2XTZA

Crystal structure of the g alpha protein atgpa1 from arabidopsis thaliana
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
349
structure length
341
Chain Sequence
MGSGIHIRKLLLLGAGESGKSTIFKQIKLLFQTGFDEGELKSYVPVIHANVYQTIKLLHDGTKEFAQNETDSAKYMLSSESIAIGEKLSEIGGRLDYPRLTKDIAEGIETLWKDPAIQETARGNELQVPDTKYLMENLKRLSDINYIPTKEDVLYARVRTTGVVEIQFSPVGEVYRLFDVGGQRNERRKWIHLFEGVTAVIFCAAISEYDQTLFEDEQKNRMMETKELFDWVLKQPCFEKTSFMLFLNKFDIFEKKVLDVPLNVCEWFRDYQPVSSGKQEIEHAYEFVKKKFEELYYQNTAPDRVDRVFKIYRTTALDQKLVKKTFKLVDETLRRRNLLEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Crystal Structure of a Self-Activating G Protein Alpha Subunit Reveals its Distinct Mechanism of Signal Initiation
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Hydrolase
molecule keywords GUANINE NUCLEOTIDE-BINDING PROTEIN ALPHA-1 SUBUNIT
total genus 130
structure length 341
sequence length 349
chains with identical sequence B, C
ec nomenclature ec 3.6.5.1: Heterotrimeric G-protein GTPase.
pdb deposition date 2010-10-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.400.10 Mainly Alpha Orthogonal Bundle GI Alpha 1, domain 2-like GI Alpha 1, domain 2-like 2xtzA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2xtzA01
2ZSFA 4X8OA 3M6AA 4JBXA 4BRUA 4QNRA 3QKSA 3RWOA 3EX7C 1KI6B 1U94A 1ZUIA 1E1QA 3EA5A 3VR2A 3GMTA 1G3QA 1N0VC 1KK0A 1FMLA 3IKJA 4NCJA 4TMXA 3V9PA 4KBGA 3WBKA 4PPGA 4PQFA 3HU2A 4IVRA 1K5GA 1VDZA 2VSXA 3MFYA 1KJZA 1XD8A 1OXSC 2RGEA 4CEIA 4ZIRB 1LB1B 2OFWA 4RD6A 1S96A 3K0CA 4C0JA 2XSZD 2A3RA 1G3UA 3H84A 5B57C 1N6OA 4TT3A 4J0QA 1J70A 3WRYC 1J8MF 2GJ9A 2IXEA 2O8CB 1ESMA 3X1YA 2JJ1D 1Q57A 3C16C 4Q1AA 4MGIR 3DHWC 5JS8A 3NC1C 2QUZA 4LPSA 4YMSA 1FP7A 3UATA 3MJRA 2IS4A 4Z8XA 3SNHA 4OKSA 2CHGA 1OJLA 2ZRDA 1VPLA 1E2EA 4CGZA 1N6KA 4NE2A 3MWLA 3NXSA 2BV3A 5KPJA 1P9NA 1TF2A 4KAXA 1P3JA 1BS1A 5HZHA 1QVAA 3H0KA 1YE8A 2GVZC 3NC0C 3K0FB 3CH5A 1R8QA 2ORVA 2BKUA 2JLUA 2BCJQ 3NBFA 3IEUA 3W6NA 4NL4H 1WP9A 1LW7A 4MITA 4LBVA 1NVUQ 5KSYA 4DBLC 4DDVA 1S9HA 2FX3A 5KU1A 2XNDA 1AGRA 3HYRA 1UBCA 1YZLA 1AS2A 1OXVA 2HLDD 2KI5A 4O0MA 4H9GA 2Z5FA 4LRWA 1LS6A 4L4UA 4AK9A 1UKEA 3GLGE 5J4LA 3VU9B 2YYZA 2GETA 4ITRC 2CXXA 3TAUA 5J4YA 3O8CA 3A6PC 5AUOB 3X1DA 3R7WA 4IFEA 1PUJA 1SVMA 5CDFA 1GL9B 1MABB 4GT1A 1WQ1R 1VIYA 3FHOA 5KNBA 1TADA 3U61B 1Z6YA 3NKVA 4IXMA 3GLIE 1EFTA 4TQUS 2JGNA 4PSAA 5KNCA 3KX2A 3BB3A 4DLXA 2H1LA 3DZ8A 4IOMA 1FQKA 2RHDA 2R8RA 2LKDA 2OBMA 4G5QA 3THWA 3K09C 1NLYA 2J1LA 3HPRA 2AR7A 4TSFD 5HPYB 5E4FA 5EQTA 1IAQA 3W9YA 1G8YA 2OSBA 2B92A 3KQHA 3WHLA 3WXMA 4KU4A 4PO8A 3B1ZA 4AIIA 1GFIA 3ND8A 3BH0A 3I8SA 4LBWA 1E99A 2C78A 2WHXA 2CNWD 1P2VA 4TTRA 2HYIC 1W4BA 2F3TA 1G19A 2WWIA 3QPVA 4Z1MD 4BFSA 2V55B 3IO5A 1IXZA 5GJCA 1N0WA 1JJ7A 1QHSA 4I1UA 4FMDB 3FDIA 1CR2A 2N42A 4HAVA 2IS6A 1KGDA 1NMXA 3T12A 1GNPA 4QKQA 5B64A 2Q9BA 1VCNA 2AL7A 4LHWA 1T91A 1VCMA 4BZXA 3H2YA 3LH5A 4C0AC 1HE8B 4Q4JA 3QQ5A 2ZI4A 2JATA 3OEHD 1MH1A 4Q1CA 4Z54A 1HA3A 2BMDA 2ZSEA 1E2GA 4L9SA 1E9AA 4CEHA 1FZQA 1VYUA 2FG5A 2WBLC 4JJZA 4PPNA 2ZANA 3TVTA 2H18A 1D6JA 3E5HA 4PXAA 3AP1A 3M1IA 3T5DA 2PZGA 4US0R 5IK2D 1E9CA 2XOKA 1UF9A 3B5JA 1UEIA 1NKTA 2KB0A 1XZPA 3CR7A 2BMEA 1ZJ6A 2YWGA 4DXAA 3AM1A 3THXB 3ZVMA 3VAAA 4HYYA 1XZQA 5FPHA 4NDZA 4LJ8A 1E9SA 3KKOA 3UKDA 3HWSA 2QMEA 1FPMA 2RGAA 4OJQA 3P4XA 1HUQA 4NCIA 1W1WA 4P4SA 3ZJYA 3F3YA 4Y0AA 3B1YA 1T3LA 1ZNYA 2ZI9A 2WSSD 3U2QA 4XIGS 4RZ3A 4TLDA 4BLRA 1HT2E 3KKNA 4X8MA 4KODA 4HB0A 1DELA 1G64A 4QBHA 2O8DA 4ZKEA 2XB4A 4C4PA 4NTZA 1IBRA 3A4LA 2H17A 3SDZA 1GNRA 2GVDC 2EW1A 2HJVA 2FNAA 2A5YB 2WJIA 5CB6A 4FMDF 2ZRPA 4NYIQ 2DFTA 2FEMA 2HCBA 1WXQA 3CLVA 1OV4A 4RJLA 3I5YA 3PFIA 4XD7D 1CKEA 4TYPA 2O8EB 5C18A 2AKAB 2PL3A 4ZDIA 2O8DB 4R98A 2QQEA 1AK2A 1IN6A 2WWGA 1N25A 1KYIA 1XPOA 4KLNA 1XRJA 3O8RA 3P20A 1NBME 1BOFA 2HF9A 3W5IA 3RRMA 1C9KA 1T5LA 5CM9C 1K6MA 4C2UA 3B85A 1YR6A 1QHGA 1XX6A 4E09A 4PQYA 1TQ2A 2C9YA 2ZRNA 1ZM9A 4H1UA 1GL6A 1E79D 3L0SA 1W49A 5EZ6B 4V02A 1E4VA 5EJEA 3EC2A 3SYKA 4Z51A 1BYIA 1E2NA 2AK3A 4JLOA 4XVRA 3P1JA 2JIZA 4F7WA 2YJTD 1F5NA 2QGNA 3I5XA 1AM4D 3VKHA 2Q9AA 2OT3B 3QXXA 5FBWB 1FP6A 3GJ3A 3RC8A 1OXTA 1JJVA 5LBIA 4JIMA 4A9AA 1KZGB 3G5UA 2D62A 2PCLA 2REXB 5FUXA 3A58B 1OB2A 4L9WA 2ZAMA 3N70A 2XOKD 1CRPA 2WICA 1EWRA 2YOGA 3B8HA 4ON9A 5GADl 3FMPB 2QAGC 4M1TA 4M9SA 2GRJA 1FOEB 4JLJA 4NCHA 4B2PA 3A1SA 4LBZA 2QE7A 3GLIB 3IQXA 4ACAA 2J41A 1E2QA 3AUYA 4WXRA 3TJZA 2O8FB 3OEHA 2R6FA 4NYJQ 1DAFA 4L16A 4KITB 5FH9A 4XD7A 3ZD7A 2IYVA 3QNUA 3NH9A 1ZUNB 3LWNA 4DCVA 2A7QA 4DSTA 1JAIA 3WNCA 5DIFA 3X1WA 1DPFA 3BGWA 5BQ5A 3M0EA 1GAJA 3AVVA 2PEYA 2XEXA 4QGHA 1GKYA 3R9XA 3OEEA 3U7FB 1MO3A 4Q02A 1P72A 4F93B 4F4JA 1JEEA 4KVAA 2Q6TA 4D6PA 2G9NA 2XNSA 3U7GA 3LFUA 5FPSA 2CNWA 3AEZA 4TLBA 1FMJA 2IUUA 1TU4A 1MV5A 1UAAA 2FSIA 3KJIA 4AD8A 4LJYA 4G0NA 2Z4SA 3GCGA 1NN3A 4Q1BA 2OG2A 2P6UA 2VF7A 3HP1A 1I2DA 4QC2A 1GITA 1ZVQA 4UJ5A 3NBXX 3PEVA 3GFPA 1R0XA 2J0UB 4KFRA 4DLZA 3BFVA 3CF0A 1BMFD 4Q4HA 4CEJB 4TZ6A 4AI6A 2XZPA 4A82A 1PLLA 2JA1A 2YC2C 2HCJB 1OFHA 2QM8A 3I1FA 1JR3E 2VP9A 3AKEA 5BN5A 2NTYC 1Z6AA 2G1JA 1OIXA 4YDSA 1P2TA 1OYWA 4MRSA 1RZ3A 3W8RA 4B34A 3UPUA 1OIVA 3ZVNA 3LD9A 