VC2B 1KK1A 5EAIA 5KTPA 4HWSA 2PD3A 3K8QA 4J16A 2XOEA 3VC1A 2X6QA 1AQJA 1B0ZA 2I80A 1K3TA 1NBIA 5ALSA 2Y66A 1YOBA 3RSQA 4AF8A 4XR9A 1U2PA 3NC1C 4GL4A 4I6EA 3TOXA 1QKIA 3AVQA 4PIPA 1PHRA 3GWZA 4PQYA 4RLQA 3WHPA 3WYNA 4KAXA 2AYZA 1KDPA 3OJ0A 3QOWA 3I8SA 3SE7A 2WAMA 1RMYA 1MXFA 1ISPA 3ZD6A 4R5HA 3U7IA 2PKWA 3VQTA 4EB8A 1XI2A 2FZ4A 5AICA 2YIVX 1X9GA 3VYUB 3HY6A 4FOSA 1GNLA 4RFLA 4AIIA 1A8QA 3B3AA 4EBBA 2OOSA 5JANA 1EE9A 2CYAA 4WKOA 4MB2A 5EINA 4DSZA 3JTMA 3HY3A 2RB4A 3GAFA 4IDOA 3RADC 3ZBTA 2Q5HA 4BL5A 1GUFA 1N8KA 2WJYA 3EVDA 5J1TB 2ISCA 6ABPA 5EZSA 1LS1A 4V0RA 3H9EO 3ZU6A 1Y6ZA 3JASB 1Q0ZA 1WSWA 1GPDG 2A0UA 2NACA 4NYMQ 3OZVA 3AJ8A 3H1GA 4PTZA 5AUOB 4L27A 1E20A 2R3SA 3C43A 4O1IA 1CR0A 1T0BA 4DPMA 1ZMRA 4J4TA 3FWHA 2R87A 3I9JA 1QP4A 3IMCA 4PBTA 1QHGA 3VZSA 5BSFA 4FOOA 4QJ3A 2ZSBA 4LDPA 3D02A 2X8AA 2ZITA 2JFYA 1TZBA 3Q8MA 1NIPA 3TMKA 1DLIA 1PJLA 3A7EA 4I1IA 4JK3A 3H17A 3JPYA 2Q1SA 3MTQA 4K9QA 4OO3A 5BR8B 2F3UA 1DB3A 1WVIA 4S35A 4E46A 2EVWX 1N77A 1XEXB 3FTPA 1MW8X 1P1IA 4IHKA 2OQRA 2HSGA 3MRXA 2GXAA 4L4UA 4YT8A 2CEAA 2IIQA 5LYJB 2C9BA 5IYZF 3WWEA 1XWIA 3GFFA 3WK8A 3F6CA 2Q28A 3ADKA 4UXHA 1UC5B 4HMOA 2H18A 4X8HA 3TQHA 3TGPA 4GECA 4JVLA 1ADYA 3FCSB 5BWBA 1SOMA 1OHHD 3O83A 3WLHA 5LLDA 1PGJA 1OCEA 3SYTA 4BP9A 3TXAA 5JNVA 5DP2A 1I3KA 5FTMA 4ZVVA 2W11A 4MA4A 3KWLA 1KZ4A 2ATCA 2XMBA 3NXSA 2C3OA 1X1TA 5JD5A 1KNXA 1D8AA 2C3UA 3F2VA 2G07A 1KP9A 3HJUA 3LP6A 4PLYA 3E9MA 1W0KD 2CE2X 4AROA 2ADMA 5EMHA 1XZFA 1UBKS 3PI7A 2GKGA 1NMEA 2HGSA 4EHIA 5BMOA 3Q5GA 4GP9A 5IAAA 4DSNA 4EBFA 1ZSYA 3BHNA 3OWXA 3CLSD 3CS3A 3L8EA 3W2TA 4KQHA 1H9AA 3UXMA 4IWYA 4LJ5A 3GRUA 1NVKA 4YJDA 2P0YA 3LXUX 1U3WA 3KJGA 1ZM7A 4RK0A 2IV3A 3ROFA 1BO6A 4OBXA 3WYCA