2P65A 4JJKA 3RSOA 3ASZA 2V6JA 3VNUA 1XEFA 2ZUCA 3RSLA 5JEEA 1OE0A 2OFXA 3FMIA 5DYIA 3GFOA 1SVIA 3CRMA 1HE1C 1DADA 2PEZA 3EPLA 1HTWA 3C15C 1FX0A 3EZFA 1JQJC 3RS3A 2G3YA 5EXXA 1WRBA 1G7SA 2BCGY 1YZKA 2VP4A 1XTKA 2WTUA 3V00A 1KZ7B 821PA 2WJVA 5CIQA 4PR0A 2CHQA 2P6RA 2C99A 1HYQA 1E0SA 4HATA 3SFVA 3RYTC 3FFBA 1NP6A 3SR0A 3DL0A 3TVDA 4B48A 4I81A 3AVTA 1Z28A 4LHXA 4QGFA 2ODBA 4A8JC 2L0XA 2J7KA 2CK3A 4LJ9A 3X2SA 4DRZA 4FIDA 3K70D 2JCSA 5EE1A 5HKKD 1OKKA 5JFGA 4LOAA 1XEXB 4URVR 5AUPB 5EE5B 2TMKA 2RAPA 1KO1A 1S1CA 5ELXA 4JSYA 4M53A 1OHHA 1E2KA 521PA 3QEJA 4O2LA 1TQ6A 2FV8A 2R9VA 1DARA 1HEIA 1NMYA 2QP9X 3SC3A 3WNBA 1M7HA 2QEQA 3Q7QA 2QROA 3LVQE 1DAKA 1O87A 621PA 2R6CA 2XSZA 4OBEA 2OAQ1 3QXHA 5CJPA 1H8EA 4DB2A 3BH6A 4LI0A 3QPUA 4XVQA 3NVAA 2F55A 4EJSB 1OXXK 4AKHA 2GDJA 3GQBA 1NI3A 4Q9KA 4BEJA 1M1YE 1XU4A 4EUNA 1KI3A 3DKPA 1TF7A 2CEAA 4JKYA 4MYHA 1R0ZA 2DWOA 5IDVA 5KOYA 4B6FA 3OFND 2YNMA 4B33A 2E87A 3A36A 1KI2A 3OIYA 1NNEA 1CIPA 2HF8A 2GF0A 3LRPA 1G5RA 3QENA 2WPDD 5SZHB 2PCJA 5CK4A 2DFNA 2ZRHA 1M8PA 3SE0A 3LQRA 2RGNA 1X8JA 3CF6R 1RW4A 2OLKA 3BRWD 4II7A 1RFLA 1OF1A 4RY2A 4QJ4A 2ZIAA 4W9MC 2W00A 4KSCA 2X8AA 4P0TA 3SJCA 4DEYA 3MAAC 2GAOA 4IKEA 2H16A 5DI3B 2WWYA 3C14C 3UG6A 2ZITA 4DHEA 2IC5A 2YC4C 2ZS7A 1N6IA 4L15A 2PH1A 3DZDA 2GCPA 1WMSA 2ZRIA 4P32A 4MRNA 4B3BA 2V7QA 1TAGA 1XXHE 1ZINA 4FMCB 4WXPA 1ZD8A 5LD2C 1CULC 2RB4A 3NBZC 1M34E 5D3MB 5CYPA 1T9HA 1VCIA 2QTVB 4WZ6A 4D4MA 2AX4A 1U81A 3FGNA 4D4JA 2NIPA 2P67A 2FA9A 3UMFA 1SXJB 3IUYA 4V0OA 1ZC3A 3AVQA 2XNDD 1HV8A 3I8XA 3LNCA 2QAJA 2CL7X 4S35A 5EP2A 2ZJ5A 3REGA 1AS3A 1KDTA 4LJ5A 5HR5A 1JNYA 1TEVA 4ERNA 1VYVA 1OPXA 3CH4B 5AWFC 2VHJA 4Z1MA 2Q3FA 4PSVA 2VL7A 4FI3C 2FE4A 1HURA 1N5IA 3D3QA 5FOWA 1GP2A 2FOLA 5LPNA 1F60A 4HLCA 1R5OA 2CVHA 1CU1A 3TK1A 2VSFA 3AVYA 4HLUC 2V4ZA 3K0CC 5FI1B 1YR9A 1E9BA 3HJNA 2BJWA 1KO5A 5DSZA 4FINA 2ZQ5A 5L3RA 1KKMA 2ZJOA 1YQTA 3C5HA 4URZR 1KSFX 2GF9A 4A0RA 1CJMA 1EFHA 4TMTA 4HZUB 2FPKA 3K70B 3LLUA 5K8UA 4CIDA 4MYTA 5JWOA 1Z2AA 3C5CA 4AKGA 3P26A 4NYJR 1CXZA 4QJ5A 1ZD9A 5L3SB 3KXKA 2OCAA 2QQ0A 2DY1A 2V3CC 3WP1B 3FHTA 1E3MA 1YZUA 2EU8A 4HZIA 1NG9A 1G8GA 1LS1A 1CJKC 1JAHA 4PPQA 2W6IA 4BFWA 4B3XA 1Z0AA 2UVQA 3A1WA 4D0NA 2XTNA 4OI4A 5C1BA 1Q1EA 2OEPA 3KFXA 4BGDA 2ZRLA 5FPKA 1NVWQ 5L3SA 3CNLA 3U44A 1G291 4RSGA 2Z0MA 2JLSA 1E2HA 2QM7A 3FPAA 4LV5B 5FTJA 3ZIAD 1II9A 5FL7D 3SEAA 3EIQA 1NY6A 4CEHB 3E1SA 2WPDA 3AQ4A 5IF9A 1ODFA 2D7CA 3AF4A 1A4RA 3AVOA 2GXSA 3BXZA 1GDDA 3Q5DA 1UFQA 1SVSA 2VP0A 1H65A 2Z6VA 2IYQA 2ZRKA 4MYUA 2BDTA 4MGZR 3BIFA 4ZV4A 5A4JA 4IFBA 5LD2B 5K8TA 3I4LA 1KI7A 3H4MA 1VG8A 3EZ9A 4EQ6A 3RLFA 2O52A 5HE9A 3GJ7A 2QBYB 4RD4A 4LHZA 4IDQA 4F4IA 4D25A 1XMJA 1VHTA 1G4UR 2GEDA 5P21A 4G5OA 2FEOA 3LX5A 5FTNA 2QT0A 1UKYA 2GJAA 5E7MA 4QM7A 4BASA 1E6CA 1UBEA 2E9SA 2KBFA 3CX7A 2C5LA 4HDCA 3TR0A 2GNOA 3QF7A 3RS0A 3AGQA 3CF2A 1KO7A 2HYDA 3B1XA 3THYA 1E98A 4YMTA 2Q3HA 4NYIR 4U5XA 1YR7A 4OQFA 2YVUA 1E2PA 3MD0A 3WRXC 2FPMA 2R2AA 3I61A 2DFLA 2VTKA 4Q1EA 1JEDA 1ZCBA 2CDNA 3DO6A 1Q0UA 4D2IA 5CM8B 1N3BA 1LV7A 3BH7A 4KV9A 2HJGA 3TUIC 1D2EA 4QHTA 2IYSA 3ZIAA 4M21A 3WP0A 3DEFA 4M1OA 2NGRA 3MGCA 2ZRFA 1ZM4A 4A92A 1NSTA 2GJ8A 4DDWA 2OE2A 3UWKA 4D0GA 3BFKA 5E7IA 5JRZA 4CT5A 1S1MA 2BMFA 3U6BA 4N0DA 1W48A 2NO9A 2FWRA 2H5EA 2FSGA 1LTQA 1U99A 4JSTA 3FYHA 3CX8A 4I99A 4JL5A 3A37A 4Q47A 2D2EA 4W5JA 1XMIA 2R65A 2HXYA 3KTAB 3B7GA 3NHBA 4UJ3A 5JHHB 1U8ZA 1GRQA 2I1VB 3ASYA 4F91B 2ZU6A 4Q03A 5AJZA 1ZMXA 1P4SA 1NN1A 2OILA 2IX3A 4IVPA 1G3RA 1F2UA 4FMBB 3G0HA 3TIFA 3SS8A 3CR8A 3D31A 1Q3HA 5FTKA 2ZJ2A 4AURA 5J4KA 1R7RA 1HQCA 4IXNA 1YZGA 721PA 1E69A 3L0PA 4GSYA 1Z6GA 4MDFA 3OIVA 4M1SA 4Y0VA 4OL0A 2Z4RA 2WAXA 3AV0B 4JL8A 1ZU4A 2W83A 1TUIA 1Z29A 4DT1B 4KO8A 4C0BA 2EFGA 2F9LA 4EAQA 2ZRJA 4TYWA 1E0JA 1JI0A 3E70C 4UXIA 5JSZB 1A5TA 1P61B 4TTQA 3L0IB 3P32A 5J4HA 1XD2A 5LB2A 4N1AA 4OQXA 5J4VA 1G8HA 2CLDX 4DLTA 1J7KA 4JKIA 1ETUA 1W36B 1R2QA 4OHWA 2B8WA 1O3YA 4OQLA 4IDNA 4D4KA 4DIEA 2ZJ8A 2ZM5A 2QN6A 1GKIA 4EFNA 1QDEA 3T1VA 3TRFA 2BBWA 1NLZA 3T1OA 2NOAA 4IDOA 2NO6A 3AH8A 3ZQJA 1UPTA 3EIHA 2D3WA 2ORWA 2A5JA 2ZSAA 3I32A 4WW0A 1IN8A 2NO0A 3EPKA 2GXAA 3HR8A 4ASUA 2G77B 4JVLA 1G5PA 3MSXA 1SGWA 2WMOB 4LGMA 2WIBA 3ZVRA 5JHGB 3R9IA 4Q9HA 3QF4A 2ZR0A 4BECA 1VG1A 4JT2A 1R5BA 4N0EA 3EC1A 2A30A 4OHXA 4RD1A 3EARA 2V54A 2FN4A 5GJVC 1KOFA 1NIJA 2WSSA 1CJUC 3DOEA 4C9BA 3KQNA 4Q7MB 4C7OB 2AD1A 4WBSA 2ZPTX 2F6RA 4EPVA 4RD3A 5FR1A 1CRQA 2ATXA 4GRAA 3B1VA 4K8OA 5AUNB 2OO7A 1HY3A 3KJGA 4PC6A 3QF4B 3S1AA 1UKVY 2E1RA 4NHOA 2N1BA 2F1HA 5FPYA 1OH6A 1G4AE 2XJ9A 2IXGA 4Q66C 4BLTA 1CR4A 3IHLA 1N6PA 4B35A 1VMAA 1G9XA 1I4TD 2JEOA 1U2RA 3MWKA 1X3SA 2ZVPX 4KHZA 5D3MA 4LX0A 1OH5A 2O0KA 5FUWA 4IEEA 5HE8A 3H86A 2Z83A 5DGXA 1BYUA 4FCTA 1SHZA 4Q7LA 5C2JB 4HAZA 3IEVA 1C1YA 1ZD1A 1NJFA 3MWYW 1W7AA 2O8BA 2DHRA 2F43A 4QFMA 3CNOA 3JVUA 5HCNA 1EK0A 4XVUA 3PVSA 1G3MA 4RKEA 3VU9A 1W47A 5EE9A 3HU1A 2CLSA 1EX6A 2FSHA 1PLJA 1NBMD 2MSDB 4PZZA 4ARZB 5AJXA 4CDGA 2IYUA 1A82A 3NIBA 1XEXA 3DOFA 2GCNA 3IBGA 2H7VA 4LK2A 4B3FX 1N5JA 1EWQA 2D2FA 1F3OA 3PR1A 1KDRA 3LDAA 1DTSA 2F43B 1QHHB 4KCGA 3PCRB 3FMFA 3TUJC 4PPFA 4BE7B 1MR3F 5AR1A 3TBKA 5LDDC 1GRRA 4B73A 1XTSA 1D2MA 1ANKA 3I92A 4A2QA 2VP5A 2ZVQX 3MUFA 2O8EA 1Z0DA 1EFCA 2DFKB 4M0LA 1N6RA 1T5IA 4P33A 2QGZA 4BFYA 3ZDQA 2IYYA 1XTJA 2JJ8A 3GLFE 3RNLA 4ZDKA 1XF9A 2WWFA 3FE2A 5FOVA 2C77A 4F38A 4JLPA 4A0GA 3FHCB 1ZU5A 5C4GB 1XFAA 1N5KA 2IF2A 1XTRA 1U0JA 4EFMA 4QGAA 3ZS9A 1IN7A 3J81k 1W5SA 1Q21A 1Z47A 2ZJYA 5JLJA 4JBWA 1P75A 4KYIB 2OCYC 1BIFA 4QG7A 4IRUB 2N46A 2RGNC 1J8YF 4MKHA 4RZXA 3B82A 1UADA 1ZM2A 3X1ZA 1QHNA 1XTQA 2WV9A 3L43A 2IWRA 4UQOA 2HT6A 2ODNA 3KJEA 4LJ6A 5JWRA 3U4QB 2RGBA 1T0JB 1KY3A 3B1WA 2XXAB 2JJ2D 4RZUA 4HSEA 3HDTA 3JVVA 1W46A 3EASA 2YV5A 2ZETA 4ZI2A 3GEIA 1T4GA 1JXOA 1COWD 4LC0A 2FMXA 2NQ2C 3I72A 3B9QA 4IEIA 3D6TB 1PLKA 1UJ2A 2ORIA 3GFTA 5DLQC 4HLQB 3RRYA 2XAUA 3NDPA 3FFAA 4G1UC 2BOVA 4ESVA 4LCBA 1WA5A 2DWQA 3OE7A 4ILEA 3F5FA 4V0NA 4EPXA 1KDPA 3AKCA 4Q9IA 4DLWA 3CO5A 3PITA 2AFHE 3MRSA 4KSBA 1Q3TA 2YZ2A 2OFOA 1PV4A 4LPKA 2W0MA 3KKQA 4L5BA 1NY5A 4XTCS 2XTMA 4ABYA 1RRCA 1LFDB 3FKSA 1J90A 2D74A 3IIJA 1ZNZA 2CCJA 4Q21A 1NVVR 5FTLA 1AN0A 3IIMA 2IHBA 1L4YA 1WE2A 2HXSA 3GLHE 4A8JA 1OKKD 1P73A 1Z3IX 4RCZA 4WA7A 4R2IA 4HB4A 4FW9A 5DI9A 4TYYA 3RS7A 1U9IC 1E1QD 3PG5A 4IVQA 4XWKA 4ZCMA 2ZE6A 3GLHA 3PJRA 3AGPA 1SVKA 2JASA 3PEYA 2BIFA 3TH5A 1EG7A 1ZRHA 4NYMR 1OB5A 1F2TB 4MGYR 5J47A 4RFSB 4GI7A 4POAA 2QAGB 2ZRMA 5AJYA 4X8HA 2WJHA 5JCZA 1TTTA 3U5ZB 2VYFA 1E9FA 2VA8A 5JJLA 4JT4A 5IRCD 2WWWA 3Q8XB 4JS0A 1TF5A 2J46A 5FOUA 4C3ZA 3B6EA 1BO6A 4ZKDA 1F2TA 1N2CE 5DO9A 2MMGA 2V6IA 2CBZA 1Q1ZA 4PC2A 4OI2A 4MUAA 3P27A 4PHTA 2W6JD 4LYFA 1CR0A 1KKLA 3CRQA 1H8ED 1XCMA 3D8BA 2PMKA 1OYYA 4PO1A 4YMUA 1GTVA 1AKEA 2GAAA 2PZFA 3AP3A 3MCAA 3LBNA 3LXRA 4B3CA 4Z8YA 1JR3D 4YMVA 1EFRD 1QG2A 3KUCA 5E7JA 1YZNA 1OHHD 1II0A 5G40A 1UM8A 2QRNA 3DMNA 1P9WA 4W7SA 2G6BA 4NPHA 5FOXA 3RRZA 2WJYA 2J0SA 2ZUBA 3K70C 5JJKA 1XD9A 1G8PA 1KO8A 1QHYA 1Z0FA 1X8LA 3MWJA 4HB2A 4RD0A 3AKYA 4P4UA 4DLYA 2IS1A 5F9FA 5EE0A 2RGDA 2WZQA 2ZJAA 2OCBA 2X2EA 1H8HD 2VRWA 4LYAA 5BXQC 4CF7A 3RRNA 1VCOA 5EP4A 1YZTA 4KVGA 1U90A 3BE4A 4Q1FA 1E2DA 4M4SA 2REBA 4P31A 1SXJA 2OM2A 4A6XA 4V0ME 5C46F 2GCOB 1SQ5A 3CX6A 3TAHA 2QSZA 4GFDA 4MA4A 1G7TA 1ZBDA 2R6AA 2GA8A 2VHUA 3TSWA 4EPTA 4GZLA 1GL7A 3TW4A 1RYFA 5G41A 2GTPA 1HQYE 4B3DA 3N2IA 5L3QB 4V0MA 1E4YA 2W2VA 5EP3A 3U3RA 1NL3A 4DDTA 3CNNA 4BRWA 5CK5A 2I4IA 3Q85A 5CLLA 1G20E 4JBYA 4EPYA 2F3RA 2QAGA 4TMWA 3KKPA 3W8NA 4RFSA 4C0KA 1JQLB 3U44B 1P5ZB 1US8A 4HUTA 3TQCA 2G0NA 4DSUA 5IHPA 1AQYA 2BEJA 1KDOA 5H8WA 4O3MA 1TQ4A 4EKDA 1N0UA 4KBFA 1DAGA 4DC9A 1G16A 3FTQA 1CP2A 5FFMA 4ZIRA 2XTZA 2KSQA 2J5XA 2ERYA 4C7OA 1V5WA 2MSEB 4RCYA 4DVGA 1ESNA 1A2KC 1AJEA 4Q4JB 2UKDA 5G53C 2UZ3A 3C41J 4UNPA 3CIOA 3GJ0A 1CR1A 3T5GA 1DAHA 3AVWA 4UKDA 2J59A 4JLMA 1SKYE 2WMNB 4D82A 5DI3A 2JIZD 4BLOA 1DBSA 2NO1A 2CE2X 2OUKA 4PAMA 2YINC 1M6NA 4TLAA 3A1TA 3EA0A 4OK6A 4NBSA 2HUPA 3PIRA 3VHLB 1XPRA 3VKWA 1Z6XA 4M8NE 2QBYA 5TMPA 2K5UA 4MGKR 4EQ6B 4ZO4A 5JS7A 1FTSA 2WOJA 2VH5R 5BN4A 2NPFA 4GZMA 4K46A 2Q9CA 4D4LA 3VQTA 5KYKA 1RKBA 1DG1G 1IONA 1OT3A 3EWSA 3ZS8A 5L3VA 1M7BA 2JLRA 4LBYA 4TL7A 3T34A 3KQKA 1WF3A 1IXRC 2EVWX 2ZI7A 2C03A 3SZRA 2IHYA 3T06B 2AFIE 2QU8A 3WYAA 3KUDA 1W5TA 2VHQA 2J7PA 3T61A 2PLRA 1LF5A 1MO5A 2QTFA 1S9DA 2W58A 4FMCF 2WM9B 3PXGA 1OFUX 5FUVA 4C0LA 3QBVA 4XWAA 4I1OA 4P4TA 1G21E 2FFBA 4RFVA 3H1TA 2QMUA 4PAOA 1BKDR 2H57A 3RS2A 1KI6A 3NBYC 4OQMA 1W0JA 3OF5A 2GK6A 3A4NA 4F92B 4IOJA 1EFUA 4NONA 5K8LA 2C95A 4M1YA 3AF3A 3U3JA 1SXJE 3KKMA 1K8RA 1A1VA 3SBEA 1L8QA 2JLVA 4RVCA 2IWHA 4V03A 3VKGA 3FWYA 3RS5A 1FUUA 4LJAA 4M1KA 4NU0A 1H8HA 1OLOA 4B2IA 3R8CA 2F9MA 3GJ4A 4Q9JA 3ZQ6A 3LQQA 2ODWA 4IW3B 2O8CA 2JDIA 4IDPA 1AZTA 2B7CA 2WOOA 4B75A 4JVNA 2C9OA 1T8UA 1SHKA 1WCV1 1LNZA 3K0EA 4AG5A 4UNNA 1UBGA 5AJVB 2GZAA 1P2SA 3I73A 2ZYWX 2ZE5A 3GEEA 4PZLA 4R2HA 4YONB 1P62B 4ASUD 4M22A 1GNQA 4QXAA 1OW3B 1TMKA 4A2PA 3AB3A 2QT1A 4XSHA 3TKLA 1R0WA 3GLFB 3M4YA 5FBVB 1N5LA 3S1AB 3TSZA 1DE0A 6Q21A 4CEJA 2V9PA 4IOKA 2XB2A 2J7PD 1KI8A 1XDBA 4QBIA 1AKYA 1UKZA 2IBMA 1S3GA 5KPDA 3CM0A 3ND9A 2GHIA 5TVKA 4FWIB 4PQRA 4GP7A 3UMSA 1AGPA 1DOAA 1XJCA 3CB4A 3PUXA 2MSCB 3CUEF 4DLUA 2EYQA 4OI1A 1AIPA 2OV2A 5B30A 2BMJA 4N3NA 4E5UA 5A0FA 1KK1A 2P0EA 1B23P 2ZR7A 1KSJA 2EFEB 3QVUA 3R7WB 4Q9LA 2BC9A 5CIWA 4CW7A 3WY9A 1XXHB 3OIWA 3QI2A 4MUBA 2BEKA 2A9KA 1KI1A 3NHAA 4W5HA 2EWVA 1MRNA 5FBRB 2JJ2A 1XTIA 4UXJA 1DAMA 4V0LA 1XBTA 1HT1E 3SJBA 5KUTA 3SBDA 2PX3A 2GEVA 2XGJA 1VTKA 3VR5A 3ADDA 1VHLA 4DB4A 3VR1A 2ZYVX 3CZPA 2BKEA 1SKQA 4XH9B 2ZRCA 5TXGA 1XXHA 3OHMA 1DAEA 5JBQA 4PX9A 3EZ2A 5BYKA 4OHYA 1I4LD 5CLQA 5GVSA 1D9XA 2F1IA 3GPLA 1JALA 4JLKA 5DYGA 2BBOA 4C30A 2DB3A 1QF9A 8OHMA 1LY1A 5FL3A 3REFA 3SHFA 2YOFA 2YOHA 1ZM3A 1S4QA 4FWTA 2FU5C 3EW9A 1VKJA 3F8TA 4PHFA 4LWZA 4RZ2A 1U0HC 1NJGA 2WSMA 1GSIA 1M2OB 2HLDA 2KJQA 3IHWA 3W34A 1JR6A 3ETLA 4G3XA 4BWYA 1VYTA 4UNQA 4LC1A 3IQWA 4A6PA 1SZPA 4PHHA 1GWNA 3LAWA 2ZREA 4FXPA 5GVRA 2DCUA 2Q3MA 1YZQA 5JCPA 3GJ8A 4LUCA 1IN4A 2IYZA 5GJWC 4LYHA 5KSOA 2CLCX 4MRPA 3VX4A 4JVSB 1US8B 3CONA 4U02A 3FVQA 3CWZA 2DPXA 4TMZA 3U7EB 1GIAA 3GJ6A 2NO7A 4JYBA 1DS6A 2GESA 1KI9A 2VPPA 1KNXA 4BFZA 1E2IA 1NKSA 5FPTA 3GLHB 3SU8A 3U60B 4BFTA 2O8BB 2ZRBA 2IYXA 4BFXA 2NZJA 4M2LA 1HH4A 3SHWA 3WMFA 2O0JA 4TSFA 1CF4A 2ATVA 4D26A 1KAGA 1TQDA 2ZEJA 4Q19A 5EZ5A 3VTKA 4US2R 1EFRA 4DZZA 1GG2A 2ZROA 3ONWA 2GK7A 4O25A 3UXMA 5KDLA 1U0LA 5EXPA 4DT1A 4A15A 2YKGA 1S0UA 2ZAOA 2V7QD 2V1UA 3SYNA 2VHTA 3BFXA 1YRBA 3UMRA 4GMDA 1GUAA 4KFTA 4KLZA 3TE6A 5KSZA 1Z63A 2CJWA 1DG3A 5EUMA 1D2NA 1X1SA 1LF0A 1E2FA 3VR6A 2ZSDA 1R5NA 1E0AA 1QHIA 2KE5A 1RRGA 1CTQA 3U6KA 1RRPA 2QG6A 3QXSA 4Q7KA 3QY0A 1CS4C 4U00A 3CBQA 1E9DA 4LV6A 4PO9A 2AWNA 4K81B 4OK3A 2WWHA 4Q4HB 2R6DA 5EXTA 4A0HA 4AWXA 1MO4A 3V4FA 3DMDA 4PC7A 5EXSA 4PANA 5JWHA 2ZI5A 2ANCA 3AKDA 1W0JD 2Q0HA 2WJJA 2DR3A 1G5TA 3IIKA 4B43A 2FSFA 3CW2A 1SVLA 4DSOA 5DHAA 5F3WB 3IBYA 1AA9A 3CRW1 3ADBA 1EX7A 2X77A 2J0QA 3DPUA 2IEZA 4B44A 4OI0A 5DH9A 2A5DA 4BZPA 3RABA 1JBKA 4PHGA 4B6EA 1JPJA 221PA 2C04A 3ICEA 4CRWB 1P7CA 4I1VA 4TT3D 3R9WA 1S8FA 4R9UC 4DUGD 3SI7A 3BAFA 5HTKA 5JI3E 1KK2A 2DBYA 1FW6A 4P3YA 4TLCA 4L8GA 4OYHA 1AS0A 2VBCA 3CRVA 3SN6A 3K9LA 4RD2A 2WKPA 1XCGB 3Q7PA 4YMWA 2IXFA 1N6HA 4YDHB 1QBKC 5HKKA 1R6BX 2GJSA 2B7BA 3JZAA 4HDOB 1TEXA 4B71A 1Z0IA 1E2MA 3B78A 1Z07A 1OIWA 5B2ZA 2QMHA 1RC8A 4EIWA 1AQUA 3RDPA 1QG4A 4LYJA 3K0SA 4FD2A 4BLPA 1S3SA 2JLQA 3CRRA 4HAXA 2ZU0C 3QIAA 2LWIA 4M1MA 2RMKA 5FUYA 2IYTA 4WVFA 4MDEA 3FB4A 4OJKA 1XNJA 1Z22A 4NYMQ 4KI0A 3W6PA 3ZZTA 2OXCA 1F6BA 4JLDA 3C7KA 1ZP6A 3THWB 3NEJA 3ADCA 4GMXA 2CL6X 1U98A 1CJTC 2C2HA 2CMKA 2Q21A 2SHKA 4HI0E 3T1QA 3VHXA 4EJSA 4TL8A 1ZYUA 4R7ZA 5KSPA 2VP2A 5JEDA 2IYRA 3EZ7A 4G5GA 4HAWA 5CDFE 3SOPA 1Z83A 4QHYA 4EPWA 4AC9A 2QP4A 4YLGA 2V1XA 4TQAA 1KSHA 4BZQA 2QE7D 4LZZA 3QKSB 5EE3A 4EFLA 2JLXA 2QNRA 3WYFA 1YVDA 3B9PA 4MKGA 2GCOA 2H8KA 1QVRA 1G18A 3WMEA 3V4RA 4I4LA 3BOSA 2WWXA 2QSYA 3Q9LA 1G8FA 1E0KA 4A1FA 1GVNB 1GRNA 2CCKA 2JDID 3GP8A 3IGFA 2PT7A 4LHVA 4AG6A 4LY6A 2FGJA 3EWAA 5FBQB 4ZCIA 4W5WA 1G6OA 2EFHB 4Q4AB 3TSOA 4BPBA 1EESA 4MH0R 2I1QA 2RGCA 2BBTA 3PUYA 4DWJA 4HZUA 2XITA 2FFHA 3BB1A 1W0KD 3BWDD 1W4RA 1L2TA 4M9QA 1OH8A 2QA5A 3QKRB 3GEHA 2FPLA 2ECKA 2BHRA 2P2LA 3CZQA 4HLUA 2FGKA 3ZZUA 3BERA 2EFDB 3OIUA 1NVVQ 1XJQA 1WB9A 1C4OA 1I2MA 4DCSA 2PJRA 3O8DA 2JAQA 4PC3A 2EYUA 2VIIA 2QY9A 5FOTA 5SZJA 1SVOA 4WZBE 3IPXA 4US1R 3K09A 2D06A 2UZIR 1D8TA 4NMMA 4YQFA 1KMHB 1UBFA 2P6NA 2W6JA 3A4MA 2XZLA 2IA5A 1NLFA 4V0KA 1IXSB 2ZJZA 3UG7A 4NCNA 1GM5A 2ZI3A 1G7CA 1QHHA 3O47A 2P3SA 2DYKA 1SVWA 1ZUHA 3FOZA 3MLEA 1FUKA 3UK6A 2A78A 2GXQA 4IHQA 3EIEA 1XD2B 1IM2A 1WDTA 3T35A 4ZDWA 2CK3D 4FCVA 2W0SA 4KXFB 4Q7JB 2D4HA 3QG5A 1KNQA 2WKRA 5UKDA 3VR4A 3BD9A 3QPWA 2BM0A 1T6NA 3O8BA 3W5JA 2GZDA 3SQWA 3ZD6A 2IUSA 4KJZA 2FH5B 4JL6A 3C8UA 2AXNA 2PT5A 3NWJA 5SZKB 4C2TA 1E32A 5F9HA 4U7DA 5G3YA 4TLEA 2ODEA 4TQ9A 3LXXA 5TY0A 4WIAA 1OFTA 3AF0A 2J3EA 5H70A 1P6XA 4F4CA 1T3SA 1Z0JA 4JLAA 1NG1A 5JMTA 1QHXA 2AHOA 2QORA 3LW8A 4BQSA 1RRFA 1Z06A 3AP2A 1NRJB 3ZVLA 2QENA 3FKSD 4TN1A 2WIAA 4QBGB 4TMVA 5CYOA 1CEEA 3PUWA 2EQBA 4GDFA 1XPUA 1Q1BA 1SXJC 1XEWX 1ZIPA 3U3MA 4JLVA 2F7SA 2R44A 3BBPA 4QHSA 1MRSA 4XTRA 4QBFA 3B2EA 2REOA 4QOSA 5L8VA 1OFIA 3LLMA 2P5TB 3QJYA 1MOZA 2J0UA 3OZXA 2C98A 2GEUA 3K53A 1MO6A 1ONBA 4LV8B 2FJUA 3SJZA 2AN9A 4XSGA 1NN5A 5GJBA 1UEJA 1IN5A 2J87A 2ZS8A 2JLYA 4JLNA 1UDXA 1MT0A 2ZXUA 3R8FA 4H1VA 4E07A 1ELOA 3LVRE 4IDHA 3GLFA 421PA 5JJIA 1W0KA 4IOLA 1IY1A 2YWFA 4QNMA 4JZKA 2PLFA 2LCFA 1GZSA 1GKUB 4OHZA 3VFDA 1E9RA 2FZ4A 3KQUA 4GNKA 3QVVA 1Z2CA 4TYQA 1N6LA 2IYWA 1II8A 2BWJA 3T1TA 2AKYA 1FX0B 1KIMA 1Q12A 2W6ID 2Z43A 5JZVA 5KHOC 3KZ1E 5J5CA 1ZIOA 3RS4A 1KY2A 1MKYA 1M74A 2LKCA 4JYCA 3C4JA 4DUGA 5SZIA 1IJEA 5IK2A 3TNFA 3QE0A 2OCPA 4B74A 1F48A 2PMDA 3W3ZB 2V8OA 4LJ4A 3HPQA 1TX4B 2ONJA 4HEJA 2B21A 3RC3A 1TNDA 3QKUA 1UDWA 5JSZA 5KDOA 1X86B 2QI9C 3L8ZA 4WZAE 4HUQA 1PUIA 1LVGA 3BC1A 4AKEA 1K5DA 4URXR 2B8TA 5AUQA 3SFZA 1G3IA 2F1RA 3SYLA 1E2LA 3LBHA 3LV8A 3BS4A 2RHMA 3LA6A 4YXWA 3TUZC 4AKIA 4Q18A 4DLSA 2R6GA 2O0HA 3ECCA 2O8FA 2JLWA 2P5SA 2A5FA 5M04A 2HV8A 3GLGA 1U9IA 1PJRA 2RCNA 1KTVA 4KYUA 1W36C 3IPYA 4XOIA 2BM1A 1Q20A 4M9ZA 1SXJD 3KXLA 2C96A 3DVLA 4B2LA 4HB3A 4MYCA 4GP6A 4ARZA 2RKOA 1CLUA 1E1RA 2FDCA 1T8TA 2IS2A 4DKXA 3WMGA 1YKSA 4MRRA 4DSNA 3QXJA 1CJVC 2A2ZA 1RPZA 3D7MA 5JRJA 3IO3A 4Q5IA 2NMVA 3KTAA 4TYNA 1E79A 1Z6TA 3KJHA 2VQSA 1E9EA 4GOXA 1FQJA 1JXMA 1PZNA 1A2BA 2NG1A 1W2GA 1T3HA 5HCIA 2MMCA 3TMKA 4I1SA 4OQNA 1KMHA 3BJIC 3KB2A 3NH6A 4UXHA 4DJTA 1YJ5A 2X1VA 4Q4LA 5DNYB 3I62A 4NZYA 1ZNWA 1JPNA 5EP1A 5TV2A 1KSGA 3LW7A 4CVNA 1JR3A 2NPIA 4ACBA 5CJ2A 3AF1A 1Z5ZA 1Z0KA 3HU3A 3AVXA 2ERXA 3U3OA 3CPJB 3PENA 4LSGA 4Q00A 2CE7A 2YWEA 2FFAA 1KHTA 3LO5A 1OH7A 1II8B 4QGGA 3A1VA 4TMKA 2KWIA 1X6VA 2QRZA 3Q5EA 1GILA 3WBJA 4BFVA 2CL0X 1FTNA 2WKQA 2ZI6A 3IILA 3GJ5A 1ZW6A 1COWA 1F2UB 4DCUA 3G82C 3N5CA 1NMZA 3KFVA 2PJZA 4URYR 4M9XA 5KTYA 3K8YA 4Q1DA 1VECA 2QMOA 1ZNXA 5D3QA 2FZLA 5TB5A 1CBUA 4WOPA 1W44A 5FL7A 3T15A 1NIPA 4UNRA 4XJXA 4MKIA 1X1RA 1JECA 3OFNA 2VF8A 3KXIA 1SKYB 1KI4A 1DAIA 2OXRA 2ONKA 1XP8A 2BBSA 4NCKA 1U8AA 1G17A 2CHVA 4YXWD 3HR7A 2CCGA 1Y63A 5F98A 3DM5A 2IL1A 1N6NA 1WBDA 3TR5A 2EFCB 3QUSA 5DHFA 1TUEA 2JJ1A 3KB1A 1VG9B 1P60A 5ANRB 3VR3A 1FL9A 3ZZ0A 1EGAA 5TDHA 3RWMB 4S2EA 2WJGA 3K9NA 3SQXA 3PV0A 2Y8EA 1Q1QA 4E22A 4AY2A 3EPHA 5CB8A 4BFUA 1G41A 1Q22A 1XMSA 3L82B 4QRHA 3QKRA 4PTLA 4GOJA 3B13B 1R10A 3GJXC 5DN6D 2F1JA 1KK3A 3R20A 1KMQA 4G5RA 1R8SA 2ZTSA 4CYMA 3OE7D 3PQCA 5FI0B 1XB2A 3DDCA 4B76A 3MMPA 5G3ZA 4QJ3A 4FN5A 3QSYA 1JB1A 3NG1A 4C0QC 4ZDJA 5F2EA 3ZGXA 1RE0A 3W3AA 4AYXA 5BW8A 1E1RD 2GBLC 3F0TA 4D80A 3AUXA 4EPRA 1OXUA 5FR2A 3TGPA 5KO2A 3L8YA 2QPAA 5E3HA 1AZSC 4C0SA 4BEBA 1A7JA 4DLVA 2IT1A 2I3BA 4A0FA 4Q4AA 4LJ7A 3VNVA 1NBMA 1GOTA 2ZR9A 3AVPA 4DCNA 1ZC4A 3QKTA 4IJMA 4ZCLA 1XMVA 2PX0A 3KDSE 3THXA 1I4DD 2G1KA 4JLBA 4KFSA 3MJHA 1YHNA 4TL6A 3SJAA 2DWPA 5KDDA 3IDQA 5AJWA 5FTMA 4D81A 1P9RA 1W4CA 4LHYA 5J40A 1NSFA 4Q01A 3RVBA 1NN0A 2FFQA 2IF0A 2O5VA 4P4SB 4ZPXA 2OBLA 5B58C 3PUVA 4DIDA 4O2RA 1J99A 1L7VC 2QP3A 1NF3A 1VG0B 2GJKA 2PBRA 2YHSA 1BMFA 1J2JA 2GKSA 3L0OA 4LDJA 5AK0A 3RANA 1XEWY 5C4MA 1D9ZA 2D7DA 3W6OA 3CKLA 4A4DA 1G1MA 3QXCA 4CT4B 4B32A 2OAP1 1XCPA 2ANBA 1NVXQ 1FFHA 3OAAA 4GL2A 2ZS9A 2ZYUX 3MG9A 3ICQB 5H68A 121PA 2GBLA 3THYB 4G01B 4TL9A 2VO1A 2B6HA 3TW8B 2XJ4A 3FMOB 1IY0A 1KJYA 4HLDA 4Q48A 5TARA 1W36D 4TTPA 1R0YA 2ZRGA 4A8JB 3NDBB 3EAQA 2H92A 1X8KA 3LY5A 2VHCA 1XWIA 1IHUA 2KBEA 1ZM7A 2YWHA 4PSKA 4XWOA 3K9GA 1TL7C 2QPOA 4PC1A 1L4UA 1T0HB 2R62A 4GPTA 3WHKA 1DEKA 1YR8A 4B3GA 2C8VA 3TLXA 2QPTA 1G6HA 2ZE8A 2ZSBA 2ASEA 4EDHA 4C0HA 4AYWA 4PAQA 2HEIA 1IJFA 3A8TA 4DDUA 1KJWA 1D5CA 2G83A 5L3QA 3U4QA 2IUTA 4JMPA 4URWR 4KFUA 2XXAA 1IQPA 3CPEA 3E2IA 3PUZA 1WBBA 2X19A 5EUQB 4D0LB 3LX8A 1Z8FA 3QBTA 4G5SA 4HAYA 3CPHA 3FKQA 1RYHA 4JVMA 5BN3A 4GBMA 3QG1A 2GILA 2AK2A 3RAPR 3JZMA 3QOFA 4GOKA 3VMFA 5BWMA 2IW3A 5DISB 3OAAD 1Y3AA 2JLZA 4OHVA 1MABA 2HT1A 4UNSA 3RHFA 4BLSA 3Q3JB 2J0VA 5LB4A 3K1JA 1R4AA 3B60A 2NZ8A 1Q44A 4HAUA 4TWZA 2QL6A 2CJWB 4QL3A 4MKFA 2IK8A 2RH5A 3EG5A 1ZCAA 5K8IA 4HUQB 3EXAA 3AF2A 2PZEA 3ZH9B 2GXUA 4NH0A 2OLJA 2W2XA 3LBIA 3U7HB 2ZJBA 4YC7A 3GLGB 1KAOA 3BB4A 1QRAA 4R71A 2VP6A 3HYTA 2VLIA 1TU3A 3ZYCA 2WAYA 5KNDA 4EJSC 2HDNB 2CVFA 5A5GA 3X1XA 2WVJA 2RGXA 2C9CA 3TQFA 2W2TA 3N2EA 1QZXA 4PFSA 5CITA 4ESHA 2AD5A 4X8LA 1DVRA 2ZYTX 3ZLJA 3WYGA 1W4AA 4WAUA 1IY2A 3PEUA 4AYTA 1YRAA 4BUJA 2IYLD 2OESA 1DO2A 2GWHA 4PZYA 4BLQA 2VEDA 4CEIB 3A1UA 3Q72A 5BYJA 3P4YA 3NEYA 4QM6A 1G7RA 3ADKA 2EWWA 2OZEA 1FNMA 3K0AA 4MQBA 4OK5A 4E03A 1M7GA 5JI2E 1BH2A 3KL4A 3L2OB 1E94E 2XX3A 4HDQB 1V43A 4RKFA 2QTHA 3I3SR 1SULA 1E96A 2ZUDA 2VSOA 4DCTA 2G0TA 1TPZA 2FF7A 3OEED 5IT5A 5DN6A 4ZI3A 5DE3A 3W90A 3PEWA 4A36A 1U8YA 2IEYA 5H1YA 4CZ2A 1P2UA 3BK7A 3K0AB 2OHFA 4NP6A 1VIAA 4A2WA 2ZE7A 1XJ0A 2QZ4A 4MRVA 3AVUA 3K0FA 1RJ9B 2J9RA 1S2MA 1PVOA 3U3KA 4DLRA 2XZOA 2X2FA 2BVNA 4FCWA 5FBLB 2G88A 2RGGA 2A5GA 4NKRA 3UIEA 3VX3A 1EXMA 3OESA 2J45A 1OSNA 2BJVA 1RVDA 1W2HA 1RJ9A 2AXPA 1YU9A 3EZ6A 3NTUA 5JECA 4TZ0A 4B47A 3THOA 3WNDA 2GZHA 3K9HA 4M1WA 3DKVA 3GD7A 1B0UA 1Z08A 5FOSA 3UANA 4URUR 3GLIA 1FNNA 5E95A 5HZKA 3QEOA 3BORA 1IOZA 3UWOA 2ZRAA 3KQLA 3EPJA 1RIFA 3DM9B 4DEXA 1KO4A 1DO0A 1E2JA 2OBNA 2AWOA 1ZAKA 3CWQA
chains in the Genus database with same CATH superfamily
2B5VA 1XL1A 4X8OA 1FK8A 1HSZA 5JROA 3UW1A 2AIRA 2BDUA 4ZYXA 3ZKAA 1GNTA 4RTNA 3EA5A 3JAWB 3GMTA 1SKBA 2OVBA 2E89A 4FHDA 4LZJA 3WA7A 2PSJA 1FMLA 4HFMA 4KBGA 3AERA 1Y9ZA 2Q5CA 4ZODA 4AY5A 4MJ3A 4PSUA 5G4KB 1LXCA 1VDZA 3A9TA 2RIPA 4P0QB 4CMJA 2JAWA 1XD8A 3GLVA 3H2GA 4ZGGA 4EGJA 2NU7B 2R1VA 1LB1B 4U2GA 1PR1A 3QPDA 4U2CA 4ZIRB 3K0CA 2XMCA 1VZ3A 2A3RA 2X0KA 2XSZD 3G88A 1G3UA 4WVLA 4QRDA 5KYXA 3H84A 2YH2A 3GGJA 1MX5A 4J0QA 5JNTA 3DT6A 3JQ9A 5AOVA 3ZOZA 4GC9A 5C5IA 3FLAA 2F8SA 1ESMA 1PUXA 3DWIA 3UCXA 1CS0B 4F45A 1MW9X 4GL4A 3ZUGA 4OEHA 1T8SA 2VNIA 3DHWC 2LVBA 4R2KA 1LZKA 1O6ZA 2MTBA 3JZFA 4NARA 2UZ1B 3LRXA 3UATA 2ZBQA 2AN1A 1RM5A 2DQKA 3DEKA 2NXWA 1JT9A 2V0NA 2RFLA 3DDSA 4OKSA 2CEKA 4QZVA 4YP1A 2HSJA 1E2EA 1Y5IA 1GGVA 2VTEA 3RHZA 3MWLA 3ZWVA 3NXSA 2PGJA 3I1JA 1OI7A 4U7WA 1TF2A 4KAXA 1OUMA 4MB2A 4R1OA 5HZHA 1TGYA 3G6WA 1F5SA 3C7AA 5I7UA 4P3NA 5ERXA 1J5EB 2BKUA 2VA9A 2BCJQ 1Z73A 5JMWA 2X8WA 3RU2A 5TGZA 1WP9A 1YXMA 4UBKA 1N3LA 3IDFA 1X1TA 4BNLA 1NX9A 4EJMA 5JPIA 3GJRA 3HN6A 2GCGA 4NFLA 5KSYA 2IVFA 2AE1A 1G4HA 2AXEA 3RODA 2I2FA 2UYQA 1BGXT 4MWEA 3VTFA 1OXVA 3UJ6A 1E63A 4WNIA 3TIVA 4BPRA 1DAPA 1UFRA 4LOLA 2JGDB 1O58A 4P53A 4DJ5X 4I5GA 5CNJA 1SU8A 4UAUA 1JH9A 1SJ9A 2A58A 2DMRA 2GETA 3T7TA 5I01A 3WSTA 2CXXA 2C2ZA 1GAEO 1EDZA 1U2ZA 1Z6PA 3X1DA 1F7VA 4IFEA 3FWNA 4K40A 1TM4E 1GL9B 4GT1A 4O2AB 4FEAA 4LYYA 3PTLA 5CDFA 1WQ1R 1T24A 5JUWA 1C2YA 2IIQA 1C1HA 2ZSJA 3FHOA 4HQLA 4X1IA 3ZCQA 2F3SA 3NHSA 3R0VA 3A25A 3PCXA 3JPWA 3NKVA 3UGKA 5LMNB 1EFTA 2JGNA 3BB3A 3UY4A 2OV8A 4E5SA 5JTUA 3OECA 4KN8A 1Y81A 2LKDA 4OG2A 1NLYA 1A4XA 2PU5A 3EH1A 4NOJA 4B9EA 5K6RA 3CSUA 2PD6A 3HPRA 4GGMX 5HPYB 3U4DA 4CV3A 3EVEA 1U6KA 1G8YA 1YS2X 4ATNA 3MTIA 3PJEA 4QNNA 2P2YA 4RWEA 1FF9A 3WHLA 3P9ZA 5CPFA 4KU4A 1MAUA 4PO8A 3E4DA 2HPHA 3WXMA 4AIIA 3WWCA 5B12A 3ZDDA 3I8SA 1GT6A 4LBWA 4CIXA 3FNEA 1XDGA 2HYIC 4DPMA 2QMZA 1KEEB 1K8XB 2NX2A 2WWIA 3HV2A 1AKUA 4BFSA 4I6EA 5ALRA 3KCQA 4P08A 2JI4A 4F11A 1PX0A 1SWVA 1BROA 3FGOA 3QI7A 3HCAA 2ECOA 2O5CA 4E5VA 1CUJA 1A5SB 2N42A 4HAVA 5SV2A 2IS6A 5GM1A 1KQPA 1YIDA 2NTVA 1NXQA 4CDMA 4QKQA 4JI2B 4PR3A 1XTZA 4LHWA 3WGGA 3WWEA 1E92A 2EKQA 2VYND 5HXAA 1MGPA 2H6EA 3H2YA 3KJZA 1HE8B 3P5SA 4GYWA 1YR2A 2OC4A 2G25A 2J4CA 1XLVA 4OU5A 4ER5A 4Z54A 1P31A 1J24A 2GTHA 3G1UA 4M46A 2BMDA 4NLLA 5B5SA 4OFZA 5JAUA 3DO5A 1OMOA 3Q6MA 1VJDA 1MHPA 3DR5A 2FG5A 2WBLC 1L6RA 1SCUA 1QV6A 3U17A 1M2NA 1ZHHA 4UU7A 3HABA 1HOXA 3QE9Y 2WEKA 4IGFA 3AP1A 4JR1A 4ODIA 4US0R 2DE0X 1XAIA 2CXQA 3GMIA 4FI3F 1UF9A 4PG5A 3WOVA 4JC5A 3NYWA 2ATEA 5BUZA 2RE8A 4QFDA 3AESA 1ZSNA 3DKKA 1I01A 3EC7A 5HTOA 4K6HA 4IZIA 3HKEA 2BMEA 1RC0A 1BHQ1 1P1IA 3NOOA 4NBUA 1ZJ6A 3TDKA 4WECA 3E1KA 1EGQA 3UWMA 1X94A 4HYYA 4JU9A 3QRWA 4WFKA 5B3JA 4CCSA 1JMVA 4LJ8A 1HFWA 1A88A 2O3QA 5K51A 4TS4A 2HSWA 2NVWA 1N1DA 1T1JA 2C07A 4OJQA 4YRQA 3P4XA 4E21A 5LQMA 1W1WA 4NU5A 3FZQA 3OPNA 4BMNA 3B1YA 3G0OA 3V3TA 5AVOA 4WNAA 1NRWA 2H31A 2CUZA 4XIGS 2P8SA 3DLCA 4ARCA 1P0CA 4X8MA 5LSAA 4HB0A 1DELA 3HUUA 3LGSA 4QBHA 2O8DA 2XB4A 5DXFA 1CIVA 2I55A 3FOCA 2YBDA 1K3UB 4U7JA 4QVIA 5E2IA 2EJBA 2XVAA 2QTNA 3D2AA 1HNWB 5HW0A 1WV1A 1VOTA 5IANA 4B7UA 3RAFC 3KR9A 2WAAA 3DNFA 4W8GA 4G4GA 1HZJA 2FEMA 4CF5A 3GDFA 1CLEA 2X23A 4D3ZA 3A9UA 4EY7A 3L5KA 1EA5A 1JEQB 1VLZA 4F7DA 5C18A 1GGKA 1ACJA 2PL3A 1SUFA 3A04A 4MSUA 4ZDIA 2V0GA 1U4OA 2I2AA 1AK2A 2I87A 1ZITA 3HCNA 4EO4A 1B8PA 2PBZA 2QTMA 2WWGA 2YMMA 2YY7A 2Z5VA 4K1XA 2FZGA 4GPIB 2VN8A 3P20A 2FF5A 4QO7A 4ZOAA 4EY6A 2RH9B 2I67A 1C9KA 1G2QA 1VFPA 5LU9A 4EATA 1K6MA 1Q50A 3VZBA 4C2UA 4A8TA 4YPFA 1XX6A 4E09A 5EWJB 4JFRA 4KL8S 2CV0A 4WCVA 2C9YA 5IJ0B 2Q9UA 1I8TA 2OLEA 1E79D 3R1IA 2TMYA 5EJ2A 4CMIB 4Z4HA 3V8RA 3QEMA 4V02A 1BC5A 1QQBA 1TLFA 3P9SA 2I54A 4FFNA 5IJAA 3MQ4A 3SYKA 3WFJA 2YV4A 2HQOA 3UMCA 2AK3A 3HFRA 4MVJF 2FE1A 4XVRA 5JLAA 4CKXA 1F7UA 1UZUA 3P1JA 1YNSA 1UAYA 4F7WA 2YJTD 4RPKA 5LIPA 1HMYA 3QSGA 3VKHA 2Q9AA 4LEIA 3QXXA 1WUHS 1Z4LA 2Q3JA 1FP6A 3AR3A 5FBWB 1GCAA 4HNQA 1TYEB 1KH3A 4GLJA 3G5UA 2D62A 2PCLA 5FUXA 2FN3A 4C7JA 5T4FA 3N70A 1Y82A 3UGTA 2XOKD 4DADA 4L8LA 4ON9A 1GJRA 1PNQA 2OV6A 1FFXB 1QZZA 2QAGC 3L7BA 4M9SA 1FOEB 1MB3A 3WKCA 2FXVA 2I22A 2X0IA 5DTEA 3FZGA 5IJWA 3OKFA 4PZAA 4LBZA 3TQQA 4ANFA 4ZICA 4ZK2A 2G07A 1DJLA 1DQZA 1TQ8A 2L17A 4ZARA 1KC3A 3IQXA 4F8EA 4WXRA 3TJZA 3CVYA 2O8FB 1DAFA 5FH9A 3RTAA 3BQ9A 3GW8A 3PUJA 4EMSA 2H7XA 4ID9A 3LWNA 1FYVA 2Z9CA 3QKIA 3I1IA 3W4IA 1DPFA 1XMPA 1AB5A 2Q6VA 3BGWA 3TTTA 2O59A 1T2CA 3M0EA 1GAJA 2OC9A 4Y6QA 4DF3A 1D2AA 5AI6A 4NNOA 3ZEAA 1V71A 3RVJA 3IIEA 3WQSB 2YS6A 4A0QA 1C41A 2JJMA 1F6WA 1USUA 1NVDA 3A1EA 1E6LA 3GGPA 3U7FB 1EG2A 1R0SA 4ZCRA 2XYVA 4LHEA 4D6PA 1BTOA 2G9NA 2XRYA 1SELA 3DMYA 1Z4NA 3PUKA 1V96A 2IOFK 3E2MA 3H6KA 3LFUA 1O6GA 2ID7A 3W7AA 2ILTA 2IUUA 3AEZA 3TZKA 1TU4A 3SNKA 3KC2A 3KJIA 3UB2A 3W5UA 5ITSA 3COPA 2FPIA 4I46A 4G0NA 2D00A 2Z4SA 4DGQA 4KQKA 5HNKA 1EVQA 2DHQA 2P6UA 3HP1A 1AKWA 1IVSA 3DYBA 5BN5B 2EZ4A 1C5KA 1EDBA 1XZNA 1R0XA 3AT1A 2FK8A 3BMOB 1S2DA 3MW8A 4HF7A 4Y30A 4ZAGA 4C1BA 5BSFA 3R76A 4B80A 1PHRA 4KQCA 4WCFA 1RSZA 4RYLA 3LUPA 4OCZA 5AW0A 3VI4B 4TZ6A 1RT9A 1EBUA 4QU5A 1IB0A 3V5NA 2DQ4A 2XWSA 4JBGA 1QWSA 3NM5A 2GO1A 3P96A 2PL1A 2VP9A 3AKEA 5H7XA 4P7GA 2BEWA 4FFOA 1J09A 1EQ2A 4TSRA 1JPVA 2HL6A 1L8XA 1P2TA 1OYWA 2QW8A 4QECA 3UJ3X 3W8RA 4B34A 4MGEA 3UPUA 1OIVA 1EFLA 5KNDD 2P9ZA 3NPMA 4JJKA 4RENA 3ASZA 2G5PA 5DGTA 5KX5F 1CUYA 2ZUCA 4K6CA 3QLUC 3SLGA 4E12A 1NBIA 1VJ0A 1LZLA 2EBHX 4ETNA 4RPCA 3KEFA 4JQOA 2MU1A 4ENTA 3VSAA 4AF7A 1HE1C 1L5OA 1Y6QA 1UBOS 1DADA 3NETA 1UZAA 2DKFA 3PLRA 4KO4S 3E18A 4L4ZA 1FX0A 1QYDA 5EPEA 2BELA 3LWDA 5H3LA 1R6TA 5EXXA 2YHIB 2BCGY 3VHQA 3G68A 1QGAA 4J8PA 2GHQA 4FSDA 3HI6A 3GZTB 5CIQA 4E6PA 8GPBA 4IH9A 1HYQA 4HATA 2AC7A 3SFVA 3FFBA 2XUHA 3NI2A 3PGJA 3NDRA 2UZAA 4J16A 4F46A 1XTTA 2J5KA 4B48A 1F9AA 2XR1A 3ILYA 2Q6KA 1ZG3A 4HY3A 5GGXA 1UH5A 2GERA 5DVZA 1SD1A 2O7VA 4HGOA 3TLMA 3E8SA 4B5LA 1RFGE 3H1GA 4QYSA 4DRZA 4JD5A 2ACKA 1LLQA 4OGKA 1NSYA 3KZMA 4LOAA 1XEXB 5EE5B 2OBYA 2TMKA 5E9JA 3ZCPA 3HM9A 1KO1A 3S70A 1BHO1 5KJ6A 3HZHA 1OHHA 2AFIA 1E2KA 2GCIA 1N8SA 521PA 1TQ6A 1GUYA 1A77A 3SC3A 3VV2A 4COKA 4ZQBA 3OFSA 2QEQA 3Q7QA 1I3CA 2QROA 3LVQE 2CZGA 5IJ9A 3QXHA 1X7ZA 2P1ZA 2G5TA 2O1WA 1CJSA 5BW4A 4IO0A 4CBVA 3ZUPA 4H3KB 3BH6A 1QO0D 2XQKA 4CLEA 3CLTD 2F8TA 3PA6A 3QOXA 1GTZA 3CSSA 1JA9A 1TK3A 2GDJA 3GQBA 2ODAA 4BEJA 5CDTA 4FYPA 4UUPA 3NLLA 1KI3A 4XCVA 4NFYA 4Y6OA 4N47A 1CY8A 2F62A 4MYHA 4AF6A 4IS3A 3ANYB 2CUNA 4IL5A 3QWIA 3QWAA 3GPBA 3MTJA 1YU6A 4QQFA 1R88A 5DHRA 4B6FA 1TYZA 2HHCA 2XGMA 5EIAA 5JNUA 1E6WA 1TO6A 3OH8A 3U16A 2GF0A 2PO5A 5I3ZA 3BCSA 3V7WA 2NP6A 2YN2A 1M6EX 1RBYA 5J1SB 3OJLA 4Y3UA 5CK4A 2DFNA 5SZHB 3TZLA 2ZRHA 4FLEA 5DEIA 3ONNA 2R6HA 4ZP1A 4N48A 3WFZA 1OV6A 2AZ4A 1L7RA 3CF6R 1RW4A 5CXUA 4RY2A 5HOQA 2ZIAA 2AX3A 4LWPA 3R6WA 4BVEA 2VCHA 1T6YA 3FLBA 3L1VA 3SXUA 4KREA 4Y7CA 3SJCA 2XB9A 2FPPA 2H0AA 3ND5A 5AH0A 3B3GA 2XAAA 4BMZA 3JQBC 3VM6A 4UASA 4G0VA 1FS4A 2JAUA 1YI0A 3RK4A 2ZS7A 1LX7A 4L15A 4AZ0B 1KS9A 3WGVA 1BE0A 1Z5GA 2RI0A 3TQOA 1E7WA 2ZRIA 1TJ3A 3BWCA 4B3BA 4UOEA 1G5QA 1XXHE 2ZUSA 3KKKA 4BQOA 1UBRS 3R9XB 4WHMA 4FGSA 5IMSA 3JD4A 1M34E 2X2PA 5IAGA 3L8DA 1UBKS 5CYPA 4CETA 1YBHA 2ZIVB 3T6KA 3DF7A 2YVAA 4I08A 4WZ6A 4EUEA 1CUAA 4BDTA 2BAGA 2NIPA 4BTEA 3HCWA 3L7CA 3F3MA 4V0OA 3SY8A 5A4DA 3VC7A 2HLNA 3HR4A 2V45A 3I8XA 2W4MA 1Z4IA 4S35A 3IJPA 3EA4A 5EP2A 4G1CA 3MQ2A 4KVFA 3VHXB 4AUNA 5IM4F 2E2WA 4LF5B 1KDTA 1RKQA 2WJ6A 4BS9A 5T7BA 4BXOB 1JNYA 1E5TA 3LYAA 4ZOEA 4L4XA 4ARBA 4QPCA 1VYVA 4MI3A 3CH4B 3JARB 5KYWA 2GZSA 2O0LA 1Y3HA 2COKA 3LI2A 3DBLA 5AWFC 5K45A 1H4QA 1NQ5A 1U5CA 4MYRA 4FI3C 4PSVA 2FE4A 2V5UA 4EK9A 1Q5PA 3AEKB 2EF1A 3ME5A 3GGSA 3E5NA 4IGAA 2OXTA 4JNKA 3T3HA 2B2XA 2FOLA 1SU7A 3FVRA 4C1NA 1F60A 4E88A 1NXPA 1A9RA 4ARIA 2CVHA 1CU1A 5LQCA 3GN2A 2NUPB 1M8FA 1T1GA 3HJNA 1E9BA 1TLTA 4P7JA 5F1OA 4D9MA 1KO5A 1TFUA 2A86A 2ZQ5A 4UVGA 5DSZA 2J6BA 2DFPA 2R7MA 1Q7EA 1F14A 3PQ4A 1Y1LA 1YL7A 1YQTA 1CQWA 3C5HA 4MWOA 5H82A 3NHYA 1VJTA 2GF9A 3ANMA 1M83A 2FEPA 3BKXA 3WLLA 4PYIA 3M7IA 3K70B 1V1JA 3G2IA 1I1OA 5K8UA 3BZBA 4JP3A 3UXYA 1W35A 4CIDA 5KNLA 1ZN2A 3HB1A 3SVTA 1H5QA 3C5CA 3OOHA 4M89A 3CUWA 3T41A 3SYRA 1BXRA 2XDQB 3GRCA 5AOBA 3A9WA 3PVZA 3ITKA 5JY6A 3ZXXA 5GM2A 1YZUA 3E9YA 1JUDA 3EYWA 4DW8A 1NG9A 1EUDB 3NATA 2ZYHA 2DVMA 1ZGAA 1EUYA 1LS1A 3W8FA 4NDAA 3A1WA 5C1BA 2QQFA 1L4BA 2VDWA 5KTRA 1GYPA 3L7OA 3O3MB 1UMCB 2YZKA 4RSGA 2G1PA 4EYGA 4LV5B 1II9A 5FL7D 1C3JA 3JQCA 4OO3A 1LDBA 3ZWKA 4F9FA 4CEHB 3RJZA 1NZFA 3OZAA 5I48A 1VSQA 2VJYA 3COSA 4ZCTA 1FYXA 2ES4A 2YWXA 4J03A 4BNIA 5U9CA 3FPBA 3F5DA 1A7KA 4I1IA 1KEKA 2ETVA 1EK5A 3AF4A 4UARA 3BXZA 5AKGA 3ZD8A 3GRVA 1Y3BE 3K31A 1H65A 2Z6VA 2IYQA 3B51X 4RAOA 4BEWA 2BDTA 3AY3A 5IUJC 2HWUA 3EGIA 3NV7A 4CKBA 2HTFA 5K8TA 1VG8A 1FSZA 1JU9A 1ZS9A 1D4ZA 3GY0A 5JAMA 1CZLA 2EP5A 2Q29A 3GJ7A 4NQZA 2MYPA 3N8DA 3R0XA 4XM0A 4A7PA 4DLLA 4IIGA 2ZR8A 1QRUA 1G4UR 2GEDA 5K5EA 5P21A 4BATA 1QH1A 1YHZA 2FEOA 2O50A 3LX5A 4ZOLA 3ZU6A 4E3WA 1WNTA 3RPEA 1IN1A 4JHLA 2GJAA 1T4CB 3IEXA 2BFFB 1WD5A 1KETA 1G63A 2C5LA 4HDCA 1WP4A 4CM8B 1U65A 3D2LA 2AKEA 1CG6A 1JFSA 5BRJA 4H3SA 3NHRA 1KO7A 3AOEC 3B1XA 3TIIA 1HTTA 1YE5A 3NFYA 3BQNB 2I80A 4QUKA 4B4VA 4JEMA 1QUFA 4MUIA 4P5DA 3O2NA 1DU4A 1E2PA 3MD0A 2D0IA 3JQAD 2FPMA 3SBXA 4INOA 3WRXC 1DC4A 3DO8A 3WVNA 2PAAA 3N7TA 1JEDA 1Y7TA 4YO7A 4BX0A 5KTTA 3DO6A 2RDMA 5FA5A 1KORA 1JI3A 1ZW1A 1JP7A 1WMAA 2F48A 3K92A 3JASB 5FPQA 4HD8A 2PZBA 4NHEA 4U4AA 4RK6A 1WXDA 1D2EA 2IYSA 3QA3E 4KNVA 2VRCA 1SEPA 2CLHB 4UBOA 2WU8A 3UCFA 3WDSA 1N1EA 2FSVA 3EBPA 1IUKA 2NGRA 3D59A 5IJZA 3QLVC 3EGEA 2CB0A 2GJ8A 3LHKA 4NU6A 3WDLA 3JALB 3A6GA 4DY6A 3BFKA 4UCXA 5JRZA 4IMJB 2AMVA 2V59A 3D0QA 3F46A 1C3XA 3LO8A 4LE1A 1HOTA 3ILSA 4YT5A 4RWZA 3OPMA 3H5NA 2A67A 4A1OA 2OA0A 3RH0A 2NO9A 2REQA 1FMCA 2FWRA 2H5EA 3GH3A 3Q98A 4JSTA 4K2AA 4RIHA 2I3GA 3FYHA 3D7KA 4Q47A 3A37A 5EIOA 5LYJF 3L05A 2VATA 3KTAB 3QU4A 4KVZA 3PHJA 3AFIA 1U8ZA 1UOOA 3AI7A 4AJKA 1IC6A 3HC7A 4LGCA 4CV1A 1SC9A 3B6ZA 5C8YA 1L1FA 3A4IA 2NT3A 2ZU6A 4OGWA 3TWOA 1FXSA 3GGDA 1KQFA 2EHJA 2B34A 1KYTA 4MHOA 3W8DA 2WMDA 4BNMA 1ZY2A 2E7ZA 5DASA 1QQ6A 1EE1A 1G3RA 1F2UA 3G0HA 2HQRA 2NT4A 2AMLA 5CNIA 3LPLA 1Q3HA 2MOKA 1PG2A 2ZJ2A 5J4KA 4V0SA 1UXIA 4DL9A 3IVRA 4YP0A 3R74A 1YUNA 4QUHA 4ROTA 3CVOA 5U4QA 1AK9A 4TGLA 4YJFB 4U2DA 2YUTA 4LK3A 5EJ7A 4FKMA 4GUAA 3UWDA 1LNQA 3QWFA 2YNMC 2YMLA 4B6JA 4MUHA 1YA8A 4PVDA 4G0WA 4KO8A 4AJ2A 2EFGA 3QVMA 1FDUA 3V8QA 3TRDA 1MUUA 2E37A 1HT0A 2EZ8A 2JNWA 3IV7A 3EK2A 1HYGA 3U7JA 3WYDA 5MFZA 3CX4A 1AQIA 3B6JA 1HO3A 1P61B 1W2WB 4GPEA 4TTQA 3OQNA 3L0IB 3AJRA 1ODKA 5BSMA 3P32A 2AOUA 1SHTX 2RKWA 1T8YA 3FNHA 1EBFA 3ZX4A 4Z0PA 4N1AA 3W06A 1FU7A 1THTA 1K5PA 3I8OA 3EUFA 5E3JA 5J4VA 2CLDX 2OO5C 4DLTA 1YA6A 4JKIA 1RYNA 3TNDA 4OHWA 2B8WA 3R3HA 4D4KA 3FWPA 4HUJA 3VYTB 1Z8NA 2QN6A 1GKIA 1P1BA 1QDEA 2HHAA 3I83A 1YMUA 3ICOA 1J2YA 2BBWA 1JQBA 3T1OA 2ZAIA 2NYUA 2IDKA 1CQJA 1QVWA 1XDZA 2R25B 3ABIA 4KPFC 3AH8A 2VJDA 3ZQJA 3TRIA 4R5MA 5A7GA 2A5JA 4JVOA 4YS6A 2ZIGA 5ER6A 4CXMA 2UYGA 5BOSB 3P9NA 1RRVA 2FKNA 3HR8A 3MS7A 4JVLA 4MVJD 4O6VA 2IEAA 1JBQA 2W37A 2BJHA 2HMTA 2WIBA 3ZVRA 2PJDA 3AJEA 4BECA 1U2DA 2I78A 3TQIA 2BP7A 3UJPA 3HSKA 5H9VA 2FN4A 3AETA 3DTVD 5IAEA 4KEAA 1KOFA 1QIHA 4C9BA 4N12A 3ZHBA 4AP5A 2AD1A 3RC2A 4LGYA 1E18A 2PM8A 3KHSA 3LDHA 5JH7A 4WNYA 4RD3A 3HXKA 2FPWA 5B36A 2PZJA 3RR2A 3HNOA 1M0TA 5D2CA 3W3AD 2VPZA 4EM6A 4K8OA 3LCJA 2PUDA 1EK6A 1ADJA 3DEJA 3S1AA 3QF4B 2CHFA 4BQEA 4EUSA 5LQRA 1UKVY 1A1SA 5FOQA 4NHOA 4WXMA 4K6OA 2QUAA 4AX4A 5M7EA 5EZYB 3IOMA 2AI3A 1PR4A 3L8CA 3DOIA 1I4TD 1U9JA 1U2RA 2PGLA 3I6YA 2ZVPX 3MWKA 3ZGVA 4R3UC 4C4AA 4DNOA 4P34A 1QANA 4IF4A 3E4CA 1YT5A 4IEEA 5HE8A 5EUBA 3UFXA 2IU6A 3HVJA 1AN9A 1B74A 1BYUA 1EFPB 2Q99A 2RC5A 2XUJA 2BE7A 1GPNA 2BUAA 4FCTA 3BE5A 1KOGA 5EMJA 1C1YA 1PFVA 2JRLA 2R5NA 3MWYW 1W7AA 2O8BA 2HU5A 2F43A 2P11A 3OT1A 5F9MA 4S2UA 1YVUA 1LLDA 4CFZA 4RKEA 1JFFA 4R51A 1N3IA 4EENA 4EGCB 2BM9A 1JEOA 3HU1A 2JHFA 4K6FA 4MR8B 2CLSA 1Y5RA 2Y66A 2MSDB 1E7RA 2RHTA 1TE2A 1JN0A 3HBLA 4PZZA 4R2WA 1QJCA 4QJIA 4OLHA 3WGHA 1AMNA 2GM4A 4XKJA 3NIBA 1M5TA 3DOFA 4QE3A 1EK2A 2H7VA 4H7JA 1D1PA 1C81A 2MR6A 2D2FA 1KDRA 1ZJJA 2IXAA 1DGQA 3S2YA 1DTSA 1P2FA 4WK6A 1TXGA 4DWVA 8ABPA 1IZZA 4KCGA 3FMFA 4FFVA 4WXYB 3TUJC 3ZY2A 5BR1A 3WRVA 4RTMA 2P9QA 3QPAA 2XDYA 1Y6ZA 5CP8A 2YXLA 1D2MA 5B7GA 1Q0ZA 3HNPA 4H2DA 1DQPA 1XZMA 2ZVQX 3MUFA 1PL0A 1XKTA 2UYCA 1EFCA 1QIKA 4M0LA 4D74A 3ADPA 4GO1A 3SZLA 5JBIA 1BVRA 3HFGA 3SZOA 2QGZA 4UU1A 1VSVA 3ZDQA 3NT4A 5BOSA 2IYYA 5CNMA 3AR8A 4RH0A 4YNBA 2WYVA 1JSCA 3CVUA 2COUA 3FE2A 4ZTBA 5JS1A 3G2PA 2VPWA 3P19A 2JFGA 4N7BA 4F38A 5I9LA 4KZPA 4NWIA 1JW9B 3FPKA 3S2GA 3Q9NA 4RTOA 3BXFA 2P2GA 4DG5A 5BSUA 3DOCA 3L4BA 3C48A 2GLXA 2NACA 1N77A 4QUDA 4GQBA 5LMUB 1RKVA 3EXEB 3ENVA 4QGAA 3ZS9A 3RUFA 5AVSA 1W5SA 2ZJ1A 3OCCA 3DZIA 3DCIA 3TQHA 3HA2A 3MS2A 1GN8A 1ZZEA 1CEQA 5CT8A 3AUTA 3OMXA 5TGDA 1R4MB 3U4HA 4C29A 4QLBA 1H3EA 1Y98A 5EJ5A 2N46A 2Z95A 1J8YF 1ODLA 3FI9A 4Z6KA 1DIRA 3QE4A 1ZM2A 2OUIA 3ONEA 1NVGA 1XTQA 1HYEA 2WV9A 2EGUA 4FGUA 2OP1A 4XX0A 5J2TA 2X3YA 3KJEA 4M0MA 5TQVA 1HE3A 2FW7A 3KKEA 1UJBA 1HRKA 2WABA 2HA5A 3RQIA 1J0AA 1T0JB 2YVKA 4G86A 4OY3A 5I7RA 4UDXX 1ZRSA 2H4JA 1QQTA 4HSEA 2D3TA 1MZPA 1UBJS 3D6MA 3EYAA 2YRXA 2PWAA 5ESXA 5JVDB 4JFAA 4DIKA 1SCUB 4Z4EA 2ZETA 2H4ZA 5JCOA 2AOTA 5G2OA 4UVEA 4G9BA 2WTBA 1JXOA 4N6OA 1S2IA 2WAOA 2Y0EA 4UUAA 4FMPA 2ORIA 1UJ2A 2J9FA 1ZJ5A 2QRJA 3L02A 2GYVA 5DM1A 3VKVA 2XAUA 1E89A 2OGWA 3NS7A 3PKZA 3NBKA 1U9CA 2M6RA 3DC2A 3PFCA 4G1UC 4MWDA 3OE7A 4KH1A 5DCUA 1K89A 2PVCA 3F5FA 5HJ5A 1PJSA 2NM0A 1KDPA 3AKCA 4DLWA 4NBWA 3PITA 4GICA 3EQ8A 4F04A 5KTPA 4UCFA 3KOWA 2WU1A 4KO1S 5IT4A 4ZWNA 3ER9A 1PV4A 1NXSA 2Y1FA 3KKQA 3C1UA 5F2NA 1IG3A 4ADSG 4LQLA 1SIBE 4CLOA 3DDNA 1I9GA 3NBAA 4YAUA 2DP4E 2XTMA 1MA0A 3EF1A 3VGJA 2QKYA 2Q0QA 1X1EA 1LFDB 3FKSA 4FN4A 1U4NA 1W5FA 1J90A 5LZ5A 5JC8A 4D8YA 3IIJA 1A8UA 1ZNZA 2CCJA 3EY4A 1NVVR 3RSZA 1X7GA 3BJZA 3IIMA 3ZHRA 4C0XA 4BZZA 2HXSA 6GPBA 1UP6A 1JTEA 3EVCA 4RCZA 2YJZA 3OETA 4R2IA 4ZOLB 3O1IC 2JLBA 3MTGA 4TYYA 2LNDA 5KZMB 3PC2A 1LU9A 3ESCA 3VR2D 4K9RA 4QULA 3HU5A 4KDCA 1ZH2A 3PG5A 2PFSA 5E0KB 4HXFB 3AGPA 4Q9DA 1E62A 3RC1A 4BBAA 3PEYA 2BIFA 1EG7A 3EDYA 1ZRHA 5JSKA 1WOMA 4EAAA 3W5DA 4MGYR 2BEVB 1FP4A 1VM6A 5IVHA 2EKLA 3N0RA 2AJCA 2NYAA 3O8OB 1N8NA 2VYFA 1E9FA 1UQRA 2VA8A 3TX2A 1PW5A 4LNHA 3ZGYA 5KWVA 2I8LA 4J0GA 1TF5A 3V3KA 1H1LB 1ESCA 3TR6A 3IC5A 1OLUB 1SOVA 4KDRA 4X71A 2V6IA 5FLYA 3UCEA 5K4GA 3L8FA 3IR5A 4ZT2A 2P9FA 1JLKA 1NXWA 2LIVA 4DV2B 2YFHA 2AC4A 3M9XA 5BWCA 5DM70 1EVEA 2W6JD 2Q7DA 1PR9A 3FNGA 1IUNA 3L04A 4BCCA 4ZZIA 1YI1A 1DT5A 1MB4A 1LNSA 1T6XA 3KZKA 2ZUVA 3PL5A 4KKXB 4M7RA 1L5WA 2PR2A 3QFCA 5TEVA 1GTVA 1AKEA 2GK3A 2PZFA 3MCAA 3CVVA 3LBNA 4R8RA 3U09A 2GT1A 1JR3D 1RYMA 1QG2A 5AOAA 3OPXA 3TBHA 4CDNA 1BW9B 3AIMA 1II0A 3OI7A 4UVIA 5G40A 4EG7A 1TW3A 4Z1OA 3MPOA 3H65A 2VXYA 3NHLA 2ZZNA 4FFBB 2HMVA 3SK0A 1NYQA 4L51A 4GRDA 3T0IA 3UT5A 3K70C 5JJKA 1XD9A 3OZFA 3R4CA 1RJEA 1Z0FA 4JA2A 4E5PA 3CWCA 4OUDB 3TTWA 4P4UA 4IDBA 3H11B 2IS1A 3K94A 4DC1A 1BW9A 3WLTA 2H07A 1SQSA 1TA9A 2ZCVA 4BB9A 5EE0A 2RGDA 1WHSA 2X2EA 1J39A 2VRWA 4K9MA 4Y2GA 4AW9A 1SRQA 3Q6NA 4YRLA 3CH6A 5EP4A 3RRNA 1YZTA 1C80A 4CMCA 1U90A 5BPHA 3ZCXA 3BE4A 4HTFB 2LBPA 4NZPA 4LQCA 1PNOA 4RHYA 3ZWDA 4V0ME 1SQ5A 2BFDB 3TAHA 3ZV6A 4JROA 4MA4A 1W88A 1XRSB 1N9GB 1OBFO 3F5QA 1CQIA 3TSWA 4GZLA 2OAGA 2QPLA 2W2NA 1GNSA 1V5GA 2ZRQA 3HI4A 5BQXA 5IZCA 3FN4A 2DHCA 3C45A 1DXQA 3NM4A 4IHJB 4V0MA 1J7JA 4CM7A 2FJPA 3M2PA 2W6MA 3IA7A 4MW2A 3OPYB 4GYYA 3E7DA 4KKVA 2A4MA 3CGWA 1N9GA 4WKNA 4QPZA 4BNUA 3L6RA 3KKPA 3AG6A 3W8NA 1QH9A 3ZTTA 4CCAA 5KTMA 5KU7A 3U44B 3GELA 4AL4A 4CUZA 1MTZA 3EQZA 2I29A 4AJEA 1TQ4A 1XKQA 3BHJA 4EKDA 3EGXA 4XGRA 3PDJA 5JSHA 3DGEC 3SLKA 1FFWA 5KB3A 4J3FA 3WGJA 4DC9A 1G16A 5JV5A 3S8YA 1ORRA 1IBSA 2XTZA 2HFJA 2WYIA 4G9GA 1XLTA 2ERYA 3KPYA 4K6KA 1M2VB 2PX8A 5EHZA 4C7OA 1FVXA 4L27A 1D0SA 1LK0A 1K98A 3A06A 3INNA 3GJ0A 3KB8A 2HNBA 3T5GA 1E3QA 1EVZA 2FPPB 5DI3A 2JIZD 2ZIXB 3A0RB 3PD0A 5FWDA 4ND6A 4BLOA 4H7DA 1C9JA 1E7SA 2Q07A 4RK1A 3ZE9A 5IPFA 3A1TA 4EHJA 1W34A 3REOA 3VHLB 3X1KA 1XPRA 3AG5A 2QBYA 3IQHX 3D7NA 2V7EA 5TMPA 2PS0A 3N2NA 4EQ6B 1EU1A 1RHJA 3M4ZA 2ZB8A 4BP9A 2FWIA 3OEYA 2WM8A 1FTSA 2WOJA 1YA4A 2VH5R 4C3VA 3IT1A 4WBXC 2NPFA 1OZGA 3HWRA 3M8KA 4BNDB 2NP7A 1K8ZB 5KYKA 5E2BA 3S4YA 1RKBA 1QAMA 2P3QA 1KJ8A 1TZBA 2JLRA 4G5XA 4LBYA 3ZS8A 2X3UA 1YASA 5KTSA 3SX4A 1X7ZB 4BAZA 3BN3A 2C03A 2X5NA 4D56A 4EQZA 5KTNA 1RR6A 1QO7A 3QVOA 1ICIA 1BVUA 3WYAA 2HHHB 4U6QA 3T61A 2JD1A 2JRCA 2H5JA 3UT0A 2ZCJA 1Q3KA 2QTFA 3MT8A 4FMCF 4RO0A 3IT0A 3T5AA 2J67A 3PXGA 5E9QA 4BRSA 1P1CA 1UT8A 1FMFA 4P1ZA 4MB6A 4C0LA 3OM0A 3L7NA 2P9EA 1H6BA 4ZVVA 3N3AC 4RFVA 3H1TA 2PSFA 3FVVA 1VLLA 4YUWA 3RS2A 2V8BA 4OQMA 3DNPA 3E9MA 3OF5A 4S1OA 2GK6A 5LM3A 1OPRA 4Q4CA 4F92B 3ODPA 4E5YA 1WDLA 3F90A 4NONA 3TIGA 2I6FA 1UZNA 2VDRB 4DN6A 1SXJE 4JGGA 4MA0A 3TDNA 1K8RA 2BFCB 2HRDA 3PFHA 3ZHTA 4ENVA 2X7XA 5L7WA 3KS9A 2QZPA 2ZB3A 1IEVA 2LE0A 4RVCA 5AW5A 3T1NA 5KOJB 2CZQA 3UAZA 2OP0A 4C6TA 4X1KA 3RS5A 3NR2A 4PNPA 1U04A 1F8FA 1OLOA 4JCCA 3GQBB 5FQNA 1XQXA 4EYOA 5AIBA 3ZGZA 2QY6A 3QP9A 1YQWA 1Z7GA 3AZPA 4B4OA 1XVUA 4IW3B 3PQ7A 1AZTA 3HSSA 1T5HX 1JR4A 3K1AA 4A0SA 1TIBA 3JWEA 4UATA 1T8UA 4H08A 1FFDA 1NOIA 5EQDA 2V7XA 5COBA 3FOEC 3WL6A 3AM5A 3OF2A 4CM5A 4D4IA 1UBGA 5AJVB 1SOWA 4DMGA 1P2SA 3ZW7A 2DTEA 2VHXA 4BNNA 3GEEA 4HDNB 4XCQA 1PR6A 3CF4G 1P80A 3KT3A 4ASUD 5EERA 1TMKA 3AB3A 2QT1A 3TKLA 3ZNPA 4IJ6A 3GLFB 3OLYA 2AT1A 3FHJA 2GPAA 4ARVA 3TCNA 1GPMA 1M1NA 1RYEA 2JLCA 6Q21A 4TKLA 3G79A 4IOKA 4TUYA 4QBIA 1AKYA 3I4CA 3CM0A 2PX4A 3FCXA 1WVMA 2Q3LA 4PQRA 3JV7A 4GP7A 3UMSA 1AGPA 1N0IA 4JUIA 2VPQA 1NF8A 3CUEF 1OAAA 5LLTA 1QRDA 4GMFA 1PJCA 2Y3IA 2EYQA 1VHWA 1H3FA 1AIPA 5MN5A 1WNFA 4XWGA 1LRLA